WorldWideScience

Sample records for california red-legged frog

  1. Recovery plan for the California Red-legged frog (Rana aurora draytonii)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The objective of this plan is to reduce threats and improve the population status of the California red-legged frog sufficiently to warrant delisting. Actions...

  2. 76 FR 45602 - Proposed Safe Harbor Agreement for California Red-Legged Frog, at Swallow Creek Ranch, San Luis...

    Science.gov (United States)

    2011-07-29

    ... Service's Safe Harbor Policy published in the Federal Register on June 17, 1999 (64 FR 32717), the Service... Fish and Wildlife Service Proposed Safe Harbor Agreement for California Red-Legged Frog, at Swallow... the Federally threatened California red-legged frog (Rana draytonii), under the Endangered Species...

  3. California Red-Legged Frog Range - CWHR [ds587

    Data.gov (United States)

    California Department of Resources — Vector datasets of CWHR range maps are one component of California Wildlife Habitat Relationships (CWHR), a comprehensive information system and predictive model...

  4. Comparative microhabitat characteristics at oviposition sites of the California red-legged frog (Rana draytonii)

    Science.gov (United States)

    Alvarez, Jeff A.; Cook, David G.; Yee, Julie L.; van Hattem, Michael G.; Fong, Darren R.; Fisher, Robert N.

    2013-01-01

    We studied the microhabitat characteristics of 747 egg masses of the federally-threatened Rana draytonii (California red-legged frog) at eight sites in California. our study showed that a broad range of aquatic habitats are utilized by ovipositing R. draytonii, including sites with perennial and ephemeral water sources, natural and constructed wetlands, lentic and lotic hydrology, and sites surrounded by protected lands and nested within modified urban areas. We recorded 45 different egg mass attachment types, although the use of only a few types was common at each site. These attachment types ranged from branches and roots of riparian trees, emergent and submergent wetland vegetation, flooded upland grassland/ruderal vegetation, and debris. eggs were deposited in relatively shallow water (mean 39.7 cm) when compared to maximum site depths. We found that most frogs in artificial pond, natural creek, and artificial channel habitats deposited egg masses within one meter of the shore, while egg masses in a seasonal marsh averaged 27.3 m from the shore due to extensive emergent vegetation. Rana draytonii appeared to delay breeding in lotic habitats and in more inland sites compared to lentic habitats and coastal sites. eggs occurred as early as mid-december at a coastal artificial pond and as late as mid-April in an inland natural creek. We speculate that this delay in breeding may represent a method of avoiding high-flow events and/or freezing temperatures. Understanding the factors related to the reproductive needs of this species can contribute to creating, managing, or preserving appropriate habitat, and promoting species recovery.

  5. Evolutionary dynamics of a rapidly receding southern range boundary in the threatened California red-legged frog (Rana draytonii)

    Science.gov (United States)

    Richmond, Jonathan Q.; Barr, Kelly R.; Backlin, Adam R.; Vandergast, Amy G.; Fisher, Robert N.

    2013-01-01

    Populations forming the edge of a species range are often imperiled by isolation and low genetic diversity, with proximity to human population centers being a major determinant of edge stability in modern landscapes. Since the 1960s, the California red-legged frog (Rana draytonii) has undergone extensive declines in heavily urbanized southern California, where the range edge has rapidly contracted northward while shifting its cardinal orientation to an east-west trending axis. We studied the genetic structure and diversity of these frontline populations, tested for signatures of contemporary disturbance, specifically fire, and attempted to disentangle these signals from demographic events extending deeper into the past. Consistent with the genetic expectations of the ‘abundant-center’ model, we found that diversity, admixture, and opportunity for random mating increases in populations sampled successively further away from the range boundary. Demographic simulations indicate that bottlenecks in peripheral isolates are associated with processes extending tens to a few hundred generations in the past, despite the demographic collapse of some due to recent fire-flood events. While the effects of recent disturbance have left little genetic imprint on these populations, they likely contribute to an extinction debt that will lead to continued range contraction unless management intervenes to stall or reverse the process.

  6. California red-legged frog (Rana draytonii) movement and habitat use: Implications for conservation

    Science.gov (United States)

    Fellers, G.M.; Kleeman, P.M.

    2007-01-01

    Nonbreeding habitats are critically important for Rana draytonii, especially for individuals that breed in temporary bodies of water. We radiotracked 123 frogs to evaluate seasonal habitat use. Individual frogs were continuously tracked for up to 16 months. Some individuals remained at breeding ponds all year, but 66% of female and 25% of male frogs moved to nonbreeding areas, even when the breeding site retained water. Frogs at our main study site moved 150 m (median), roughly the distance to the nearest suitable nonbreeding area. The greatest straight-line distance traveled was 1.4 km, although the presumed distance traveled was 2.8 km. Females were more likely than males to move from permanent ponds (38% of females, 16% of males), but among dispersing frogs, males and females did not differ in distance moved. Some frogs left breeding sites shortly after oviposition (median = 12 days for females, 42.5 days for males), but many individuals remained until the site was nearly dry. Fog provided moisture for dispersal or migration throughout the summer. Our data demonstrate that maintaining populations of pond-breeding amphibians requires that all essential habitat components be protected; these include (1) breeding habitat, (2) nonbreeding habitat, and (3) migration corridors. In addition, a buffer is needed around all three areas to ensure that outside activities do not degrade any of the three habitat components. Copyright 2007 Society for the Study of Amphibians and Reptiles.

  7. 76 FR 55413 - Proposed Safe Harbor Agreement for California Red-legged Frog, California Tiger Salamander, Smith...

    Science.gov (United States)

    2011-09-07

    ... californiense) and federally endangered Smith's blue butterfly (Euphilotes enoptes smithi) under the Endangered... Register on June 17, 1999 (64 FR 32717), the Service would issue a permit to the Applicant authorizing...

  8. AIRBORNE PESTICIDES AND POPULATION DECLINES OF A CALIFORNIA ALPINE FROG

    Science.gov (United States)

    The mountain yellow-legged frog (Rana muscosa) has disappeared from most of its historic localities in the Sierra Nevada of California, and airborne pesticides from the Central Valley have been implicated as a causal agent. To determine the distribution and temporal variation of ...

  9. Pesticides and Population Declines of California Alpine Frogs

    Science.gov (United States)

    Airborne pesticides from the Central Valley of California have been implicated as a cause for population declines of several amphibian species, with the strongest evidence for the mountain yellow-legged frog complex (Rana muscosa and R. sierrae) in the Sierra Nevada. We measured ...

  10. Contemporary "Hoisan-wa" Language Maintenance in Northern California: Evidence from Fourteen Frog Story Narratives

    Science.gov (United States)

    Leung, Genevieve

    2012-01-01

    This article explores uninvestigated issues in Cantonese and "Hoisan-wa" language maintenance from an ethnic Chinese diaspora point of view. Data come from a larger study looking at Frog Story narratives from 140 Cantonese-English bilingual children in California. Fourteen of these children were found to display uniquely "Hoisan-wa" phonology and…

  11. Pesticide Distributions and Population Declines of California Alpine Frogs, Rana Muscosa and Rana Sierrae

    Science.gov (United States)

    Atmospherically deposited pesticides from the intensively cultivated Central Valley of California have been implicated as a cause for population declines of several amphibian species, with the strongest evidence for the frogs Rana muscosa and Rana sierrae at high elevation in th...

  12. CITIZEN SCIENTISTS MONITOR A DEADLY FUNGUS THREATENING AMPHIBIAN COMMUNITIES IN NORTHERN COASTAL CALIFORNIA, USA.

    Science.gov (United States)

    Group, Ecoclub Amphibian; Pope, Karen L; Wengert, Greta M; Foley, Janet E; Ashton, Donald T; Botzler, Richard G

    2016-07-01

    Ecoclub youth and supervising family members conducted citizen science to assess regional prevalence and distribution of Batrachochytrium dendrobatidis (Bd) among amphibians at Humboldt Bay National Wildlife Refuge (Refuge) and Redwood National and State Parks (Parks), Humboldt County, California, US, May 2013 through December 2014. Using quantitative real-time PCR, 26 (17%) of 155 samples were positive for Bd. Positive samples occurred in four frog and toad species: foothill yellow-legged frog ( Rana boylii ), northern red-legged frog ( Rana aurora ), Pacific chorus frog ( Pseudacris regilla ), and western toad (Anaxyrus [Bufo] boreas); no salamanders or anuran larvae were positive. Except for R. aurora , all infected anurans were first-time species reports for coastal northern California. At the Refuge, significantly fewer (6/71) postmetamorphic amphibians were positive compared to the Parks (20/69; P=0.0018). We assessed the association of being PCR-positive for Bd, season of sampling, and age of sampler (child, teen, or adult). The full model with season, species, and sampler age had the greatest support. Frogs tested in winter or spring were more likely to be positive than those tested in summer or fall; foothill yellow-legged frogs, northern red-legged frogs, and western toads were more likely to be positive than were Pacific chorus frogs; and the probability of being positive nearly doubled when a child (≤12 yr old) collected the sample compared to a teen or adult. Our results support other chytrid studies that found amphibians are more susceptible to Bd when temperatures are cool and that species differ in their susceptibility. The Ecoclub's findings provide new information important to conservation of northern California's coastal amphibians and demonstrate the value of involving children in citizen science. PMID:27195681

  13. Accumulation of pesticides in Pacific chorus frogs (Pseudacris regilla) from California's Sierra Nevada Mountains, USA.

    Science.gov (United States)

    Smalling, Kelly L; Fellers, Gary M; Kleeman, Patrick M; Kuivila, Kathryn M

    2013-09-01

    Pesticides are receiving increasing attention as potential causes of amphibian declines, acting singly or in combination with other stressors, but limited information is available on the accumulation of current-use pesticides in tissue. The authors examined potential exposure and accumulation of currently used pesticides in pond-breeding frogs (Pseudacris regilla) collected from 7 high elevations sites in northern California. All sites sampled are located downwind of California's highly agricultural Central Valley and receive inputs of pesticides through precipitation and/or dry deposition. Whole frog tissue, water, and sediment were analyzed for more than 90 current-use pesticides and pesticide degradates using gas chromatography-mass spectrometry. Two fungicides, pyraclostrobin and tebuconazole, and one herbicide, simazine, were the most frequently detected pesticides in tissue samples. Median pesticide concentration ranged from 13 µg/kg to 235 µg/kg wet weight. Tebuconazole and pyraclostrobin were the only 2 compounds observed frequently in frog tissue and sediment. Significant spatial differences in tissue concentration were observed, which corresponded to pesticide use in the upwind counties. Data generated indicated that amphibians residing in remote locations are exposed to and capable of accumulating current-use pesticides. A comparison of P. regilla tissue concentrations with water and sediment data indicated that the frogs are accumulating pesticides and are potentially a more reliable indicator of exposure to this group of pesticides than either water or sediment.

  14. Accumulation of pesticides in pacific chorus frogs (Pseudacris regilla) from California's Sierra Nevada Mountains, USA

    Science.gov (United States)

    Smalling, Kelly L.; Fellers, Gary M.; Kleeman, Patrick M.; Kuivila, Kathryn M.

    2013-01-01

    Pesticides are receiving increasing attention as potential causes of amphibian declines, acting singly or in combination with other stressors, but limited information is available on the accumulation of current-use pesticides in tissue. The authors examined potential exposure and accumulation of currently used pesticides in pond-breeding frogs (Pseudacris regilla) collected from 7 high elevations sites in northern California. All sites sampled are located downwind of California's highly agricultural Central Valley and receive inputs of pesticides through precipitation and/or dry deposition. Whole frog tissue, water, and sediment were analyzed for more than 90 current-use pesticides and pesticide degradates using gas chromatography–mass spectrometry. Two fungicides, pyraclostrobin and tebuconazole, and one herbicide, simazine, were the most frequently detected pesticides in tissue samples. Median pesticide concentration ranged from 13 µg/kg to 235 µg/kg wet weight. Tebuconazole and pyraclostrobin were the only 2 compounds observed frequently in frog tissue and sediment. Significant spatial differences in tissue concentration were observed, which corresponded to pesticide use in the upwind counties. Data generated indicated that amphibians residing in remote locations are exposed to and capable of accumulating current-use pesticides. A comparison of P. regilla tissue concentrations with water and sediment data indicated that the frogs are accumulating pesticides and are potentially a more reliable indicator of exposure to this group of pesticides than either water or sediment.

  15. Spatial Patterns of Airborne Pesticides in the Alpine Habitat of a Declining California Amphibian, The Mountain Yellow-Legged Frog

    Science.gov (United States)

    The mountain yellow-legged frog complex (Rana muscosa complex) has disappeared from most of its historic localities in the Sierra Nevada of California, and airborne pesticides from the Central Valley have been implicated as a causal agent. To determine the distributions and conce...

  16. Airborne Pesticides as an Unlikely Cause for Population Declines of Alpine Frogs in the Sierra Nevada, California

    Science.gov (United States)

    Airborne pesticides from the Central Valley of California have been implicated as a cause for population declines of several amphibian species, with the strongest evidence for the mountain yellow-legged frog complex (Rana muscosa and R. sierrae) in the Sierra Nevada. We measured...

  17. Caracterização microbiológica e clínica de surtos de "red leg" em Minas Gerais e avaliação do efeito bactericida in vitro do Vantocil IB® para Aeromonas hydrophila Microbiological and clinical characterization of "red leg" outbreaks in Minas Gerais, Brazil, and evaluation of in vitro bacterial effects of Vantocil IB® for Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    Anna Christina de Almeida

    2000-08-01

    Full Text Available Com o objetivo da caracterização da ocorrência de "red leg" em Minas Gerais, avaliaram-se rãs jovens e adultas que apresentavam úlceras nas patas e dedos, derrame hemorrágico na pele da região ventral, incoordenação motora, altas taxas de mortalidade em adultos e abscessos hepáticos à necropsia. No cultivo de fragmentos de pele lesada e abscessos, foi isolado e identificado Aeromonas hydrophila. O efeito bactericida do VANTOCIL IB® foi superior ao permanganato de potássio, determinado pela concentração inibitória mínima para colónias isoladas.With the objective of characterizating lhe ocurrence of "red leg" in Minas Gerais, Brazill, young and adult frogs which presented in theirpads and limbs hemorragie in the skin of the ventral region, incordination, high death rate in adults and hepatic abscess at necropsy, have been evaluated. In fragment culture ofdamage skin and abscess, Aeromonas. hydrophila hás been isolated and identified. The bactericidal effect of VANTOCIL IB® was higher than that of potassium permanganate, as determinated by the minimal inhibitory concentration for isolated colonies.

  18. TEMPORAL AND SPATIAL PATTERNS OF AIRBORNE PESTICIDES IN THE ALPINE ENVIRONMENT OF A DECLINING CALIFORNIA AMPHIBIAN, THE MOUNTAIN YELLOW-LEGGED FROG

    Science.gov (United States)

    The mountain yellow-legged frog (Rana muscosa) has disappeared from most of its historic localities in the Sierra Nevada of California, and airborne pesticides from the Central Valley have been implicated as a causal agent. To determine the distribution and temporal variation of...

  19. Diseases of the Red-Legged Partridge (Alectoris rufa L.: a review

    Directory of Open Access Journals (Sweden)

    J. Millán

    2009-06-01

    Full Text Available In spite of the ecological and socio-economical importance of the red-legged partridge (Alectoris rufa as a prey of threatened species and as a gamebird, and the reported influence that pathogens have in other populations of galliform birds, information about diseases of the red-legged partridge is still scarce. Very little is known about the importance of the diseases in the dynamics of free-living partridge populations. However, enzootic avian poxvirus may be causing the death of partridge chicks in some natural populations. In contrast, more evidences support that the intense management of partridges (trough release of farm-reared partridges, supplemental feeding, or predator control are promoting the release and transmission of infectious and parasitic diseases. Infectious and protozoan agents and monoxenous helminths typical from farmed galliforms (Ascaridia sp., Eucoleus contortus, or Heterakis gallinarum are extremely frequent in partridge rearing facilities. The presence of such helminths but also other disease outbreaks (e.g. salmonellosis in wild partridges may be related with the release of farm-reared partridges. Other cases of disease in the wild, such as avian tuberculosis, may be favoured by the aggregation of partridges and other birds around feeders and water points, and by the absence of predators that should remove sick partridges. Intense supplementary feeding may also promote patho-physiological troubles, such as an incorrect development and eventual massive deaths of juvenile wild partridges in summer months. These and other available reports of infectious and parasitic agents and other diseases of diverse aetiology are reviewed.

  20. The effect of livestock, altitude and slope on a red-legged partridge population in Alentejo, Portugal

    OpenAIRE

    Ramalho, H; Machado, R.; Anjos, O.; Santos, P.

    2011-01-01

    Red-legged partridge (Alectoris rufa) is a non-migratory bird found mainly in the Iberian Peninsula whose conservation status is Least Concern. However, in the last decades there has been a growing concern for the loss of habitat quality due to the results of either land abandonment or farming intensification. This study was conducted in an agrosilvopastoral land use system called montado.

  1. Conservation genetics of evolutionary lineages of the endangered mountain yellow-legged frog, Rana muscosa (Amphibia: Ranidae), in southern California

    Science.gov (United States)

    Schoville, Sean D.; Tustall, Tate S.; Vredenburg, Vance T.; Backlin, Adam R.; Gallegos, Elizabeth; Wood, Dustin A.; Fisher, Robert N.

    2011-01-01

    Severe population declines led to the listing of southern California Rana muscosa (Ranidae) as endangered in 2002. Nine small populations inhabit watersheds in three isolated mountain ranges, the San Gabriel, San Bernardino and San Jacinto. One population from the Dark Canyon tributary in the San Jacinto Mountains has been used to establish a captive breeding population at the San Diego Zoo Institute for Conservation Research. Because these populations may still be declining, it is critical to gather information on how genetic variation is structured in these populations and what historical inter-population connectivity existed between populations. Additionally, it is not clear whether these populations are rapidly losing genetic diversity due to population bottlenecks. Using mitochondrial and microsatellite data, we examine patterns of genetic variation in southern California and one of the last remaining populations of R. muscosa in the southern Sierra Nevada. We find low levels of genetic variation within each population and evidence of genetic bottlenecks. Additionally, substantial population structure is evident, suggesting a high degree of historical isolation within and between mountain ranges. Based on estimates from a multi-population isolation with migration analysis, these populations diversified during glacial episodes of the Pleistocene, with little gene flow during population divergence. Our data demonstrate that unique evolutionary lineages of R. muscosa occupy each mountain range in southern California and should be managed separately. The captive breeding program at Dark Canyon is promising, although mitigating the loss of neutral genetic diversity relative to the natural population might require additional breeding frogs.

  2. Nocturnal Foraging by Red-Legged Kittiwakes, a Surface Feeding Seabird That Relies on Deep Water Prey During Reproduction.

    Directory of Open Access Journals (Sweden)

    Nobuo Kokubun

    Full Text Available Narrow foraging specialization may increase the vulnerability of marine predators to climate change. The red-legged kittiwake (Rissa brevirostris is endemic to the Bering Sea and has experienced drastic population fluctuations in recent decades, presumably due to climate-driven changes in food resources. Red-legged kittiwakes are presumed to be a nocturnal surface-foraging seabird that feed almost entirely on deep water Myctophidae fishes. However, there is little empirical evidence confirming their nocturnal foraging activity during the breeding season. This study investigated the foraging behavior of red-legged kittiwakes by combining GPS tracking, accelerometry, and dietary analyses at the world's largest breeding colony of red-legged kittiwakes on St. George I. GPS tracking of 5 individuals revealed that 82.5% of non-flight behavior (including foraging and resting occurred over the ocean basin (bottom depth >1,000 m. Acceleration data from 4 birds showed three types of behaviors during foraging trips: (1 flight, characterized by regular wing flapping, (2 resting on water, characterized by non-active behavior, and (3 foraging, when wing flapping was irregular. The proportions of both foraging and resting behaviors were higher at night (14.1 ± 7.1% and 20.8 ± 14.3% compared to those during the day (6.5 ± 3.0% and 1.7 ± 2.7%. The mean duration of foraging (2.4 ± 2.9 min was shorter than that of flight between prey patches (24.2 ± 53.1 min. Dietary analyses confirmed myctophids as the dominant prey (100% by occurrence and 98.4 ± 2.4% by wet-weight. Although the sample size was limited, these results suggest that breeding red-legged kittiwakes concentrated their foraging on myctophids available at the surface during nighttime in deep water regions. We propose that the diel patterns and ephemeral nature of their foraging activity reflected the availability of myctophids. Such foraging specialization may exacerbate the vulnerability of red-legged

  3. Nocturnal Foraging by Red-Legged Kittiwakes, a Surface Feeding Seabird That Relies on Deep Water Prey During Reproduction.

    Science.gov (United States)

    Kokubun, Nobuo; Yamamoto, Takashi; Kikuchi, Dale M; Kitaysky, Alexander; Takahashi, Akinori

    2015-01-01

    Narrow foraging specialization may increase the vulnerability of marine predators to climate change. The red-legged kittiwake (Rissa brevirostris) is endemic to the Bering Sea and has experienced drastic population fluctuations in recent decades, presumably due to climate-driven changes in food resources. Red-legged kittiwakes are presumed to be a nocturnal surface-foraging seabird that feed almost entirely on deep water Myctophidae fishes. However, there is little empirical evidence confirming their nocturnal foraging activity during the breeding season. This study investigated the foraging behavior of red-legged kittiwakes by combining GPS tracking, accelerometry, and dietary analyses at the world's largest breeding colony of red-legged kittiwakes on St. George I. GPS tracking of 5 individuals revealed that 82.5% of non-flight behavior (including foraging and resting) occurred over the ocean basin (bottom depth >1,000 m). Acceleration data from 4 birds showed three types of behaviors during foraging trips: (1) flight, characterized by regular wing flapping, (2) resting on water, characterized by non-active behavior, and (3) foraging, when wing flapping was irregular. The proportions of both foraging and resting behaviors were higher at night (14.1 ± 7.1% and 20.8 ± 14.3%) compared to those during the day (6.5 ± 3.0% and 1.7 ± 2.7%). The mean duration of foraging (2.4 ± 2.9 min) was shorter than that of flight between prey patches (24.2 ± 53.1 min). Dietary analyses confirmed myctophids as the dominant prey (100% by occurrence and 98.4 ± 2.4% by wet-weight). Although the sample size was limited, these results suggest that breeding red-legged kittiwakes concentrated their foraging on myctophids available at the surface during nighttime in deep water regions. We propose that the diel patterns and ephemeral nature of their foraging activity reflected the availability of myctophids. Such foraging specialization may exacerbate the vulnerability of red-legged

  4. Microbiological and Histological Examinations of Endangered Neurergus kaiseri Tissues Displaying Red-leg Syndrome

    Institute of Scientific and Technical Information of China (English)

    Paria PARTO; Zahra MS HAGHIGHI; Somaye VAISSI; Mozafar SHARIFI

    2014-01-01

    Presence of the red leg syndrome (RLS) was documented through bacterial and histological examinations in the endangered Kaiser’s mountain newt Neurergus kaiseri obtained from a pet shop. The individuals which were severely infected showed lethargy, appetite loss, weight loss, abdominal skin redness and skin ulcers on hind legs. This study reveals the presence of two bacteria causing RLS on the skin of captive N. kaiseri including Proteus vulgaris and Bacillus cereus. Sections of skin in affected areas and internal organs were examined through standard histological procedures. Histologically, epidermal necrosis and ulcers, epidermal gland depletion, myositis and subcutaneous edema, gastric submucosal edema and hepatomegaly were seen. There were also correlations between the microbial infection and structural changes in tissues of Kaiser’s mountain newt. The severity of the structural changes are related to the level of microbial infection in the target organs and could be sustained by the isolation of P. vulgaris and other pathogens. The presence of the infective bacterial population and their interaction on the skin of the newt may have changed the normal skin lfora and facilitate the prevalence of other disease.

  5. Improving decision-making for sustainable hunting: regulatory mechanisms of hunting pressure in red-legged partridge

    OpenAIRE

    Caro, Jesús; Delibes-Mateos, Miguel; Viñuela, Javier; López-Lucero. Juan Francisco; Arroyo, Beatriz

    2015-01-01

    Knowledge about how hunting pressure is determined, and the relative efficacy of different mechanisms to regulate harvest, can help to improve the managers’ decision-making process. We developed a general framework about the decision-making process that regulates red-legged partridge (Alectoris rufa) hunting pressure in central Spain based on information from a focus group and individual interviews with game managers. We also used available information to compare the efficiency of different t...

  6. Polychlorinated biphenyls and toxaphene in Pacific tree frog tadpoles (Hyla regilla) from the California Sierra Nevada, USA.

    Science.gov (United States)

    Angermann, Jeffrey E; Fellers, Gary M; Matsumura, Fumio

    2002-10-01

    Pacific tree frog (Hyla regilla) tadpoles were collected throughout the Sierra Nevada mountain range, California, USA, in 1996 and 1997 and analyzed for the presence of polychlorinated biphenyls (PCBs) and toxaphene. Whole-tadpole sigma PCB levels ranged from 244 ng/g (wet wt) at lower elevations on the western slope to 1.6 ng/g high on the eastern slope, whereas sigma toxaphene levels ranged from 15.6 to 1.5 ng/g. Linear regression of PCB and toxaphene residue levels versus elevation indicated a significant relationship, with an r2 value of 0.33 for PCB and 0.45 for toxaphene indicating a significant elevation effect on PCB and toxaphene bioaccumulation in Sierra Nevada H. regilla. Tadpole samples from sites in east-facing versus west-facing drainage basins showed significant differences in PCB and toxaphene residue levels, suggesting the possibility of a rain-shadow effect in the long-range atmospheric transport of these contaminants to the Sierra Nevada Mountains. PMID:12371500

  7. Turning population trend monitoring into active conservation: Can we save the cascades frog (Rang cascadae) in the Lassen Region of California?

    Science.gov (United States)

    Fellers, G.M.; Pope, K.L.; Stead, J.E.; Koo, M.S.; Welsh, W.H.

    2008-01-01

    Monitoring the distribution, population size, and trends of declining species is necessary to evaluate their vulnerability to extinction. It is the responsibility of scientists to alert management professionals of the need for preemptive action if a species approaches imminent, regional extirpation. This is the case with Rana cascadae (Cascades Frog) populations near Lassen Peak From 1993 to 2007, we conducted 1,873 amphibian surveys at 856 sites within Lassen Volcanic National Park and Lassen National Forest, California, USA. These surveys encompassed all R. cascadae habitats: ponds, lakes, meadows, and streams on those lands. We found frogs at only six sites during 14 years of surveys, and obtained one report of a single frog at one additional locality. These sites represented 12 years. Causes for the decline remain unclear, but introduced trout, disease, and pesticides are likely factors. We recommend that (1) additional protection for R. cascadae within 50 km of Lassen Peak; (2) investigation of the genetics of R. cascadae in California; (3) research into the role of possible causative factors in these declines; and (4) implementation of a feasibility study to captive breed and reintroduce R. cascadae in the Lassen area. Copyright ?? 2008. Gary Fellers. All rights reserved.

  8. Diseases of frogs and toads

    Science.gov (United States)

    Green, D.E.; Converse, K.A.; Majumdar, S.K.; Huffman, J.E.; Brenner, F.J.; Panah, A.I.

    2005-01-01

    This chapter presents information on infectious diseases of free-living frogs and toads that have completed metamorphosis. The diseases discussed in this chapter pertain principally to sub-adult and adult frogs and toads that are at least 60-90 days removed from completion of metamorphosis. The main emphasis of this chapter is the diseases found in amphibians of Canada and the United States. Diseases of recent metamorphs, larvae and amphibian eggs are presented in the chapters Diseases of Amphibian Eggs and Embryos and Diseases of Tadpoles. The smallest disease agents (viruses and bacteria) are presented first, followed by fungi, protozoa, helminths and ectoparasites. Diseases presented in this chapter are Ranaviral (iridovirus) infection Lucke frog herpesvirus (kidney cancer) Frog erythrocytic virus West Nile virus Red-leg disease (bacterial septicemia) Salmonellosis Chytrid fungal infection Basidiobolus fungi Dermosporidiosis Ichthyophoniasis Dermocystidium & Dermomycoides Myxozoa Ribeiroia flukes and Amphibian malformations Clinostomum metacercaria Aspects of each disease are presented to assist the biologist with recognition of diseases in the field. Hence, the major emphases for identification of diseases are the epizootiological aspects (host species, life stage, casualty numbers, etc) and gross findings ('lesions'). Descriptions of the microscopical, ultrastructural and cultural characteristics of each infectious agent were considered beyond the scope of this text. Detailed cultural and microscopical features of these disease agents are available in other reviews (Taylor et al., 2001; Green, 2001). Some diseases, while common in captive and zoo amphibians, are exceptionally rare in free-living frogs and toads, and therefore are omitted from this review. Among the diseases not presented are infections by chlamydia and mycobacteria, which occur principally in captive colonies of African clawed frogs (Xenopus, Hymenochirus, et al.) and northern leopard frogs

  9. Effects of lead shot ingestion on bone mineralization in a population of red-legged partridge (Alectoris rufa)

    Energy Technology Data Exchange (ETDEWEB)

    Álvarez-Lloret, Pedro, E-mail: pedroalvarez@geol.uniovi.es [Department of Mineralogy and Petrology, University of Granada, Avd. Fuentenueva s/n, 18002 Granada (Spain); Departament of Geology, University of Oviedo, C/Jesús Arias de Velasco, s/n, 33005 Oviedo (Spain); Rodríguez-Navarro, Alejandro B. [Department of Mineralogy and Petrology, University of Granada, Avd. Fuentenueva s/n, 18002 Granada (Spain); Romanek, Christopher S. [Department of Earth and Environmental Sciences, University of Kentucky, Lexington, KY (United States); Ferrandis, Pablo [Department of Plant Production and Agricultural Technology, E.T.S. Ingenieros Agrónomos, University of Castilla-La Mancha, Campus Universitario s/n, 02071 Albacete (Spain); Martínez-Haro, Mónica [Instituto de Investigación en Recursos Cinegéticos, IREC (CSIC, UCLM, JCCM), Ronda de Toledo s/n, 13005 Ciudad Real (Spain); IMAR-Instituto do Mar, Department of Life Sciences, University of Coimbra, 3004-517 Coimbra (Portugal); Mateo, Rafael [Instituto de Investigación en Recursos Cinegéticos, IREC (CSIC, UCLM, JCCM), Ronda de Toledo s/n, 13005 Ciudad Real (Spain)

    2014-01-01

    The effect of lead (Pb) toxicity on bone mineralization was investigated in a wild population of red-legged partridge (Alectoris rufa) inhabiting a farmland area contaminated with Pb-shot from recreational hunting activities in Albacete, a southeastern province of Spain. Femora from 40 specimens of red-legged partridge were analyzed for Pb by graphite furnace atomic absorption spectroscopy (GF-AAS), and for bone composition by Fourier transform infrared (FTIR) spectroscopy and X-ray diffraction (XRD). The FTIR and DRX data of bone were analyzed in detail to determine possible alterations in bone mineral chemistry and crystallinity due to Pb toxicity. Results showed a marked decrease in the degree of mineralization as Pb concentrations in bone tissue increased while XRD analyses showed that the crystallinity of apatite crystals increased with the Pb load in bone. These load-dependent effects are indicative that Pb contamination altered bone remodeling by reducing new bone mineral formation and demonstrate that bone quality is a sensitive indicator of adverse effects on wild bird populations exposed to Pb pollution. - Highlights: •The effect of Pb toxicity on bone mineralization was investigated in partridges. •Lead exposure decreased bone mineralization degree. •Demonstrated usefulness of FTIR and DRX to evaluate alterations in bone chemistry and crystallinity by Pb exposure.

  10. Pathogenicity of two recent Western Mediterranean West Nile virus isolates in a wild bird species indigenous to Southern Europe: the red-legged partridge.

    Science.gov (United States)

    Sotelo, Elena; Gutierrez-Guzmán, Ana Valeria; del Amo, Javier; Llorente, Francisco; El-Harrak, Mehdi; Pérez-Ramírez, Elisa; Blanco, Juan Manuel; Höfle, Ursula; Jiménez-Clavero, Miguel Angel

    2011-01-01

    West Nile virus (WNV) is an emerging zoonotic pathogen whose geographic spread and incidence in humans, horses and birds has increased significantly in recent years. WNV has long been considered a mild pathogen causing self-limiting outbreaks. This notion has changed as WNV is causing large epidemics with a high impact on human and animal health. This has been particularly noteworthy since its introduction into North America in 1999. There, native bird species have been shown to be highly susceptible to WNV infection and disease with high mortalities. For this reason, the effect of WNV infection in North American bird species has been thoroughly studied by means of experimental inoculations in controlled trials. To a lesser extent, European wild birds have been shown to be affected clinically by WNV infection. Yet experimental studies on European wild bird species are lacking. The red-legged partridge (Alectoris rufa) is a gallinaceous bird indigenous to the Iberian Peninsula, widely distributed in South Western Europe. It plays a key role in the Mediterranean ecosystem and constitutes an economically important game species. As such it is raised intensively in outdoor facilities. In this work, red-legged partridges were experimentally infected with two recent WNV isolates from the Western Mediterranean area: Morocco/2003 and Spain/2007. All inoculated birds became viremic and showed clinical disease, with mortality rates of 70% and 30%, respectively. These results show that Western Mediterranean WNV variants can be pathogenic for some European bird species, such as the red-legged partridge. PMID:21314967

  11. Among-population variation in monthly and annual survival of the Baja California Tree Frog, Pseudacris hypochondriaca curta, in desert oases of Baja California Sur, Mexico

    OpenAIRE

    Luja, V H; Rodriguez-Estrella, R; M Schaub; Schmidt, B R

    2015-01-01

    Survival is an important component of the demography of an animal. We estimated monthly and annual survival probabilities of three populations of the Baja California Treefrog (Pseudacris hypochondriaca curta) inhabiting desert oases of Baja California Sur, Mexico. We used data from a two-year mark recapture study to estimate survival. Recapture probabilities varied widely among months and there was no clear temporal pattern underlying the fluctuations. Annual survival was 27 and 29% for t...

  12. Pathogenicity of two recent Western Mediterranean West Nile virus isolates in a wild bird species indigenous to Southern Europe: the red-legged partridge

    Directory of Open Access Journals (Sweden)

    Sotelo Elena

    2011-01-01

    Full Text Available Abstract West Nile virus (WNV is an emerging zoonotic pathogen whose geographic spread and incidence in humans, horses and birds has increased significantly in recent years. WNV has long been considered a mild pathogen causing self-limiting outbreaks. This notion has changed as WNV is causing large epidemics with a high impact on human and animal health. This has been particularly noteworthy since its introduction into North America in 1999. There, native bird species have been shown to be highly susceptible to WNV infection and disease with high mortalities. For this reason, the effect of WNV infection in North American bird species has been thoroughly studied by means of experimental inoculations in controlled trials. To a lesser extent, European wild birds have been shown to be affected clinically by WNV infection. Yet experimental studies on European wild bird species are lacking. The red-legged partridge (Alectoris rufa is a gallinaceous bird indigenous to the Iberian Peninsula, widely distributed in South Western Europe. It plays a key role in the Mediterranean ecosystem and constitutes an economically important game species. As such it is raised intensively in outdoor facilities. In this work, red-legged partridges were experimentally infected with two recent WNV isolates from the Western Mediterranean area: Morocco/2003 and Spain/2007. All inoculated birds became viremic and showed clinical disease, with mortality rates of 70% and 30%, respectively. These results show that Western Mediterranean WNV variants can be pathogenic for some European bird species, such as the red-legged partridge.

  13. Carotenoid-based bill and eye ring coloration as honest signals of condition: an experimental test in the red-legged partridge ( Alectoris rufa)

    Science.gov (United States)

    Pérez-Rodríguez, Lorenzo; Viñuela, Javier

    2008-09-01

    Carotenoid pigments cannot be synthesized by vertebrates but must be ingested through the diet. As they seem to be a limited resource, carotenoid-based ornaments are particularly interesting as possible honest signals of individual quality, in particular of foraging efficiency and nutritional status. Some studies have demonstrated the condition dependence of carotenoid-based plumage in birds. However, many other carotenoid-pigmented bare parts (i.e. skin, caruncles, bills, cere, and tarsi) are present in birds but, in comparison with plumage, little is known about these traits as indicators of individual quality. Here, we show that the eye ring pigmentation and bill redness of the red-legged partridge ( Alectoris rufa) are positively associated to body condition and recent changes in body mass. Also, we found a negative relationship between these two traits and heterophil-to-lymphocyte ratio, an indicator of physiological stress (the relationship with bill redness being significant only for males). In an experiment, we found that after a period of reduction in food intake (with the consequent loss of body mass), food-restricted birds showed lower eye ring pigmentation than ad-libitum-fed birds. Therefore, different ornaments seem to reflect changes in body condition but at different speeds or intensities (eye ring, a fleshy ornament, appears to respond more rapidly to changes in the nutritional status than a keratinized structure as the bill). These results indicate that carotenoid-based ornaments are condition-dependent traits in the red-legged partridge, being therefore susceptible to be employed as honest signals of quality in sexual selection.

  14. Sublethal Pb exposure produces season-dependent effects on immune response, oxidative balance and investment in carotenoid-based coloration in red-legged partridges.

    Science.gov (United States)

    Vallverdú-Coll, Núria; Ortiz-Santaliestra, Manuel E; Mougeot, François; Vidal, Dolors; Mateo, Rafael

    2015-03-17

    Ingestion of lead (Pb) shot pellets constitutes the main cause of Pb poisoning in avifauna. We studied the effects of sublethal Pb exposure on immunity, carotenoid-based coloration, oxidative stress and trade-offs among these types of responses during spring and autumn in red-legged partridges (Alectoris rufa). We evaluated constitutive immunity testing lysozyme and natural antibody levels, and blood bactericidal and phagocytic activities. We studied induced immunity by testing PHA and humoral responses. We analyzed fecal parasite and bacterial abundance and oxidative stress biomarkers. Pb exposure in spring reduced natural antibody levels, whereas in autumn, it reduced lysozyme levels and increased phagocytic activity. Pb exposure increased PHA response in both seasons, and decreased T-independent humoral response in autumn. Pb exposure also increased noncoliform and decreased coliform Gram-negative gut bacteria. In spring, Pb exposure decreased antioxidant levels and increased coloration in males, whereas in autumn, it increased retinol levels but reduced coloration in both genders. Our results suggest that in spring, Pb-exposed females used antioxidants to cope with oxidative stress at the expense of coloration, whereas Pb-exposed males increased coloration, which may reflect an increased breeding investment. In autumn, both genders prioritized oxidative balance maintenance at the expense of coloration. PMID:25674808

  15. Short communication. Effects of the time to change from incubation to hatching temperature on the artificial incubation of red-legged partridge (Alectoris rufa eggs

    Directory of Open Access Journals (Sweden)

    Paloma Gomez-de-Travecedo

    2014-06-01

    Full Text Available This study investigates, in red-legged partridge (Alectoris rufa, the effects of the time to change from incubation to hatching temperature on egg weight loss, hatchability, chick weight at hatch, incubation length, and development stage at embryonic mortality. Five batches of 80 eggs each were incubated at 37.8ºC during the first 18, 19, 20, 21 or 22 d of incubation, and subsequently at 37.5ºC until hatching. Hatchability, development stage at embryonic mortality and chick weight at hatch were not affected by the time of temperature change (p > 0.05. However, incubation length and egg weight loss after 21 d of incubation as representative of that of developed embryos were influenced by the incubation treatment (p<0.001 and p<0.05, respectively. Thus, eggs maintained at the incubation temperature of 37.8ºC for 22 d not only hatched earlier (23.04 d but also with lower dispersion than eggs from the other treatments. As hatching may start around day 22 of incubation, to improve hatching synchrony we could recommend to move A. rufa eggs from the incubator, set at 37.8ºC, to the hatcher on the 21st d of incubation keeping the temperature unchanged, and reduce it to 37.5ºC on the 22nd d. Nevertheless, further research should be carried out to study the effect of this temperature scheduling on chick growth and performance.

  16. Structural insights into the evolution of a sexy protein: novel topology and restricted backbone flexibility in a hypervariable pheromone from the red-legged salamander, Plethodon shermani.

    Science.gov (United States)

    Wilburn, Damien B; Bowen, Kathleen E; Doty, Kari A; Arumugam, Sengodagounder; Lane, Andrew N; Feldhoff, Pamela W; Feldhoff, Richard C

    2014-01-01

    In response to pervasive sexual selection, protein sex pheromones often display rapid mutation and accelerated evolution of corresponding gene sequences. For proteins, the general dogma is that structure is maintained even as sequence or function may rapidly change. This phenomenon is well exemplified by the three-finger protein (TFP) superfamily: a diverse class of vertebrate proteins co-opted for many biological functions - such as components of snake venoms, regulators of the complement system, and coordinators of amphibian limb regeneration. All of the >200 structurally characterized TFPs adopt the namesake "three-finger" topology. In male red-legged salamanders, the TFP pheromone Plethodontid Modulating Factor (PMF) is a hypervariable protein such that, through extensive gene duplication and pervasive sexual selection, individual male salamanders express more than 30 unique isoforms. However, it remained unclear how this accelerated evolution affected the protein structure of PMF. Using LC/MS-MS and multidimensional NMR, we report the 3D structure of the most abundant PMF isoform, PMF-G. The high resolution structural ensemble revealed a highly modified TFP structure, including a unique disulfide bonding pattern and loss of secondary structure, that define a novel protein topology with greater backbone flexibility in the third peptide finger. Sequence comparison, models of molecular evolution, and homology modeling together support that this flexible third finger is the most rapidly evolving segment of PMF. Combined with PMF sequence hypervariability, this structural flexibility may enhance the plasticity of PMF as a chemical signal by permitting potentially thousands of structural conformers. We propose that the flexible third finger plays a critical role in PMF:receptor interactions. As female receptors co-evolve, this flexibility may allow PMF to still bind its receptor(s) without the immediate need for complementary mutations. Consequently, this unique

  17. Structural insights into the evolution of a sexy protein: novel topology and restricted backbone flexibility in a hypervariable pheromone from the red-legged salamander, Plethodon shermani.

    Directory of Open Access Journals (Sweden)

    Damien B Wilburn

    Full Text Available In response to pervasive sexual selection, protein sex pheromones often display rapid mutation and accelerated evolution of corresponding gene sequences. For proteins, the general dogma is that structure is maintained even as sequence or function may rapidly change. This phenomenon is well exemplified by the three-finger protein (TFP superfamily: a diverse class of vertebrate proteins co-opted for many biological functions - such as components of snake venoms, regulators of the complement system, and coordinators of amphibian limb regeneration. All of the >200 structurally characterized TFPs adopt the namesake "three-finger" topology. In male red-legged salamanders, the TFP pheromone Plethodontid Modulating Factor (PMF is a hypervariable protein such that, through extensive gene duplication and pervasive sexual selection, individual male salamanders express more than 30 unique isoforms. However, it remained unclear how this accelerated evolution affected the protein structure of PMF. Using LC/MS-MS and multidimensional NMR, we report the 3D structure of the most abundant PMF isoform, PMF-G. The high resolution structural ensemble revealed a highly modified TFP structure, including a unique disulfide bonding pattern and loss of secondary structure, that define a novel protein topology with greater backbone flexibility in the third peptide finger. Sequence comparison, models of molecular evolution, and homology modeling together support that this flexible third finger is the most rapidly evolving segment of PMF. Combined with PMF sequence hypervariability, this structural flexibility may enhance the plasticity of PMF as a chemical signal by permitting potentially thousands of structural conformers. We propose that the flexible third finger plays a critical role in PMF:receptor interactions. As female receptors co-evolve, this flexibility may allow PMF to still bind its receptor(s without the immediate need for complementary mutations. Consequently

  18. Transcriptomic Characterization of Innate and Acquired Immune Responses in Red-Legged Partridges (Alectoris rufa: A Resource for Immunoecology and Robustness Selection.

    Directory of Open Access Journals (Sweden)

    Natalia Sevane

    Full Text Available Present and future challenges for wild partridge populations include the resistance against possible disease transmission after restocking with captive-reared individuals, and the need to cope with the stress prompted by new dynamic and challenging scenarios. Selection of individuals with the best immune ability may be a good strategy to improve general immunity, and hence adaptation to stress. In this study, non-infectious challenges with phytohemagglutinin (PHA and sheep red blood cells allowed the classification of red-legged partridges (Alectoris rufa according to their overall immune responses (IR. Skin from the area of injection of PHA and spleen, both from animals showing extreme high and low IR, were selected to investigate the transcriptional profiles underlying the different ability to cope with pathogens and external aggressions. RNA-seq yielded 97 million raw reads from eight sequencing libraries and approximately 84% of the processed reads were mapped to the reference chicken genome. Differential expression analysis identified 1488 up- and 107 down-regulated loci in individuals with high IR versus low IR. Partridges displaying higher innate IR show an enhanced activation of host defence gene pathways complemented with a tightly controlled desensitization that facilitates the return to cellular homeostasis. These findings indicate that the immune system ability to respond to aggressions (either diseases or stress produced by environmental changes involves extensive transcriptional and post-transcriptional regulations, and expand our understanding on the molecular mechanisms of the avian immune system, opening the possibility of improving disease resistance or robustness using genome assisted selection (GAS approaches for increased IR in partridges by using genes such as AVN or BF2 as markers. This study provides the first transcriptome sequencing data of the Alectoris genus, a resource for molecular ecology that enables integration

  19. Report on Oregon Spotted Frog Egg Mass Surveys 2013-2015

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Oregon spotted frogs (Rana pretiosa) were once common across wetlands throughout western Washington and Oregon and were found in northern California and southern...

  20. Yet More Frogs

    Science.gov (United States)

    Shutler, Paul M. E.

    2011-01-01

    Extending a recent paper by Derek Holton, we show how to represent the algorithm for the Frog Problem diagrammatically. This diagrammatic representation suggests a simpler proof of the symmetrical case (equal numbers of frogs of each colour) by allowing the even and odd cases to be treated together. It also provides a proof in the asymmetrical…

  1. Carryover aquatic effects on survival of metamorphic frogs during pond emigration

    Science.gov (United States)

    Chelgren, N.D.; Rosenberg, D.K.; Heppell, S.S.; Gitelman, A.I.

    2006-01-01

    In organisms with complex life cycles, physiological stressors during early life stages may have fitness-level impacts that are delayed into later stages or habitats. We tested the hypothesis that body size and date of metamorphosis, which are highly responsive to aquatic stressors, influence post-metamorphic survival and movement patterns in the terrestrial phase of an ephemeral pond-breeding frog by examining these traits in two populations of northern red-legged frogs (Rana aurora aurora). To increase variation of body size at metamorphosis, we manipulated food availability for 314 of 1045 uniquely marked tadpoles and estimated the probability that frogs survived and emigrated using concentric rings of drift fencing surrounding ponds and Bayesian capture-recapture modeling. The odds of surviving and emigrating from the ponds to the innermost drift fences, ???12 m, increased by factors of 2.20 (95% credibility intervals 1.39-4.23) and 2.54 (0.94-4.91) with each millimeter increase in snout-vent length and decreased by factors of 0.91 (0.85-0.96) and 0.89 (0.80-1.00) with each day's delay in metamorphosis for the two ponds. The odds of surviving and moving to the next ring of fencing, 12 m to ???40 m from the ponds, increased by a factor of 1.20 (0.45-4.06) with each millimeter increase in size. Our results demonstrated that body size and timing of metamorphosis relate strongly to the performance of newly metamorphosed frogs during their initial transition into terrestrial habitat. Carryover effects of aquatic stressors that reduce size and delay metamorphosis may have population-level impacts that are not expressed until terrestrial stages. Since changes in both aquatic and terrestrial systems are implicated in many amphibian declines, quantifying both immediate and delayed effects of stressors on demographic rates is critical to sound management. ?? 2006 by the Ecological Society of America.

  2. Utilization of frog waste

    OpenAIRE

    Lekshmy Nair, A.; Prabhu, P.V.

    1980-01-01

    Commercial frog waste samples have been converted into meals by cooking at 0.7 kg/sq. cm for 30 min, draining off the stick water and drying the press cake either in the sun, tunnel dryer under controlled conditions or hot air oven. Yield of the meal varied between 18.6 to 21.5% of the fresh frog waste. Chemical analyses of the meals have shown that the meals prepared from frog waste conform to standards prescribed for fish meal and livestock feed and can therefore be used for supplementation...

  3. Tetrodotoxin: Occurrence in atelopid frogs of Costa Rica.

    Science.gov (United States)

    Kim, Y H; Brown, G B; Mosher, F A

    1975-07-11

    The potent neurotoxin tetrodotoxin, which has previously been found in puffer fish of the order Tetraordontiformes, a goby (Gobius criniger), and the California newt (Taricha torosa), has now been identified in the skins of frogs of the genus Atelopus from Costa Rica. PMID:1138374

  4. Frogs In Danger

    Institute of Scientific and Technical Information of China (English)

    李笑; 岳巧玲

    2005-01-01

    If you go out to the field at ni ght inspring or summer,you can hear frogs croaking and singing joyfully here and there.It seems as if they were performing a fiel dsymphony (交响曲).How pleasant and sweet it sounds!It fills nature with music and vitality.

  5. Fixação esquelética externa em fratura tarsometatársica de seriema (Cariama cristata: relato de caso External skeletal fixation in tarsumetatarsus fracture of red-legged seriema (Cariama cristata: a case report

    Directory of Open Access Journals (Sweden)

    B.B.J. Torres

    2007-02-01

    Full Text Available Uma seriema (Cariama cristata adulta foi atendida com histórico de traumatismo por tentativa de captura. A ave apresentava dificuldade de apoio do membro pélvico direito, dor à manipulação e fratura exposta do osso tarsometatarso. Optou-se pelo tratamento cirúrgico com redução fechada, utilizando-se fixador esquelético externo tipo II, com barra de conexão acrílica. A técnica cirúrgica utilizada foi satisfatória para o tratamento da fratura, possibilitando reparação óssea e retorno funcional do membro 60 dias após a cirurgia.An adult red-legged seriema (Cariama cristata was referred for examination with history of trauma by capture. The physical examination revealed lameness in the right pelvic limb, sensibility to touch and open fracture of tarsumetatarsus. The treatment was done with surgical closed reduction using a external skeletal fixator type II with acrylic connecting bar. The surgical technique applied was satisfactory for the treatment of the fracture of tarsumetatarsus, since there was bone healing and functional return of the limb at 60 days after surgery.

  6. Frogs and climate change in South Africa

    OpenAIRE

    Minter, Leslie Rory

    2011-01-01

    This article explores the relationship between frog declines and climate change, discusses the possible impact of climate change on the South African frog fauna, and highlights the necessity for increased research and monitoring of our frog populations.

  7. Mosquito repellents in frog skin

    OpenAIRE

    Williams, C. R.; Smith, B.P.C; Best, S.M.; Tyler, M.J.

    2006-01-01

    The search for novel insect repellents has been driven by health concerns over established synthetic compounds such as diethyl-m-toluamide (DEET). Given the diversity of compounds known from frog skin and records of mosquito bite and ectoparasite infestation, the presence of mosquito repellents in frogs seemed plausible. We investigated frog skin secretions to confirm the existence of mosquito repellent properties. Litoria caerulea secretions were assessed for mosquito repellency by topical a...

  8. Ultrasonic communication in frogs.

    Science.gov (United States)

    Feng, Albert S; Narins, Peter M; Xu, Chun-He; Lin, Wen-Yu; Yu, Zu-Lin; Qiu, Qiang; Xu, Zhi-Min; Shen, Jun-Xian

    2006-03-16

    Among vertebrates, only microchiropteran bats, cetaceans and some rodents are known to produce and detect ultrasounds (frequencies greater than 20 kHz) for the purpose of communication and/or echolocation, suggesting that this capacity might be restricted to mammals. Amphibians, reptiles and most birds generally have limited hearing capacity, with the ability to detect and produce sounds below approximately 12 kHz. Here we report evidence of ultrasonic communication in an amphibian, the concave-eared torrent frog (Amolops tormotus) from Huangshan Hot Springs, China. Males of A. tormotus produce diverse bird-like melodic calls with pronounced frequency modulations that often contain spectral energy in the ultrasonic range. To determine whether A. tormotus communicates using ultrasound to avoid masking by the wideband background noise of local fast-flowing streams, or whether the ultrasound is simply a by-product of the sound-production mechanism, we conducted acoustic playback experiments in the frogs' natural habitat. We found that the audible as well as the ultrasonic components of an A. tormotus call can evoke male vocal responses. Electrophysiological recordings from the auditory midbrain confirmed the ultrasonic hearing capacity of these frogs and that of a sympatric species facing similar environmental constraints. This extraordinary upward extension into the ultrasonic range of both the harmonic content of the advertisement calls and the frog's hearing sensitivity is likely to have co-evolved in response to the intense, predominantly low-frequency ambient noise from local streams. Because amphibians are a distinct evolutionary lineage from microchiropterans and cetaceans (which have evolved ultrasonic hearing to minimize congestion in the frequency bands used for sound communication and to increase hunting efficacy in darkness), ultrasonic perception in these animals represents a new example of independent evolution. PMID:16541072

  9. Changing Use and Occurrence of Pesticides in Surface Waters of California's Rice-Growing Region

    Science.gov (United States)

    Orlando, J. L.; Hladik, M.; Smalling, K. L.; Kuivila, K.

    2011-12-01

    concentrations up to 136 and 128 μg/L, respectively. Clomazone and thiobencarb were detected in greater than 93% of water samples, with maximum concentrations of 19.4, and 12.4 μg/L. Propanil was present in 60% of samples and at a maximum concentration of 6.5 μg/L. The U.S. Environmental Protection Agency (EPA) has established chronic invertebrate toxicity benchmarks for concentrations of azoxystrobin, clomazone, and thiobencarb in water of 44, 2,200, and 1.0 μg/L, respectively. Concentrations of azoxystrobin and thiobencarb exceeded these benchmarks in one and three samples, respectively. The chronic fish toxicity benchmark of 9.1μg/L for propanil was not exceeded in any samples. Although the propanil degradate 3,4-DCA does not have established aquatic life benchmarks, EPA noted that it may be 11 and 7 times more toxic than the parent compound to freshwater invertebrates on an acute and chronic basis, respectively (2009 memo on Risks of Propanil Use to Federally Threatened California Red-legged Frog). This study illustrates the importance of understanding changing pesticide use and the resulting changes in pesticide concentrations in the environment.

  10. Landscape resistance to frog movements

    Science.gov (United States)

    Mazerolle, M.J.; Desrochers, A.

    2005-01-01

    An animal's capacity to recolonize a patch depends on at least two components: its ability to detect the patch and its ability to reach it. However, the disruption of such processes by anthropic disturbances could explain low animal abundance patterns observed by many investigators in certain landscapes. Through field experiments, we compared the orientation and homing success of northern green frogs (Rana clamitans melanota Rafinesque, 1820) and northern leopard frogs (Rana pipiens Schreber, 1782) translocated across disturbed or undisturbed surfaces. We also monitored the path selected by individuals when presented with a choice between a short distance over a disturbed surface and a longer, undisturbed route. Finally, we measured the water loss and behaviour of frogs on substrates resulting from anthropogenic disturbances and a control. When presented with a choice, 72% of the frogs avoided disturbed surfaces. Although able to orient towards the pond of capture when translocated on disturbed surfaces, frogs had a lower probability of homing successfully to the pond than when translocated at a similar distance on an undisturbed surface. Frogs lost the most water on substrates associated with disturbance and in the absence of cover. Our data illustrate that anthropically disturbed areas devoid of cover, such as mined peatlands and agricultural fields, disrupt the ability of frogs to reach habitat patches and are likely explanations to their reduced abundance patterns in such environments. ?? 2005 NRC Canada.

  11. THE STRUCTURE OF A FOLKLORE IMAGE OF THE FROG

    OpenAIRE

    ZHUCHKOVA A.V.; GALAY K.N.

    2014-01-01

    We consider an animalistic image of a frog in fairy tales «The Frog-Tsarevna» and «The Prince-frog». We define the typology of this image. Also we offer the psychological and philosophical interpretation of an image of a frog in fairy tales, considering the frog`s skin is a metaphor of egoism.

  12. A Comparison of V-Frog[C] to Physical Frog Dissection

    Science.gov (United States)

    Lalley, James P.; Piotrowski, Phillip S.; Battaglia, Barbara; Brophy, Keith; Chugh, Kevin

    2010-01-01

    The purpose of the present study was to examine and compare the effectiveness of virtual frog dissection using V-Frog[C] and physical frog dissection on learning, retention, and affect. Subjects were secondary students enrolled in year-long life science classes in a suburban high school (N=102). Virtual dissections were done with V-Frog[C], a…

  13. Sensitivity of Coastal Environments and Wildlife to Spilled Oil: Northern California: REPTILES (Reptile and Amphibian Polygons)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains sensitive biological resource data for sea turtles and estuarine frogs and turtles in Northern California. Vector polygons in this data set...

  14. FROG: Time-series analysis

    Science.gov (United States)

    Allan, Alasdair

    2014-06-01

    FROG performs time series analysis and display. It provides a simple user interface for astronomers wanting to do time-domain astrophysics but still offers the powerful features found in packages such as PERIOD (ascl:1406.005). FROG includes a number of tools for manipulation of time series. Among other things, the user can combine individual time series, detrend series (multiple methods) and perform basic arithmetic functions. The data can also be exported directly into the TOPCAT (ascl:1101.010) application for further manipulation if needed.

  15. Salmonella Infection and Water Frogs

    Centers for Disease Control (CDC) Podcasts

    2010-01-12

    This podcast, featuring lead investigator Shauna Mettee, discusses the first known outbreak of Salmonella in people due to contact with water frogs.  Created: 1/12/2010 by National Center for Zoonotic, Vector-Borne, and Enteric Diseases (NCZVED).   Date Released: 1/12/2010.

  16. Mechanics of the frog ear

    NARCIS (Netherlands)

    Van Dijk, Pim; Mason, Matthew J.; Schoffelen, Richard L. M.; Narins, Peter M.; Meenderink, Sebastiaan W. F.

    2011-01-01

    The frog inner ear contains three regions that are sensitive to airborne sound and which are functionally distinct. (1) The responses of nerve fibres innervating the low-frequency, rostral part of the amphibian papilla (AP) are complex. Electrical tuning of hair cells presumably contributes to the f

  17. FROG - Fingerprinting Genomic Variation Ontology.

    Directory of Open Access Journals (Sweden)

    E Abinaya

    Full Text Available Genetic variations play a crucial role in differential phenotypic outcomes. Given the complexity in establishing this correlation and the enormous data available today, it is imperative to design machine-readable, efficient methods to store, label, search and analyze this data. A semantic approach, FROG: "FingeRprinting Ontology of Genomic variations" is implemented to label variation data, based on its location, function and interactions. FROG has six levels to describe the variation annotation, namely, chromosome, DNA, RNA, protein, variations and interactions. Each level is a conceptual aggregation of logically connected attributes each of which comprises of various properties for the variant. For example, in chromosome level, one of the attributes is location of variation and which has two properties, allosomes or autosomes. Another attribute is variation kind which has four properties, namely, indel, deletion, insertion, substitution. Likewise, there are 48 attributes and 278 properties to capture the variation annotation across six levels. Each property is then assigned a bit score which in turn leads to generation of a binary fingerprint based on the combination of these properties (mostly taken from existing variation ontologies. FROG is a novel and unique method designed for the purpose of labeling the entire variation data generated till date for efficient storage, search and analysis. A web-based platform is designed as a test case for users to navigate sample datasets and generate fingerprints. The platform is available at http://ab-openlab.csir.res.in/frog.

  18. FROG - Fingerprinting Genomic Variation Ontology.

    Science.gov (United States)

    Abinaya, E; Narang, Pankaj; Bhardwaj, Anshu

    2015-01-01

    Genetic variations play a crucial role in differential phenotypic outcomes. Given the complexity in establishing this correlation and the enormous data available today, it is imperative to design machine-readable, efficient methods to store, label, search and analyze this data. A semantic approach, FROG: "FingeRprinting Ontology of Genomic variations" is implemented to label variation data, based on its location, function and interactions. FROG has six levels to describe the variation annotation, namely, chromosome, DNA, RNA, protein, variations and interactions. Each level is a conceptual aggregation of logically connected attributes each of which comprises of various properties for the variant. For example, in chromosome level, one of the attributes is location of variation and which has two properties, allosomes or autosomes. Another attribute is variation kind which has four properties, namely, indel, deletion, insertion, substitution. Likewise, there are 48 attributes and 278 properties to capture the variation annotation across six levels. Each property is then assigned a bit score which in turn leads to generation of a binary fingerprint based on the combination of these properties (mostly taken from existing variation ontologies). FROG is a novel and unique method designed for the purpose of labeling the entire variation data generated till date for efficient storage, search and analysis. A web-based platform is designed as a test case for users to navigate sample datasets and generate fingerprints. The platform is available at http://ab-openlab.csir.res.in/frog.

  19. CARE AND FEEDING OF FROGS

    International Nuclear Information System (INIS)

    'Propellers' are features in Saturn's A ring associated with moonlets that open partial gaps. They exhibit non-Keplerian motion (Tiscareno et al.); the longitude residuals of the best-observed propeller, 'Blériot', appear consistent with a sinusoid of period ∼4 years. Pan and Chiang proposed that propeller moonlets librate in 'frog resonances' with co-orbiting ring material. By analogy with the restricted three-body problem, they treated the co-orbital material as stationary in the rotating frame and neglected non-co-orbital material. Here we use simple numerical experiments to extend the frog model, including feedback due to the gap's motion, and drag associated with the Lindblad disk torques that cause Type I migration. Because the moonlet creates the gap, we expect the gap centroid to track the moonlet, but only after a time delay tdelay, the time for a ring particle to travel from conjunction with the moonlet to the end of the gap. We find that frog librations can persist only if tdelay exceeds the frog libration period Plib, and if damping from Lindblad torques balances driving from co-orbital torques. If tdelay ib, then the libration amplitude damps to zero. In the case of Blériot, the frog resonance model can reproduce the observed libration period Plib ≅ 4 yr. However, our simple feedback prescription suggests that Blériot's tdelay ∼ 0.01Plib, which is inconsistent with the observed libration amplitude of 260 km. We urge more accurate treatments of feedback to test the assumptions of our toy models.

  20. CARE AND FEEDING OF FROGS

    Energy Technology Data Exchange (ETDEWEB)

    Pan, Margaret; Chiang, Eugene, E-mail: mpan@astro.berkeley.edu [Department of Astronomy, University of California, Berkeley, CA 94720 (United States)

    2012-01-15

    'Propellers' are features in Saturn's A ring associated with moonlets that open partial gaps. They exhibit non-Keplerian motion (Tiscareno et al.); the longitude residuals of the best-observed propeller, 'Bleriot', appear consistent with a sinusoid of period {approx}4 years. Pan and Chiang proposed that propeller moonlets librate in 'frog resonances' with co-orbiting ring material. By analogy with the restricted three-body problem, they treated the co-orbital material as stationary in the rotating frame and neglected non-co-orbital material. Here we use simple numerical experiments to extend the frog model, including feedback due to the gap's motion, and drag associated with the Lindblad disk torques that cause Type I migration. Because the moonlet creates the gap, we expect the gap centroid to track the moonlet, but only after a time delay t{sub delay}, the time for a ring particle to travel from conjunction with the moonlet to the end of the gap. We find that frog librations can persist only if t{sub delay} exceeds the frog libration period P{sub lib}, and if damping from Lindblad torques balances driving from co-orbital torques. If t{sub delay} << Pl{sub ib}, then the libration amplitude damps to zero. In the case of Bleriot, the frog resonance model can reproduce the observed libration period P{sub lib} {approx_equal} 4 yr. However, our simple feedback prescription suggests that Bleriot's t{sub delay} {approx} 0.01P{sub lib}, which is inconsistent with the observed libration amplitude of 260 km. We urge more accurate treatments of feedback to test the assumptions of our toy models.

  1. Spatial Patterns of Airborne Pesticides in the Alpine Habitat of a Declining Calfornia Amphibian, The Mountain Yellow-Legged Frog

    Science.gov (United States)

    The mountain yellow-legged frog complex (Rana muscosa complex) has disappeared from most of its historic localities in the Sierra Nevada of California, and airborne pesticides from the Central Valley have been implicated as a causal agent. To determine the distributions and conce...

  2. From frog integument to human skin: dermatological perspectives from frog skin biology

    NARCIS (Netherlands)

    Haslam, I.S.; Roubos, E.; Mangoni, M.L.; Yoshizato, K.; Vaudry, H.; Kloepper, J.E.; Pattwell, D.M.; Maderson, P.F.A.; Paus, R.

    2014-01-01

    For over a century, frogs have been studied across various scientific fields, including physiology, embryology, neuroscience, (neuro)endocrinology, ecology, genetics, behavioural science, evolution, drug development, and conservation biology. In some cases, frog skin has proven very successful as a

  3. Care and feeding of frogs

    CERN Document Server

    Pan, Margaret; 10.1088/0004-6256/143/1/9

    2012-01-01

    "Propellers" are features in Saturn's A ring associated with moonlets that open partial gaps. They exhibit non-Keplerian motion (Tiscareno 2010); the longitude residuals of the best-observed propeller, "Bl\\'eriot," appear consistent with a sinusoid of period ~4 years. Pan and Chiang (2010) proposed that propeller moonlets librate in "frog resonances" with co-orbiting ring material. By analogy with the restricted three-body problem, they treated the co-orbital material as stationary in the rotating frame and neglected non-co-orbital material. Here we use simple numerical experiments to extend the frog model, including feedback due to the gap's motion, and drag associated with the Lindblad disk torques that cause Type I migration. Because the moonlet creates the gap, we expect the gap centroid to track the moonlet, but only after a time delay t_diff, the time for a ring particle to travel from conjunction with the moonlet to the end of the gap. We find that frog librations can persist only if t_diff exceeds the...

  4. Snoring puddle frog

    International Nuclear Information System (INIS)

    Full text: The purpose of this paper is to hold a biological mirror in front of ourselves, the nuclear energy community, and to suggest that the reflection we will see there will help us both professionally and as members of a broader society. Let us start with sex. For sex to function as a means of reproduction, a male and a female of a particular species have to recognise each other and mate. The important terms here are 'particular species' and 'recognise'. Within most species, extraordinarily precise mate recognition systems have evolved. The precise frequency of the croak of a particular species of frog; the precise seasonal coloration of a particular species of salmon; the precise length of the tail of a particular species of bird; each is recognisable instantly to a prospective mate, though not to untrained human ears or eyes. 'The Recognition Concept of Species' (1985) is a monograph that has become something of a 'classic' in annals of evolutionary biology. Its author, HEH Paterson, suggests that a species can be defined as a group of organisms that share a common mate recognition system. Mating is an exchange of genes, and creatures that do not recognise each other do not exchange genes. A mate recognition system closes off the gene pool and may increasingly isolate its participants from even their nearest relatives. Biological evolution has numerous links and parallels with the evolution of human cultures. Some of our recognition systems seem to have a knack for drawing everyone in - American popular culture, for example, is now inescapable. Other recognition systems repel all but a few - take, or rather don't take, the Hell's Angels or the Ku Klux Klan. We, as members of the nuclear energy culture, are members of a closed and even repellent gene pool. We share a recognition system by which we perpetuate ourselves from generation to generation, from Hiroshima to Chernobyl. Outsiders do not understand our language: terms like 'credit for fission products

  5. Expression analysis and identification of antimicrobial peptide transcripts from six North American frog species

    Science.gov (United States)

    Robertson, Laura S.; Fellers, Gary M.; Marranca, Jamie Marie; Kleeman, Patrick M.

    2013-01-01

    Frogs secrete antimicrobial peptides onto their skin. We describe an assay to preserve and analyze antimicrobial peptide transcripts from field-collected skin secretions that will complement existing methods for peptide analysis. We collected skin secretions from 4 North American species in the field in California and 2 species in the laboratory. Most frogs appeared healthy after release; however, Rana boylii in the Sierra Nevada foothills, but not the Coast Range, showed signs of morbidity and 2 died after handling. The amount of total RNA extracted from skin secretions was higher in R. boylii and R. sierrae compared to R. draytonii, and much higher compared to Pseudacris regilla. Interspecies variation in amount of RNA extracted was not explained by size, but for P. regilla it depended upon collection site and date. RNA extracted from skin secretions from frogs handled with bare hands had poor quality compared to frogs handled with gloves or plastic bags. Thirty-four putative antimicrobial peptide precursor transcripts were identified. This study demonstrates that RNA extracted from skin secretions collected in the field is of high quality suitable for use in sequencing or quantitative PCR (qPCR). However, some species do not secrete profusely, resulting in very little extracted RNA. The ability to measure transcript abundance of antimicrobial peptides in field-collected skin secretions complements proteomic analyses and may provide insight into transcriptional mechanisms that could affect peptide abundance.

  6. Malformed frog survey Dahomey NWR - 2001

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Report contains field data sheets assoicated with malformed frog survey on Dahomey NWR in 2001. Work was done in support of regional sampling on refuges for...

  7. Meeting the "Standards" with Vanishing Frogs.

    Science.gov (United States)

    Davidson, Cindy B.; Matthews, Catherine E.; Patrick, Patricia

    2001-01-01

    Explains methods for introducing high school students to the issue of the declining amphibian population. Plays the game Frogs' Futures following a seminar as an instructional strategy. Describes the game, procedures, and rules. (YDS)

  8. Frog Call Survey Summary 2002-2006

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Since 2002, Patuxent Research Refuge has conducted frog surveys on South Tract, Central Tract, and North Tract locations. These surveys are conducted by Patuxent...

  9. California Bioregions

    Data.gov (United States)

    California Department of Resources — California regions developed by the Inter-agency Natural Areas Coordinating Committee (INACC) were digitized from a 1:1,200,000 California Department of Fish and...

  10. Landing on branches in the frog Trachycephalus resinifictrix (Anura: Hylidae)

    OpenAIRE

    Bijma, Nienke N.; Gorb, Stanislav N.; Kleinteich, Thomas

    2016-01-01

    Frogs (Lissamphibia: Anura) are famous for their saltatory or hopping locomotion, which is related to numerous anatomical specialisations that are characteristic for the group. However, while the biomechanics of take-off in frogs have been studied in detail, much less is known on how frogs land after a jump. Besides terrestrial and aquatic species, several lineages of frogs adopted an arboreal lifestyle and especially the biomechanics of landing on challenging, small, and unpredictable substr...

  11. Oregon Spotted Frog Range - CWHR [ds597

    Data.gov (United States)

    California Department of Resources — Vector datasets of CWHR range maps are one component of California Wildlife Habitat Relationships (CWHR), a comprehensive information system and predictive model...

  12. Northern Leopard Frog Range - CWHR [ds593

    Data.gov (United States)

    California Department of Resources — Vector datasets of CWHR range maps are one component of California Wildlife Habitat Relationships (CWHR), a comprehensive information system and predictive model...

  13. Cascades Frog Range - CWHR [ds591

    Data.gov (United States)

    California Department of Resources — Vector datasets of CWHR range maps are one component of California Wildlife Habitat Relationships (CWHR), a comprehensive information system and predictive model...

  14. The propeller and the frog

    CERN Document Server

    Pan, Margaret

    2010-01-01

    "Propellers" in planetary rings are disturbances in ring material excited by moonlets that open only partial gaps. We describe a new type of co-orbital resonance that can explain the observed non-Keplerian motions of propellers. The resonance is between the moonlet underlying the propeller, and co-orbiting ring particles downstream of the moonlet where the gap closes. The moonlet librates within the gap about an equilibrium point established by co-orbiting material and stabilized by the Coriolis force. In the limit of small libration amplitude, the libration period scales linearly with the gap azimuthal width and inversely as the square root of the co-orbital mass. The new resonance recalls but is distinct from conventional horseshoe and tadpole orbits; we call it the "frog" resonance, after the relevant term in equine hoof anatomy. For a ring surface density and gap geometry appropriate for the propeller Bl\\'eriot in Saturn's A ring, our theory predicts a libration period of ~4 years, similar to the ~3.7 yea...

  15. New species of Haematoloechus (Digenea: Plagiorchidae in the lung of the foothill yellow-legged frog Rana boylii (Anura, from Humboldt County, California, USA Especie nueva de Haematoloechus (Digenea: Plagiorchidae del pulmón de la rana de patas amarillas Rana boylii (Anura, de Humboldt County, California, Estados Unidos de América

    Directory of Open Access Journals (Sweden)

    David Zamparo

    2011-06-01

    Full Text Available A new species of Haematoloechus is described from the lungs of Rana boylii from Humboldt County, California. The new species is similar to Haematoloechus buttensis, Haematoloechus kernensis, and Haematoloechus complexus in general course of the uterus and gonad shape. It is similar to H. buttensis by having a cirrus sac terminating midway between the posterior margin of the pharynx and the anterior margin of the ovary, and having a smaller oral/ventral sucker ratio; to H. complexus by having the genital pore ventral to the pharynx, and it is similar to H. kernensis by having a larger oral sucker to pharynx width ratio. The new species is unique by lacking an extra-cecal longitudinal uterine loop from the hind-body. Molecularly, the new species differs 1.04-1.15% in partial 28S sequence with respect to H. complexus, and a monophyletic grouping of these specimens in a phylogenetic analysis of all available sequence data consistent with the species-specific status proposed herein. Evidence is also presented to suggest that specimens identified as H. buttensis in Rana pretiosa from British Columbia, Canada represents a new, but still undescribed species. The importance of conducting biological inventories of helminths, along with continued monitoring of populations, and collections based taxonomy are related.Una especie nueva de Haematoloechus es descrita de los pulmones de Rana boylii de Humboldt County, California. La especie nueva guarda semejanza con Haematoloechus buttensis, Haematoloechus kernensis, y Haematoloechus complexus en la disposición general del útero y en la forma de las gónadas. Es similar a H. buttensis en que la bolsa del cirro finaliza entre el margen posterior de la faringe y el margen anterior del ovario, y en presentar una relación menor entre la ventosa oral y el acetábulo; a H. complexus por tener el poro genital ventral a la faringe, y a H. kernensis por tener una relación mayor del ancho de la ventosa oral contra la

  16. FROG: The Fast & Realistic OPENGL Displayer

    CERN Document Server

    Quertenmont, Loic

    2009-01-01

    FROG is a generic framework dedicated to visualisation of events in high energy experiment. It is suitable to any particular physics experiment or detector design. The code is light (<3 MB) and fast (browsing time ~20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OPENGL and GLUT libraries. Moreover, FROG does not require installation of third party libraries for the visualisation. This document describes the features and principles of FROG version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisations, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally, several examples of its current applications are presented for illustration.

  17. FROG The Fast and Realistic OPENGL Displayer

    CERN Document Server

    Quertenmont, Loic

    2009-01-01

    FROG is a generic framework dedicated to visualisation of events in high energy experiment. It is suitable to any particular physics experiment or detector design. The code is light ($<3\\textrm{MB}$) and fast (browsing time ~20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OPENGL and GLUT libraries. Moreover, FROG does not require installation of third party libraries for the visualisation. This document describes the features and principles of FROG version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisations, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally, several examples of its current applications are presented for illustration.

  18. Birds and frogs in mathematics and physics

    International Nuclear Information System (INIS)

    Some scientists are birds, others are frogs. Birds fly high in the air and survey broad vistas of mathematics out to the far horizon. They delight in concepts that unify our thinking and bring together diverse problems from different parts of the landscape. Frogs live in the mud below and see only the flowers that grow nearby. They delight in the details of particular objects, and they solve problems one at a time. A brief history of mathematics and its applications in physics is presented in this article. (from the history of physics)

  19. F.R.O.G. - Abstracts

    OpenAIRE

    2008-01-01

    From October 17th to 19th the international Games Conference "Future and Reality of Gaming" (F.R.O.G. 08) took place in Vienna as part of the Game City. The three days of the conference offered a large variety of international keynote speakers as well as a broad review on the cutting edge research on the topic of gaming. The presentations at F.R.O.G. 08 covered topics such as theory of gaming, culture of gaming, future perspectives of the games industry, game design as well as various pedagog...

  20. F.R.O.G. - Abstracts Keynotes

    OpenAIRE

    2008-01-01

    From October 17th to 19th the international Games Conference "Future and Reality of Gaming" (F.R.O.G. 08) took place in Vienna as part of the Game City. The three days of the conference offered a large variety of international keynote speakers as well as a broad review on the cutting edge research on the topic of gaming. The presentations at F.R.O.G. 08 covered topics such as theory of gaming, culture of gaming, future perspectives of the games industry, game design as well as various pedagog...

  1. Birds and frogs in mathematics and physics

    Energy Technology Data Exchange (ETDEWEB)

    Dyson, Freeman J [Institute for Advanced Study, Princeton, NJ (United States)

    2010-11-15

    Some scientists are birds, others are frogs. Birds fly high in the air and survey broad vistas of mathematics out to the far horizon. They delight in concepts that unify our thinking and bring together diverse problems from different parts of the landscape. Frogs live in the mud below and see only the flowers that grow nearby. They delight in the details of particular objects, and they solve problems one at a time. A brief history of mathematics and its applications in physics is presented in this article. (from the history of physics)

  2. The Observation of Frog Species at State University of Malang as a Preliminary Effort on Frog Conservation

    OpenAIRE

    Dian Ratri Wulandari; Muhammad Habibi; Dwi Listyorini

    2013-01-01

    Frog is an amphibian which is widely spread around the world. Indonesia houses 450 species which represent 11% of frog species in the world. In Java Island alone, there live 42 species of frogs and toads. Frogs can be used as an environment indicator in that the presence of frog in a particular place indicates that the place stays natural and unpolluted. The 1st Campus of State University of Malang, which is located in the heart of Malang District, has been developing rapidly currently. Thus,...

  3. Do all frogs swim alike? The effect of ecological specialization on swimming kinematics in frogs.

    Science.gov (United States)

    Robovska-Havelkova, Pavla; Aerts, Peter; Rocek, Zbynek; Prikryl, Tomas; Fabre, Anne-Claire; Herrel, Anthony

    2014-10-15

    Frog locomotion has attracted wide scientific interest because of the unusual and derived morphology of the frog pelvic girdle and hind limb. Previous authors have suggested that the design of the frog locomotor system evolved towards a specialized jumping morphology early in the radiation of the group. However, data on locomotion in frogs are biased towards a few groups and most of the ecological and functional diversity remains unexplored. Here, we examine the kinematics of swimming in eight species of frog with different ecologies. We use cineradiography to quantify movements of skeletal elements from the entire appendicular skeleton. Our results show that species with different ecologies do differ in the kinematics of swimming, with the speed of limb extension and especially the kinematics of the midfoot being different. Our results moreover suggest that this is not a phylogenetic effect because species from different clades with similar ecologies converge on the same swimming kinematics. We conclude that it is important to analyze frog locomotion in a broader ecological and evolutionary context if one is to understand the evolutionary origins of this behavior.

  4. Frog egg growth, experiment S003

    Science.gov (United States)

    Young, R. S.; Tremor, J. W.

    1971-01-01

    The objective of experiment was to determine the effect of weightlessness on the ability of a fertilized frog egg to divide normally and to differentiate and form a normal embryo. This experiment was first attempted on the Gemini 8 mission and was completed only partially because of the early termination of that mission.

  5. Tracking Frogs that sing ultrasonic duet

    Institute of Scientific and Technical Information of China (English)

    XIN Ling

    2009-01-01

    @@ In central China, unique frogs talk by emitting ultrasonic calls, male to show their virility and female for courtship, which are received by tunable ears with amazing accuracy. Prof. SHEN Junxian from the CAS Institute of Biophysics and his collaborators are working diligently to explore the mysteries of unique sound communication in animal kingdom.

  6. Female frogs send ultrasonic signals for courtship

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ During their studies of Odorrana tormota,a frog species with recessed tympanic membranes,CAS researchers have found that females go ultrasonic during courtship,revealing an amazingly system for communication.The work was reported online on 8 May by Nature.

  7. Water Frogs, Aquariums, and Salmonella -- Oh My!

    Centers for Disease Control (CDC) Podcasts

    2009-12-09

    This CDC Kidtastics podcast discusses how people can get Salmonella from water frogs and aquariums.  Created: 12/9/2009 by National Center for Zoonotic, Vector-Borne, and Enteric Diseases (NCZVED).   Date Released: 12/9/2009.

  8. Venomous Frogs Use Heads as Weapons.

    Science.gov (United States)

    Jared, Carlos; Mailho-Fontana, Pedro Luiz; Antoniazzi, Marta Maria; Mendes, Vanessa Aparecida; Barbaro, Katia Cristina; Rodrigues, Miguel Trefaut; Brodie, Edmund D

    2015-08-17

    Venomous animals have toxins associated with delivery mechanisms that can introduce the toxins into another animal. Although most amphibian species produce or sequester noxious or toxic secretions in the granular glands of the skin to use as antipredator mechanisms, amphibians have been considered poisonous rather than venomous because delivery mechanisms are absent. The skin secretions of two Brazilian hylid frogs (Corythomantis greening and Aparasphenodon brunoi) are more toxic than the venoms of deadly venomous Brazilian pitvipers, genus Bothrops; C. greeningi secretion is 2-fold and A. brunoi secretion is 25-fold as lethal as Bothrops venom. Like the venoms of other animals, the skin secretions of these frogs show proteolytic and fibrinolytic activity and have hyaluronidase, which is nontoxic and nonproteolytic but promotes diffusion of toxins. These frogs have well-developed delivery mechanisms, utilizing bony spines on the skull that pierce the skin in areas with concentrations of skin glands. C. greeningi has greater development of head spines and enlarged skin glands producing a greater volume of secretion, while A. brunoi has more lethal venom. C. greeningi and A. brunoi have highly toxic skin secretions and an associated delivery mechanism; they are therefore venomous. Because even tiny amounts of these secretions introduced into a wound caused by the head spines could be dangerous, these frogs are capable of using their skin toxins as venoms against would-be predators. PMID:26255851

  9. Frog value chain case study in Ho Chi Minh City Vietnam

    OpenAIRE

    Le, Minh Quoc

    2012-01-01

    Frog is valuable product in Vietnam but the natural frogs are overexploited thus, the new model to raising frog is desired. Many species of frogs are cultured in Vietnam, especially in Ho Chi Minh City, for trial of the adaptive ability of exotic species in Vietnam condition. Recently, the frogs’ species from Thailand and Taiwan are prepotent and spread out Vietnam. Nowadays, frog culture becomes one of the newest industries in Vietnam. With a short life cycle, frog culture is farming as econ...

  10. The Bear,The Rabbit And The Golden Frog

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Mr. Bear and Mr. Rabbit didn’t like each other very much. One day, while walking through the woods, they came across a golden frog. They were amazed when the frog talked to them. The golden frog admitted that he didn’t often meet anyone, but, when he did, he always gave them six wishes. He told them that they could have 3 wishes each.

  11. The checklist of protozoan and acanthocephalan from frogs in China

    OpenAIRE

    XIA Weili; Huang, Bing; Zhu, Shunhai; Men Qifei; Han, Hongyu; Dong, Hui; Zhao, Qiping

    2015-01-01

    In order to understand the species of protozoan and acanthocephalan from frogs and their geographic distributions in China.Relevant literatures that reported protozoan and acanthocephalan in frogs of China were collected and a checklist was provided according to newer classification system on protozoan and acanthocephalan based on these literatures.In summary,61 species of protozoan and 8 species of acanthocephalan have been recorded in 31 species of frogs in China.Among them,the species of p...

  12. Reducing outage times: a FROG perspective

    International Nuclear Information System (INIS)

    In 1992, the Framatome Owners Group (FROG) was set up. It provides a forum for the members, who are all users of Framatome nuclear steam supply systems, to share and benefit from each others experience. Joint activities have been focused on safety and economic performance. Through effective control of outage duration, the average capability factor for the 60 plus nuclear units operated by the members rose from 74% in 1992 to 81.5% in 1993, while the average unplanned capability loss factor reduced from 9% to 3.5%. The specific measures now being taken by three FROG members to improve these results still further are described. The members concerned are Electrabel of Belgium, Electrite de France and the Korea Electric Power Co. (UK)

  13. Faint Infrared-Excess Field Galaxies FROGs

    CERN Document Server

    Moustakas, L A; Zepf, S E; Bunker, A J

    1997-01-01

    Deep near-infrared and optical imaging surveys in the field reveal a curious population of galaxies that are infrared-bright (I-K>4), yet with relatively blue optical colors (V-I20, is high enough that if placed at z>1 as our models suggest, their space densities are about one-tenth of phi-*. The colors of these ``faint red outlier galaxies'' (fROGs) may derive from exceedingly old underlying stellar populations, a dust-embedded starburst or AGN, or a combination thereof. Determining the nature of these fROGs, and their relation with the I-K>6 ``extremely red objects,'' has implications for our understanding of the processes that give rise to infrared-excess galaxies in general. We report on an ongoing study of several targets with HST & Keck imaging and Keck/LRIS multislit spectroscopy.

  14. Vocal competition in male Xenopus laevis frogs

    OpenAIRE

    Tobias, Martha L.; Corke, Anna; Korsh, Jeremy; Yin, David; Kelley, Darcy B.

    2010-01-01

    Male Xenopus laevis frogs produce underwater advertisement calls that attract gravid females and suppress calling by male competitors. Here we explore whether groups of males establish vocal ranks and whether auditory cues alone suffice for vocal suppression. Tests of male–male pairs within assigned groups reveal linear vocal dominance relations, in which each male has a defined rank. Both the duration over which males interact, as well as the number of competitive opportunities, affect linea...

  15. Biogeographic patterns of Colombian frogs and toads

    International Nuclear Information System (INIS)

    Using the data provided in Ruiz-Carranza et al. (1996) the distributions of the 540 species of frogs and toads are partitioned among ten ecogeographic units of Colombia defined on the basis of precipitation and elevation. Some lowlands areas (pacific lowlands, Amazonian) exhibit high diversity (85-94 species) but lowlands areas in general are impoverished (30-52 species), especially when contrasted with upland areas. The three Andean cordilleras harbor between 87 and 121 species of frogs and toads, demonstrating that the biodiversity of Colombia resides primarily in its montane components, not in its lowland rain forests. When biological endemicity is separated from political endemicity, five areas of high endemicity remain (the three Andean cordilleras, the Sierra Nevada de Santa Marta, and the pacific lowlands). We endeavor to explain this description by recourse to cladistic analyses of several groups of leptodactylid frogs where we find that the general pattern of diversification is by means of horizontal diversification (allopatric speciation) with a minor contribution from vertical diversification

  16. Using a Phototransduction System to Monitor the Isolated Frog Heart

    Science.gov (United States)

    Stephens, Philip J.

    2015-01-01

    A simple and inexpensive method of monitoring the movement of an isolated frog heart provides comparable results to those obtained with a force transducer. A commercially available photoresistor is integrated into a Wheatstone bridge circuit, and the output signal is interfaced directly with a recording device. An excised, beating frog heart is…

  17. Coleman Revisited: School Segregation, Peers, and Frog Ponds

    Science.gov (United States)

    Goldsmith, Pat Rubio

    2011-01-01

    Students from minority segregated schools tend to achieve and attain less than similar students from White segregated schools. This study examines whether peer effects can explain this relationship using normative models and frog-pond models. Normative models (where peers become alike) suggest that minority schoolmates are a liability. Frog-pond…

  18. 49 CFR 213.355 - Frog guard rails and guard faces; gage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Frog guard rails and guard faces; gage. 213.355... Higher § 213.355 Frog guard rails and guard faces; gage. The guard check and guard face gages in frogs... distance between the gage line of a frog to the guard line 1 of its guard rail or guarding face,...

  19. California Air Basins

    Data.gov (United States)

    California Department of Resources — Air ResourcesCalifornia Air Resources BoardThe following datasets are from the California Air Resources Board: * arb_california_airbasins - California Air BasinsThe...

  20. Tongue adhesion in the horned frog Ceratophrys sp.

    Science.gov (United States)

    Kleinteich, Thomas; Gorb, Stanislav N.

    2014-06-01

    Frogs are well-known to capture elusive prey with their protrusible and adhesive tongues. However, the adhesive performance of frog tongues and the mechanism of the contact formation with the prey item remain unknown. Here we measured for the first time adhesive forces and tongue contact areas in living individuals of a horned frog (Ceratophrys sp.) against glass. We found that Ceratophrys sp. generates adhesive forces well beyond its own body weight. Surprisingly, we found that the tongues adhered stronger in feeding trials in which the coverage of the tongue contact area with mucus was relatively low. Thus, besides the presence of mucus, other features of the frog tongue (surface profile, material properties) are important to generate sufficient adhesive forces. Overall, the experimental data shows that frog tongues can be best compared to pressure sensitive adhesives (PSAs) that are of common technical use as adhesive tapes or labels.

  1. Biodiversity of frog haemoparasites from sub-tropical northern KwaZulu-Natal, South Africa

    OpenAIRE

    Netherlands, Edward C; Cook, Courtney A.; Donnavan J.D. Kruger; Du Preez, Louis H.; Smit, Nico J.

    2015-01-01

    Since South Africa boasts a high biodiversity of frog species, a multispecies haemoparasite survey was conducted by screening the blood from 29 species and 436 individual frogs. Frogs were collected at three localities in sub-tropical KwaZulu-Natal, a hotspot for frog diversity. Twenty per cent of the frogs were infected with at least one of five groups of parasites recorded. Intraerythrocytic parasites comprising Hepatozoon, Dactylosoma, and viral or bacterial organisms, as well as extracell...

  2. The Observation of Frog Species at State University of Malang as a Preliminary Effort on Frog Conservation

    Directory of Open Access Journals (Sweden)

    Dian Ratri Wulandari

    2013-04-01

    Full Text Available Frog is an amphibian which is widely spread around the world. Indonesia houses 450 species which represent 11% of frog species in the world. In Java Island alone, there live 42 species of frogs and toads. Frogs can be used as an environment indicator in that the presence of frog in a particular place indicates that the place stays natural and unpolluted. The 1st Campus of State University of Malang, which is located in the heart of Malang District, has been developing rapidly currently. Thus, it requires the construction of new various facilities to support its huge activities. Extensive construction can be destructive even damaging to the habitat of frog, which potentially threats the frog’s life, if it does not take the environmental impact into careful consideration. This study is aimed to identify the species of frog which survives at State University of Malang with, particularly the frog species found in 1995. Species identification was conducted by observing the morphological character. This study found that there were four species with three species remained survived in 1995; those were Duttaphrynus melanostictus, Polypedates leucomystax, and Kaloula baleta; and one new species called Rana chalconota. This study also revealed that there were four species which were extinct; those were Fejervarya cancrivora, Fejervarya limnocharis, Ingerophrynus biporcatus, and Occidoziga lima. This situation shows the decreasing amount of species from 7 to 4 within the last 17 years. This result indicates that there is a serious environmental degradation which causes the losing of frog habitats. Further research is needed to study the ecological condition changing in order to save the frog species.

  3. Frog community responses to recent American bullfrog invasions

    Institute of Scientific and Technical Information of China (English)

    Yiming LI; Zhunwei KE; Yihua WANG; Tim M. BLACKBURN

    2011-01-01

    Native species may decline quickly when confronted with an exotic species to which they are not adapted. The extent of decline may depend on the abundance of an invader and the length of time since it first arrived in the community (residence time), and the interaction between these two variables. We tested these effects using data on the effects of American bullfrog Lithobates catesbeianus invasion on native frog communities in 65 permanent lentic waters on islands in the Zhoushan Archipelago, China. We examined variation in native frog abundance and species richness in relation to features of the American bullfrog invasion, habitat disturbance, characteristics of the water body and fish communities and the presence of red swamp crayfish.Bullfrog invaded sites had lower native frog density and species richness, higher submerged vegetation cover and greater frequency of repairs to the water body than did non-invaded sites. The minimum adequate general linear mixed models showed that both native frog density and species richness were negatively related to post-metamorphosis bullfrog density, and that native frog species richness was also positively related to the vegetation cover. There was no effect on either native frog density or species richness of residence time or its interaction with bullfrog density, or of the abundance of bullfrog tadpoles. The results suggested that post-metamorphosis bullfrogs had impacts on native frog communities in the islands, and that the extents of these impacts are proportional to post-metamorphosis bullfrog density.

  4. Landing on branches in the frog Trachycephalus resinifictrix (Anura: Hylidae).

    Science.gov (United States)

    Bijma, Nienke N; Gorb, Stanislav N; Kleinteich, Thomas

    2016-04-01

    Frogs (Lissamphibia: Anura) are famous for their saltatory or hopping locomotion, which is related to numerous anatomical specialisations that are characteristic for the group. However, while the biomechanics of take-off in frogs have been studied in detail, much less is known on how frogs land after a jump. Besides terrestrial and aquatic species, several lineages of frogs adopted an arboreal lifestyle and especially the biomechanics of landing on challenging, small, and unpredictable substrates, such as leaves or branches, are virtually unknown. Here we studied the landing kinematics of the arboreal frog Trachycephalus resinifictrix (Hylidae) on a wooden stick that was used to mimic a small tree branch. We observed two different landing behaviours: (1) landing on the abdomen and (2) attachment with the toes of either the forelimb or the hindlimb. In the latter case, the frogs performed a cartwheel around the stick, while they were only attached by their adhesive toe pads. We estimated the forces that act on the toes during this behaviour to be up to fourteen times the body weight of the animals. This behaviour demonstrates the remarkable adhesive capabilities of the toe pads and the body control of the frogs.

  5. Pathophysiology in mountain yellow-legged frogs (Rana muscosa during a chytridiomycosis outbreak.

    Directory of Open Access Journals (Sweden)

    Jamie Voyles

    Full Text Available The disease chytridiomycosis is responsible for declines and extirpations of amphibians worldwide. Chytridiomycosis is caused by a fungal pathogen (Batrachochytrium dendrobatidis that infects amphibian skin. Although we have a basic understanding of the pathophysiology from laboratory experiments, many mechanistic details remain unresolved and it is unknown if disease development is similar in wild amphibian populations. To gain a better understanding of chytridiomycosis pathophysiology in wild amphibian populations, we collected blood biochemistry measurements during an outbreak in mountain yellow-legged frogs (Rana muscosa in the Sierra Nevada Mountains of California. We found that pathogen load is associated with disruptions in fluid and electrolyte balance, yet is not associated with fluctuations acid-base balance. These findings enhance our knowledge of the pathophysiology of this disease and indicate that disease development is consistent across multiple species and in both laboratory and natural conditions. We recommend integrating an understanding of chytridiomycosis pathophysiology with mitigation practices to improve amphibian conservation.

  6. Autometallographic tracing of mercury in frog liver

    International Nuclear Information System (INIS)

    The distribution of mercury in the liver of the frog Rana ridibunda with the autometallographic method was investigated. The mercury specific autometallographic (HgS/SeAMG) technique is a sensitive histochemical approach for tracing mercury in tissues from mercury-exposed organisms. Mercury accumulates in vivo as mercury sulphur/mercury selenium nanocrystals that can be silver-enhanced. Thus, only a fraction of the Hg can be visualized. Six animals were exposed for one day and another group of six animals for 6 days in 1 ppm mercury (as HgCI2 ) dissolved in fresh water. A third group of six animals, served as controls, were sacrificed the day of arrival at the laboratory. First, mercury appears in the blood plasma and erythrocytes. Next, mercury moves to hepatocytes and in the apical part of the cells, that facing bile canaliculi. In a next step, mercury appears in the endothelial and Kupffer cells. It seems likely that, the mercury of hepatocytes moves through bile canaliculi to the gut, most probably bound to glutathione and/or other similar ligands. Most probably, the endothelial and Kupffer cells comprise the first line of defense against metal toxicity. - Frogs can be good bioindicators of mercury

  7. Elastic modulus of tree frog adhesive toe pads

    OpenAIRE

    Barnes, W. Jon. P.; Goodwyn, Pablo J. Perez; Nokhbatolfoghahai, Mohsen; Gorb, Stanislav N.

    2011-01-01

    Previous work using an atomic force microscope in nanoindenter mode indicated that the outer, 10- to 15-μm thick, keratinised layer of tree frog toe pads has a modulus of elasticity equivalent to silicone rubber (5–15 MPa) (Scholz et al. 2009), but gave no information on the physical properties of deeper structures. In this study, micro-indentation is used to measure the stiffness of whole toe pads of the tree frog, Litoria caerulea. We show here that tree frog toe pads are amongst the softes...

  8. Coldwater NWR Malformed Frog Survey Data 2008-2010

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Data set contains information concerning surveys for malformed frog collections on Coldwater NWR and the Harris Tract, in MS from 20082010. Data were collected as...

  9. Frog: The fast and realistic OpenGL event displayer

    International Nuclear Information System (INIS)

    FROG is a generic framework dedicated to visualisation of events in high energy physics experiment. It is suitable to any particular physics experiment or detector design. The code is light (< 3 MB) and fast (browsing time ∼ 20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OpenGL and Glut libraries. Moreover, Frog does not require installation of heavy third party libraries for the visualisation. This documents describes the features and principles of Frog version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisation, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally the application of FROG for physic experiment/environement, such as Gastof, CMS, ILD, Delphes will be presented for illustration.

  10. FROG: The Fast And Realistic OpenGL Event Displayer

    CERN Document Server

    Quertenmont, Loic

    2009-01-01

    FROG [1] [2] is a generic framework dedicated to visualisation of events in high energy experiment. It is suitable to any particular physics experiment or detector design. The code is light (< 3 MB) and fast (browsing time 20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OPENGL [3] and GLUT [4] libraries. Moreover, FROG does not require installation of third party libraries for the visualisation. This documents describes the features and principles of FROG version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisation, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally the application of FROG for physic experiment/environement, such as Gastof, CMS, ILD, Delphes will be presented for illustration.

  11. Unscheduled DNA synthesis in frog lens at 50C

    International Nuclear Information System (INIS)

    Unscheduled DNA labeling occurs in the frog even at low temperatures. It is concluded tentatively that UV-induced labeling observed in cold incubated lenses represents repair synthesis of DNA. (author)

  12. 10 years of activities for the Framatome Owners Group (FROG)

    International Nuclear Information System (INIS)

    FROG (Framatome owners group) was created in 1991 by 5 electricity producers Electrabel (Belgium), EDF (France), ESKOM (South-Africa), GNPJVC (Daya bay China) and KEPCO (South-Korea), since then 2 other members joined the group Vattenfall (Sweden) and LANPC ( Ling-Ao China). All the members agree to share their experience in operating nuclear reactors designed by Framatome, FROG members represent more than 80 nuclear units. FROG wants to promote the exchange of information between its members in order to improve performances in a broad sense (safety, techniques, costs and management). The FROG committee opened its 20. meeting last year in Lyon (France), among the different topics that were discussed we have: -) a review of the main events that occurred in nuclear power plants, -) actions to reduce the stress on reactor staff, -) the shortening of downtimes, -) the comparison of production costs, and -) the in-line 3-dimensional monitoring of the nuclear core. (A.C.)

  13. Dahomey NWR Malformed Frog Survey Data 2003-2004

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Data set contains information concerning surveys for malformed frog collections on Dahomey NWR in MS from 2003-2004. Data were collected as part of the national...

  14. Final Critical Habitat for Oregon Spotted Frog (Rana pretiosa)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — These data identify, in general, the areas of FINAL critical habitat for Rana pretiosa (Oregon Spotted Frog). Maps published in the Federal Register 2016.

  15. Phosphonoacetic Acid Inhibition of Frog Virus 3 Replication

    OpenAIRE

    Elliott, R. M.; Bateson, A.; Kelly, D C

    1980-01-01

    Phosphonoacetic acid at concentrations above 200 μg/ml inhibited the replication of frog virus 3 in BHK cells. The inhibition of viral DNA replication observed in these cells was reversible and correlated with the inhibition of the virus-induced DNA polymerase activity in an in vitro assay. The synthesis of frog virus 3-induced late or γ polypeptides was also inhibited by phosphonoacetic acid, although the early (α and β) polypeptides were unaffected.

  16. Sophisticated Communication in the Brazilian Torrent Frog Hylodes japi

    OpenAIRE

    Fábio P de Sá; Juliana Zina; Célio F. B. Haddad

    2016-01-01

    Intraspecific communication in frogs plays an important role in the recognition of conspecifics in general and of potential rivals or mates in particular and therefore with relevant consequences for pre-zygotic reproductive isolation. We investigate intraspecific communication in Hylodes japi, an endemic Brazilian torrent frog with territorial males and an elaborate courtship behavior. We describe its repertoire of acoustic signals as well as one of the most complex repertoires of visual disp...

  17. A Method for Mechanism Analysis of Frog Swimming Based on Motion Observation Experiments

    OpenAIRE

    , Wei Zhang; Jizhuang Fan; Yanhe Zhu; Yulong Qiu; Jie Zhao

    2014-01-01

    For understanding the mechanism of frog swimming under water and designing a frog-inspired swimming robot, kinematics of the frog body and trajectories of joints should be obtained. In this paper, an aquatic frog, Xenopus laevis, was chosen for analysis of swimming motions which were recorded by a high speed camera, and kinematic data were processed in a swimming data extraction platform. According to the shape features of the frog, we propose a method that the frog eyes are set as the natura...

  18. Frogs Communicate by Means of Ultrasonic Sounds

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    @@ People are always fascinated by ways that some members of mammalian species (such as dolphins, bats and some rodents) communicate using sounds that we cannot hear. But think twice if you say the capacity of producing and detecting ultrasounds (frequencies greater than 20kHz) is limited to mammalians. A study implemented by Prof. SHEN Junxian from the CAS Institute of Biophysics (IBP) and colleagues in CAS and abroad showed that a rare frog species in China should also be added to that list. It is the first documented case of a non-mammalian species being able to use ultrasonic communication. Their work was reported in the March 16 issue of the journal Nature.

  19. Reproductive ecology of Sichuan digging frogs (Microhylidae: Kaloula rugifera

    Directory of Open Access Journals (Sweden)

    Wei Chen

    2015-06-01

    Full Text Available Abstract. We investigated the reproductive ecology of Sichuan digging frogs (Microhylidae: Kaloula rugifera in Mianyang, China during the wet season of 2013. Male Sichuan digging frogs first appear at temporary ponds following the first heavy rain of the wet season and initiate calling. Females arrive at ponds shortly after males. Male frogs chorus extensively throughout the wet season during the evenings and nights following rainstorms. Female frogs leave the pond after laying eggs, and likely only lay one clutch annually. Amplexus lasted up to three hours. Females were larger than males in terms of body size, but we found no evidence of size-assortative mating. Clutch size varied from 920 to 2200 eggs, with egg diameter ranging from 1.33 to 1.93 mm. Larger female frogs laid more eggs, and there was no correlation between egg number and egg size. Tadpoles hatched from eggs within 18-20 hours of oviposition, and grew for 30-40 days before complete metamorphosis occurred. The initial body length of tadpoles ranged from 3-5 mm snout-vent length. Growth was fastest immediately after hatching, and declined asymptotically with increasing tadpole body size. Overall, Sichuan digging frogs have a breeding biology characterized by strong male-male competition with prolonged breeding coinciding with the annual wet season. Keywords. Breeding ecology; Kaloula rugifera; life history; mating system

  20. Plasticity of Peripheral Auditory Frequency Sensitivity in Emei Music Frog

    Science.gov (United States)

    Zhang, Dian; Cui, Jianguo; Tang, Yezhong

    2012-01-01

    In anurans reproductive behavior is strongly seasonal. During the spring, frogs emerge from hibernation and males vocalize for mating or advertising territories. Female frogs have the ability to evaluate the quality of the males' resources on the basis of these vocalizations. Although studies revealed that central single torus semicircularis neurons in frogs exhibit season plasticity, the plasticity of peripheral auditory sensitivity in frog is unknown. In this study the seasonally plasticity of peripheral auditory sensitivity was test in the Emei music frog Babina daunchina, by comparing thresholds and latencies of auditory brainstem responses (ABRs) evoked by tone pips and clicks in the reproductive and non-reproductive seasons. The results show that both ABR thresholds and latency differ significantly between the reproductive and non-reproductive seasons. The thresholds of tone pip evoked ABRs in the non-reproductive season increased significantly about 10 dB than those in the reproductive season for frequencies from 1 KHz to 6 KHz. ABR latencies to waveform valley values for tone pips for the same frequencies using appropriate threshold stimulus levels are longer than those in the reproductive season for frequencies from 1.5 to 6 KHz range, although from 0.2 to 1.5 KHz range it is shorter in the non-reproductive season. These results demonstrated that peripheral auditory frequency sensitivity exhibits seasonal plasticity changes which may be adaptive to seasonal reproductive behavior in frogs. PMID:23029243

  1. Is chytridiomycosis driving Darwin's frogs to extinction?

    Directory of Open Access Journals (Sweden)

    Claudio Soto-Azat

    Full Text Available Darwin's frogs (Rhinoderma darwinii and R. rufum are two species of mouth brooding frogs from Chile and Argentina that have experienced marked population declines. Rhinoderma rufum has not been found in the wild since 1980. We investigated historical and current evidence of Batrachochytrium dendrobatidis (Bd infection in Rhinoderma spp. to determine whether chytridiomycosis is implicated in the population declines of these species. Archived and live specimens of Rhinoderma spp., sympatric amphibians and amphibians at sites where Rhinoderma sp. had recently gone extinct were examined for Bd infection using quantitative real-time PCR. Six (0.9% of 662 archived anurans tested positive for Bd (4/289 R. darwinii; 1/266 R. rufum and 1/107 other anurans, all of which had been collected between 1970 and 1978. An overall Bd-infection prevalence of 12.5% was obtained from 797 swabs taken from 369 extant individuals of R. darwinii and 428 individuals representing 18 other species of anurans found at sites with current and recent presence of the two Rhinoderma species. In extant R. darwinii, Bd-infection prevalence (1.9% was significantly lower than that found in other anurans (7.3%. The prevalence of infection (30% in other amphibian species was significantly higher in sites where either Rhinoderma spp. had become extinct or was experiencing severe population declines than in sites where there had been no apparent decline (3.0%; x(2 = 106.407, P<0.001. This is the first report of widespread Bd presence in Chile and our results are consistent with Rhinoderma spp. declines being due to Bd infection, although additional field and laboratory investigations are required to investigate this further.

  2. Frog Foam Nest Protein Diversity and Synthesis.

    Science.gov (United States)

    Hissa, Denise Cavalcante; Bezerra, Walderly Melgaço; Freitas, Cléverson Diniz Teixeira De; Ramos, Márcio Viana; Lopes, José Luiz De Souza; Beltramini, Leila Maria; Roberto, Igor Joventino; Cascon, Paulo; Melo, Vânia Maria Maciel

    2016-08-01

    Some amphibian species have developed a breeding strategy in which they deposit their eggs in stable foam nests to protect their eggs and larvae. The frog foam nests are rich in proteins (ranaspumin), especially surfactant proteins, involved in the production of the foam nest. Despite the ecological importance of the foam nests for evolution and species conservation, the biochemical composition, the long-term stability and even the origin of the components are still not completely understood. Recently we showed that Lv-RSN-1, a 23.5-kDa surfactant protein isolated from the nest of the frog Leptodacylus vastus, presents a structural conformation distinct from any protein structures yet reported. So, in the current study we aimed to reveal the protein composition of the foam nest of L. vastus and further characterize the Lv-RSN-1. Proteomic analysis showed the foam nest contains more than 100 of proteins, and that Lv-RSN-1 comprises 45% of the total proteins, suggesting a key role in the nest construction and stability. We demonstrated by Western blotting that Lv-RSN-1 is mainly produced only by the female in the pars convoluta dilata, which highlights the importance of the female preservation for conservation of species that depend on the production of foam nests in the early stages of development. Overall, our results showed the foam nest of L. vastus is composed of a great diversity of proteins and that besides Lv-RSN-1, the main protein in the foam, other proteins must have a coadjuvant role in building and stability of the nest. PMID:27460953

  3. Flesh fly myiasis (Diptera, Sarcophagidae) in Peruvian poison frogs genus Epipedobates (Anura, Dendrobatidae)

    OpenAIRE

    Mattias Hagman; Thomas Pape; Rainer Schulte

    2005-01-01

    In this note we review records of myiasis in poison frogs collected in various locations in Peru during 1982-2005 and present evidence that larger and medium-sized poison frogs (Epipedobates) are infected with sarcophagid fly larvae.

  4. Prostaglandin E2 release from dermis regulates sodium permeability of frog skin epithelium

    DEFF Research Database (Denmark)

    Rytved, Klaus A.; Brodin, Birger; Nielsen, Robert

    1995-01-01

    Arachidonic acid, cAMP, epithelium, frog skin, intracellular calcium, prostaglandin E*U2, sodium transport, tight epithelium.......Arachidonic acid, cAMP, epithelium, frog skin, intracellular calcium, prostaglandin E*U2, sodium transport, tight epithelium....

  5. Resurrecting an Extinct Species: Archival DNA, Taxonomy, and Conservation of the Vegas Valley Leopard Frog

    Science.gov (United States)

    Suggestions that the extinct Vegas Valley leopard frog (Rana fisheri = Lithobates fisheri) may have been synonymous with one of several declining species has complicated recovery planning for imperiled leopard frogs in southwestern North America. To address this concern, we recon...

  6. Panamanian frog species host unique skin bacterial communities

    Directory of Open Access Journals (Sweden)

    Lisa K. Belden

    2015-10-01

    Full Text Available Vertebrates, including amphibians, host diverse symbiotic microbes that contribute to host disease resistance. Globally, and especially in montane tropical systems, many amphibian species are threatened by a chytrid fungus, Batrachochytrium dendrobatidis (Bd, that causes a lethal skin disease. Bd therefore may be a strong selective agent on the diversity and function of the microbial communities inhabiting amphibian skin. In Panamá, amphibian population declines and the spread of Bd have been tracked. In 2012, we completed a field survey in Panamá to examine frog skin microbiota in the context of Bd infection. We focused on three frog species and collected two skin swabs per frog from a total of 136 frogs across four sites that varied from west to east in the time since Bd arrival. One swab was used to assess bacterial community structure using 16S rRNA amplicon sequencing and to determine Bd infection status, and one was used to assess metabolite diversity, as the bacterial production of anti-fungal metabolites is an important disease resistance function. The skin microbiota of the three Panamanian frog species differed in OTU (operational taxonomic unit, ~bacterial species community composition and metabolite profiles, although the pattern was less strong for the metabolites. Comparisons between frog skin bacterial communities from Panamá and the US suggest broad similarities at the phylum level, but key differences at lower taxonomic levels. In our field survey in Panamá, across all four sites, only 35 individuals (~26% were Bd infected. There was no clustering of OTUs or metabolite profiles based on Bd infection status and no clear pattern of west-east changes in OTUs or metabolite profiles across the four sites. Overall, our field survey data suggest that different bacterial communities might be producing broadly similar sets of metabolites across frog hosts and sites. Community structure and function may not be as tightly coupled in

  7. Evaluation of Antimicrobial and Healing Activities of Frog Skin on Guinea Pigs Wounds

    OpenAIRE

    2015-01-01

    Background: Frog skin secretions have potentials against a wide spectrum of bacteria. Also, frog skin compositions have healing properties. Objectives: The aim of this study was to investigate the antibacterial potentials along with healing properties of frog skin Rana ridibunda, a species which thoroughly lives in Iran marshes, as a biological dressing on wounds. Materials and Methods: In this study, excisional wounds, dressed with frog skin, were compared between experimental and control gr...

  8. The first see-through frog created by breeding: description, inheritance patterns, and dermal chromatophore structure

    OpenAIRE

    Masayuki Sumida; Mohammed Mafizul Islam; Takeshi Igawa; Atsushi Kurabayashi; Yukari Furukawa; Naomi Sano; Tamotsu Fujii; Norio Yoshizaki

    2016-01-01

    We have succeeded in creating see-through frogs from natural color mutants of the Japanese brown frog Rana japonica, which usually possesses an ochre or brown back; this coloration enables the organs, blood vessels, and eggs to be observed through the skin without performing dissection. We crossed two kinds of recessive color mutant (black-eyed and gray-eyed) frogs through artificial insemination, and F2 offspring produced frogs whose skin is translucent throughout the life cycle. Three kinds...

  9. Reproductive ecology of Sichuan digging frogs (Microhylidae: Kaloula rugifera)

    OpenAIRE

    Wei Chen; Lina Ren; Dujuan He; Ying Wang; David Pike

    2015-01-01

    Abstract. We investigated the reproductive ecology of Sichuan digging frogs (Microhylidae: Kaloula rugifera) in Mianyang, China during the wet season of 2013. Male Sichuan digging frogs first appear at temporary ponds following the first heavy rain of the wet season and initiate calling. Females arrive at ponds shortly after males. Male frogs chorus extensively throughout the wet season during the evenings and nights following rainstorms. Female frogs leave the pond after laying eggs, and lik...

  10. Specialist or generalist? Feeding ecology of the Malagasy poison frog Mantella aurantiaca

    OpenAIRE

    Woodhead, Cindy; Vences, Miguel; Vieites, David R.; Gamboni, Ilona; Brian L Fisher; Griffiths, Richard A.

    2007-01-01

    We studied the diet of a population of free-ranging Mantella aurantiaca, an alkaloid-containing poison frog from Madagascar. As in other poison frogs, this species is thought to sequester alkaloids from arthropod prey. Among prey, mites and ants are known to regularly contain alkaloids and mites appear to be a major source of dietary alkaloids in poison frogs. We predicted that mites and ants would constitute the most important prey item for these frogs. Prey inventories were obtained during ...

  11. Sierra Nevada Yellow-legged Frog Range - CWHR [ds592

    Data.gov (United States)

    California Department of Resources — Vector datasets of CWHR range maps are one component of California Wildlife Habitat Relationships (CWHR), a comprehensive information system and predictive model...

  12. Foothill Yellow-legged Frog Range - CWHR [ds589

    Data.gov (United States)

    California Department of Resources — Vector datasets of CWHR range maps are one component of California Wildlife Habitat Relationships (CWHR), a comprehensive information system and predictive model...

  13. Sierra Madre Yellow-legged Frog Range - CWHR [ds613

    Data.gov (United States)

    California Department of Resources — Vector datasets of CWHR range maps are one component of California Wildlife Habitat Relationships (CWHR), a comprehensive information system and predictive model...

  14. 49 CFR 213.143 - Frog guard rails and guard faces; gage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Frog guard rails and guard faces; gage. 213.143... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.143 Frog guard rails and guard faces; gage. The guard check and guard face gages in frogs shall be within the...

  15. 49 CFR 236.327 - Switch, movable-point frog or split-point derail.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Switch, movable-point frog or split-point derail..., AND APPLIANCES Interlocking Rules and Instructions § 236.327 Switch, movable-point frog or split-point derail. Switch, movable-point frog, or split-point derail equipped with lock rod shall be maintained...

  16. 75 FR 8733 - Least Chub and Columbia Spotted Frog Candidate Conservation Agreement With Assurances; Receipt of...

    Science.gov (United States)

    2010-02-25

    ... Fish and Wildlife Service Least Chub and Columbia Spotted Frog Candidate Conservation Agreement With... (CCAA) for the least chub (Iotichthys phlegethontis) and Columbia spotted frog (Rana lutreiventris..., least chub and Columbia spotted frog inhabited a variety of aquatic habitat types throughout...

  17. Radioimmunoassay of plasma corticotropin in the edible Frog Rana esculenta L

    International Nuclear Information System (INIS)

    In the green Frog (Rana esculenta) the plasma contains a polypeptide immunologically related to human and porcine corticotropins. A radioimmunoassay capable of detecting 4.10-12 g hog ACTH has been used for a direct plasma ACTH assay in the Frog. Using this method the ACTH rate was determined both in untreated frogs and in animals under various experimental conditions

  18. The biology, economy, hunting and legislation of edible Frogs (Ranidae Intended for Export in Turkey

    Directory of Open Access Journals (Sweden)

    Hülya Şereflişan

    2016-07-01

    Full Text Available The frogs production is done on the basis of fully hunting, an important export product in Turkey. The frogs are almost no domestic consumption. The frogs are exported to France, Italy, Switzerland, Lebanon, Greece and Spain by five companies a processed form as live frog, frozen frog legs and chilled frog legs. In Turkey, some regulations related to hunting frogs and exports are prepared by under the Ministry of Agriculture and Rural Affairs General Directorate of Protection and Control. The hunting frogs is banned by 3/1 the Commercial Fisheries regulating the hunting notification. These prohibitions are designed to be different for each province. The provinces are permitted for frogs hunting by the legislation in Adana, Afyonkarahisar, Balıkesir, Bingöl, Bursa, Edirne, Bursa, Istanbul and Yalova. Frogs were exported in different amounts (kg with different price in every year during the last ten years. The highest amounts of the frogs with the lowest of price were exported in 2013. Prey weight is shrinking due to overfishing. In this case, the price of export materials has got significantly negative effects. As a result, the ban on hunting and restrictive measures for protection should be taken seriously in some of the provinces. Hunting ban is absolutely necessary in Turkey. In many countries including Turkey, in order to ensure sustainability, it is important to do the frog breeding.

  19. The Funeral of Froggy the Frog: The Child as Dramatist, Designer, and Realist

    Science.gov (United States)

    Cummins, Lauren

    2004-01-01

    One sunny afternoon, six-year-old Zachary and his friend John Michael, four and a half, discovered a dead frog in a bag of clay in the garage. Zachary proposed, "Let's have a funeral for the frog." This is how the funeral drama of Froggy the Frog began. This article describes the play experiences of Zachary and John Michael as designers,…

  20. Tourism and the conservation of critically endangered frogs.

    Directory of Open Access Journals (Sweden)

    Clare Morrison

    Full Text Available Protected areas are critical for the conservation of many threatened species. Despite this, many protected areas are acutely underfunded, which reduces their effectiveness significantly. Tourism is one mechanism to promote and fund conservation in protected areas, but there are few studies analyzing its tangible conservation outcomes for threatened species. This study uses the 415 IUCN critically endangered frog species to evaluate the contribution of protected area tourism revenue to conservation. Contributions were calculated for each species as the proportion of geographic range inside protected areas multiplied by the proportion of protected area revenues derived from tourism. Geographic ranges were determined from IUCN Extent of Occurrence maps. Almost 60% (239 of critically endangered frog species occur in protected areas. Higher proportions of total range are protected in Nearctic, Australasian and Afrotopical regions. Tourism contributions to protected area budgets ranged from 5-100%. These financial contributions are highest for developing countries in the Afrotropical, Indomalayan and Neotropical regions. Data for both geographic range and budget are available for 201 critically endangered frog species with proportional contributions from tourism to species protection ranging from 0.8-99%. Tourism's financial contributions to critically endangered frog species protection are highest in the Afrotropical region. This study uses a coarse measure but at the global scale it demonstrates that tourism has significant potential to contribute to global frog conservation efforts.

  1. Sophisticated Communication in the Brazilian Torrent Frog Hylodes japi.

    Science.gov (United States)

    de Sá, Fábio P; Zina, Juliana; Haddad, Célio F B

    2016-01-01

    Intraspecific communication in frogs plays an important role in the recognition of conspecifics in general and of potential rivals or mates in particular and therefore with relevant consequences for pre-zygotic reproductive isolation. We investigate intraspecific communication in Hylodes japi, an endemic Brazilian torrent frog with territorial males and an elaborate courtship behavior. We describe its repertoire of acoustic signals as well as one of the most complex repertoires of visual displays known in anurans, including five new visual displays. Previously unknown in frogs, we also describe a bimodal inter-sexual communication system where the female stimulates the male to emit a courtship call. As another novelty for frogs, we show that in addition to choosing which limb to signal with, males choose which of their two vocal sacs will be used for visual signaling. We explain how and why this is accomplished. Control of inflation also provides additional evidence that vocal sac movement and color must be important for visual communication, even while producing sound. Through the current knowledge on visual signaling in Neotropical torrent frogs (i.e. hylodids), we discuss and highlight the behavioral diversity in the family Hylodidae. Our findings indicate that communication in species of Hylodes is undoubtedly more sophisticated than we expected and that visual communication in anurans is more widespread than previously thought. This is especially true in tropical regions, most likely due to the higher number of species and phylogenetic groups and/or to ecological factors, such as higher microhabitat diversity.

  2. Occurrence and Distribution of Cave Dwelling Frogs of Peninsular India

    Directory of Open Access Journals (Sweden)

    Jayant Biswas

    2014-10-01

    Full Text Available The life in subterranean caves always needs a high degree of biological adaptability, due to its unusual ecosystem. The cave dwelling species usually get selected from preadapted biological traits for cave life. The cave dwelling tendencies in frog are very uncommon. Majority of reported cave frogs usually prefer cave for temporary shelter. In India, the biospeleological inventory is still in its primary stage. Till date no serious attempt has been taken to understand the cave dwelling habitat for any frog in India. Inspite of it, in India time to time various reports on natural histories of anurans reveal its cave dwelling tendencies. On the basis of personal observations and available literature in this report I have documented the occurrences and distributions of five cave dwelling frogs of India. Common biological traits from all the established cave frogs, which could be referred as preadapted for cave life, have been discussed. Further, the possible threats and IUCN status of each discussed species has been highlighted.

  3. Sophisticated Communication in the Brazilian Torrent Frog Hylodes japi.

    Directory of Open Access Journals (Sweden)

    Fábio P de Sá

    Full Text Available Intraspecific communication in frogs plays an important role in the recognition of conspecifics in general and of potential rivals or mates in particular and therefore with relevant consequences for pre-zygotic reproductive isolation. We investigate intraspecific communication in Hylodes japi, an endemic Brazilian torrent frog with territorial males and an elaborate courtship behavior. We describe its repertoire of acoustic signals as well as one of the most complex repertoires of visual displays known in anurans, including five new visual displays. Previously unknown in frogs, we also describe a bimodal inter-sexual communication system where the female stimulates the male to emit a courtship call. As another novelty for frogs, we show that in addition to choosing which limb to signal with, males choose which of their two vocal sacs will be used for visual signaling. We explain how and why this is accomplished. Control of inflation also provides additional evidence that vocal sac movement and color must be important for visual communication, even while producing sound. Through the current knowledge on visual signaling in Neotropical torrent frogs (i.e. hylodids, we discuss and highlight the behavioral diversity in the family Hylodidae. Our findings indicate that communication in species of Hylodes is undoubtedly more sophisticated than we expected and that visual communication in anurans is more widespread than previously thought. This is especially true in tropical regions, most likely due to the higher number of species and phylogenetic groups and/or to ecological factors, such as higher microhabitat diversity.

  4. Biological Jumping Mechanism Analysis and Modeling for Frog Robot

    Institute of Scientific and Technical Information of China (English)

    Meng Wang; Xi-zhe Zang; Ji-zhuang Fan; Jie Zhao

    2008-01-01

    This paper presents a mechanical model of jumping robot based on the biological mechanism analysis of frog. By biological observation and kinematic analysis the frog jump is divided into take-off phase, aerial phase and landing phase. We find the similar trajectories of hindlimb joints during jump, the important effect of foot during take-off and the role of forelimb in supporting the body. Based on the observation, the frog jump is simplified and a mechanical model is put forward. The robot leg is represented by a 4-bar spring/linkage mechanism model, which has three Degrees of Freedom (DOF) at hip joint and one DOF (passive) at tarsometatarsal joint on the foot. The shoulder and elbow joints each has one DOF for the balancing function of arm.The ground reaction force of the model is analyzed and compared with that of frog during take-off. The results show that the model has the same advantages of low likelihood of premature lift-off and high efficiency as the frog. Analysis results and the model can be employed to develop and control a robot capable of mimicking the jumping behavior of flog.

  5. Tourism and the Conservation of Critically Endangered Frogs

    Science.gov (United States)

    Morrison, Clare; Simpkins, Clay; Castley, J. Guy; Buckley, Ralf C.

    2012-01-01

    Protected areas are critical for the conservation of many threatened species. Despite this, many protected areas are acutely underfunded, which reduces their effectiveness significantly. Tourism is one mechanism to promote and fund conservation in protected areas, but there are few studies analyzing its tangible conservation outcomes for threatened species. This study uses the 415 IUCN critically endangered frog species to evaluate the contribution of protected area tourism revenue to conservation. Contributions were calculated for each species as the proportion of geographic range inside protected areas multiplied by the proportion of protected area revenues derived from tourism. Geographic ranges were determined from IUCN Extent of Occurrence maps. Almost 60% (239) of critically endangered frog species occur in protected areas. Higher proportions of total range are protected in Nearctic, Australasian and Afrotopical regions. Tourism contributions to protected area budgets ranged from 5–100%. These financial contributions are highest for developing countries in the Afrotropical, Indomalayan and Neotropical regions. Data for both geographic range and budget are available for 201 critically endangered frog species with proportional contributions from tourism to species protection ranging from 0.8–99%. Tourism's financial contributions to critically endangered frog species protection are highest in the Afrotropical region. This study uses a coarse measure but at the global scale it demonstrates that tourism has significant potential to contribute to global frog conservation efforts. PMID:22984440

  6. Sophisticated Communication in the Brazilian Torrent Frog Hylodes japi

    Science.gov (United States)

    de Sá, Fábio P.; Zina, Juliana; Haddad, Célio F. B.

    2016-01-01

    Intraspecific communication in frogs plays an important role in the recognition of conspecifics in general and of potential rivals or mates in particular and therefore with relevant consequences for pre-zygotic reproductive isolation. We investigate intraspecific communication in Hylodes japi, an endemic Brazilian torrent frog with territorial males and an elaborate courtship behavior. We describe its repertoire of acoustic signals as well as one of the most complex repertoires of visual displays known in anurans, including five new visual displays. Previously unknown in frogs, we also describe a bimodal inter-sexual communication system where the female stimulates the male to emit a courtship call. As another novelty for frogs, we show that in addition to choosing which limb to signal with, males choose which of their two vocal sacs will be used for visual signaling. We explain how and why this is accomplished. Control of inflation also provides additional evidence that vocal sac movement and color must be important for visual communication, even while producing sound. Through the current knowledge on visual signaling in Neotropical torrent frogs (i.e. hylodids), we discuss and highlight the behavioral diversity in the family Hylodidae. Our findings indicate that communication in species of Hylodes is undoubtedly more sophisticated than we expected and that visual communication in anurans is more widespread than previously thought. This is especially true in tropical regions, most likely due to the higher number of species and phylogenetic groups and/or to ecological factors, such as higher microhabitat diversity. PMID:26760304

  7. Vocal competition in male Xenopus laevis frogs.

    Science.gov (United States)

    Tobias, Martha L; Corke, Anna; Korsh, Jeremy; Yin, David; Kelley, Darcy B

    2010-11-01

    Male Xenopus laevis frogs produce underwater advertisement calls that attract gravid females and suppress calling by male competitors. Here we explore whether groups of males establish vocal ranks and whether auditory cues alone suffice for vocal suppression. Tests of male-male pairs within assigned groups reveal linear vocal dominance relations, in which each male has a defined rank. Both the duration over which males interact, as well as the number of competitive opportunities, affect linearity. Linear dominance across the group is stable for about 2 weeks; rank is dynamic. Males engage in physical interactions (clasping) while paired but clasping and vocal rank are not correlated. Playbacks of advertisement calls suppress calling and calls from high- and low-ranking males are equally effective. Thus, auditory cues alone suffice to suppress vocal behavior. Playback intensities equivalent to a nearby male advertising effectively suppress calling while low-intensity playbacks are either ineffective or stimulate vocal behavior. X. laevis advertisement calls are biphasic, composed of alternating fast and slow click trills. Approximately half the males tested are more vocally suppressed by all slow than by all fast trills; thus, these males can distinguish between the two phases. The fully aquatic family Pipidae diverged from terrestrial ancestors approximately 170 mya. Vocal suppression in the X. laevis mating system may represent the translation of an ancient anuran social strategy to underwater life. PMID:21442049

  8. Feeding kinematics of phyllomedusine tree frogs.

    Science.gov (United States)

    Gray, L A; Nishikawa, K C

    1995-02-01

    Previous studies have demonstrated that the phyllomedusine hylids possess highly protrusible tongues, a derived characteristic within the family Hylidae. In the present study, the kinematics of the feeding behavior of a phyllomedusine species, Pachymedusa dacnicolor, was analyzed using high-speed video (180 frames s-1). Its behavior was compared with that of Hyla cinerea, a species with a weakly protrusible tongue. P. dacnicolor exhibits a faster rate of tongue protraction, a longer gape cycle and more variable feeding kinematics than H. cinerea. In addition, the tongue is used in a unique 'fly-swatter' fashion, to pin the prey to the substratum as the frog completes the lunge. The rapid tongue protraction, extended gape cycle and fly-swatter action may have evolved in response to a diet of large, rapidly moving insects. In addition, several duration variables of the feeding cycle were greater for misses than for captures and drops, which suggests that sensory feedback rather than biomechanics controls gape cycle duration.

  9. Sticking under wet conditions: the remarkable attachment abilities of the torrent frog, Staurois guttatus.

    Directory of Open Access Journals (Sweden)

    Thomas Endlein

    Full Text Available Tree frogs climb smooth surfaces utilising capillary forces arising from an air-fluid interface around their toe pads, whereas torrent frogs are able to climb in wet environments near waterfalls where the integrity of the meniscus is at risk. This study compares the adhesive capabilities of a torrent frog to a tree frog, investigating possible adaptations for adhesion under wet conditions. We challenged both frog species to cling to a platform which could be tilted from the horizontal to an upside-down orientation, testing the frogs on different levels of roughness and water flow. On dry, smooth surfaces, both frog species stayed attached to overhanging slopes equally well. In contrast, under both low and high flow rate conditions, the torrent frogs performed significantly better, even adhering under conditions where their toe pads were submerged in water, abolishing the meniscus that underlies capillarity. Using a transparent platform where areas of contact are illuminated, we measured the contact area of frogs during platform rotation under dry conditions. Both frog species not only used the contact area of their pads to adhere, but also large parts of their belly and thigh skin. In the tree frogs, the belly and thighs often detached on steeper slopes, whereas the torrent frogs increased the use of these areas as the slope angle increased. Probing small areas of the different skin parts with a force transducer revealed that forces declined significantly in wet conditions, with only minor differences between the frog species. The superior abilities of the torrent frogs were thus due to the large contact area they used on steep, overhanging surfaces. SEM images revealed slightly elongated cells in the periphery of the toe pads in the torrent frogs, with straightened channels in between them which could facilitate drainage of excess fluid underneath the pad.

  10. Prevalence and intensity of Alaria alata (Goeze, 1792) in water frogs and brown frogs in natural conditions.

    Science.gov (United States)

    Patrelle, Cécile; Portier, Julien; Jouet, Damien; Delorme, Daniel; Ferté, Hubert

    2015-12-01

    In the last 15 years, the mesocercariae of Alaria alata have frequently been reported in the wild boar during routine Trichinella inspections made compulsory for the trade of venison meat in Europe. If these studies have focused primarily on mesocercariae isolated from meat, few works have been done so far to understand the circulation of the parasite in natural conditions especially in the intermediate hosts. This study focuses on the second intermediate hosts of this parasite assessing the suitability of two amphibian groups-brown frogs and water frogs sensu lato-for mesocercarial infection on an area where A. alata has already been identified in water snails and wild boars. During this study, both groups showed to be suitable for mesocercarial infection, with high prevalence and parasite burdens. Prevalence was higher in the brown frog group (56.9 versus 11.54 % for water frogs) which would indicate that it is a preferential group for infection on the study area, though reasons for this remain to be investigated. No significant difference among prevalences was observed between tadpoles and frogs. This study, the first focusing on A. alata in these amphibians in Europe, provides further information on circulation of this parasite in natura. PMID:26319522

  11. Voxel-based frog phantom for internal dose evaluation

    International Nuclear Information System (INIS)

    A voxel-based frog phantom has been developed for radiation protection of the environment. The voxel-based frog phantom was applied to evaluating self-absorbed fractions (self-AFs), which are defined as the fraction of energy emitted by a radiation source that is absorbed within the source organ. The self-AFs were evaluated for both photons and electrons in the spleen, kidneys, and liver using Monte Carlo simulations. Furthermore, self-S values (μGy/MBq·s) for 18F and 90Y in the organs were calculated using the results of the self-AFs. Consequently, the voxel-based frog phantom was found to be useful for the organ dose evaluations, which have not been proposed by the International Commission on Radiological Protection (ICRP). It was also confirmed that the self-AFs and self-S values are largely dependent on the mass of the source organ. (author)

  12. Radiation processing for the control of Salmonella in frog legs

    International Nuclear Information System (INIS)

    Large consignments of frogs legs are exported annually from India. Failure to satisfy some of the strict microbiological standards, especially in relating to Salmonellae contamination, has resulted in the rejection of large quantities of the product in recent years. This has emphasised the need for better and more effective methods than those currently in use for the elimination of Salmonellae. With a view to developing an irradiation process for the control of this public health problem, commercial samples of frog legs have been screened to assess the incidence of Salmonella. The various serotypes have been identified and their radiation sensitivities determined. Based on these data, a radiation treatment of frozen frog legs for the elimination of Salmonella has been developed. (author)

  13. Frog: The Fast & Realistic OpenGL Event Displayer

    CERN Document Server

    Quertenmont, Loic

    2009-01-01

    FROG [1] is a generic framework dedicated to visualisation of events in high energy experiment. It is suitable for any particular physics experiment or detector design. The code is light ($<3~\\textrm{MB}$) and fast (browsing time $\\sim20$ events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OpenGL[2] and GLUT [3] libraries. Moreover, \\textsc{Frog} does not require installation of third party libraries for the visualisation. This documents describes the features and principles of FROG version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisation, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally, several examples of its current applications are presented for illustration.

  14. ’He descended legs-upwards‘: Position and motion in Tzeltal frog stories

    OpenAIRE

    P Brown

    2000-01-01

    How are events framed in narrative? Speakers of English (a 'satellite-framed' language), when 'reading' Mercer Mayer's wordless picture book 'Frog, Where Are You?', find the story self-evident: a boy has a dog and a pet frog; the frog escapes and runs away; the boy and dog look for it across hill and dale, through woods and over a cliff, until they find it and return home with a baby frog child of the original pet frog. In Tzeltal, as spoken in a Mayan community in southern Mexico, the story ...

  15. Position and motion in Tzeltal frog stories: The acquisition of narrative style

    OpenAIRE

    P Brown

    2004-01-01

    How are events framed in narrative? Speakers of English (a 'satellite-framed' language), when 'reading' Mercer Mayer's wordless picture book 'Frog, Where Are You?', find the story self-evident: a boy has a dog and a pet frog; the frog escapes and runs away; the boy and dog look for it across hill and dale, through woods and over a cliff, until they find it and return home with a baby frog child of the original pet frog. In Tzeltal, as spoken in a Mayan community in southern Mexico, the story ...

  16. California Political Districts

    Data.gov (United States)

    California Department of Resources — This is a series of district layers pertaining to California'spolitical districts, that are derived from the California State Senateand State Assembly information....

  17. Effect of ionizing radiation on cell death in frog spleen

    International Nuclear Information System (INIS)

    It was studied the number of dead cells in frog spleen by means of coloration with trypan blue which allowed to estimate last stage of apoptosis dead of cells.The investigated frogs (Rana arvalis) were caught in september 1997 at radionuclide contamination territory (the Gomel Region, the Khojniki District). Control animals were caught in village Ratamka of the Minsk District. The percent of dead cells was less in control group in 1,5 times. Under additional irradiation (2 Gy) the number of dead cells in spleen also differs significantly in the investigated and control groups

  18. Host Defense Peptides from Asian Frogs as Potential Clinical Therapies

    Directory of Open Access Journals (Sweden)

    Vineeth T.V. Kumar

    2015-03-01

    Full Text Available Host defense peptides (HDPs are currently major focal points of medical research as infectious microbes are gaining resistance to existing drugs. They are effective against multi-drug resistant pathogens due to their unique primary target, biological membranes, and their peculiar mode of action. Even though HDPs from 60 Asian frog species belonging to 15 genera have been characterized, research into these peptides is at a very early stage. The purpose of this review is to showcase the status of peptide research in Asia. Here we provide a summary of HDPs from Asian frogs.

  19. Determination of age, longevity and age at reproduction of the frog Microhyla ornata by skeletochronology

    Indian Academy of Sciences (India)

    Suresh M Kumbar; Katti Pancharatna

    2001-06-01

    Skeletochronological estimation of age, longevity, age at sexual maturity and breeding of Microhyla ornata was done. Frogs ( = 62) were collected locally in August (rainy season) 1997 and brought to the laboratory. Body mass and snout-vent-length (SVL) of each frog was recorded; the 4th toe of both the hind limbs was clipped under anaesthesia, fixed in 10% formalin, demineralized in 5% nitric acid and processed for histology. Limb bones (femur, humerus, tibiofibula and radioulna) of 6 large sized frogs were also processed for skeletochronology in order to study the rate of resorption. Gonads of 25 frogs (belonging to different body size ranges) were processed for histology in order to ascertain the gametogenic status of individual frogs. One to four growth rings consisting of growth zones and lines of arrested growth (LAGs) were noticed in frogs of different body sizes; the number of LAGs remained identical in all the limb bones and phalanges in 5 out of 6 frogs. Back calculation indicated that the resorption rate is very low in this frog. Male frogs possessed sperm bundles in seminiferous tubules in the 1st year, while females showed yolky follicles in the ovary in the 2nd year. Frogs found in amplexus were 3–5 years old. The results suggest that this frog may live for a maximum of 5 years in the natural population.

  20. Divergence among barking frogs (Eleutherodactylus augusti) in the southwestern United States

    Science.gov (United States)

    Goldberg, C.S.; Sullivan, B.K.; Malone, J.H.; Schwalbe, C.R.

    2004-01-01

    Barking frogs (Eleutherodactylus augusti) are distributed from southern Mexico along the Sierra Madre Occidental into Arizona and the Sierra Madre Oriental into Texas and New Mexico. Barking frogs in Arizona and most of Texas live in rocky areas in oak woodland, while those in New Mexico and far western Texas live in rodent burrows in desertscrub. Barking frogs in each of the three states have distinct coloration and differ in sexually dimorphic characters, female vocalization, and skin toxicity. We analyzed advertisement call variation and conducted a phylogenetic analysis using mitochondrial DNA sequences (ND2 and tRNA regions) for barking frogs from these three states. Advertisement calls of frogs from Arizona were significantly longer in duration, higher in frequency, and had longer duration pulses than those of frogs from either New Mexico or Texas; frogs from these latter two sites were indistinguishable in these call variables. Phylogenetic analysis showed deep divisions among barking frogs from the three states. Differences in call structure, coloration, and mitochondrial DNA sequences strongly suggest that barking frogs in Arizona are reproductively isolated from those in New Mexico and Texas. Our results indicate that either northern populations are connected via gene flow through southern Mexico (i.e., they are subspecies as currently recognized), or represent independent lineages as originally described (i.e., western barking frogs, E. cactorum in AZ, and the eastern barking frogs, E. latrans in NM, TX).

  1. Morphometric discrimination of wild from farmed Dybowski's frog (Rana dybowskii) based on hindlimb length

    Institute of Scientific and Technical Information of China (English)

    XIA Rui; HUANG Xiao-ming; YANG Shu-hui; XU Yan-chun; Ying Lu; Thomas D.Dahmer

    2011-01-01

    Commercial farming of anuran species that arc declining in the wild raises a need to discriminate wild from farmed frogs. We hypothesized wild frogs might have extended hindlimbs due to greater frequency or intensity of jumping relative to farmed frogs, highlighting a morphometric approach to discrimination of wild from farmed frogs using hindiimb length. In the present study, Dybowski's frog (Rana dybowskii) was used to test this hypothesis. We measured body mass (Mb)and hindlimb length (Lh) of 2-year old farmed frogs and wild frogs aged 2 to 5 years. Dybowski's frog demonstrated significant dimorphism in Mb and Lh. Mb was significantly greater among farmed 2-year old frogs in both sexes (p=0.000), while only among females w as Lh significantly greater for wild frogs (p=0.000). Lh/Mb was used as an index for origin discrimination to eliminate the influence of Mb due to variation of husbandry conditions among farms. Mean Lh/Mb for fanned frogs was significantly lower than for wild frogs (p=0.000) in the 2-year old age class.Discrimination correctly classified 84.4% of fanned and 96.3% of wild male frogs. Among females, 92.9% of farmed frogs and 90.1% wild frogs were correctly classified. The ovcrall correctness of classification was 92.1% and 90.8% for males and females, respectively. However, Lh/Mb revealed variation with age, resulting in reduced discriminative power for frogs ≥3 years old. We introduced a coefficient Ce to adjust the Lh/Mb of frogs ≥3 years to the level equivalent to 2-year frogs. Thc adjustment achieved 89.5% for overall correctness of origin for wild males and 92.4% for wild females ≥3 years old. These results show that Lh/Mb is an effective index to discriminate wild from fanned Dybowski's frog. Since the physical demands ofjumping are common among anurans, this index is also potentially applicable to other anuran species.

  2. BIFURCATION ANALYSIS OF A MITOTIC MODEL OF FROG EGGS

    Institute of Scientific and Technical Information of China (English)

    吕金虎; 张子范; 张锁春

    2003-01-01

    The mitotic model of frog eggs established by Borisuk and Tyson is qualitatively analyzed. The existence and stability of its steady states are further discussed. Furthermore, the bifurcation of above model is further investigated by using theoretical analysis and numerical simulations. At the same time, the numerical results of Tyson are verified by theoretical analysis.

  3. The checklist of protozoan and acanthocephalan from frogs in China

    Directory of Open Access Journals (Sweden)

    XIA Weili

    2015-04-01

    Full Text Available In order to understand the species of protozoan and acanthocephalan from frogs and their geographic distributions in China.Relevant literatures that reported protozoan and acanthocephalan in frogs of China were collected and a checklist was provided according to newer classification system on protozoan and acanthocephalan based on these literatures.In summary,61 species of protozoan and 8 species of acanthocephalan have been recorded in 31 species of frogs in China.Among them,the species of protozoan belong to 7 phyla,11 classes,12 orders,14 families,21 genera, and the species of acanthocephalan belong to 1 phylum,2 classes,2 orders,2 families,3 genera.The Chinese and Latin names,the namer and naming years,the parasitic hosts and parts,the geographical distributions and the sources of literatures of these protozoan and acanthocephalan species were listed as well,which provids the basic materials for a more comprehensive understand about species of protozoan and acanthocephalan from frogs in China.

  4. Research on moving object detection based on frog's eyes

    Science.gov (United States)

    Fu, Hongwei; Li, Dongguang; Zhang, Xinyuan

    2008-12-01

    On the basis of object's information processing mechanism with frog's eyes, this paper discussed a bionic detection technology which suitable for object's information processing based on frog's vision. First, the bionics detection theory by imitating frog vision is established, it is an parallel processing mechanism which including pick-up and pretreatment of object's information, parallel separating of digital image, parallel processing, and information synthesis. The computer vision detection system is described to detect moving objects which has special color, special shape, the experiment indicates that it can scheme out the detecting result in the certain interfered background can be detected. A moving objects detection electro-model by imitating biologic vision based on frog's eyes is established, the video simulative signal is digital firstly in this system, then the digital signal is parallel separated by FPGA. IN the parallel processing, the video information can be caught, processed and displayed in the same time, the information fusion is taken by DSP HPI ports, in order to transmit the data which processed by DSP. This system can watch the bigger visual field and get higher image resolution than ordinary monitor systems. In summary, simulative experiments for edge detection of moving object with canny algorithm based on this system indicate that this system can detect the edge of moving objects in real time, the feasibility of bionic model was fully demonstrated in the engineering system, and it laid a solid foundation for the future study of detection technology by imitating biologic vision.

  5. Measurement and Evaluation of Wear Frogs Switches ŽSR

    Directory of Open Access Journals (Sweden)

    Urda Ján

    2014-05-01

    Full Text Available This paper deals with the measurement and evaluation of wear frogs switches ZSR. One of the main problems is the oversize wear. The possibilities analysis of this problem is offered through a set of switches and monitoring of selected parameters. One of these parameters is also monitoring the vertical wear

  6. Biophysics of underwater hearing in the clawed frog, Xenopus laevis

    DEFF Research Database (Denmark)

    Christensen-Dalsgaard, J; Elepfandt, A

    1995-01-01

    Anesthetized clawed frogs (Xenopus laevis) were stimulated with underwater sound and the tympanic disk vibrations were studied using laser vibrometry. The tympanic disk velocities ranged from 0.01 to 0.5 mm/s (at a sound pressure of 2 Pa) in the frequency range of 0.4-4 kHz and were 20-40 dB higher...

  7. Occurrence of tetrodotoxin in the frog Atelopus oxyrhynchus.

    Science.gov (United States)

    Mebs, D; Schmidt, K

    1989-01-01

    Alcohol extracts from the frog Atelopus oxyrhynchus were toxic to mice when injected intraperitoneally. The toxin was purified by gel filtration on a Sephadex G-15 column, and was identified as tetrodotoxin by thin-layer chromatography and GC-MS analysis of the alkali-hydrolyzed and trimethylsilylated derivative giving the same pattern as the C9-base of tetrodotoxin. PMID:2781581

  8. Potential for Loss of Breeding Habitat for Imperiled Mountain Yellow-legged Frog ( Rana muscosa) in High Sierra Nevada Mountain Water Bodies due to Reduced Snowpack: Interaction of Climate Change and an Introduced Predator

    Science.gov (United States)

    Lacan, I.; Matthews, K. R.

    2005-12-01

    Year to year variation in snowpack (20-200% average) and summer rain create large fluctuations in the volume of water in ponds and small lakes of the higher elevation (> 3000 m) Sierra Nevada. These water bodies are critical habitat for the imperiled mountain yellow-legged frog, Rana muscosa, which has decreased in abundance by 90% during the past century, due in part to the loss of suitable habitat and introduction of a fish predator (trout, Oncorhynchus spp.). Climate change is predicted to reduce the amount of snowpack, potentially impacting amphibian habitats throughout the Sierra Nevada by further reducing the lake and pond water levels and resulting in drying of small lakes during the summer. Mountain yellow-legged frogs are closely tied to water during all life stages, and are unique in having a three- to four-year tadpole phase. Thus, tadpole survival and future recruitment of adult frogs requires adequate water in lakes and ponds throughout the year, but larger lakes are populated with fish that prey on frogs and tadpoles. Thus, most successful frog breeding occurs in warm, shallow, fishless ponds that undergo wide fluctuations in volume. These water bodies would be most susceptible to the potential climate change effects of reduced snowpack, possibly resulting in lower tadpole survival. This study explores the link between the changes in water availability -- including complete pond drying -- and the abundance and recruitment of mountain yellow-legged frog in Dusy Basin, Kings Canyon National Park, California, USA. We propose using the low-snowpack years (1999, 2002, 2004) as comparative case studies to predict future effects of climate change on aquatic habitat availability and amphibian abundance and survival. To quantify the year to year variation and changes in water volume available to amphibians, we initiated GPS lake mapping in 2002 to quantify water volumes, water surface area, and shoreline length. We tracked these changes by repeated mapping of

  9. Cryoprotectant Production in Freeze-Tolerant Wood Frogs Is Augmented by Multiple Freeze-Thaw Cycles.

    Science.gov (United States)

    Larson, Don J; Barnes, Brian M

    2016-01-01

    Ice nucleation across the skin of wood frogs (Lithobates sylvaticus) rapidly induces endogenous production of glucose, a cryoprotectant necessary for freeze tolerance. In laboratory studies of freeze tolerance, wood frogs are cooled slowly, often at -0.05°C h(-1), to facilitate high cryoprotectant production and survival. Under natural conditions in Alaska, however, wood frogs accumulate maximal tissue glucose concentrations while cooling at much faster rates, -0.35° to -1.6°C h(-1), and in addition undergo multiple successive freeze-thaw cycles before remaining frozen for the winter. We examined whether simulating these ecologically relevant cooling rates and repeated freeze-thaw events in captive wood frogs results in the high glucose concentrations found in naturally frozen wood frogs. We found that over successive freezing and thawing events, glucose concentrations increased stepwise in all measured tissues. Short thawing periods did not result in a statistically significant decline of glucose concentrations. Wood frogs that experienced three freeze-thaw events had fresh weight glucose concentrations that approached values found in tissues of wood frogs frozen in natural conditions. Laboratory wood frogs survive frozen for 2 mo, while wood frogs frozen under natural conditions survive frozen for up to 7 mo at temperatures below -18°C. We hypothesize that repeated freeze-thaw cycles with rapid cooling and warming rates allow for greater survival in Alaskan wood frogs through enhanced cryoprotectant production. PMID:27327184

  10. Habitat use and spatial structure of a barking frog (Eleutherodactylus augusti) population in southeastern Arizona

    Science.gov (United States)

    Goldberg, C.S.; Schwalbe, C.R.

    2004-01-01

    Barking Frogs (Eleutherodactylus augusti) are the northernmost ranging member of the large tropical family Leptodactylidae. We investigated the ecology of this saxicolous species at the northern edge of its range in a canyon in southern Arizona. We captured 54 frogs on discontinuous rock outcrops; eight of nine females and 39 of 45 males were on limestone outcrops. The remaining frogs were closer to limestone outcrops by more than 200 m than would be expected if they were distributed randomly with respect to limestone formations. Seven of 10 frogs radio-tracked had core home ranges (50% fixed kernel) from 94 to 100% on limestone; the other three frogs did not have any part of their home range on limestone outcrops. During five years of mark-recapture efforts, no frogs were found on a different outcrop from the one where they were originally captured; no radio-tracked frogs moved between outcrops during the breeding season. We estimated that four to 20 Barking Frogs occupied each outcrop; these groups probably are connected primarily by juvenile dispersal. As an organism living at the edge of its range, Barking Frogs in Arizona may rely heavily on extensive underground areas such as those found in limestone to protect them from a physiologically challenging environment. To manage for the persistence of Barking Frogs in southern Arizona, we must identify and protect habitat patches and movement pathways among them.

  11. Adaptive response in frogs chronically exposed to low doses of ionizing radiation in the environment

    International Nuclear Information System (INIS)

    Using the micronucleus assay, decreased levels of DNA damage were found after high dose ionizing radiation exposure of liver cells taken from frogs inhabiting a natural environment with above-background levels of ionizing radiation, compared to cells taken from frogs inhabiting background areas. The data obtained from a small number of animals suggest that stress present in the above-background environment could induce an adaptive response to ionizing radiation. This study did not reveal harmful effects of exposure to low levels of radioactivity. On the contrary, stress present in the above-background area may serve to enhance cellular defense mechanisms. - Highlights: → Frogs were collected from background and higher tritium level habitats. → The micronucleus assay was conducted on liver cells obtained from the frogs. → No detrimental effects were noted in frogs exposed to elevated tritium. → Adaptive responses were observed in frogs exposed to elevated tritium.

  12. Adaptive response in frogs chronically exposed to low doses of ionizing radiation in the environment

    Energy Technology Data Exchange (ETDEWEB)

    Audette-Stuart, M., E-mail: stuartm@aecl.ca [Environmental Technologies Branch, Atomic Energy of Canada Limited, Chalk River Laboratories, Chalk River, Ontario, K0J 1P0 (Canada); Kim, S.B.; McMullin, D.; Festarini, A.; Yankovich, T.L.; Carr, J.; Mulpuru, S. [Environmental Technologies Branch, Atomic Energy of Canada Limited, Chalk River Laboratories, Chalk River, Ontario, K0J 1P0 (Canada)

    2011-06-15

    Using the micronucleus assay, decreased levels of DNA damage were found after high dose ionizing radiation exposure of liver cells taken from frogs inhabiting a natural environment with above-background levels of ionizing radiation, compared to cells taken from frogs inhabiting background areas. The data obtained from a small number of animals suggest that stress present in the above-background environment could induce an adaptive response to ionizing radiation. This study did not reveal harmful effects of exposure to low levels of radioactivity. On the contrary, stress present in the above-background area may serve to enhance cellular defense mechanisms. - Highlights: > Frogs were collected from background and higher tritium level habitats. > The micronucleus assay was conducted on liver cells obtained from the frogs. > No detrimental effects were noted in frogs exposed to elevated tritium. > Adaptive responses were observed in frogs exposed to elevated tritium.

  13. Assessment of radiocesium contamination in frogs 18 months after the Fukushima Daiichi nuclear disaster

    Science.gov (United States)

    Matsushima, Noe; Ihara, Sadao; Takase, Minoru; Horiguchi, Toshihiro

    2015-04-01

    We investigated the accumulation of radionuclides in frogs inhabiting radioactively contaminated areas around Fukushima Daiichi Nuclear Power Plant (FDNPP) to search for possible adverse effects due to radionuclides. We collected 5 frog species and soil samples in areas within and outside a 20-km radius from FDNPP in August and September 2012 and determined their radiocesium concentrations (134Cs and 137Cs). There was a positive correlation between radiocesium concentrations in the soil samples and frogs, and the highest concentration in frogs was 47,278.53 Bq/kg-wet. Although we conducted a histological examination of frog ovaries and testes by light microscopy to detect possible effects of radionuclides on the morphology of germ cells, there were no clear abnormalities in the gonadal tissues of frogs collected from sites with different contamination levels.

  14. Food Composition of the Marsh Frog, Rana ridibunda Pallas, 1771, in Thrace

    OpenAIRE

    Kerim ÇİÇEK; Ahmet MERMER

    2007-01-01

    The purpose of this investigation was to determine the feeding habits of the marsh frog, Rana ridibunda, populations inhabiting Turkish Thrace. Analysis of the stomach contents of 53 (19 males, 34 females) adult individuals was performed. The frog diet consisted of a wide variety of arthropods; Diptera (42.62%) and Coleoptera (21.84%) were especially prominent. Aquatic forms did not contribute much to the frog diet. The prey items identified indicate that individuals of this species, like oth...

  15. A zero-one law for recurrence and transience of frog processes

    OpenAIRE

    Kosygina, Elena; Zerner, Martin P. W.

    2015-01-01

    We provide sufficient conditions for the validity of a dichotomy, i.e. zero-one law, between recurrence and transience of general frog models. In particular, the results cover frog models with i.i.d. numbers of frogs per site where the frog dynamics are given by quasi-transitive Markov chains or by random walks in a common random environment including super-critical percolation clusters on $\\mathbb{Z}^d$. We also give a sufficient and almost sharp condition for recurrence of uniformly ellipti...

  16. Food habits and ontogenetic diet shifts of the litter dwelling frog proceratophrys boiei (wied)

    OpenAIRE

    Ariovaldo A. Giaretta; Márcio S. Araújo; Hermes F. de Medeiros; Katia G. Facure

    1998-01-01

    Here is described the diet of Proceratophrys boiei (Wied, 1825), a leaf litter frog of the Atlantic Forest, and test for relationships between frog size and prey size and type. The diet was determined by stomach content analysis. In 38 frogs, was found 76 prey items belonging to 23 taxa. Insects predominate in the diet and the most frequent categories were coleopterans (39.4% of total volume) and orthopterans (25.0%). There was a positive correlation between frog size and volume of prey taken...

  17. Eugenol Anesthesia in African Clawed Frogs (Xenopus laevis) of Different Body Weights

    OpenAIRE

    Goulet, Félix; Hélie, Pierre; Vachon, Pascal

    2010-01-01

    The objective of this prospective study was to determine the duration of anesthesia in Xenopus laevis frogs of different body weights relative to exposure time in a eugenol (350 µL/L) bath. Two groups of 5 female frogs each weighing 7.5 ± 2.1 g (small frogs) or 29.2 ± 7.4 g (medium frogs) were used. The acetic acid test (AAT), withdrawal reflex, righting reflex, heart rate, and blood oxygen saturation were used to evaluate CNS depression after eugenol bath administration. No responses to the ...

  18. First isolation and identification of Elizabethkingia meningoseptica from cultured tiger frog, Rana tigerina rugulosa.

    Science.gov (United States)

    Xie, Zhen-Yu; Zhou, Yong-Can; Wang, Shi-Feng; Mei, Bing; Xu, Xian-Dong; Wen, Wan-Yao; Feng, Yong-Qin

    2009-07-01

    Elizabethkingia meningoseptica has been recognised as an occasional but serious opportunistic bacterial pathogen to human beings. Recently, it was frequently isolated from tiger frog, Rana tigerina rugulosa, with cataract disease, which is the most common disease of unknown aetiology of frogs in Hainan, China. The purpose of this study was to identify and characterise the bacterial strains isolated from the recent outbreaks of cataract disease in farmed tiger frog in Hainan, China, and to evaluate their pathogenicity to the frog and their sensitivity to 20 chemotherapeutic agents. The 16S rRNA gene sequences of strains W0701 (1478bp), W0702 (1477bp) and W0703 (1478bp) showed 98.6-98.7% similarity with the sequence of E. meningoseptica type strain (ATCC 13253) and 99.9-100% similarity with that of E. meningoseptica NTU 870424-IL. Six strains (W0701-W0706) were selected to represent 24 isolates retrieved from six moribund frogs. The morphological, physiological and biochemical characteristics of the six representative isolates were consistent with those of E. meningoseptica strains. The organisms were only susceptible to vancomycin and moderately susceptible to cefoperazone among the 20 investigated chemotherapeutic agents. Virulence test with strain W0702 was conducted and pathogenicity (by intramuscular injection) was demonstrated in the tiger frog. In conclusion, 24 isolates obtained from frogs with cataract disease were the E. meningoseptica strains highly pathogenic to tiger frog, and this is the first report of E. meningoseptica as a pathogen for tiger frog. PMID:19327918

  19. Abundance of Green Tree Frogs and Insects in Artificial Canopy Gaps in a Bottomland Hardwood Forest.

    Energy Technology Data Exchange (ETDEWEB)

    Horn, Scott; Hanula, James, L.; Ulyshen, Michael D.; Kilgo, John, C.

    2005-04-01

    ABSTRACT - We found more green tree frogs ( Hyla cinerea) n canopv gaps than in closed canopy forest. Of the 331 green tree frogs observed, 88% were in canopv gaps. Likewise, higher numbers and biomasses of insects were captured in the open gap habitat Flies were the most commonlv collected insect group accounting for 54% of the total capture. These data suggest that one reason green tree frogs were more abundant in canopy gaps was the increased availability of prey and that small canopy gaps provide early successional habitats that are beneficial to green tree frog populations.

  20. Contractile reaction of isolated frog aorta after X-irradiation

    International Nuclear Information System (INIS)

    The action of X-rays (50 kV, filtered by 0.3 mm Al) on helical strip of frog aorta (rana esculenta) has been investigated. The isolated preparations have a stable basal tone and are radio-sensitive to X-rays which induce reversible, dose-dependent, contractile responses. After repeated irradiational tachyphylaxis appears. The threshold doses are about 250 R at 3 to 6 kR/min, antiadrenergic (phentolamine, propranolol), anticholinergic (atropin), antihistaminic (Neo-Bridal) and serotoninergic (Deseril) drugs have no visible influence on the X-ray induced reaction, i.e. these action mechanisms of the irradiation-induced contraction do not seem probable. Theophylline and cAMP inhibit the X-ray contraction probably non-specifically. Indometacin also inhibits the X-ray contraction: this suggests participation of prostaglandin-mechanism on the contraction of frog aorta after irradiation. (orig.)

  1. Nanoscale friction and adhesion of tree frog toe pads.

    Science.gov (United States)

    Kappl, Michael; Kaveh, Farzaneh; Barnes, W Jon P

    2016-01-01

    Tree frogs have become an object of interest in biomimetics due to their ability to cling to wet and slippery surfaces. In this study, we have investigated the adhesion and friction behavior of toe pads of White's tree frog (Litoria caerulea) using atomic force microscopy (AFM) in an aqueous medium. Facilitating special types of AFM probes with radii of ∼400 nm and ∼13 μm, we were able to sense the frictional response without damaging the delicate nanopillar structures of the epithelial cells. While we observed no significant adhesion between both types of probes and toe pads in wet conditions, frictional forces under such conditions were very pronounced and friction coefficients amounted between 0.3 and 1.1 for the sliding friction between probes and the epithelial cell surfaces. PMID:27165465

  2. The Genome of the Western Clawed Frog Xenopus tropicalis

    Energy Technology Data Exchange (ETDEWEB)

    Hellsten, Uffe; Harland, Richard M.; Gilchrist, Michael J.; Hendrix, David; Jurka, Jerzy; Kapitonov, Vladimir; Ovcharenko, Ivan; Putnam, Nicholas H.; Shu, Shengqiang; Taher, Leila; Blitz, Ira L.; Blumberg, Bruce; Dichmann, Darwin S.; Dubchak, Inna; Amaya, Enrique; Detter, John C.; Fletcher, Russell; Gerhard, Daniela S.; Goodstein, David; Graves, Tina; Grigoriev, Igor V.; Grimwood, Jane; Kawashima, Takeshi; Lindquist, Erika; Lucas, Susan M.; Mead, Paul E.; Mitros, Therese; Ogino, Hajime; Ohta, Yuko; Poliakov, Alexander V.; Pollet, Nicolas; Robert, Jacques; Salamov, Asaf; Sater, Amy K.; Schmutz, Jeremy; Terry, Astrid; Vize, Peter D.; Warren, Wesley C.; Wells, Dan; Wills, Andrea; Wilson, Richard K.; Zimmerman, Lyle B.; Zorn, Aaron M.; Grainger, Robert; Grammer, Timothy; Khokha, Mustafa K.; Richardson, Paul M.; Rokhsar, Daniel S.

    2009-10-01

    The western clawed frog Xenopus tropicalis is an important model for vertebrate development that combines experimental advantages of the African clawed frog Xenopus laevis with more tractable genetics. Here we present a draft genome sequence assembly of X. tropicalis. This genome encodes over 20,000 protein-coding genes, including orthologs of at least 1,700 human disease genes. Over a million expressed sequence tags validated the annotation. More than one-third of the genome consists of transposable elements, with unusually prevalent DNA transposons. Like other tetrapods, the genome contains gene deserts enriched for conserved non-coding elements. The genome exhibits remarkable shared synteny with human and chicken over major parts of large chromosomes, broken by lineage-specific chromosome fusions and fissions, mainly in the mammalian lineage.

  3. ESR analysis of irradiated frogs' legs and fishes

    International Nuclear Information System (INIS)

    Electron spin resonance (ESR) spectral analysis of different parts (bones, scales, jaw, etc.) from ionized (irradiated) frozen frogs' legs and fishes (brown trout and sardine) were recorded. There is always present, after treatment, a signal due to the irradiation. ESR and ENDOR experiments lead us to assign it to h1 centers from hydroxyapatite, as in the case of other irradiated meat bones. The use of ESR to prove whether one of these foods has been irradiated or not is discussed. (author)

  4. Two Types of Assays for Detecting Frog Sperm Chemoattraction

    OpenAIRE

    Burnett, Lindsey A.; Tholl, Nathan; Chandler, Douglas E.

    2011-01-01

    Sperm chemoattraction in invertebrates can be sufficiently robust that one can place a pipette containing the attractive peptide into a sperm suspension and microscopically visualize sperm accumulation around the pipette1. Sperm chemoattraction in vertebrates such as frogs, rodents and humans is more difficult to detect and requires quantitative assays. Such assays are of two major types - assays that quantitate sperm movement to a source of chemoattractant, so-called sperm accumulation assay...

  5. Role of cutaneous surface fluid in frog osmoregulation

    DEFF Research Database (Denmark)

    Larsen, Erik Hviid; Ramløv, Hans

    2013-01-01

    The study investigated whether evaporative water loss (EWL) in frogs stems from water diffusing through the skin or fluid secreted by mucous glands. Osmolality of cutaneous surface fluid (CSF) of Rana esculenta (Pelophylax kl. esculentus) subjected to isoproterenol or 30 °C–34 °C was 191 ± 9.3 an....... As a regulated external physiological compartment, CSF would be of importance for the immune defenses that amphibians employ in protecting their skin....

  6. Radioimmunoassay for plasma corticotropin in frogs (Rana esculenta L.)

    International Nuclear Information System (INIS)

    A radioimmunoassay technique has been developed for measuring frog plasma corticotropin (ACTH) without prior extraction. Using synthetic porcine ACTH as a reference standard, 131I-labeled synthetic human ACTH (sp act greater than 500 mCi/mg) as tracer and rabbit anti-porcine ACTH serum, the lower measurable value was estimated at about 4 pg ACTH. Only human and porcine ACTH, ACTH, and frog pituitary ACTH reacted with the rabbit anti-porcine ACTH serum. No cross-reactivity has been found with synthetic ACTH, αMSH, and bovine βMSH. Appearance of damaged 131I-h ACTH components after storage in plasma solutions was followed for 7 days. The conditions making it possible to reduce ACTH damage have been ascertained. The average plasma corticotropin level (+- CI) was found to be 38.8 +- 7.8 pg/ml without any significant difference between males and females. These results suggest that frog ACTH secretion has much in common with mammalian secretions

  7. Developmental aspects of the direct-developing frog Adelophryne maranguapensis.

    Science.gov (United States)

    de Lima, Ana V P; Reis, Alice H; Amado, Nathália G; Cassiano-Lima, Daniel; Borges-Nojosa, Diva M; Oriá, Reinaldo B; Abreu, José G

    2016-05-01

    Direct development in amphibians is characterized by the loss of aquatic breeding. The anuran Adelophryne maranguapensis is one example of a species with direct development, and it is endemic to the state of Ceará, Brazil. Detailed morphological features of A. maranguapensis embryos and the stages of sequential development have not been described before. Here, we analyzed all available genetic sequence tags in A. maranguapensis (tyr exon 1, pomc and rag1) and compared them with sequences from other species of Adelophryne frogs. We describe the A. maranguapensis reproductive tract and embryonic body development, with a focus on the limbs, tail, ciliated cells of the skin, and the egg tooth, which were analyzed using scanning electron microscopy. Histological analyses revealed ovaries containing oocytes surrounded by follicular cells, displaying large nuclei with nucleoli inside. Early in development, the body is unpigmented, and the neural tube forms dorsally to the yolk vesicle, typical of a direct-developing frog embryo. The hindlimbs develop earlier than the forelimbs. Ciliated cells are abundant during the early stages of skin development and are less common during later stages. The egg tooth appears in the later stages and develops as a keratinized microridge structure. The developmental profile of A. maranguapensis presented here will contribute to our understanding of the direct-development model and may help preserve this endangered native Brazilian frog. genesis 54:257-271, 2016. © 2016 Wiley Periodicals, Inc.

  8. Polyandry, Predation, and the Evolution of Frog Reproductive Modes.

    Science.gov (United States)

    Zamudio, Kelly R; Bell, Rayna C; Nali, Renato C; Haddad, Célio F B; Prado, Cynthia P A

    2016-09-01

    Frog reproductive modes are complex phenotypes that include egg/clutch characteristics, oviposition site, larval development, and sometimes, parental care. Two evident patterns in the evolution of these traits are the higher diversity of reproductive modes in the tropics and the apparent progression from aquatic to terrestrial reproduction, often attributed to higher fitness resulting from decreased predation on terrestrial eggs and tadpoles. Here, we propose that sexual selection-and not only natural selection due to predation-favors terrestrial breeding by reducing the loss of fitness due to polyandry. To examine this novel selective mechanism, we reconstructed the evolution of reproductive diversity in two frog families (Hylidae and Leptodactylidae) and tested for concerted evolution of egg and tadpole development sites with specific mating behaviors. We found that oviposition and tadpole development sites are evolving independently, do not show the same diversity and/or directionality in terms of terrestriality, and thus may be diversifying due to different selective mechanisms. In both families, terrestrial egg deposition is correlated with amplexus that is hidden from competing males, and in hylids, testes mass was significantly larger and more variable in males with exposed amplexus that are vulnerable to polyandry. Our results indicate that intrasexual selection has been an underappreciated mechanism promoting diversification of frog reproductive modes. PMID:27513910

  9. Electrophysiological evidence for an ATP-gated ion channel in the principal cells of the frog skin epithelium

    DEFF Research Database (Denmark)

    Brodin, Birger; Nielsen, Robert

    2000-01-01

    P2X receptor, Na+ absorption, Short circuit current, Cell potential, Microelectrodes, Frog skin, Cytosolic Ca2+......P2X receptor, Na+ absorption, Short circuit current, Cell potential, Microelectrodes, Frog skin, Cytosolic Ca2+...

  10. Correlation between chloride flux via the mitochondria-rich cells and transepithelial water movement in isolated frog skin (Rana esculenta)

    DEFF Research Database (Denmark)

    Nielsen, Robert

    1995-01-01

    Antidiuretic hormone; chloride transport; electroosmosis; Frog skin; Intercalated cells; Local osmosis; Mitochondria-rich cells.......Antidiuretic hormone; chloride transport; electroosmosis; Frog skin; Intercalated cells; Local osmosis; Mitochondria-rich cells....

  11. Develop Inventory Protocols for frogs within the Region 1 Great Northern and Great Basin LCC, Protocol Development & Remote Audial Inventory

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Many refuges lack basic information on distribution of frogs, but conducting inventory surveys for frogs can be problematic. Different species breed at different...

  12. Snow cover and late fall movement influence wood frog survival during an unusually cold winter.

    Science.gov (United States)

    O'Connor, Jason H; Rittenhouse, Tracy A G

    2016-07-01

    Understanding how organisms will respond to altered winter conditions is hampered by a paucity of information on the winter ecology for many species. Amphibians are sensitive to environmental temperature and moisture conditions and may be vulnerable to changes in winter climate. We used a combination of radio telemetry and field enclosures to monitor survival of the freeze-tolerant wood frog (Lithobates sylvaticus) during the unusually cold winter of 2013-2014. We experimentally manipulated snow cover to determine the effect of snow removal on winter survival. In addition, we placed a group of untracked frogs at locations used by tracked frogs prior to long-distance late fall movement to investigate whether late fall movement entailed survival consequences. Winter survival was highest (75.3 %) among frogs at post-movement locations that received natural snow cover. The odds of surviving the winter for frogs in the snow removal treatment was only 21.6 % that of frogs in the natural snow treatment. Likewise, paired frogs placed at pre-fall movement locations had only 35.1 % the odds of surviving as tracked frogs at post-fall movement locations. A comparison of a priori models that included microhabitat conditions measured at wood frog overwintering locations revealed that the minimum temperature experienced and the depth of the frog in the substrate explained additional variation in winter survival. Our results suggest that acute exposure to lethal temperature conditions is the most likely cause of mortality during this study, rather than energy exhaustion or desiccation. They also demonstrate the importance of snow cover to the winter survival of wood frogs. PMID:26497126

  13. Teale California shoreline

    Data.gov (United States)

    California Department of Resources — California Spatial Information System (CaSIL) is a project designed to improve access to geo-spatial and geo-spatial related data information throughout the state...

  14. California Condor Critical Habitat

    Data.gov (United States)

    California Department of Resources — These Data identify (in general) the areas where critical habitat for the California Condor occur. Critical habitat for the species consists of the following 10...

  15. An Effective Hybrid Cuckoo Search Algorithm with Improved Shuffled Frog Leaping Algorithm for 0-1 Knapsack Problems

    OpenAIRE

    Yanhong Feng; Gai-Ge Wang; Qingjiang Feng; Xiang-Jun Zhao

    2014-01-01

    An effective hybrid cuckoo search algorithm (CS) with improved shuffled frog-leaping algorithm (ISFLA) is put forward for solving 0-1 knapsack problem. First of all, with the framework of SFLA, an improved frog-leap operator is designed with the effect of the global optimal information on the frog leaping and information exchange between frog individuals combined with genetic mutation with a small probability. Subsequently, in order to improve the ...

  16. Differentiation of frog fats from vegetable and marine oils by Fourier Transform Infrared Spectroscopy and chemometric analysis

    OpenAIRE

    M. E. Ali; Nina Naquiah, A. N.; Mustafa, S; S. B. A. Hamid

    2015-01-01

    The agro-based production and consumption of frogs coupled with world-wide trading have been increased in the recent years giving rise to the risk of frog fat adulteration in expensive vegetable and marine oils. For the first time, we profiled here frog fats using Fourier Transform Infrared (FTIR) Spectroscopy coupled with multivariate principal component analysis (PCA). The comparison of the FTIR spectral absorbance intensities demonstrated linkage of frog fats to other edible fats and oils....

  17. Evaluating Group Housing Strategies for the Ex-Situ Conservation of Harlequin Frogs (Atelopus spp.) Using Behavioral and Physiological Indicators

    OpenAIRE

    Cikanek, Shawna J.; Simon Nockold; Brown, Janine L.; James W Carpenter; Angie Estrada; Jorge Guerrel; Katharine Hope; Roberto Ibáñez; Sarah B Putman; Brian Gratwicke

    2014-01-01

    We have established ex situ assurance colonies of two endangered Panamanian harlequin frogs, Atelopus certus and Atelopus glyphus, but observed that males fought with each other when housed as a group. Housing frogs individually eliminated this problem, but created space constraints. To evaluate the potential stress effects from aggressive interactions when grouping frogs, we housed male frogs in replicated groups of one, two, and eight. We measured aggressive behavioral interactions and feca...

  18. An addition to the diversity of dendrobatid frogs in Venezuela: description of three new collared frogs (Anura: Dendrobatidae: Mannophryne

    Directory of Open Access Journals (Sweden)

    César Luis Barrio-Amorós

    2010-07-01

    Full Text Available Three new species of collared frogs of the genus Mannophryne are described from Venezuela. Two are newly discovered taxa from the Venezuelan Andes, whereas the third species, previously confused with M. trinitatis, is from the Caracas area in the Cordillera de la Costa. The call of the three new species and that of Mannophryne collaris are described. Taxonomic, zoogeographic, and conservation issues are discussed.

  19. Recurrence for the frog model with drift on $\\mathbb{Z}^d$

    OpenAIRE

    Döbler, Christian; Pfeifroth, Lorenz

    2014-01-01

    In this paper we present a recurrence criterion for the frog model on $\\mathbb{Z}^d$ with an i.i.d. initial configuration of sleeping frogs and such that the underlying random walk has a drift to the right.

  20. The critical probability for the frog model is not a monotonic function of the graph

    OpenAIRE

    Fontes, L. R.; Machado, F. P.; Sarkar, A.

    2004-01-01

    We show that the critical probability for the frog model on a graph is not a monotonic function of the graph. This answers a question of Alves, Machado and Popov. The nonmonotonicity is unexpected as the frog model is a percolation model.

  1. Comparison of RABITT and FROG measurements in the temporal characterization of attosecond pulse trains

    CERN Document Server

    Kim, Kyung Taec; Park, Mi Na; Imran, Tayyab; Umesh, G; Nam, Chang Hee

    2007-01-01

    The attosecond high harmonic pulses obtained from a long Ar-filled gas cell were characterized by two techniques - the reconstruction of attosecond beating by interference of two-photon transition (RABITT) and frequency-resolved optical gating (FROG) methods. The pulse durations obtained by RABITT and FROG methods agreed within 10 %.

  2. The toxicity of Poison Dart Frog alkaloids against the Fire Ant (Solenopsis invicta)

    Science.gov (United States)

    Hundreds of alkaloids, representing over 20 structural classes, have been identified from the skin of neotropical poison frogs (Dendrobatidae). These alkaloids are derived from arthropod prey of the frogs, and are generally are believed to deter vertebrate predators. We developed a method to put ind...

  3. Flesh fly myiasis (Diptera, Sarcophagidae in Peruvian poison frogs genus Epipedobates (Anura, Dendrobatidae

    Directory of Open Access Journals (Sweden)

    Mattias Hagman

    2005-10-01

    Full Text Available In this note we review records of myiasis in poison frogs collected in various locations in Peru during 1982-2005 and present evidence that larger and medium-sized poison frogs (Epipedobates are infected with sarcophagid fly larvae.

  4. Hematological, Biochemical and Histopathological Studies on Marsh Frog, Rana ridibunda, Naturally Infected with Waltonella duboisi

    Directory of Open Access Journals (Sweden)

    A.M. Al-Attar

    2010-01-01

    Full Text Available The present study was aimed to evaluate the impact of Waltonella duboisi naturally infection in the marsh frog, Rana ridibunda. Healthy and infected frogs of both sexes were collected from Al-Qatif and Al-Hassa farms, Eastern Province, Saudi Arabia. The hematological, biochemical and histopathological changes were estimated in infected male and female frogs compared with healthy frogs. The values of red blood cell count, hemoglobin concentration, hematocrit, mean cell volume, mean corpuscular hemoglobin, mean corpuscular hemoglobin concentration and white blood cell count were statistically decreased in infected frogs. Infection with Waltonella duboisi induced significant reduction in the levels of serum glucose and total proteins, while the values of triglycerides cholesterol, creatinine, glutamic pyruvic acid transaminase and glutamic oxaloacetic acid transaminase were significantly elevated. Histopathological examination of stomach, small intestine, liver showed the larval developmental stages of Waltonella duboisi. A partially abnormal of testis and ovary structures with pronounced disturbance in quantity and quality of spermatogenesis and oogenesis processes were noted in infected of both sexes of frogs. From the present study, it is obviously that Waltonella duboisi caused many severe physiological and histopathological alterations in both sexes of the marsh frogs. Thus, more sincere ecological and scientific efforts are required to rescue the marsh frog population from parasitic infection, pathogenic factors and increases of mortality rate.

  5. Radioautographic and histologic investigation of skin in young and old frogs

    International Nuclear Information System (INIS)

    Age differences in the skin structure have been studied in young (one year-old) and aged (five and a half year- old) frogs, Xenopus laevis. The epidermis in young frogs is made up of an average of 6.3 and 4.7 layers of epithelial cells at abdominal and dorsal surfaces, respectively. In aged frogs, the number of respective cell layers at abdominal and dorsal surfaces increases to 8.8 and 5.6. The thickness of the dermis (spongiosum) in aged frogs is decrease d 25% on the abdominal side (from 267 μm to 207 μm) but is increased by 11% on the dorsal side (from 275 μm to 305 μm). The nucleolar index and 3H-uridine incorporation, as judged by radioautography, by epithelial cells are drastically reduced in aged frogs.

  6. Abundance of green tree frogs and insects in artificial canopy gaps in a bottomland hardwood forest.

    Energy Technology Data Exchange (ETDEWEB)

    Horn, Scott; Hanula, James L.; Ulyshen, Michael D.; Kilgo, John C.

    2005-01-01

    Horn, Scott, James L. Hanula, Michael D. Ulyshen, and John C. Kilgo. 2005. Abundance of green tree frogs and insects in artificial canopy gaps in a bottomland hardwood forest. Am. Midl. Nat. 153:321-326. Abstract: We found more green tree frogs (Hyla cinerea) in canopy gaps than in closed canopy forest. Of the 331 green tree frogs observed, 88% were in canopy gaps. Likewise, higher numbers and biomasses of insects were captured in the open gap habitat. Flies were the most commonly collected insect group accounting for 54% of the total capture. These data suggest that one reason green tree frogs were more abundant in canopy gaps was the increased availability of prey and that small canopy gaps provide early successional habitats that are beneficial to green tree frog populations.

  7. Frankixalus, a New Rhacophorid Genus of Tree Hole Breeding Frogs with Oophagous Tadpoles.

    Directory of Open Access Journals (Sweden)

    S D Biju

    Full Text Available Despite renewed interest in the biogeography and evolutionary history of Old World tree frogs (Rhacophoridae, this family still includes enigmatic frogs with ambiguous phylogenetic placement. During fieldwork in four northeastern states of India, we discovered several populations of tree hole breeding frogs with oophagous tadpoles. We used molecular data, consisting of two nuclear and three mitochondrial gene fragments for all known rhacophorid genera, to investigate the phylogenetic position of these new frogs. Our analyses identify a previously overlooked, yet distinct evolutionary lineage of frogs that warrants recognition as a new genus and is here described as Frankixalus gen. nov. This genus, which contains the enigmatic 'Polypedates' jerdonii described by Günther in 1876, forms the sister group of a clade containing Kurixalus, Pseudophilautus, Raorchestes, Mercurana and Beddomixalus. The distinctiveness of this evolutionary lineage is also corroborated by the external morphology of adults and tadpoles, adult osteology, breeding ecology, and life history features.

  8. Absence of tetrodotoxins in a captive-raised riparian frog, Atelopus varius.

    Science.gov (United States)

    Daly, J W; Padgett, W L; Saunders, R L; Cover, J F

    1997-05-01

    Bufonid frogs of the genus Atelopus contain two classes of skin toxins, namely the steroidal bufadienolides and the water-soluble tetrodotoxins. Frogs of the Panamanian species Atelopus varius have now been raised in captivity and levels in skin extracts of bufadienolides and of tetrodotoxin-like compounds assessed, using inhibition of [3H]ouabain binding and inhibition of [3H]saxitoxin binding, respectively. Levels of ouabain equivalents, corresponding to bufadienolides, were comparable to those found in wild-caught frogs from the same population in Panama, while tetrodotoxin-like activity was undetectable. The results strongly implicate environmental factors, perhaps symbiotic microorganisms, in the genesis of tetrodotoxins in the skin of frogs of the genus Atelopus, while indicating that the frog itself produces the skin bufadienolides. PMID:9203295

  9. Behavioral Responses of Northern Leopard Frogs (Rana pipiens to Roads and Traffic: Implications for Population Persistence

    Directory of Open Access Journals (Sweden)

    Lenore Fahrig

    2009-12-01

    Full Text Available A key goal in road ecology is to determine which species are most vulnerable to the negative effects of roads on population persistence. Theory suggests that species that avoid roads are less likely to be negatively affected by roads than those that do not avoid roads. The goal of this study was to take a step toward testing this prediction by evaluating the behavioral response to roads and traffic of a species whose populations are known to be negatively affected by roads and traffic, the northern leopard frog (Rana pipiens. We studied the movement patterns of northern leopard frogs during their spring migration from overwintering sites in a river to various breeding ponds that were disconnected from the river by roads. We performed short-distance translocations of migrating frogs, followed them visually, and documented their movement coordinates following each hop, both near the roads and in non-roaded areas. We found that frogs took longer to move near roads with more traffic and that their movement was quickest in areas without roads nearby. Frogs tended to deviate more from a straight-line course when they were released near roads than compared with control areas, but this response was independent of traffic volume. All frogs released near roads attempted to cross the road. On very low traffic roads (10.86 mean vehicles per hour, 94% of frogs crossed the road successfully, whereas at higher traffic roads (58.29 mean vehicles per hour 72% were successful. Our results suggest that frog's inability to avoid going onto roads and their slow movement combine to make them particularly vulnerable to road mortality, which likely explains the strong negative effects of roads on frog population abundance. Conservation efforts should focus on preventing frogs from accessing the road surface through the use of drift fencing and culverts.

  10. Response of the Italian agile frog (Rana latastei) to a Ranavirus, frog virus 3: a model for viral emergence in naïve populations.

    OpenAIRE

    Pearman, P. B.; Garner, T. W. J.; Straub, M.; Greber, U F

    2004-01-01

    Ranavirus (family Iridoviridae) is a genus of pathogens of poikilotherms, and some ranaviruses may play a role in widespread mortality of amphibians. Ecology of viral transmission in amphibians is poorly known but can be addressed through experimentation in the laboratory. In this study, we use the Ranavirus frog virus 3 (FV3) as an experimental model for pathogen emergence in naive populations of tadpoles. We simulated emerging disease by exposing tadpoles of the Italian agile frog (Rana lat...

  11. 论莫言小说《蛙》中的“蛙”意象%The Frog Image in the Novel Frog by Mo Yan

    Institute of Scientific and Technical Information of China (English)

    蒋卉

    2012-01-01

    从远古神话到到当代小说,从考古、民俗到文学想象,“蛙”意象的产生与发展经历了一个漫长而富有变化的过程。文章结合文学人类学的理论对莫言长篇小说《蛙》中的“蛙”意象进行深度分析,追溯到“蛙”原型中的“蛙女神”,将其与小说中突出的人物“姑姑”进行对比,揭示这一原型意象的运用对小说文化蕴涵的提升作用。%The image of frog has a long history since its creation and differs quite well in different texts like ancient mythology,contemporary novels,archeology,folklore and literary i- maginations. This paper analyzes the image of frog from the perspective of literary anthropolo- gy in the novel Frog by Mo Yan. A comparative, study of the protagonist,the aunt of the nar- rator in the novel,and the frog goddess,the prototype frog, will be conducted,which indicates that the archetypal image of frog helps to enrich cultural connotations of the novel.

  12. Periodic Solutions of a Model of Mitosis in Frog Eggs

    Institute of Scientific and Technical Information of China (English)

    Bei-ye Feng; Zuo-huan Zheng

    2002-01-01

    In this paper,we discuss a simplified model of mitosis in frog eggs proposed by M.T. Borisuk and J.J.Tyson in [1]. By using rigorous qualitative analysis, we prove the existence of the periodic solutions on a large scale and present the space region of the periodic solutions and the parameter region coresponding to the periodic solution. We also present the space region and the parameter region where there are no periodic solutions. The results are in accordance with the numerical results in [1] up to the qualitative property.

  13. Plasma membrane electron transport in frog blood vessels

    Indian Academy of Sciences (India)

    Rashmi P Rao; K Nalini; J Prakasa Rao

    2009-12-01

    In an attempt to see if frog blood vessels possess a plasma membrane electron transport system, the postcaval vein and aorta isolated from Rana tigrina were tested for their ability to reduce ferricyanide, methylene blue, and 2,6-dichloroindophenol. While the dyes remained unchanged, ferricyanide was reduced to ferrocyanide. This reduction was resistant to inhibition by cyanide and azide. Heptane extraction or formalin fixation of the tissues markedly reduced the capability to reduce ferricyanide. Denuded aortas retained only 30% of the activity of intact tissue. Our results indicate that the amphibian postcaval vein and aorta exhibit plasma membrane electron transport

  14. Taxonomy Icon Data: Western clawed frog [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Western clawed frog Xenopus tropicalis Chordata/Vertebrata/Amphibia Xenopus_tropicalis_L.png Xenopus_tropica...lis_NL.png Xenopus_tropicalis_S.png Xenopus_tropicalis_NS.png http://biosciencedbc....jp/taxonomy_icon/icon.cgi?i=Xenopus+tropicalis&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Xenopus+tropical...is&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Xenopus+tropical...is&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Xenopus+tropicalis&t=NS http://togodb.biosciencedbc.jp/togodb/view/taxonomy_icon_comment_en?species_id=137 ...

  15. Landing in basal frogs: evidence of saltational patterns in the evolution of anuran locomotion

    Science.gov (United States)

    Essner, Richard L.; Suffian, Daniel J.; Bishop, Phillip J.; Reilly, Stephen M.

    2010-10-01

    All frogs are assumed to jump in a similar manner by rapidly extending hindlimbs during the propulsive phase and rotating the limbs forward during flight in order to land forelimbs first. However, studies of jumping behavior are lacking in the most primitive living frogs of the family Leiopelmatidae. These semi-aquatic or terrestrial anurans retain a suite of plesiomorphic morphological features and are unique in using an asynchronous (trot-like) rather than synchronous “frog-kick” swimming gait of other frogs. We compared jumping behavior in leiopelmatids to more derived frogs and found that leiopelmatids maintain extended hindlimbs throughout flight and landing phases and do not land on adducted forelimbs. These “belly-flop” landings limit the ability for repeated jumps and are consistent with a riparian origin of jumping in frogs. The unique behavior of leiopelmatids shows that frogs evolved jumping before they perfected landing. Moreover, an inability to rapidly cycle the limbs may provide a functional explanation for the absence of synchronous swimming in leiopelmatids.

  16. The first see-through frog created by breeding: description, inheritance patterns, and dermal chromatophore structure.

    Science.gov (United States)

    Sumida, Masayuki; Islam, Mohammed Mafizul; Igawa, Takeshi; Kurabayashi, Atsushi; Furukawa, Yukari; Sano, Naomi; Fujii, Tamotsu; Yoshizaki, Norio

    2016-01-01

    We have succeeded in creating see-through frogs from natural color mutants of the Japanese brown frog Rana japonica, which usually possesses an ochre or brown back; this coloration enables the organs, blood vessels, and eggs to be observed through the skin without performing dissection. We crossed two kinds of recessive color mutant (black-eyed and gray-eyed) frogs through artificial insemination, and F2 offspring produced frogs whose skin is translucent throughout the life cycle. Three kinds of dermal chromatophores-xanthophores, iridophores, and melanophores-are observed in a layered arrangement in the skin of wild-type frogs, but few chromatophores were present in the skin of the see-through frogs. The translucent skin enables observation of organ growth and cancer formation and progression in the animal, which can be monitored over its entire life without the need for dissection. See-through frogs thus provide a useful animal model for environmental, medical, and biological research. PMID:27080918

  17. Prevalence of malformed frogs in Kaoping and Tungkang river basins of southern Taiwan.

    Science.gov (United States)

    Huang, Da-Ji; Chiu, Yuh-Wen; Chen, Chien-Min; Huang, Kai-Hsiang; Wang, Shu-Yin

    2010-05-01

    In this study we found many amphibians with bizarre appearances, known as malformations in Pingtung County southern Taiwan. For this investigation we collected frogs inhabiting the Kaoping and Tungkang river watersheds between February 2006 and June 2007. Among the total number of 10,909 normal frogs (i.e., anurans) collected during the investigation period, the Indian rice frogs (Rana limnocharis) account for the greatest number next is the Chinese bullfrog (Rana rugulosa). Of all the 244 captured malformed frogs, the Indian rice frog account for the greatest proportion. These malformed frogs have their main distribution in upstream areas of these two rivers. Our result indicates that the appearance rate of malformed frogs is 1.8% in the upstream reaches of the Kaoping River and 2.6%, and 0.8%, respectively in the upstream and midstream reaches of the Tungkang river. The most-commonly-found malformation is the lack of palms, followed by the lack of appendages, exostosis, and a malformed appendicular. It is, therefore, reasonable to speculate that the causes for the malformation may be related to the increased organic pollutants and agricultural chemicals used in the upstream reaches of these two rivers. PMID:21047008

  18. Poison frogs rely on experience to find the way home in the rainforest.

    Science.gov (United States)

    Pašukonis, Andrius; Warrington, Ian; Ringler, Max; Hödl, Walter

    2014-11-01

    Among vertebrates, comparable spatial learning abilities have been found in birds, mammals, turtles and fishes, but virtually nothing is known about such abilities in amphibians. Overall, amphibians are the most sedentary vertebrates, but poison frogs (Dendrobatidae) routinely shuttle tadpoles from terrestrial territories to dispersed aquatic deposition sites. We hypothesize that dendrobatid frogs rely on learning for flexible navigation. We tested the role of experience with the local cues for poison frog way-finding by (i) experimentally displacing territorial males of Allobates femoralis over several hundred metres, (ii) using a harmonic direction finder with miniature transponders to track these small frogs, and (iii) using a natural river barrier to separate the translocated frogs from any familiar landmarks. We found that homeward orientation was disrupted by the translocation to the unfamiliar area but frogs translocated over similar distances in their local area showed significant homeward orientation and returned to their territories via a direct path. We suggest that poison frogs rely on spatial learning for way-finding in their local area.

  19. Pathological Study of Blood Parasites in Rice Field Frogs, Hoplobatrachus rugulosus (Wiegmann, 1834

    Directory of Open Access Journals (Sweden)

    Achariya Sailasuta

    2011-01-01

    Full Text Available One hundred and forty adult rice field frogs, Hoplobatrachus rugulosus (Wiegmann, 1834, were collected in Srakaew province, Thailand. For blood parasite examination, thin blood smears were made and routinely stained with Giemsa. The results showed that 70% of the frogs (98/140 were infected with 5 species of blood parasites, including a Trypanosoma rotatorium-like organism, Trypanosoma chattoni, Hepatozoon sp. a, Hepatozoon sp. b, and Lankesterella minima. Pathological examination of the liver, lung, spleen, and kidney of the frogs that were apparently infected with one of these blood parasites were collected and processed by routine histology and subsequently stained with haematoxylin and eosin. Histopathological findings associated with the Trypanosoma rotatorium-like organism and Trypanosoma chattoni-infected frogs showed no pathological lesions. Hepatozoon sp. a and Hepatozoon sp. b-infected frogs developed inflammatory lesions predominantly in the liver, demonstrating granuloma-like lesions with Hepatozoon sp. meronts at the centre. Tissue sections of Lankesterella minima-infected frogs also showed lesions. Liver and spleen showed inflammatory lesions with an accumulation of melanomacrophage centres (MMCs surrounding the meronts and merozoites. It is suggested that Hepatozoon sp. a, Hepatozoon sp. b, and Lankesterella minima-infections are capable of producing inflammatory lesions in the visceral organs of rice field frogs, and the severity of lesions is tentatively related to levels of parasitemia.

  20. Pesticides in amphibian habitats of Central and Northern California, USA

    Science.gov (United States)

    Fellers, Gary M.; Sparling, W; McConnell, Laura; Kleeman, Patrick M.; Drakeford, Leticia

    2013-01-01

    Previous studies have indicated that toxicity from pesticide exposure may be contributing to amphibian declines in California and that atmospheric deposition could be a primary pathway for pesticides to enter amphibian habitats. We report on a survey of California wetlands sampled along transects associated with Lassen Volcanic National Park, Lake Tahoe, Yosemite National Park, and Sequoia National Park. Each transect ran from the Pacific coast to the Cascades or Sierra Nevada mountains. Pacific chorus frogs (Pseudacris regilla), water, and sediment were collected from wetlands in 2001 and 2002. Twenty-three pesticides were found in frog, water, or sediment samples. Six contaminants including trifluralin, α-endosulfan, chlordanes, and trans-nonachlor were found in adult P. regilla. Seventeen contaminants were found in sediments, including endosulfan sulfate, chlordanes, 1-chloro-4-[2,2-dichloro-1-(4-chlorophenyl)ethenyl]benzene (4,4′-DDE), and chlorpyrifos. The mean number of chemicals detected per pond in sediments was 2.4 (2.5, standard deviation). In water, 17 chemicals were detected, with β-endosulfan being present in almost all samples. Trifluralin, chlordanes, and chlorpyrifos were the next most common. The mean number of chemicals in water per pond was 7.8 (2.9). With the possible exception of chlorpyrifos oxon in sediments and total endosulfans, none of the contaminants exceeded known lethal or sublethal concentrations in P. regilla tissue. Endosulfans, chlorpyrifos, and trifluralin were associated with historic and present day population status of amphibians. Cholinesterase, an essential neurological enzyme that can be depressed by certain pesticides, was reduced in tadpoles from areas with the greatest population declines.

  1. Octylphenol induced gene expression in testes of Frog, Rana chensinensis.

    Science.gov (United States)

    Li, Xinyi; Liu, Jia; Zhang, Yuhui

    2016-06-01

    Octylphenol (OP) is an endocrine-disrupting chemical (EDC), which can disrupt the reproductive system. To understand the effect of OP, a subtractive cDNA library was constructed using suppression subtractive hybridization (SSH) to identify alterations of gene transcription in the testes of the frog Rana chensinensis after OP exposure. Two hundred positive clones were selected and 134 sequences of gene fragments were produced from the subtractive library randomly. These genes were identified to be involved in metabolic process, cellular process, biological regulation, stimulus, immune system and female pregnancy process. In order to verify the efficiency of the subtractive cDNA library, PSG9 and PAPP-A were analyzed further as two representatives of differentially expressed transcription genes using semi-quantitative RT-PCR. Our result was the first successful construction of the subtractive cDNA library in frog testes after OP treatment. Based on this cDNA library, OP was shown to affect multiple physiological processes including inducing immune response, disrupting the steroid hormone synthesis and influencing spermatogenesis in the testis by up-regulation of specific genes. PMID:26896894

  2. The regulation of volume and ion composition in frog skin.

    Science.gov (United States)

    Ferreira, K T; Ferreira, H G

    1981-08-20

    1. Chemical determinations of Cl- in frog skin indicate that the intracellular concentration of this ion is above that corresponding to an equilibrium distribution. 2. Published data on Na+ efflux from the cell compartments into the two external bathing solutions, and on unidirectional fluxes across the whole preparation suggest that there are large unidirectional fluxes across the basolateral membranes. 3. Cl- uptake from the mucosal barrier is very small, and the removal of Cl- from the mucosal bathing solution does not affect the intracellular Cl- concentration. 4. Removal of Cl- from the serosal bathing solution produces a drastic decrease in cell Cl- together with a loss of water. 5. This is accompanied by a less marked effect on Na+ and K+ content of the cells. 6. The removal of Na+ from the serosal bathing solution produces also a decrease in Cl-, Na+ and K+ content of the cells with a marked loss of water. 7. It is suggested that the basolateral membrane of the frog skin is the site of mechanisms able to regulate volume and ion composition of the epithelial cells and that part of these mechanisms consists of a coupling between the movements of Na+ and Cl-. PMID:7295713

  3. New genus of diminutive microhylid frogs from Papua New Guinea

    Directory of Open Access Journals (Sweden)

    Fred Kraus

    2010-06-01

    Full Text Available A new genus of diminutive (10.1-11.3 mm microhylid frogs is described from New Guinea that is unique in its combination ofonly seven presacral vertebrae, a reduced phalangeal formula that leaves the first fingers and first toes as vestigial nubs, and reduction of the prepollex and prehallux to single elements. Relationships to other genera are unknown, but overall similarity suggests some relationship to Cophixalus, although that genus also differs in some muscle characters and likely remains paraphyletic. The new genus contains two species, which are among the smallest known frogs in the world. Their miniaturization may be related to their inhabiting leaf litter, exploitation of which may for small size. The new genus is currently known only from one mountaintop in the southeasternmost portion of New Guinea and another on a nearby island. This region is part of the East Papuan Composite Terrane and, should this lineage prove endemic to that region, it may suggest that it originated prior to that geological unit’s docking with mainland New Guinea at 23–29 MY.

  4. The genetic structure of a relict population of wood frogs

    Science.gov (United States)

    Scherer, Rick; Muths, Erin; Noon, Barry; Oyler-McCance, Sara

    2012-01-01

    Habitat fragmentation and the associated reduction in connectivity between habitat patches are commonly cited causes of genetic differentiation and reduced genetic variation in animal populations. We used eight microsatellite markers to investigate genetic structure and levels of genetic diversity in a relict population of wood frogs (Lithobates sylvatica) in Rocky Mountain National Park, Colorado, where recent disturbances have altered hydrologic processes and fragmented amphibian habitat. We also estimated migration rates among subpopulations, tested for a pattern of isolation-by-distance, and looked for evidence of a recent population bottleneck. The results from the clustering algorithm in Program STRUCTURE indicated the population is partitioned into two genetic clusters (subpopulations), and this result was further supported by factorial component analysis. In addition, an estimate of FST (FST = 0.0675, P value \\0.0001) supported the genetic differentiation of the two clusters. Estimates of migration rates among the two subpopulations were low, as were estimates of genetic variability. Conservation of the population of wood frogs may be improved by increasing the spatial distribution of the population and improving gene flow between the subpopulations. Construction or restoration of wetlands in the landscape between the clusters has the potential to address each of these objectives.

  5. Evolution of advertisement calls in African clawed frogs

    Science.gov (United States)

    Tobias, Martha L.; Evans, Ben J.; Kelley, Darcy B.

    2014-01-01

    Summary For most frogs, advertisement calls are essential for reproductive success, conveying information on species identity, male quality, sexual state and location. While the evolutionary divergence of call characters has been examined in a number of species, the relative impacts of genetic drift or natural and sexual selection remain unclear. Insights into the evolutionary trajectory of vocal signals can be gained by examining how advertisement calls vary in a phylogenetic context. Evolution by genetic drift would be supported if more closely related species express more similar songs. Conversely, a poor correlation between evolutionary history and song expression would suggest evolution shaped by natural or sexual selection. Here, we measure seven song characters in 20 described and two undescribed species of African clawed frogs (genera Xenopus and Silurana) and four populations of X. laevis. We identify three call types — click, burst and trill — that can be distinguished by click number, call rate and intensity modulation. A fourth type is biphasic, consisting of two of the above. Call types vary in complexity from the simplest, a click, to the most complex, a biphasic call. Maximum parsimony analysis of variation in call type suggests that the ancestral type was of intermediate complexity. Each call type evolved independently more than once and call type is typically not shared by closely related species. These results indicate that call type is homoplasious and has low phylogenetic signal. We conclude that the evolution of call type is not due to genetic drift, but is under selective pressure. PMID:24723737

  6. Eggshell thickness variation in red-legged partridge (Alectoris rufa) from Spain

    DEFF Research Database (Denmark)

    Castilla, Aurora M.; de Aragón, Juan Martínez; Herrel, Anthony;

    2009-01-01

    in an agricultural area (wild eggs) and eggs from game farms (farm eggs). Wild eggs had shells significantly thicker (  = 0.32 mm, n = 74) than farm eggs (  = 0.28 mm, n = 89), despite game farm partridges being fed a diet rich in calcium and not exposed to agricultural pollutants. Eggshell thickness did not affect...

  7. Physical characteristics of the eggs of red-legged partridge (Alectoris rufa reared in captivity

    Directory of Open Access Journals (Sweden)

    S. Ribeiro

    2013-12-01

    Full Text Available O objetivo do presente estudo foi avaliar os efeitos da idade das fêmeas (um, dois e três anos e do mês de postura (março, abril e maio sobre as características físicas dos ovos da perdiz vermelha (Alectoris rufa criada em cativeiro. O peso (W, o comprimento máximo (L e a largura máxima (B de 2878 ovos foram determinados diretamente, enquanto o índice de forma (B/L, o volume (V e a superfície (S foram calculados com base nos parâmetros determinados diretamente. A análise mostrou diferenças significativas (P0,05. Observaram-se diferenças significativas (P<0,01 na largura máxima e no índice de forma do ovo entre as diferentes classes de idades, com valores mais elevados nas fêmeas mais velhas e no período de postura mais tardio. O volume dos ovos estimados por meio de V1= 0,51LB2e V2=0,913W foi afetado significativamente (P<0,01 pela idade e pelo mês de postura, bem como as áreas, S1=4.835W0,662, S2=4,951V10,666e S3=4,951V20,666, as quais apresentaram os mesmos efeitos.

  8. Life History of the Red-legged Thrush (Mimocichla plumbea ardosiacea) in Puerto Rico

    NARCIS (Netherlands)

    Rolle, Francis J.

    1963-01-01

    To the ornithologist the West Indies offer an assortment of field problems. In an area where it is unlikely that new species of birds will be discovered, and where the life histories of only a handful of birds are known, concentrated study of individual life histories becomes of prime importance. Th

  9. Frog2: Efficient 3D conformation ensemble generator for small compounds

    OpenAIRE

    Miteva, Maria A; Guyon, Frederic; Tufféry, Pierre

    2010-01-01

    Frog is a web tool dedicated to small compound 3D generation. Here we present the new version, Frog2, which allows the generation of conformation ensembles of small molecules starting from either 1D, 2D or 3D description of the compounds. From a compound description in one of the SMILES, SDF or mol2 formats, the server will return an ensemble of diverse conformers generated using a two stage Monte Carlo approach in the dihedral space. When starting from 1D or 2D description of compounds, Frog...

  10. Biomimetic agent based modelling using male Frog calling behaviour as a case study

    DEFF Research Database (Denmark)

    Jørgensen, Søren V.; Demazeau, Yves; Christensen-Dalsgaard, Jakob;

    2014-01-01

    A new agent-based modelling tool has been developed to allow the modelling of populations of individuals whose interactions are characterised by tightly timed dynamics. The tool was developed to model male frog calling dynamics, to facilitate research into what local rules may be employed...... Frog, E. coqui, is implemented as a case study for the presentation and discussion of the tool, and results from this model are presented. RANA, in its present stage of development, is shown to be able to handle the problem of modelling calling frogs, and several fruitful extensions are proposed...

  11. A field evaluation of frogs as a potential source of secondary organophosphorus insecticide poisoning

    Science.gov (United States)

    Powell, G.V.N.; DeWeese, L.R.; Lamont, T.G.

    1982-01-01

    Because amphibians are relatively resistant to organophosphorus insecticides and can bioaccumulate residues to high levels, they may be a source of secondary poisoning for vertebrates that feed on them. This hypothesis was tested by determining residues in breeding upland chorus frogs Pseudacris triseriata, that were collected from ponds treated with the organophosphorus insecticide fenthion. Frogs were collected up to 3-days posttreatment in four areas that were treated with fenthion formulated in either diesel oil or water. No residues of fenthion were detected above the 0.01 ppm level of analytical sensitivity. These results indicate that the frogs were not a likely source of secondary poisoning for predatory vertebrates.

  12. Effects of predatory fish on survival and behavior of larval gopher frogs (Rana capito) and Southern Leopard Frogs (Rana sphenocephala)

    Science.gov (United States)

    Gregoire, D.R.; Gunzburger, M.S.

    2008-01-01

    Southern Leopard Frogs, Rana sphenocephala, are habitat generalists occurring in virtually all freshwater habitats within their geographic range, whereas Gopher Frogs, Rana capito, typically breed in ponds that do not normally contain fish. To evaluate the potential for predation by fish to influence the distribution of these species, we conducted a randomized factorial experiment. We examined the survival rate and behavior of tadpoles when exposed to Warmouth Sunfish, Lepomis gulosus, Banded Sunfish, Enneacanthus obesus, and Eastern Mosquitofish, Gambusia holbrooki. We also conducted a choice experiment to examine the survival rate of the two species of tadpoles when a predator is given a choice of both species simultaneously. Lepomis gulosus consumed the most tadpoles and ate significantly more tadpoles of R. capito than R. sphenocephala. Gambusia holbrooki injured the most tadpoles, especially R. capito. Enneacanthus obesus did not have an effect on behavior or survival of either anuran species. Tadpoles of both anurans increased hiding when in the presence of L. gulosus and G. holbrooki, but a greater proportion of R. capito hid than did R. sphenocephala. Our results suggest that R. capito are more vulnerable to predation by fish than are R. sphenocephala. The introduction of fish may play a role in population declines of certain anurans breeding in normally fish-free wetlands, and even small fish, such as mosquitofish, may have significant negative effects on the tadpoles of R. capito. Copyright 2008 Society for the Study or Amphibians and Reptiles.

  13. Authentic Assessment in California.

    Science.gov (United States)

    Educational Leadership, 1989

    1989-01-01

    Describes the teacher-developed California Assessment Program (CAP) writing measure, designed to support California's reform curriculum and based on matrix sampling techniques. This program will be supplemented by literature and mathematics assessments. The greatest challenge is designing an assessment to match the state's new history and social…

  14. California's English Learner Students

    Science.gov (United States)

    Hill, Laura E.

    2012-01-01

    English Learner (EL) students in California's schools are numerous and diverse, and they lag behind their native-English-speaking peers. Closing the achievement gap for EL students has been a long-standing goal for California educators, and there are some signs of success. Now that EL funding and curriculum issues are receiving a fresh level of…

  15. Adaptive Grouping Cloud Model Shuffled Frog Leaping Algorithm for Solving Continuous Optimization Problems

    Directory of Open Access Journals (Sweden)

    Haorui Liu

    2016-01-01

    Full Text Available The shuffled frog leaping algorithm (SFLA easily falls into local optimum when it solves multioptimum function optimization problem, which impacts the accuracy and convergence speed. Therefore this paper presents grouped SFLA for solving continuous optimization problems combined with the excellent characteristics of cloud model transformation between qualitative and quantitative research. The algorithm divides the definition domain into several groups and gives each group a set of frogs. Frogs of each region search in their memeplex, and in the search process the algorithm uses the “elite strategy” to update the location information of existing elite frogs through cloud model algorithm. This method narrows the searching space and it can effectively improve the situation of a local optimum; thus convergence speed and accuracy can be significantly improved. The results of computer simulation confirm this conclusion.

  16. Western spotted frog (Rana pretiosa) distribution in the Bonneville Basin of western Utah: Research in progress

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report provides information on the western spotted frog Rana pretiosa which occurs in Tule Valley, Utah. The following topics are discussed; general...

  17. Effects of oxymorphazone in frogs: long lasting antinociception in vivo, and apparently irreversible binding in vitro

    International Nuclear Information System (INIS)

    Oxymorphazone was found to be a relatively weak antinociceptive drug in intact frog (Rana esculenta) when acetic acid was used as pain stimulus. Frogs remained analgesic for at least 48 hrs following oxymorphazone administration. The ligand increased the latency of wiping reflex in spinal frogs too. There effects were blocked by naloxone. In equilibrium binding studies (3H)oxymorphazone had high affinity to the opioid receptors of frog brain and spinal cord as well. Kinetic experiments show that only 25% of the bound (3H)oxymorphazone is readily dissociable. Preincubation of the membranes with labeled oxymorphazone results in a washing resistant inhibition of the opioid binding sites. At least 70% of the (3H)oxymorphazone specific binding is apparently irreversible after reaction at 5 nM ligand concentration, and this can be enhanced by a higher concentration of tritiated ligand

  18. The Developmental Effects Of A Municipal Wastewater Effluent On The Northern Leopard Frog, Rana pipiens

    Science.gov (United States)

    Wastewater effluents are complex mixtures containing a variety of anthropogenic compounds, many of which are known endocrine disruptors. In order to characterize the development and behavorial effects of such a complex mixture, northern leopard frogs, Rana pipiens, were e...

  19. Exploratory evaluation of nutrient enrichment and frog response at Conboy Lake National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — We sampled nutrient and water quality parameters and surveyed Oregon spotted frogs (Rana pretiosa) life stages (eggs, larvae and recently metamorphosed juveniles)...

  20. Okefenokee and Banks Lake National Wildlife Refuge 2009 Frog Abnormality Survey Summary

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Summary of frog observations for abnormal conditions at select sites on both Okefenokee and Banks Lake NWRs. During the 2009 summer, STEP students Zach Carter along...

  1. The Inconsistency Between The Notorious Jumping Frog of Calaveras County and The Man That Corrupted Hadleyburg

    Institute of Scientific and Technical Information of China (English)

    TAN Wen-hua

    2015-01-01

    This paper compares Mark Twain’s The Notorious Jumping Frog of Calaveras County and The Man That Corrupted Had⁃leyburg, in terms of their stylistic and semantic inconsistency, specifically, their narrative technique and moral vision.

  2. Adaptive Grouping Cloud Model Shuffled Frog Leaping Algorithm for Solving Continuous Optimization Problems.

    Science.gov (United States)

    Liu, Haorui; Yi, Fengyan; Yang, Heli

    2016-01-01

    The shuffled frog leaping algorithm (SFLA) easily falls into local optimum when it solves multioptimum function optimization problem, which impacts the accuracy and convergence speed. Therefore this paper presents grouped SFLA for solving continuous optimization problems combined with the excellent characteristics of cloud model transformation between qualitative and quantitative research. The algorithm divides the definition domain into several groups and gives each group a set of frogs. Frogs of each region search in their memeplex, and in the search process the algorithm uses the "elite strategy" to update the location information of existing elite frogs through cloud model algorithm. This method narrows the searching space and it can effectively improve the situation of a local optimum; thus convergence speed and accuracy can be significantly improved. The results of computer simulation confirm this conclusion.

  3. Instruction Manual and Frog Survey Protocols for Region 1 National Wildlife Refuges, East-side Zone

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This manual is intended to assist biologists wishing to conduct surveys for frogs and toads. The document includes detailed information on how to conduct surveys,...

  4. Semaphoring in an earless frog: the origin of a novel visual signal.

    Science.gov (United States)

    Lindquist, E D; Hetherington, T E

    1998-10-01

    Social communication in anuran amphibians (frogs and toads) is mediated predominantly by acoustic signals. Unlike most anurans, the Panamanian golden frog, Atelopus zeteki, lacks a standard tympanic middle ear and appears to have augmented its communicatory repertoire to include rotational limb motions as visual signals, referred to here as semaphores. The communicatory nature of semaphoring was inferred from experimental manipulations using mirrored self-image presentations and nonresident introductions. Male frogs semaphored significantly more when presented with a mirrored self-image than with a nonreflective control. Novel encounters between resident males and nonresident frogs demonstrated that semaphores were used directionally and were displayed toward target individuals. Females semaphored frequently and this observation represents a rare case of signaling by females in a typically male-biased communicatory regime. Semaphore actions were clearly linked to a locomotory gait pattern and appear to have originated as an elaboration of a standard stepping motion. PMID:24399272

  5. Data on the isolation of immunoglobulin from the serum of the green frog: Rana esculenta

    OpenAIRE

    Stošić Svetlana; Divjak Isidora; Ješić Snežana; Nešić V.; Račić A.; Popović Nada

    2006-01-01

    Even though the green frog (Rana esculenta) is often used as an experimental model for further studies of physiological laws, little is still known about its serum proteins and their role in immunity. Its serum proteins have been studied quite extensively, as when they are taken up into the organism of another animal they represent antigens themselves. In this work, an attempt was made to isolate some frog serum proteins and to investigate the electrophoretic qualities of the isolated compone...

  6. Effects of X-irradiation on some aspects of protein metabolism in the frog, Rana hexadactyla

    International Nuclear Information System (INIS)

    Changes in the level of total proteins and protease in brain, muscle and liver tissues of normal and X-irradiated frogs were determined. Low doses of radiation produced an increment in protein level while high doses produced decrement. However, protease activity at all doses exhibited an elevatory trend. Exposure of frogs to lethal doses resulted in increased protease activity and decreased protein content during post-irradiation periods. The results are discussed on the basis of protein destruction and lysosomal damage. (auth.)

  7. Interference of a short-chain phospholipid with ion transport pathways in frog skin

    DEFF Research Database (Denmark)

    Unmack, M A; Frederiksen, O; Willumsen, N J

    1997-01-01

    The effects of mucosal application of the short-chain phospholipid didecanoyl-L-alpha-phosphatidylcholine (DDPC; with two saturated 10-carbon acyl chains) on active Na+ transport and transepithelial conductance (G) in the frog skin (Rana temporaria) were investigated. Active Na+ transport...... of the frog skin epithelium and opens a paracellular tight junction pathway. Both effects may be caused by incorporation of DDPC in the apical cell membrane....

  8. Landscape associations of frog and toad species in Iowa and Wisconsin, U.S.A

    Science.gov (United States)

    Knutson, M.G.; Sauer, J.R.; Olsen, D.A.; Mossman, M.J.; Hemesath, L.M.; Lannoo, M.J.; Kaiser, Hinrich; Casper, Gary S.; Bernstein, Neil P.

    2000-01-01

    Landscape habitat associations of frogs and toads in Iowa and Wisconsin were tested to determine whether they support or refute previous general habitat classifications. We examined which Midwestern species shared similar habitats to see if these associations were consistent across large geographic areas (states). Rana sylvatica (wood frog), Hyla versicolor (eastern gray treefrog), Pseudacris crucifer (spring peeper), and Acris crepitans (cricket frog) were identified as forest species, P. triseriata (chorus frog), H. chrysoscelis (Cope's gray treefrog), R. pipiens (leopard frog), and Bufo americanus (American toad) as grassland species, and R. catesbeiana (bullfrog), R. clamitans (green frog), R. palustris (pickerel frog), and R. septentrionalis (mink frog) as lake or stream species. The best candidates to serve as bioindicators of habitat quality were the forest species R. sylvatica, H. versicolor, and P. crucifer, the grassland species R. pipiens and P. triseriata, and a cold water wetland species, R. palustris. Declines of P. crucifer, R. pipiens, and R. palustris populations in one or both states may reflect changes in habitat quality. Habitat and community associations of some species differed between states, indicating that these relationships may change across the range of a species. Acris crepitans may have shifted its habitat affinities from open habitats, recorded historically, to the more forested habitat associations we recorded. We suggest contaminants deserve more investigation regarding the abrupt and widespread declines of this species. Interspersion of different habitat types was positively associated with several species. A larger number of wetland patches may increase breeding opportunities and increase the probability of at least one site being suitable. We noted consistently negative associations between anuran species and urban development. Given the current trend of urban growth and increasing density of the human population, declines of

  9. Glycogen accumulation in normal and irradiated minced muscle autografts on frog gastrocnemius

    International Nuclear Information System (INIS)

    Alterations induced in glycogen content and phosphorylase activity have been studied in normal and irradiated minced muscle autografts on frog gastrocnemius at days 1, 3, 5, 7, 10, 15 and 30 postgrafting. The changes observed in the glycogen content and phosphorylase activity conform to the degeneration and regeneration phases of muscle repair. An attempt has been made to explain the altered glycogen utilizing capacities of the frog skeletal muscle during its repair and regeneration. (author)

  10. Strategies for assessing the implications of malformed frogs for environmental health.

    OpenAIRE

    Burkhart, J G; Ankley, G; Bell, H; Carpenter, H.; Fort, D.; Gardiner, D; Gardner, H; Hale, R; Helgen, J C; Jepson, P.; Johnson, D.; Lannoo, M.; Lee, D; Lary, J; Levey, R

    2000-01-01

    The recent increase in the incidence of deformities among natural frog populations has raised concern about the state of the environment and the possible impact of unidentified causative agents on the health of wildlife and human populations. An open workshop on Strategies for Assessing the Implications of Malformed Frogs for Environmental Health was convened on 4-5 December 1997 at the National Institute of Environmental Health Sciences in Research Triangle Park, North Carolina. The purpose ...

  11. Sexual differences in prevalence of a new species of trypanosome infecting túngara frogs

    Directory of Open Access Journals (Sweden)

    Ximena E. Bernal

    2016-04-01

    Full Text Available Trypanosomes are a diverse group of protozoan parasites of vertebrates transmitted by a variety of hematophagous invertebrate vectors. Anuran trypanosomes and their vectors have received relatively little attention even though these parasites have been reported from frog and toad species worldwide. Blood samples collected from túngara frogs (Engystomops pustulosus, a Neotropical anuran species heavily preyed upon by eavesdropping frog-biting midges (Corethrella spp., were examined for trypanosomes. Our results revealed sexual differences in trypanosome prevalence with female frogs being rarely infected (<1%. This finding suggests this protozoan parasite may be transmitted by frog-biting midges that find their host using the mating calls produced by male frogs. Following previous anuran trypanosome studies, we examined 18S ribosomal RNA gene to characterize and establish the phylogenetic relationship of the trypanosome species found in túngara frogs. A new species of giant trypanosome, Trypanosoma tungarae n. sp., is described in this study. Overall the morphometric data revealed that the trypomastigotes of T. tungarae n. sp. are similar to other giant trypanosomes such as Trypanosoma rotatorium and Trypanosoma ranarum. Despite its slender and long cell shape, however, 18S rRNA gene sequences revealed that T. tungarae n. sp. is sister to the rounded-bodied giant trypanosome, Trypanosoma chattoni. Therefore, morphological convergence explains similar morphology among members of two non-closely related groups of trypanosomes infecting frogs. The results from this study underscore the value of coupling morphological identification with molecular characterization of anuran trypanosomes.

  12. Checklist and Simple Identification Key for Frogs and Toads from District IV of The MADA Scheme, Kedah, Malaysia.

    Science.gov (United States)

    Jaafar, Ibrahim; Chai, Teoh Chia; Sah, Shahrul Anuar Mohd; Akil, Mohd Abdul Muin Md

    2009-12-01

    A survey was conducted to catalogue the diversity of anurans in District IV of the Muda Agriculture Development Authority Scheme (MADA) in Kedah Darul Aman, Malaysia, from July 1996 to January 1997. Eight species of anurans from three families were present in the study area. Of these, the Common Grass Frog (Fejevarya limnocharis) was the most abundant, followed by Mangrove Frog (Fejevarya cancrivora), Long-legged Frog (Hylarana macrodactyla), and Common Toad (Duttaphrynus melanostictus). Puddle Frog (Occidozyga lima), Taiwanese Giant Frog (Hoplobatrachus rugulosus), and Banded Bullfrog (Kaluola pulchra) were rare during the sampling period, and only one Paddy Frog (Hylarana erythraea) was captured. A simple identification key for the anurans of this area is included for use by scientists and laymen alike. PMID:24575178

  13. Evaluating group housing strategies for the ex-situ conservation of harlequin frogs (Atelopus spp.) using behavioral and physiological indicators.

    Science.gov (United States)

    Cikanek, Shawna J; Nockold, Simon; Brown, Janine L; Carpenter, James W; Estrada, Angie; Guerrel, Jorge; Hope, Katharine; Ibáñez, Roberto; Putman, Sarah B; Gratwicke, Brian

    2014-01-01

    We have established ex situ assurance colonies of two endangered Panamanian harlequin frogs, Atelopus certus and Atelopus glyphus, but observed that males fought with each other when housed as a group. Housing frogs individually eliminated this problem, but created space constraints. To evaluate the potential stress effects from aggressive interactions when grouping frogs, we housed male frogs in replicated groups of one, two, and eight. We measured aggressive behavioral interactions and fecal glucocorticoid metabolite (GC) concentrations as indicators of stress in each tank. In both small and large groups, frogs initially interacted aggressively, but aggressive interactions and fecal GCs declined significantly after the first 2 weeks of being housed together, reaching the lowest levels by week 4. We conclude that aggressive interactions in same-sex groups of captive Atelopus may initially cause stress, but the frogs become habituated within a few weeks and they can safely be housed in same-sex groups for longer periods of time. PMID:24587290

  14. Evaluating group housing strategies for the ex-situ conservation of harlequin frogs (Atelopus spp. using behavioral and physiological indicators.

    Directory of Open Access Journals (Sweden)

    Shawna J Cikanek

    Full Text Available We have established ex situ assurance colonies of two endangered Panamanian harlequin frogs, Atelopus certus and Atelopus glyphus, but observed that males fought with each other when housed as a group. Housing frogs individually eliminated this problem, but created space constraints. To evaluate the potential stress effects from aggressive interactions when grouping frogs, we housed male frogs in replicated groups of one, two, and eight. We measured aggressive behavioral interactions and fecal glucocorticoid metabolite (GC concentrations as indicators of stress in each tank. In both small and large groups, frogs initially interacted aggressively, but aggressive interactions and fecal GCs declined significantly after the first 2 weeks of being housed together, reaching the lowest levels by week 4. We conclude that aggressive interactions in same-sex groups of captive Atelopus may initially cause stress, but the frogs become habituated within a few weeks and they can safely be housed in same-sex groups for longer periods of time.

  15. Chytridiomycosis in wild frogs from southern Costa Rica

    Science.gov (United States)

    Lips, Karen R.; Green, D.E.; Papendick, R.

    2003-01-01

    In 1993, the amphibian fauna of Las Tablas, Costa Rica, began to decline, and by 1998 approximately 50% of the species formerly present could no longer be found. Three years later, at the Reserva Forestal Fortuna, in western Panama, a site approximately 75 km east southeast of Las Tablas, KRL encountered a mass die-off of amphibians and a subsequent decline in abundance and species richness. The epidemiological features of the anuran population declines and die-offs at both sites were similar, suggesting a similar cause. Herein we document the presence of the fungus, Batrachochytrium dendrobatidis, in dead and dying wild frogs collected at Las Tablas just prior to population declines of several anuran species.

  16. Effects of acute exposure to magnetic field on ionic composition of frog sciatic nerve

    International Nuclear Information System (INIS)

    Objective: To evaluate the possible interaction between magnetic field and cadmium on ionic composition of frog sciatic nerve. Design: The combined effect of magnetic field and cadmium (1.5mg/kg; in lymphatic sac) were studied in frog sciatic nerves (Rana Esculenta). Sciatic nerve samples were extracted, weighed and mixed in bidistilled water in order to analyze by inductively coupled plasma (ICP) ionic composition. Setting: Frogs (Rana Esculenta) were reared in swimming-pool (Faculte des Sciences de Bizerte, Tunisia). Frogs were cared for under the Tunisian Code of Practice for the Care and Use of Animals for Scientific purpose and the Experimental Protocols were approved by the Ethics Committee. Subjects: Treated and control groups (n=6) weighing 50-100g at the time of experiments were housed in the same condition three weeks before the beginning of the experiments. Results: Acute exposure to magnetic field increased significantly the calcium (+298%, p<0.05) and iron (+50%, p<0.05) contents of frog sciatic nerve, whereas magnesium and copper contents remained unchanged. The association between magnetic field and cadmium, induced marked increase of calcium (+360%, p<0.05), whereas magnesium content remained stable. Conclusions: Magnetic field exposure alters the ionic composition in the frog sciatic nerve, especially calcium and iron. Magnetic field magnifies the effect of cadmium on calcium homeostasis. (author)

  17. Gas chromatographic and electron spin resonance investigations of gamma-irradiated frog legs

    International Nuclear Information System (INIS)

    Several very sensitive techniques to measure radiation-induced products in frog legs were investigated. Presented here are results from the use of electron spin resonance (ESR) spectroscopy and capillary gas chromatography (GC) to measure radiolysis products in γ-irradiated frog legs. When bone is irradiated, a characteristic ESR signal develops and is easily measured. The intensity of the ESR signal is dose-dependent and stable for several months at room temperature. When triglycerides or fatty acids are irradiated, some of the major stable products formed are hydrocarbons with one less carbon than the precursor fatty acids. These hydrocarbons are formed as the result of the loss of CO2 during various free radical reactions. A capillary GC procedure was developed to monitor the formation of these hydrocarbons in γ-irradiated frog legs. Since frog legs contain large amounts of palmitic, stearic, oleic, and linoleic acids, the formation of the hydrocarbons (pentadecane, heptadecane, 8-heptadecene, and 6,9-heptadecadiene, respectively) from the decarboxylation of these fatty acids was monitored. The yields of these hydrocarbons were found to be linear with applied dose. A sample from a lot of imported frog legs that were believed to have been treated with ionizing radiation was also analyzed. The ESR technique, in conjunction with the GC data on the hydrocarbons, appears to be a useful approach for identifying and monitoring frog legs that have been treated with ionizing radiation. (author)

  18. Biodiversity of frog haemoparasites from sub-tropical northern KwaZulu-Natal, South Africa.

    Science.gov (United States)

    Netherlands, Edward C; Cook, Courtney A; Kruger, Donnavan J D; du Preez, Louis H; Smit, Nico J

    2015-04-01

    Since South Africa boasts a high biodiversity of frog species, a multispecies haemoparasite survey was conducted by screening the blood from 29 species and 436 individual frogs. Frogs were collected at three localities in sub-tropical KwaZulu-Natal, a hotspot for frog diversity. Twenty per cent of the frogs were infected with at least one of five groups of parasites recorded. Intraerythrocytic parasites comprising Hepatozoon, Dactylosoma, and viral or bacterial organisms, as well as extracellular parasites including trypanosomes and microfilarid nematodes were found. A significant difference (P biodiversity of haemoparasite infections, with all five groups of parasites recorded. The other two sites, that is the area bordering the reserve and the Kwa Nyamazane Conservancy, had a lower diversity with no parasite infections recorded and only Hepatozoon species recorded respectively. Such findings could be ascribed to the anthropogenic impact on the latter two sites, the first by the rural village activities, and the second by the bordering commercial sugar cane agriculture. Future studies should include both morphological and molecular descriptions of the above parasites, as well as the identification of potential vectors, possibly clarifying the effects human activities may have on frog haemoparasite life cycles and as such their biodiversity. PMID:25830113

  19. The island rule in the Brazilian frog Phyllodytes luteolus (Anura: Hylidae: incipient gigantism?

    Directory of Open Access Journals (Sweden)

    Marcio Mageski

    2015-10-01

    Full Text Available ABSTRACT The island rule suggests that, when mainland animals are isolated on islands, large animals tend to become smaller, while small animals tend to become larger. A small frog in eastern Brazil, Phyllodytes luteolus (Wied-Neuwied, 1824, is widely distributed in association with bromeliads. At the end of the last glaciation, parts of the mainland became islands due to rising sea levels, thereby isolating frog populations on these islands. If the island rule holds, we predicted that frogs on islands would tend to be larger than frogs on the mainland. We compared sizes (weight and length of 30 randomly selected male frogs from the mainland with 30 from an island in the state of Espírito Santo, Brazil. We also sampled population density on the island and mainland because concurrent with changing sizes, depending on the causal relationship, density may also change. As predicted, island frogs tended to be larger (both in snout-vent length and weight and were much more abundant. While not specifically addressed in this study, the absence of predators and interspecific competitors may explain both of these trends.

  20. Acute Toxicity of a Heavy Metal Cadmium to an Anuran, the Indian Skipper Frog Rana cyanophlyctis

    Directory of Open Access Journals (Sweden)

    Ajai Kumar Srivastav

    2016-08-01

    Full Text Available Background: There has been increasing awareness throughout the world regarding the remarkable decrease in amphibian population. For such amphibian population decline several causes have been given. Cadmium, a heavy metal is released both from natural sources (leaching of cadmium rich soils and anthropogenic activities to the aquatic and terrestrial environments. This study evaluated the toxicity of heavy metal cadmium to Indian skipper frog Rana cyanophlyctis. Methods: For the determination of LC50 values for cadmium, four-day static renewal acute toxicity test was used. Five replicates each containing ten frogs were subjected to each concentration of cadmium chloride (15, 20, 25, 30, 35, 40, 45 and 50 mg/L. At different exposure periods (24, 48, 72 and 96 h, the mortality of the frog was subjected to Probit analysis with the POLO-PC software (LeOra Software to calculate the LC50 and 95% confidence level. Results: The LC50 values of cadmium chloride for the frog R. cyanophlyctis at 24, 48, 72, and 96 h are 32.586, 29.994, 27.219 and 23.048 mg/L, respectively. The results have been discussed with the toxicity reported for other aquatic vertebrate --fish. Conclusion: Cadmium caused mortality to the frog and this could be one of the reasons for population decline of frogs which inhabit water contaminated with heavy metals.

  1. Impact of Dams on Riparian Frog Communities in the Southern Western Ghats, India

    Directory of Open Access Journals (Sweden)

    Rohit Naniwadekar

    2014-08-01

    Full Text Available The Western Ghats is a global biodiversity hotspot and home to diverse and unique assemblages of amphibians. Several rivers originate from these mountains and hydropower is being tapped from them. The impacts of hydrological regulation of riparian ecosystems to wildlife and its habitat are poorly documented, and in particular the fate of frog populations is unknown. We examined the effects of dams on riparian frog communities in the Thamirabarani catchment in southern Western Ghats. We used nocturnal visual encounter surveys constrained for time, to document the species richness of frogs below and above the dam, and also at control sites in the same catchment. While we did not find differences in species richness below and above the dams, the frog community composition was significantly altered as a likely consequence of altered flow regime. The frog species compositions in control sites were similar to above-dam sites. Below-dam sites had a distinctly different species composition. Select endemic frog species appeared to be adversely impacted due to the dams. Below-dam sites had a greater proportion of generalist and widely distributed species. Dams in the Western Ghats appeared to adversely impact population of endemic species, particularly those belonging to the genus Nyctibatrachus that shows specialization for intact streams.

  2. Towards a better understanding of the use of probiotics for preventing chytridiomycosis in Panamanian golden frogs.

    Science.gov (United States)

    Becker, Matthew H; Harris, Reid N; Minbiole, Kevin P C; Schwantes, Christian R; Rollins-Smith, Louise A; Reinert, Laura K; Brucker, Robert M; Domangue, Rickie J; Gratwicke, Brian

    2011-12-01

    Populations of native Panamanian golden frogs (Atelopus zeteki) have collapsed due to a recent chytridiomycosis epidemic. Reintroduction efforts from captive assurance colonies are unlikely to be successful without the development of methods to control chytridiomycosis in the wild. In an effort to develop a protective treatment regimen, we treated golden frogs with Janthinobacterium lividum, a skin bacterium that has been used to experimentally prevent chytridiomycosis in North American amphibians. Although J. lividum appeared to colonize A. zeteki skin temporarily, it did not prevent or delay mortality in A. zeteki exposed to Batrachochytrium dendrobatidis, the causative agent of chytridiomycosis. After introduction of J. lividum, average bacterial cell counts reached a peak of 1.7 × 10(6) cells per frog ~2 weeks after treatment but declined steadily after that. When J. lividum numbers declined to ~2.8 × 10(5) cells per frog, B. dendrobatidis infection intensity increased to greater than 13,000 zoospore equivalents per frog. At this point, frogs began to die of chytridiomycosis. Future research will concentrate on isolating and testing antifungal bacterial species from Panama that may be more compatible with Atelopus skin. PMID:22328095

  3. Apical Na+ permeability of frog skin during serosal Cl- replacement.

    Science.gov (United States)

    Leibowich, S; DeLong, J; Civan, M M

    1988-05-01

    Gluconate substitution for serosal Cl- reduces the transepithelial short-circuit current (Isc) and depolarizes short-circuited frog skins. These effects could result either from inhibition of basolateral K+ conductance, or from two actions to inhibit both apical Na+ permeability (PapNa) and basolateral pump activity. We have addressed this question by studying whole-and split-thickness frog skins. Intracellular Na+ concentration (CcNa) and PapNa have been monitored by measuring the current-voltage relationship for apical Na+ entry. This analysis was conducted by applying trains of voltage pulses, with pulse durations of 16 to 32 msec. Estimates of PapNa and CcNa were not detectably dependent on pulse duration over the range 16 to 80 msec. Serosal Cl- replacement uniformly depolarized short-circuited tissues. The depolarization was associated with inhibition of Isc across each split skin, but only occasionally across the whole-thickness preparations. This difference may reflect the better ionic exchange between the bulk medium and the extracellular fluid in contact with the basolateral membranes, following removal of the underlying dermis in the split-skin preparations. PapNa was either unchanged or increased, and CcNa either unchanged or reduced after the anionic replacement. These data are incompatible with the concept that serosal Cl- replacement inhibits PapNa and Na,K-pump activity. Gluconate substitution likely reduces cell volume, triggering inhibition of the basolateral K+ channels, consistent with the data and conclusions of S.A. Lewis, A.G. Butt, M.J. Bowler, J.P. Leader and A.D.C. Macknight (J. Membrane Biol. 83:119-137, 1985) for toad bladder. The resulting depolarization reduces the electrical force favoring apical Na+ entry. The volume-conductance coupling serves to conserve volume by reducing K+ solute loss. Its molecular basis remains to be identified. PMID:2458472

  4. Apical Na+ permeability of frog skin during serosal Cl- replacement.

    Science.gov (United States)

    Leibowich, S; DeLong, J; Civan, M M

    1988-05-01

    Gluconate substitution for serosal Cl- reduces the transepithelial short-circuit current (Isc) and depolarizes short-circuited frog skins. These effects could result either from inhibition of basolateral K+ conductance, or from two actions to inhibit both apical Na+ permeability (PapNa) and basolateral pump activity. We have addressed this question by studying whole-and split-thickness frog skins. Intracellular Na+ concentration (CcNa) and PapNa have been monitored by measuring the current-voltage relationship for apical Na+ entry. This analysis was conducted by applying trains of voltage pulses, with pulse durations of 16 to 32 msec. Estimates of PapNa and CcNa were not detectably dependent on pulse duration over the range 16 to 80 msec. Serosal Cl- replacement uniformly depolarized short-circuited tissues. The depolarization was associated with inhibition of Isc across each split skin, but only occasionally across the whole-thickness preparations. This difference may reflect the better ionic exchange between the bulk medium and the extracellular fluid in contact with the basolateral membranes, following removal of the underlying dermis in the split-skin preparations. PapNa was either unchanged or increased, and CcNa either unchanged or reduced after the anionic replacement. These data are incompatible with the concept that serosal Cl- replacement inhibits PapNa and Na,K-pump activity. Gluconate substitution likely reduces cell volume, triggering inhibition of the basolateral K+ channels, consistent with the data and conclusions of S.A. Lewis, A.G. Butt, M.J. Bowler, J.P. Leader and A.D.C. Macknight (J. Membrane Biol. 83:119-137, 1985) for toad bladder. The resulting depolarization reduces the electrical force favoring apical Na+ entry. The volume-conductance coupling serves to conserve volume by reducing K+ solute loss. Its molecular basis remains to be identified.

  5. Checklist and Simple Identification Key for Frogs and Toads from District IV of The MADA Scheme, Kedah, Malaysia

    OpenAIRE

    Jaafar, Ibrahim; Chai, Teoh Chia; Sah, Shahrul Anuar Mohd; Akil, Mohd Abdul Muin Md.

    2009-01-01

    A survey was conducted to catalogue the diversity of anurans in District IV of the Muda Agriculture Development Authority Scheme (MADA) in Kedah Darul Aman, Malaysia, from July 1996 to January 1997. Eight species of anurans from three families were present in the study area. Of these, the Common Grass Frog (Fejevarya limnocharis) was the most abundant, followed by Mangrove Frog (Fejevarya cancrivora), Long-legged Frog (Hylarana macrodactyla), and Common Toad (Duttaphrynus melanostictus). Pudd...

  6. Diet, Density, and Distribution of the Introduced Greenhouse Frog, Eleutherodactylus planirostris, on the Island of Hawaii

    OpenAIRE

    Olson, Christina A.

    2011-01-01

    The greenhouse frog, Eleutherodactylus planirostris, native to Cuba and the Bahamas, was recently introduced to Hawaii. Studies from other invaded habitats suggest that it may impact Hawaiian ecosystems by consuming and potentially reducing endemic invertebrates. However, there have been no studies on the greenhouse frog in Hawaii. The first component of this study was to conduct a diet analysis. We conducted a stomach content analysis of 427 frogs from 10 study sites on the island of Hawa...

  7. California Ocean Uses Atlas

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset is a result of the California Ocean Uses Atlas Project: a collaboration between NOAA's National Marine Protected Areas Center and Marine Conservation...

  8. California Watershed Hydrologic Units

    Data.gov (United States)

    California Department of Resources — This dataset is intended to be used as a tool for water-resource management and planning activities, particularly for site-specific and localized studies requiring...

  9. Earthquakes in Southern California

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — There have been many earthquake occurrences in Southern California. This set of slides shows earthquake damage from the following events: Imperial Valley, 1979,...

  10. Coastal California Digital Imagery

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This digital ortho-imagery dataset is a survey of coastal California. The project area consists of approximately 3774 square miles. The project design of the...

  11. California Harpoon Fishery

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains vessel logbook and landings data from harpoon vessels that fish within 200 miles of the California coast, from 1974 to present. The harpoon...

  12. The Oxbow School, California.

    Science.gov (United States)

    Pearson, Clifford A.

    2003-01-01

    Describes the design of the Oxbow School, an art- and design-oriented high school in Napa, California, including the educational context and design goals. Includes information on the architects, as well as floor plans and photographs. (EV)

  13. California Data Exchange Center

    Science.gov (United States)

    ... to make July &28;Water Smart Month.&29; &28;Conserving ... Remote sensors today indicate that statewide, snowpack water content is 54 percent of ... California ranked first, along with Texas, on ...

  14. Biodiversity of frog haemoparasites from sub-tropical northern KwaZulu-Natal, South Africa

    Directory of Open Access Journals (Sweden)

    Edward C. Netherlands

    2015-04-01

    Full Text Available Since South Africa boasts a high biodiversity of frog species, a multispecies haemoparasite survey was conducted by screening the blood from 29 species and 436 individual frogs. Frogs were collected at three localities in sub-tropical KwaZulu-Natal, a hotspot for frog diversity. Twenty per cent of the frogs were infected with at least one of five groups of parasites recorded. Intraerythrocytic parasites comprising Hepatozoon, Dactylosoma, and viral or bacterial organisms, as well as extracellular parasites including trypanosomes and microfilarid nematodes were found. A significant difference (P < 0.01 in the prevalence of parasitaemia was found across species, those semi-aquatic species demonstrating the highest, followed by semi-terrestrial frog species. None of those species described as purely terrestrial and aquatic were infected. Hepatozoon and Trypanosoma species accounted for most of the infections, the former demonstrating significant differences in intensity of infection across species, families and habitat types (P = 0.028; P = 0.006; P = 0.007 respectively. Per locality, the first, the formally protected Ndumo Game Reserve, had the highest biodiversity of haemoparasite infections, with all five groups of parasites recorded. The other two sites, that is the area bordering the reserve and the Kwa Nyamazane Conservancy, had a lower diversity with no parasite infections recorded and only Hepatozoon species recorded respectively. Such findings could be ascribed to the anthropogenic impact on the latter two sites, the first by the rural village activities, and the second by the bordering commercial sugar cane agriculture. Future studies should include both morphological and molecular descriptions of the above parasites, as well as the identification of potential vectors, possibly clarifying the effects human activities may have on frog haemoparasite life cycles and as such their biodiversity.

  15. Cryoprotectants and extreme freeze tolerance in a subarctic population of the wood frog.

    Directory of Open Access Journals (Sweden)

    Jon P Costanzo

    Full Text Available Wood frogs (Rana sylvatica exhibit marked geographic variation in freeze tolerance, with subarctic populations tolerating experimental freezing to temperatures at least 10-13 degrees Celsius below the lethal limits for conspecifics from more temperate locales. We determined how seasonal responses enhance the cryoprotectant system in these northern frogs, and also investigated their physiological responses to somatic freezing at extreme temperatures. Alaskan frogs collected in late summer had plasma urea levels near 10 μmol ml-1, but this level rose during preparation for winter to 85.5 ± 2.9 μmol ml-1 (mean ± SEM in frogs that remained fully hydrated, and to 186.9 ± 12.4 μmol ml-1 in frogs held under a restricted moisture regime. An osmolality gap indicated that the plasma of winter-conditioned frogs contained an as yet unidentified osmolyte(s that contributed about 75 mOsmol kg-1 to total osmotic pressure. Experimental freezing to -8°C, either directly or following three cycles of freezing/thawing between -4 and 0°C, or -16°C increased the liver's synthesis of glucose and, to a lesser extent, urea. Concomitantly, organs shed up to one-half (skeletal muscle or two-thirds (liver of their water, with cryoprotectant in the remaining fluid reaching concentrations as high as 0.2 and 2.1 M, respectively. Freeze/thaw cycling, which was readily survived by winter-conditioned frogs, greatly increased hepatic glycogenolysis and delivery of glucose (but not urea to skeletal muscle. We conclude that cryoprotectant accrual in anticipation of and in response to freezing have been greatly enhanced and contribute to extreme freeze tolerance in northern R. sylvatica.

  16. An Analysis of Predator Selection to Affect Aposematic Coloration in a Poison Frog Species.

    Directory of Open Access Journals (Sweden)

    Corinna E Dreher

    Full Text Available Natural selection is widely noted to drive divergence of phenotypic traits. Predation pressure can facilitate morphological divergence, for example the evolution of both cryptic and conspicuous coloration in animals. In this context Dendrobatid frogs have been used to study evolutionary forces inducing diversity in protective coloration. The polytypic strawberry poison frog (Oophaga pumilio shows strong divergence in aposematic coloration among populations. To investigate whether predation pressure is important for color divergence among populations of O. pumilio we selected four mainland populations and two island populations from Costa Rica and Panama. Spectrometric measurements of body coloration were used to calculate color and brightness contrasts of frogs as an indicator of conspicuousness for the visual systems of several potential predators (avian, crab and snake and a conspecific observer. Additionally, we conducted experiments using clay model frogs of different coloration to investigate whether the local coloration of frogs is better protected than non-local color morphs, and if predator communities vary among populations. Overall predation risk differed strongly among populations and interestingly was higher on the two island populations. Imprints on clay models indicated that birds are the main predators while attacks of other predators were rare. Furthermore, clay models of local coloration were equally likely to be attacked as those of non-local coloration. Overall conspicuousness (and brightness contrast of local frogs was positively correlated with attack rates by birds across populations. Together with results from earlier studies we conclude that conspicuousness honestly indicates toxicity to avian predators. The different coloration patterns among populations of strawberry poison frogs in combination with behavior and toxicity might integrate into equally efficient anti-predator strategies depending on local predation and

  17. Defects in host immune function in tree frogs with chronic chytridiomycosis.

    Directory of Open Access Journals (Sweden)

    Sam Young

    Full Text Available The amphibian chytrid fungus Batrachochytrium dendrobatidis (Bd has caused mass mortality leading to population declines and extinctions in many frog species worldwide. The lack of host resistance may be due to fungal immunosuppressive effects that have been observed when Bd is incubated with cultured lymphocytes, but whether in vivo host immunosuppression occurs is unknown. We used a broad range of hematologic and protein electrophoresis biomarkers, along with various functional tests, to assess immune competence in common green (Litoria caerulea and white-lipped (L. infrafrenata tree frogs experimentally infected with Bd. Compared with uninfected frogs, Bd infection in L. caerulea caused a reduction in immunoglobulin and splenic lymphocyte responses to antigenic stimulation with sheep red blood cells, along with decreased white blood cell and serum protein concentrations, indicating possible impaired immune response capability of Bd-infected frogs. This is the first in vivo study suggesting that infection with Bd causes multiple defects in systemic host immune function, and this may contribute to disease development in susceptible host species. Although L. infrafrenata failed to maintain Bd infection after exposure, white blood cell and serum globulin concentrations were lower in recovered frogs compared with unexposed frogs, but antigen-specific serum and splenic antibody, and splenic cellular, responses were similar in both recovered and unexposed frogs. This may indicate potential systemic costs associated with infection clearance and/or redirection of host resources towards more effective mechanisms to overcome infection. No clear mechanism for resistance was identified in L. infrafrenata, suggesting that localized and/or innate immune defense mechanisms may be important factors involved in disease resistance in this species.

  18. Biomarkers of oxidative stress and metal accumulation in marsh frog (Pelophylax ridibundus).

    Science.gov (United States)

    Borković-Mitić, Slavica S; Prokić, Marko D; Krizmanić, Imre I; Mutić, Jelena; Trifković, Jelena; Gavrić, Jelena; Despotović, Svetlana G; Gavrilović, Branka R; Radovanović, Tijana B; Pavlović, Slađan Z; Saičić, Zorica S

    2016-05-01

    To understand the effect of metals on the marsh frog Pelophylax ridibundus and the possible environment-induced changes in oxidative stress enzymes, we determined the concentrations of 18 metals: Al, As, Ba, Ca, Cd, Co, Cr, Cu, Fe, Ga, Hg, In, Li, Mn, Ni, Pb, Sr, and Zn, in the tissues (liver, skin, and muscle) and water samples collected from different locations in Serbia. The activities of superoxide dismutase (SOD), catalase (CAT), glutathione peroxidase (GSH-Px), glutathione reductase (GR), glutathione S-transferase (GST), acetylcholinesterase (AChE), and changes in concentrations of reduced glutathione (GSH) and sulfhydryl groups (SH) were analyzed in the tissues of the sampled frogs. The concentrations of Al, Cd, Co, Cr, Cu, Fe, Ga, Hg, and Ni were highest in the liver, whereas those of Ba, Ca, Li, Mn, Pb, Sr, and Zn were highest in the skin. Hg correlated positively with liver SOD (in frogs from Danube-Tisza-Danube Canal (DTD)), muscle CAT (DTD), and muscle GST Ponjavica River (PO); Pb demonstrated a strong positive correlation with liver GR in frogs from Mt. Fruška Gora (FG); Cd only exhibited a positive correlation with AChE in the skin of frogs from DTD. In the skin, Zn correlated positively with AChE (DTD), SH groups (PO), and CAT (FG), and negatively with CAT, GST, and SH in the liver of frogs from DTD. Examination of these oxidative stress biomarkers, together with analysis of metal accumulation in the liver and skin of marsh frogs, provides a powerful tool for the assessment of metal pollution. PMID:26846240

  19. Enzymatic regulation of glycogenolysis in a subarctic population of the wood frog: implications for extreme freeze tolerance.

    Directory of Open Access Journals (Sweden)

    M Clara F do Amaral

    Full Text Available The wood frog, Rana sylvatica, from Interior Alaska survives freezing at -16°C, a temperature 10-13°C below that tolerated by its southern conspecifics. We investigated the hepatic freezing response in this northern phenotype to determine if its profound freeze tolerance is associated with an enhanced glucosic cryoprotectant system. Alaskan frogs had a larger liver glycogen reserve that was mobilized faster during early freezing as compared to conspecifics from a cool-temperate region (southern Ohio, USA. In Alaskan frogs the rapid glucose production in the first hours of freezing was associated with a 7-fold increase in glycogen phosphorylase activity above unfrozen frog levels, and the activity of this enzyme was higher than that of frozen Ohioan frogs. Freezing of Ohioan frogs induced a more modest (4-fold increase in glycogen phosphorylase activity above unfrozen frog values. Relative to the Ohioan frogs, Alaskan frogs maintained a higher total protein kinase A activity throughout an experimental freezing/thawing time course, and this may have potentiated glycogenolysis during early freezing. We found populational variation in the activity and protein level of protein kinase A which suggested that the Alaskan population had a more efficient form of this enzyme. Alaskan frogs modulated their glycogenolytic response by decreasing the activity of glycogen phosphorylase after cryoprotectant mobilization was well under way, thereby conserving their hepatic glycogen reserve. Ohioan frogs, however, sustained high glycogen phosphorylase activity until early thawing and consumed nearly all their liver glycogen. These unique hepatic responses of Alaskan R. sylvatica likely contribute to this phenotype's exceptional freeze tolerance, which is necessary for their survival in a subarctic climate.

  20. Frog: a FRee Online druG 3D conformation generator.

    Science.gov (United States)

    Leite, T Bohme; Gomes, D; Miteva, M A; Chomilier, J; Villoutreix, B O; Tufféry, P

    2007-07-01

    In silico screening methods based on the 3D structures of the ligands or of the proteins have become an essential tool to facilitate the drug discovery process. To achieve such process, the 3D structures of the small chemical compounds have to be generated. In addition, for ligand-based screening computations or hierarchical structure-based screening projects involving a rigid-body docking step, it is necessary to generate multi-conformer 3D models for each input ligand to increase the efficiency of the search. However, most academic or commercial compound collections are delivered in 1D SMILES (simplified molecular input line entry system) format or in 2D SDF (structure data file), highlighting the need for free 1D/2D to 3D structure generators. Frog is an on-line service aimed at generating 3D conformations for drug-like compounds starting from their 1D or 2D descriptions. Given the atomic constitution of the molecules and connectivity information, Frog can identify the different unambiguous isomers corresponding to each compound, and generate single or multiple low-to-medium energy 3D conformations, using an assembly process that does not presently consider ring flexibility. Tests show that Frog is able to generate bioactive conformations close to those observed in crystallographic complexes. Frog can be accessed at http://bioserv.rpbs.jussieu.fr/Frog.html. PMID:17485475

  1. Chemical camouflage--a frog's strategy to co-exist with aggressive ants.

    Directory of Open Access Journals (Sweden)

    Mark-Oliver Rödel

    Full Text Available Whereas interspecific associations receive considerable attention in evolutionary, behavioural and ecological literature, the proximate bases for these associations are usually unknown. This in particular applies to associations between vertebrates with invertebrates. The West-African savanna frog Phrynomantis microps lives in the underground nest of ponerine ants (Paltothyreus tarsatus. The ants usually react highly aggressively when disturbed by fiercely stinging, but the frog is not attacked and lives unharmed among the ants. Herein we examined the proximate mechanisms for this unusual association. Experiments with termites and mealworms covered with the skin secretion of the frog revealed that specific chemical compounds seem to prevent the ants from stinging. By HPLC-fractionation of an aqueous solution of the frogs' skin secretion, two peptides of 1,029 and 1,143 Da were isolated and found to inhibit the aggressive behaviour of the ants. By de novo sequencing using tandem mass spectrometry, the amino acid sequence of both peptides consisting of a chain of 9 and 11 residues, respectively, was elucidated. Both peptides were synthesized and tested, and exhibited the same inhibitory properties as the original frog secretions. These novel peptides most likely act as an appeasement allomone and may serve as models for taming insect aggression.

  2. DNA repair and resistance to UV-B radiation in western spotted frogs

    Science.gov (United States)

    Blaustein, A.R.; Hays, J.B.; Hoffman, P.D.; Chivers, D.P.; Kiesecker, J.M.; Leonard, W.P.; Marco, A.; Olson, D.H.; Reaser, J.K.; Anthony, R.G.

    1999-01-01

    We assessed DNA repair and resistance to solar radiation in eggs of members of the western spotted frog complex (Rana pretiosa and R. luteiventris), species whose populations are suffering severe range reductions and declines. Specifically, we measured the activity of photoreactivating enzyme (photolyase) in oocytes of spotted frogs. In some species, photoreactivation is the most important mechanism for repair of UV-damaged DNA. Using field experiments, we also compared the hatching success of spotted frog embryos at natural oviposition sites at three elevations, where some embryos were subjected to ambient levels of UV-B radiation and others were shielded from UV-B radiation. Compared with other amphibians, photolyase activities in spotted frogs were relatively high. At all sites, hatching success was unaffected by UV-B. Our data support the interpretation that amphibian embryos with relatively high levels of photolyase are more resistant to UV-B radiation than those with lower levels of photolyase. At the embryonic stage, UV-B radiation does not presently seem to be contributing to the population declines of spotted frogs.

  3. Characterization of gene expression endpoints during postembryonic development of the northern green frog (Rana clamitans melanota).

    Science.gov (United States)

    Hammond, S Austin; Veldhoen, Nik; Kobylarz, Marek; Webber, Nicholas R; Jordan, Jameson; Rehaume, Vicki; Boone, Michelle D; Helbing, Caren C

    2013-05-01

    Postembryonic development of a larval tadpole into a juvenile frog involves the coordinated action of thyroid hormone (TH) across a diversity of tissues. Changes in the frog transcriptome represent a highly sensitive endpoint in the detection of developmental progression, and for the identification of environmental chemical contaminants that possess endocrine disruptive properties. Unfortunately, in contrast with their vital role as sentinels of environmental change, few gene expression tools currently exist for the majority of native North American frog species. We have isolated seven expressed gene sequences from the Northern green frog (Rana clamitans melanota) that encode proteins associated with TH-mediated postembryonic development and global stress response, and established a quantitative real-time polymerase chain reaction (qPCR) assay. We also obtained three additional species-specific gene sequences that functioned in the normalization of the expression data. Alterations in mRNA abundance profiles were identified in up to eight tissues during R. clamitans postembryonic development, and following exogenous administration of TH to premetamorphic tadpoles. Our results characterize tissue distribution and sensitivity to TH of select mRNA of a common North American frog species and support the potential use of this qPCR assay in identification of the presence of chemical agents in aquatic environments that modulate TH action. PMID:23647014

  4. Citizen Science Program Shows Urban Areas Have Lower Occurrence of Frog Species, but Not Accelerated Declines.

    Directory of Open Access Journals (Sweden)

    Martin J Westgate

    Full Text Available Understanding the influence of landscape change on animal populations is critical to inform biodiversity conservation efforts. A particularly important goal is to understand how urban density affects the persistence of animal populations through time, and how these impacts can be mediated by habitat provision; but data on this question are limited for some taxa. Here, we use data from a citizen science monitoring program to investigate the effect of urbanization on patterns of frog species richness and occurrence over 13 years. Sites surrounded by a high proportion of bare ground (a proxy for urbanization had consistently lower frog occurrence, but we found no evidence that declines were restricted to urban areas. Instead, several frog species showed declines in rural wetlands with low-quality habitat. Our analysis shows that urban wetlands had low but stable species richness; but also that population trajectories are strongly influenced by vegetation provision in both the riparian zone and the wider landscape. Future increases in the extent of urban environments in our study area are likely to negatively impact populations of several frog species. However, existing urban areas are unlikely to lose further frog species in the medium term. We recommend that landscape planning and management focus on the conservation and restoration of rural wetlands to arrest current declines, and the revegetation of urban wetlands to facilitate the re-expansion of urban-sensitive species.

  5. Asplenium bird’s nest ferns in rainforest canopies are climate-contingent refuges for frogs

    Directory of Open Access Journals (Sweden)

    Brett R. Scheffers

    2014-12-01

    Full Text Available Epiphytes are important for canopy dwelling organisms because they provide a cool and moist microhabitat in the relatively hot and dry canopy. Here we examine whether epiphytic Asplenium ferns act as important habitats for arboreal frogs. We conducted extensive fern and habitat surveys for frogs in the Philippines, and complimented these surveys with roaming day and night canopy surveys to identify the full extent of habitat use across the vertical strata. We artificially dried ferns of various sizes to identify relationships between water and temperature buffering. Ferns are the preferred diurnal microhabitat and breeding habitat for arboreal frogs. A strong positive relationship exists between fern size and frog usage and abundance. Our drying experiments show that large ferns buffer maximum temperatures and reduce variability in temperatures, and buffering is directly linked to their hydration. Frogs are likely using large ferns for their moist, cool, environments for breeding and daytime retreat, which supports the buffered microhabitat hypothesis—these plants promote species coexistence through habitat creation and amelioration of physical stress. However, drying experiments suggest that this buffering is contingent on regular rainfall. Altered rainfall regimes could lead to the unexpected loss of the functional capacity of these important fern habitats.

  6. THE MOCHE BOTANICAL FROG (La rana botánica mochica

    Directory of Open Access Journals (Sweden)

    Donna McClelland †

    2011-06-01

    Full Text Available Plants and animals with features which identify them as supernaturals characterize the art of the Precolumbian Moche culture of northern Peru. Among these animals is a frog with feline attributes and a consistent association with manioc tubers, stalks, and plants, the Botanical Frog. The Botanical Frog appears to have been patterned on Leptodactylus pentadactylus. It is shown copulating with felines. Fine line painted vessels and ones with low relief decoration show the Botanical Frog performing as part of a ritual involving other animals and cultivated crops, suggesting that the Botanical Frog was associated with agriculture. ESPAÑOL: El arte de la cultura mochica de la costa norte del Perú presenta plantas y animales mostrando rasgos sobrenaturales. Uno de los animales es una rana con elementos felinos y asociada con tubérculos, ramas y plantas de yuca. La Rana Botánica probablemente tiene su origen en Leptodactylus pentadactylus, una rana carnívora de la selva amazónica. La Rana Botánica copula con felinos y, en vasijas pintadas con líneas finas o con escenarios representados en bajorrelieve, toma parte en ceremonias involucrando a otros animales y cosechas domésticas. Parece ser que la Rana Botánica era un ser sobrenatural asociado con la agricultura.

  7. Viability of Vibrio cholerae 01 on frog legs under frozen and refrigerated conditions and low dose radiation treatment

    International Nuclear Information System (INIS)

    Frog legs were contaminated with Vibrio cholerae 01, Inaba serotype, EITor biotype. The organism remained viable for more than 28 and 2 d when stored at -20°C and 4°C, respectively. Exposure to a multicuries 60Cobalt source of 50 and 100 kilorads eliminated V. cholerae from both the frozen and fresh frog legs

  8. Inverse Effects on Growth and Development Rates by Means of Endocrine Disruptors in African Clawed Frog Tadpoles ("Xenopus Laevis")

    Science.gov (United States)

    Hackney, Zachary Carl

    2007-01-01

    Previous work on fish, frogs, and salamanders, showed the ability for estrogen (EE2) and anthropogenic endocrine disruptors to skew sex ratios and cause hermaphrodism. This study addressed the effects of estrogens on growth and development rates of African clawed frog tadpoles ("Xenopus laevis") during their gender determination stages. The…

  9. Diet of introduced bullfrogs (Rana catesbeiana): Predation on and diet overlap with native frogs on Daishan Island, China

    Science.gov (United States)

    Wu, Zhengjun; Li, Y.; Wang, Y.; Adams, Michael J.

    2005-01-01

    We examined diet of introduced Bullfrogs (Rana catesbeiana) and three native frog species (Rana limnocharis, Rana nigromaculata, and Bufo bufo gargarizans) co-occurring at a group of ponds on Daishan Island, east of China, to gain insight into the nature of potential interactions between Bullfrogs and native frog species. For postmetamorphic Bullfrogs, aquatic prey items dominated volumetrically. Prey size, diet volume and volumetric percentage of native frogs in diet increased with Bullfrog body size. The number and volumetric percentage of native frogs in the diet were not different for female and male Bullfrogs, and both were higher for adults than for juveniles. Diet overlap between males and juveniles was higher than that between males and females and between females and juveniles. Diet overlap with each native frog species of male Bullfrogs was lower than that of female Bullfrogs and juvenile Bullfrogs. We did not exam effects of Bullfrogs on native frogs but our results suggest that the primary threat posed by juvenile Bullfrogs to native frogs on Daishan Island is competition for food, whereas the primary threat posed by male Bullfrogs is direct predation. Female Bullfrogs may threaten native frogs by both competition and predation. These differences among Bullfrog groups may be attributed to differences in body size and microhabitat use.

  10. The California Hazards Institute

    Science.gov (United States)

    Rundle, J. B.; Kellogg, L. H.; Turcotte, D. L.

    2006-12-01

    California's abundant resources are linked with its natural hazards. Earthquakes, landslides, wildfires, floods, tsunamis, volcanic eruptions, severe storms, fires, and droughts afflict the state regularly. These events have the potential to become great disasters, like the San Francisco earthquake and fire of 1906, that overwhelm the capacity of society to respond. At such times, the fabric of civic life is frayed, political leadership is tested, economic losses can dwarf available resources, and full recovery can take decades. A patchwork of Federal, state and local programs are in place to address individual hazards, but California lacks effective coordination to forecast, prevent, prepare for, mitigate, respond to, and recover from, the harmful effects of natural disasters. Moreover, we do not know enough about the frequency, size, time, or locations where they may strike, nor about how the natural environment and man-made structures would respond. As California's population grows and becomes more interdependent, even moderate events have the potential to trigger catastrophes. Natural hazards need not become natural disasters if they are addressed proactively and effectively, rather than reactively. The University of California, with 10 campuses distributed across the state, has world-class faculty and students engaged in research and education in all fields of direct relevance to hazards. For that reason, the UC can become a world leader in anticipating and managing natural hazards in order to prevent loss of life and property and degradation of environmental quality. The University of California, Office of the President, has therefore established a new system-wide Multicampus Research Project, the California Hazards Institute (CHI), as a mechanism to research innovative, effective solutions for California. The CHI will build on the rich intellectual capital and expertise of the Golden State to provide the best available science, knowledge and tools for

  11. An Assessment of Pulsed Flows on Foothill Yellow-legged Frog Habitat Hydraulics in a Regulated River using Two-Dimensional Hydrodynamic Modeling

    Science.gov (United States)

    Yarnell, S.; Lind, A.; Kupferberg, S.

    2007-12-01

    We used a freely available two-dimensional model, River2D, to evaluate changes in habitat suitability and availability for Foothill yellow-legged frog egg masses and tadpoles during pulsed flow events. Two study sites in Northern California, one on the unregulated South Fork Eel River and the other on the regulated North Fork Feather River, were selected for modeling. Simulated depths and velocities agreed well with measured field values. When coupled with a definition of breeding habitat suitability that encompassed the variability of field- measured values and the range of error within the model output, the model accurately predicted suitable breeding locations throughout the survey reach. Using data on percentages of egg mass and tadpole loss associated with increased velocities, we assessed several scenarios of how pulsed flows affected habitat availability and suitability. In a seasonal (spring) pulse scenario, lower discharges provided the greatest weighted usable area for breeding, but higher initial discharges provided the greatest buffering capacity against lethal increases in velocity. In an aseasonal (summer) pulse scenario, only 20-30% of the suitable tadpole habitat in the unregulated site and <5% of the suitable habitat in the regulated site remained suitable during the pulse regardless of initial flow level. In both scenarios, the unregulated study site provided 2-3 times the buffering capacity of the regulated site. This was likely due to differences in channel morphology; the regulated site had an entrenched channel with steep banks, while the unregulated site had an asymmetric cross-sectional shape where shallow overbank areas provided refuge from high velocities as flows fluctuated. This type of model-based methodology that can evaluate effects from flow fluctuation on individuals and local habitat conditions for multiple life stages would be useful for managing Foothill yellow-legged frog or similar aquatic species in regulated river systems.

  12. Characterization of UV radiation sensitive frog cell lines

    International Nuclear Information System (INIS)

    Twenty-one subclones of nine frog cell isolates were tested for sensitivity to a panel of DNA damaging agents. Two clones were identified which had a greater than wild type level of sensitivity to UV radiation but had a wild type level of sensitivity to the other agents. These clones were the haploid RRP602-7 and the diploid RRP802-1. RRP802-1 was found to be unstable with respect to UV sensitivity. The line was cloned in order to isolate stable sensitive and wild type derivatives. RRP802-1-16, a UV sensitive clone and RRP802-1-13, a clone with a wild type level of sensitivity to UV radiation, were isolated. The UV radiation sensitivity of RRP602-7, RRP802-1 and RRP802-1-16 did not correlate with cell size, cell shape, cell cycle distribution or ploidy. The cell cycle distribution after UV irradiation, the rate of DNA synthesis after UV-irradiation, the DNA polymerase α activity and the sister chromatid exchange frequency were all measured in RRP602-7, RRP802-1 and RRP802-1-16 in order to examine the DNA repair capacity. The presence of DNA repair pathways was examined directly in RRP602-7, RRP802-1 and RRP802-1-16. All were found to be proficient in photo-reactivation repair and postreplication repair of UV elicited DNA damage

  13. Calcium diffusion through perineurium of frog sciatic nerve

    International Nuclear Information System (INIS)

    Calcium and sucrose permeabilities (PCa or Psucrose) were calculated from the fluxes of 45Ca and [3H]sucrose across perfused everted and normal configurations of the perineurial cylinder isolated from the frog sciatic nerve and from fluxes into an intact nerve segment bathed in Ringer. Mean PCa for influx across the isolated perineurium equaled 10.2 ± 0.6 x 10-7 cm/s compared with Psucrose = 7.4 ± 0.4 x 10-7 cm/s. For efflux, PCa = 27.5 ± 5.0 x 10-7 cm/s and Psucrose = 23.2 ± 4.7 x 10-7 cm/s. The mean ratio of PCa for efflux to PCa for influx was not significantly different from the flux ratio for sucrose. Asymmetrical fluxes across the perineurial cylinder were due presumably to bulk flow and resultant solvent drag out of the lumen caused by perfusion pressure. Calcium accumulated in the perineurial tissue in a saturable manner with a Km of 80 μM and a Bmax of 0.22 μmol/g wet wt. The half time for calcium exchange from the external medium to the nerve was calculated as 3 h. This long half time and the calcium-sequestering ability of the perineurium suggest that the perineurium can stabilize endoneurial calcium during transient changes in the calcium concentration of plasma

  14. Antibody dependent enhancement of frog virus 3 infection

    Directory of Open Access Journals (Sweden)

    Penny Emily

    2010-02-01

    Full Text Available Abstract Background Viruses included in the family Iridoviridae are large, icosahedral, dsDNA viruses that are subdivided into 5 genera. Frog virus 3 (FV3 is the type species of the genus Ranavirus and the best studied iridovirus at the molecular level. Typically, antibodies directed against a virus act to neutralize the virus and limit infection. Antibody dependent enhancement occurs when viral antibodies enhance infectivity of the virus rather than neutralize it. Results Here we show that anti-FV3 serum present at the time of FV3 infection enhances infectivity of the virus in two non-immune teleost cell lines. We found that antibody dependent enhancement of FV3 was dependent on the Fc portion of anti-FV3 antibodies but not related to complement. Furthermore, the presence of anti-FV3 serum during an FV3 infection in a non-immune mammalian cell line resulted in neutralization of the virus. Our results suggest that a cell surface receptor specific to teleost cell lines is responsible for the enhancement. Conclusions This report represents the first evidence of antibody dependent enhancement in iridoviruses. The data suggests that anti-FV3 serum can either neutralize or enhance viral infection and that enhancement is related to a novel antibody dependent enhancement pathway found in teleosts that is Fc dependent.

  15. A multigene species tree for Western Mediterranean painted frogs (Discoglossus).

    Science.gov (United States)

    Pabijan, Maciej; Crottini, Angelica; Reckwell, Dennis; Irisarri, Iker; Hauswaldt, J Susanne; Vences, Miguel

    2012-09-01

    Painted frogs (Discoglossus) are an anuran clade that originated in the Upper Miocene. Extant species are morphologically similar and have a circum-Mediterranean distribution. We assembled a multilocus dataset from seven nuclear and four mitochondrial genes for several individuals of all but one of the extant species and reconstructed a robust phylogeny by applying a coalescent-based species-tree method and a concatenation approach, both of which gave congruent results. The earliest phylogenetic split within Discoglossus separates D. montalentii from a clade comprising all other species. Discoglossus montalentii is monophyletic for haplotype variation at all loci and has distinct morphological, bioacoustic and karyotypic characters. We find moderate support for a sister-group relationship between the Iberian taxa and the Moroccan D. scovazzi, and high support for a D. pictus -D. sardus clade distributed around the Tyrrhenian basin. Topological discordance among gene trees during the speciation of D. galganoi, D. scovazzi, D. pictus and D. sardus is interpreted as the consequence of nearly simultaneous, vicariant diversification. The timing of these events is unclear, but possibly coincided with the final geotectonic rearrangement of the Western Mediterranean in the Middle Miocene or later during the Messinian salinity crisis. The Iberian taxa D. galganoi galganoi and D. g. jeanneae are reciprocally monophyletic in mitochondrial DNA but not in nuclear gene trees, and are therefore treated as subspecies of D. galganoi. PMID:22641173

  16. Environmental constraints and call evolution in torrent-dwelling frogs.

    Science.gov (United States)

    Goutte, Sandra; Dubois, Alain; Howard, Samuel D; Marquez, Rafael; Rowley, Jodi J L; Dehling, J Maximilian; Grandcolas, Philippe; Rongchuan, Xiong; Legendre, Frédéric

    2016-04-01

    Although acoustic signals are important for communication in many taxa, signal propagation is affected by environmental properties. Strong environmental constraints should drive call evolution, favoring signals with greater transmission distance and content integrity in a given calling habitat. Yet, few empirical studies have verified this prediction, possibly due to a shortcoming in habitat characterization, which is often too broad. Here we assess the potential impact of environmental constraints on the evolution of advertisement call in four groups of torrent-dwelling frogs in the family Ranidae. We reconstruct the evolution of calling site preferences, both broadly categorized and at a finer scale, onto a phylogenetic tree for 148 species with five markers (∼3600 bp). We test models of evolution for six call traits for 79 species with regard to the reconstructed history of calling site preferences and estimate their ancestral states. We find that in spite of existing morphological constraints, vocalizations of torrent-dwelling species are most probably constrained by the acoustic specificities of torrent habitats and particularly their high level of ambient noise. We also show that a fine-scale characterization of calling sites allows a better perception of the impact of environmental constraints on call evolution. PMID:26960074

  17. Sexual selection drives speciation in an Amazonian frog

    Science.gov (United States)

    Boul, K.E.; Funk, W.C.; Darst, C.R.; Cannatella, D.C.; Ryan, M.J.

    2007-01-01

    One proposed mechanism of speciation is divergent sexual selection, whereby divergence in female preferences and male signals results in behavioural isolation. Despite the appeal of this hypothesis, evidence for it remains inconclusive. Here, we present several lines of evidence that sexual selection is driving behavioural isolation and speciation among populations of an Amazonian frog (Physalaemus petersi). First, sexual selection has promoted divergence in male mating calls and female preferences for calls between neighbouring populations, resulting in strong behavioural isolation. Second, phylogenetic analysis indicates that populations have become fixed for alternative call types several times throughout the species' range, and coalescent analysis rejects genetic drift as a cause for this pattern, suggesting that this divergence is due to selection. Finally, gene flow estimated with microsatellite loci is an average of 30 times lower between populations with different call types than between populations separated by a similar geographical distance with the same call type, demonstrating genetic divergence and incipient speciation. Taken together, these data provide strong evidence that sexual selection is driving behavioural isolation and speciation, supporting sexual selection as a cause for speciation in the wild. ?? 2006 The Royal Society.

  18. Birds and frogs selected papers, 1990-2014

    CERN Document Server

    Dyson, Freeman J

    2015-01-01

    This book is a sequel to the volume of selected papers of Dyson up to 1990 that was published by the American Mathematical Society in 1996. The present edition comprises a collection of the most interesting writings of Freeman Dyson, all personally selected by the author, from the period 1990–2014. The five sections start off with an Introduction, followed by Talks about Science, Memoirs, Politics and History, and some Technical Papers. The most noteworthy is a lecture entitled Birds and Frogs to the American Mathematical Society that describes two kinds of mathematicians with examples from real life. Other invaluable contributions include an important tribute to C. N. Yang written for his retirement banquet at Stony Brook University, as well as a historical account of the Operational Research at RAF Bomber Command in World War II provocatively titled A Failure of Intelligence. The final section carries the open-ended question of whether any conceivable experiment could detect single gravitons to provide d...

  19. Synthesis of nanoparticles with frog foam nest proteins

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hyo-Jick, E-mail: choihc@ucmail.uc.edu; Ebersbacher, Charles F. [University of Cincinnati, School of Energy, Environmental, Biological and Medical Engineering (United States); Myung, Nosang V. [University of California, Riverside, Department of Chemical and Environmental Engineering (United States); Montemagno, Carlo D., E-mail: montemcd@ucmail.uc.edu [University of Cincinnati, School of Energy, Environmental, Biological and Medical Engineering (United States)

    2012-09-15

    Microemulsions provide an efficient means of synthesizing monodispersed nanoparticles. Recent studies have demonstrated potential problems of surfactant due to the interaction with nanoparticles/precursors. To solve the problems, various types of chemical surfactants have been tested, but natural biosurfactants have not received a great deal of attention in engineering application. Here, we report the formation of microemulsions using frog foam nest protein, ranaspumin-2 (RSN-2), based on the hypothesis that RSN-2 assembles at the water-oil interface as a result of conformational change into an extended form. Fluorescence spectroscopic studies showed that RSN-2 undergoes a reversible transition between extended and globular conformation in foams/microemulsions and aqueous solution, respectively. Microemulsions were formulated with RSN-2 to synthesize 8-10 nm superparamagnetic iron oxide nanoparticles by mixing precursor-containing microemulsions with base-containing microemulsions. RSN-2 proteins were recovered from microemulsions and found to be recycled to make foams and microemulsions. Fluorescence spectroscopic analyses showed that RSN-2 maintained its mechanical agitation-induced amphiphilicity throughout multiple foaming/defoaming processes. These results suggest that conformational flexibility and structural stability of RSN-2 in aggressive environments enable the recycled use of RSN-2, elucidating the cost-effective advantage.

  20. The Story of California = La Historia de California.

    Science.gov (United States)

    Bartel, Nick

    "The Story of California" is a history and geography of the state of California, intended for classroom use by limited-English-proficient, native Spanish-speaking students in California's urban middle schools. The book is designed with the left page in English and the right page in Spanish to facilitate student transition into comfortable use of…

  1. Columbia spotted frog (Rana luteiventris) in southeastern Oregon: A survey of historical localities, 2009

    Science.gov (United States)

    Pearl, Chistopher A.; Galvan, Stephanie K.; Adams, Michael J.; McCreary, Brome

    2010-01-01

    The Columbia spotted frog (Rana luteiventris) occupies a large range in western North America and is comprised of at least three genetic units. Concern exists regarding the status of the Great Basin populations in Oregon, Idaho, and Nevada. We surveyed target and nearby alternate sites on public lands in southeastern Oregon where there was evidence that Columbia spotted frogs were historically present. We found the species at 59.5 percent (25 of 42) of target or nearby alternate sites. They were in 15 of 23 permanent streams and 8 of 13 intermittent streams. Our surveys do not provide evidence of widespread population losses in our sites. Interpretation of status of Columbia spotted frogs in this study is limited by a lack of precision in some of the historical locations and by our inability to determine if locations where only adults were indicated in the historical record once had breeding populations. Our results support the need for continued investigation of these populations.

  2. Estimation of radiation doses from 137Cs to frogs in a wetland ecosystem

    International Nuclear Information System (INIS)

    Currently, there is no established methodology to estimate radiation doses to non-human biota. Therefore, in this study, various dose models were used to estimate radiation doses to moor frogs (Rana arvalis) in a wetland ecosystem contaminated with 137Cs. External dose estimations were based on activity concentrations of 137Cs in soil and water, considering changes in habitat over a life-cycle. Internal doses were calculated from the activity concentrations of 137Cs measured in moor frogs. Depending on the dose model used, the results varied substantially. External dose rates ranged from 21 to 160 mGy/y, and internal dose rates varied between 1 and 14 mGy/y. Maximum total dose rates to frogs were below the expected safe level for terrestrial populations, but close to the suggested critical dose rate for amphibians. The results show that realistic assumptions in dose models are particularly important at high levels of contamination

  3. Cadmium-induced oxidative stress and apoptosis in the testes of frog Rana limnocharis

    International Nuclear Information System (INIS)

    Highlights: ► Cd can cause vacuoles and deformity of the spermatogenic cells in the frog testes. ► Cd can result in oxidative stress in the frog testes. ► Cd can induce significantly increase of ROS contents triggered DNA damages in the frog testes. ► Cd can cause apoptosis in the testes of male R. limnocharis. ► Apoptosis by Cd in the frog testes is related to Caspase-3, Bax and Bcl-2 genes. - Abstract: This study explored the genetic damage induced by cadmium exposure in the testes of Rana limnocharis. Healthy adult frogs were exposed to 2.5, 5, 7.5, or 10 mg/L of cadmium solution for 14 days. The results showed that exposure to these concentrations increased the levels of reactive oxygen species and malondialdehyde content in the testes, clearly indicating a dose–effect relationship. Moreover, the same dosages of Cd2+ solution increased glutathione (reduced) content, with the values being significantly different from those observed in the control group (P < 0.01). The comet assay results demonstrated that the DNA damage rate, tail length, and tail moment of samples obtained from frogs exposed to 2.5–7.5 mg/L of cadmium solution significantly increased compared with those of samples obtained from the control group (P < 0.01). These findings suggest that cadmium can induce free radical generation, followed by lipid peroxidation and DNA damage. Ultrastructural observation revealed vacuoles in the spermatogenic cells, cell dispersion, incomplete cell structures, and deformed nucleoli. Moreover, cadmium exposure induced significant down-regulation of Bcl-2 expression and up-regulation of Bax and caspase-3 expressions. Taken together, these data indicate that cadmium can induce testicular cell apoptosis in R. limnocharis. Exploring the effects of cadmium on the mechanism of reproductive toxicity in amphibians will help provide a scientific basis accounting for the global population decline in amphibian species.

  4. Application of Surface-Water Microlayer Sampler in the Hydrologic Assessment of Frog Malformations in Minnesota

    Science.gov (United States)

    Jones, P. M.; Menheer, M. A.; Taylor, H.; Aiken, G.; Peart, D.; Thurman, E. M.; Scribner, E. A.; Weishaar, J.; Rostad, C.; Rosenberry, D.

    2001-12-01

    Since the summer of 1993, frog malformations have been reported throughout North America, including over 150 sites in 54 counties of Minnesota. Water-quality analyses of bulk water (grab) samples collected at more than 20 frog malformation sites have yet to indicate any direct relationships between water quality and frog malformation rates. However, many potential contaminants to frog egg masses, metamorphs, and adults are hydrophobic or have a strong association with floating particles that may accumulate in microlayers found on the surface of water bodies. To assess surface microlayer chemistry, a radio-controlled catamaran sampler was developed to collect hydrophobic microlayer samples using a rotating Teflon-coated drum. The drum was positioned to sit approximately 0.5 inch in the surface-water body. Samples were collected on the rotating drum, extracted off the rotating drum using a series of wiper-blades, and funneled into Teflon collection pans. A series of water samples were collected using three different techniques to determine if any relationships exist between the water quality of the surface microlayer and/or lower waters and frog malformation rates. Grab, upper-surface, and microlayer samples were collected during June, August and October 2001 at four surface-water bodies. Grab samples were collected through Teflon tubing held throughout the vertical water column, while upper-surface water samples were collected through Teflon tubing held at the water surface. Microlayer samples were collected using the designed sampler. Collected water samples were analyzed for major ions, trace elements, nutrients, total mercury, dissolved organic carbon, pesticides, hormones, isoflavones, and a series of waste-water constituents. In 2000, frog malformation rates were above 5% at two of the sites, and rates were less than 1% at the other two sites. Available results from water-quality analyses will be presented.

  5. The Australasian frog family Ceratobatrachidae in China, Myanmar and Thailand: discovery of a new Himalayan forest frog clade.

    Science.gov (United States)

    Yan, Fang; Jiang, Ke; Wang, Kai; Jin, Jie-Qiong; Suwannapoom, Chatmongkon; Li, Cheng; Vindum, Jens V; Brown, Rafe M; Che, Jing

    2016-01-18

    In an effort to study the systematic affinities and specieslevel phylogenetic relationships of the enigmatic anurans variably assigned to the genera Ingerana or Limnonectes (family Dicroglossidae), we collected new molecular sequence data for five species including four Himalayan taxa, Limnonectes xizangensis, Lim. medogensis, Lim. alpina, [corrected] Ingerana borealis and one southeast Asian species, I. tasanae, and analyzed these together with data from previous studies involving other ostensibly related taxa. Our surprising results demonstrate unequivocally that Lim. xizangensis, Lim. medogensis and Lim. alpina [corrected] form a strongly supported clade, the sister-group of the family Australasian forest frog family Ceratobatrachidae. This discovery requires an expansion of the definition of Ceratobatrachidae and represents the first record of this family in China. These three species are distinguished from the species of Ingerana and Limnonectes by the: (1) absence of interdigital webbing of the foot, (2) absence of terminal discs on fingers and toes, (3) absence of circumarginal grooves on the fingers and toes, and (4) absence of tarsal folds. Given their phylogenetic and morphological distinctiveness, we assign them to the oldest available generic name for this clade, Liurana Dubois 1987, and transfer Liurana from Dicroglossidae to the family Ceratobatrachidae. In contrast, Ingerana tasanae was found to be clustered with strong support with the recently described genus Alcalus (Ceratobatrachidae), a small clade of otherwise Sundaic species; this constitutes a new record of the family Ceratobatrachidae for Myanmar and Thailand. Finally, Ingerana borealis clustered with the "true" Ingerana (family Dicroglossidae), for which the type species is I. tenasserimensis.

  6. California Indian Food and Culture.

    Science.gov (United States)

    2001

    This learning kit begins with a glossary of terms to help students learn about California Indians and their food. The kit explains that California Indians were the first people to live in the area now known as California, and that these tribes differed in the languages they spoke, the regions they lived in, and the foods that they ate. It explains…

  7. A new Gephyromantis (Phylacomantis frog species from the pinnacle karst of Bemaraha, western Madagascar

    Directory of Open Access Journals (Sweden)

    Angelica Crottini

    2011-02-01

    Full Text Available We describe a new mantellid frog of the subfamily Mantellinae from the karstic Bemaraha Plateau, western Madagascar. The new species belongs to the genus Gephyromantis, subgenus Phylacomantis, which previously included G. azzurrae, G. corvus and G. pseudoasper. Gephyromantis atsingy sp. n. has a snout-vent length of 35–43 mm and is a scansorial frog living among the Tsingy de Bemaraha pinnacles and inside the caves present in the area. A morphological analysis and biomolecular comparison revealed the degree of differentiation between these four species of the Phylacomantis subgenus. The new species seems to be endemic to Tsingy de Bemaraha.

  8. Changes in body fluids of the cocooning fossorial frog Cyclorana australis in a seasonally dry environment.

    Science.gov (United States)

    Reynolds, Stephen J; Christian, Keith A; Tracy, Christopher R; Hutley, Lindsay B

    2011-11-01

    We investigated changes in the lymph (equivalent to plasma) and urine of the cocooning frog Cyclorana australis during the dry season in monsoonal northern Australia. Frogs in moist soil for two days were fully hydrated (lymph 220 mOsm kg(-1), urine 49 mOsm kg(-1)). From five weeks onwards the soil was dry (matric potential soil, osmolality increase in C. australis was not severe. Aestivation in a cocoon facilitates survival in shallow burrows, but such a strategy may only be effective in environments with seasonally reliable rainfall. PMID:21777688

  9. Mortality and Morbidity in African Clawed Frogs (Xenopus laevis) Associated with Construction Noise and Vibrations

    OpenAIRE

    Felt, Stephen A; Cowan, Andrea M; Luong, Richard; Green, Sherril L

    2012-01-01

    In Spring 2008, 175 adult female Xenopus laevis were exposed to construction-related vibrations that caused overt water rippling in the frog tanks. The 3 affected tanks were custom-built static, 300-gal ‘pond-style’ tanks that sat on the floor of the housing room. The water in the tank developed visible ripples as a result of the vibrations transmitted through the floor during jack-hammering in an adjacent room that was approximately 10 ft away. All frogs in the tanks displayed buoyancy probl...

  10. Introducing the Forensic Research/Reference on Genetics knowledge base, FROG-kb

    Directory of Open Access Journals (Sweden)

    Rajeevan Haseena

    2012-09-01

    Full Text Available Abstract Background Online tools and databases based on multi-allelic short tandem repeat polymorphisms (STRPs are actively used in forensic teaching, research, and investigations. The Fst value of each CODIS marker tends to be low across the populations of the world and most populations typically have all the common STRP alleles present diminishing the ability of these systems to discriminate ethnicity. Recently, considerable research is being conducted on single nucleotide polymorphisms (SNPs to be considered for human identification and description. However, online tools and databases that can be used for forensic research and investigation are limited. Methods The back end DBMS (Database Management System for FROG-kb is Oracle version 10. The front end is implemented with specific code using technologies such as Java, Java Servlet, JSP, JQuery, and GoogleCharts. Results We present an open access web application, FROG-kb (Forensic Research/Reference on Genetics-knowledge base, http://frog.med.yale.edu, that is useful for teaching and research relevant to forensics and can serve as a tool facilitating forensic practice. The underlying data for FROG-kb are provided by the already extensively used and referenced ALlele FREquency Database, ALFRED (http://alfred.med.yale.edu. In addition to displaying data in an organized manner, computational tools that use the underlying allele frequencies with user-provided data are implemented in FROG-kb. These tools are organized by the different published SNP/marker panels available. This web tool currently has implemented general functions possible for two types of SNP panels, individual identification and ancestry inference, and a prediction function specific to a phenotype informative panel for eye color. Conclusion The current online version of FROG-kb already provides new and useful functionality. We expect FROG-kb to grow and expand in capabilities and welcome input from the forensic community in

  11. Introducing the Forensic Research/Reference on Genetics knowledge base, FROG-kb

    Science.gov (United States)

    2012-01-01

    Background Online tools and databases based on multi-allelic short tandem repeat polymorphisms (STRPs) are actively used in forensic teaching, research, and investigations. The Fst value of each CODIS marker tends to be low across the populations of the world and most populations typically have all the common STRP alleles present diminishing the ability of these systems to discriminate ethnicity. Recently, considerable research is being conducted on single nucleotide polymorphisms (SNPs) to be considered for human identification and description. However, online tools and databases that can be used for forensic research and investigation are limited. Methods The back end DBMS (Database Management System) for FROG-kb is Oracle version 10. The front end is implemented with specific code using technologies such as Java, Java Servlet, JSP, JQuery, and GoogleCharts. Results We present an open access web application, FROG-kb (Forensic Research/Reference on Genetics-knowledge base, http://frog.med.yale.edu), that is useful for teaching and research relevant to forensics and can serve as a tool facilitating forensic practice. The underlying data for FROG-kb are provided by the already extensively used and referenced ALlele FREquency Database, ALFRED (http://alfred.med.yale.edu). In addition to displaying data in an organized manner, computational tools that use the underlying allele frequencies with user-provided data are implemented in FROG-kb. These tools are organized by the different published SNP/marker panels available. This web tool currently has implemented general functions possible for two types of SNP panels, individual identification and ancestry inference, and a prediction function specific to a phenotype informative panel for eye color. Conclusion The current online version of FROG-kb already provides new and useful functionality. We expect FROG-kb to grow and expand in capabilities and welcome input from the forensic community in identifying datasets and

  12. A new Gephyromantis (Phylacomantis) frog species from the pinnacle karst of Bemaraha, western Madagascar

    Science.gov (United States)

    Crottini, Angelica; Glaw, Frank; Casiraghi, Maurizio; Jenkins, Richard K.B.; Mercurio, Vincenzo; Randrianantoandro, Christian; Randrianirina, Jasmin E.; Andreone, Franco

    2011-01-01

    Abstract We describe a new mantellid frog of the subfamily Mantellinae from the karstic Bemaraha Plateau, western Madagascar. The new species belongs to the genus Gephyromantis, subgenus Phylacomantis, which previously included Gephyromantis azzurrae, Gephyromantis corvus and Gephyromantis pseudoasper. Gephyromantis atsingy sp. n. has a snout-vent length of 35–43 mm and is a scansorial frog living among the Tsingy de Bemaraha pinnacles and inside the caves present in the area. A morphological analysis and biomolecular comparison revealed the degree of differentiation between these four species of the Phylacomantis subgenus.The new species seems to be endemic to Tsingy de Bemaraha. PMID:21594161

  13. Leap Frog Digital Sensors and Definition, Integration & Testing FY 2003 Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    Meitzler, Wayne D.; Ouderkirk, Steven J.; Shoemaker, Steven V.; Tzemos, Spyridon; Griswold, Richard L.

    2003-12-31

    The objective of Leap Frog is to develop a comprehensive security tool that is transparent to the user community and more effective than current methods for preventing and detecting security compromises of critical physical and digital assets. Current security tools intrude on the people that interact with these critical assets by requiring them to perform additional functions or having additional visible sensors. Leap Frog takes security to the next level by being more effective and reducing the adverse impact on the people interacting with protected assets.

  14. Biomimetic agent based modelling using male Frog calling behaviour as a case study

    DEFF Research Database (Denmark)

    Jørgensen, Søren V.; Demazeau, Yves; Christensen-Dalsgaard, Jakob;

    2014-01-01

    by individuals to generate their observed population behaviour. A number of existing agent-modelling frameworks are considered, but none have the ability to handle large numbers of time-dependent event-generating agents; hence the construction of a new tool, RANA. The calling behaviour of the Puerto Rican Tree...... Frog, E. coqui, is implemented as a case study for the presentation and discussion of the tool, and results from this model are presented. RANA, in its present stage of development, is shown to be able to handle the problem of modelling calling frogs, and several fruitful extensions are proposed...

  15. Extinction of montane populations of the northern leopard frog (Rana pippins) in Colorado

    Science.gov (United States)

    Corn, Paul Stephen; Fogleman, James C.

    1984-01-01

    Between 1973 and 1982 nine populations of the northern leopard frog in the Red Feather Lakes region of Larimer County, Colorado, failed in reproduce. These failures all resulted in extinction of the populations. One area formerly supporting a population was recolonized in 1980, but no frogs were observed at any of the nine sites in 1981 or 1982. Six of the populations went extinct because the breeding ponds dried up. The remaining populations were small enough to be susceptible to random events, but the nature of these events is unknown.

  16. Oviposition and development in the glass frog Hyalinobatrachium orientale (Anura: Centrolenidae)

    OpenAIRE

    Nokhbatolfoghahai, Mohsen; Christopher J. Pollock; Downie, J. Roger

    2015-01-01

    Oviposition and development in the glass frog Hyalinobatrachium orientale (Anura: Centrolenidae). Oviposition and external embryonic developmental features are described in the Tobago glass frog, Hyalinobatrachium orientale. Egg clutches are nearly always laid on the undersides of leaves (one exception); usually leaves of Heliconia sp. are used, but Philodendron and palms may be used in the absence of Heliconia. Clutches contain 28.0 ± 5.3 eggs (mean ± SD) and eggs are 1.86 ± 0.11 mm in diame...

  17. Ion secretion and isotonic transport in frog skin glands.

    Science.gov (United States)

    Ussing, H H; Lind, F; Larsen, E H

    1996-07-01

    The aim of this study was to clarify the mechanism of isotonic fluid transport in frog skin glands. Stationary ion secretion by the glands was studied by measuring unidirectional fluxes of 24Na+, 42K+, and carrier-free 134Cs+ in paired frog skins bathed on both sides with Ringer's solution, and with 10(-5) M noradrenaline on the inside and 10(-4) M amiloride on the outside. At transepithelial thermodynamic equilibrium conditions, the 134Cs+ flux ratio, JoutCs/JinCs, varied in seven pairs of preparations from 6 to 36. Since carrier-free 134Cs+ entering the cells is irreversibly trapped in the cellular compartment (Ussing & Lind, 1996), the transepithelial net flux of 134Cs+ indicates that a paracellular flow of water is dragging 134Cs+ in the direction from the serosal- to outside solution. From the measured flux ratios it was calculated that the force driving the secretory flux of Cs+ varied from 30 to 61 mV among preparations. In the same experiments unidirectional Na+ fluxes were measured as well, and it was found that also Na+ was subjected to secretion. The ratio of unidirectional Na+ fluxes, however, was significantly smaller than would be predicted if the two ions were both flowing along the paracellular route dragged by the flow of water. This result indicates that Na+ and Cs+ do not take the same pathway through the glands. The flux ratio of unidirectional K+ fluxes indicated active secretion of K+. The time it takes for steady-state K+ fluxes to be established was significantly longer than that of the simultaneously measured Cs+ fluxes. These results allow the conclusion that - in addition to being transported between cells - K+ is submitted to active transport along a cellular pathway. Based on the recirculation theory, we propose a new model which accounts for stationary Na+, K+, Cl- and water secretion under thermodynamic equilibrium conditions. The new features of the model, as compared to the classical Silva-model for the shark-rectal gland, are: (i

  18. 青蛙放养个体大小对稻蛙共育效益的影响%Effect of Frog Size on Rice-frog Symbiosis System

    Institute of Scientific and Technical Information of China (English)

    俞光荣; 袁德明

    2014-01-01

    In rice-frog symbiosis system, the anti-insect effect of frog can not only improve the rice quality but also increase the profit of frog raising. Most frog released in this system is usually small with single weight less than 100 g. Experiments were conducted to ex-plore the influences of frog weight on anti-insect effect and raising profit. The results showed that released with single frog weight of 75 g can reach the profit level as that of the single frog weight of 100 g.%稻蛙共育是一种新的生态稻作模式,高产高效,但在青蛙繁育过程中,由于个体差异,造成稻田可套养时单体质量低于100 g的青蛙数量较多。针对这一情况,笔者对稻田放养单体质量低于100 g青蛙对治虫、养殖效益的影响开展了对比试验。结果表明,稻蛙共育中采用单体质量75g的青蛙放养是可行的,能基本达到100 g单体质量青蛙的放养效果。

  19. SOUTH WARNER WILDERNESS, CALIFORNIA.

    Science.gov (United States)

    Duffield, Wendell A.; Weldin, Robert E.

    1984-01-01

    A mineral appraisal utilized geologic, geochemical, and geophysical data and an examination of mining claims in the South Warner Wilderness, California. Results of this study indicate that little promise for the occurrence of mineral resources exists within the area. Small veins of optical quality calcite occur on the east side of the area but, are not considered a resource.

  20. Indians of California.

    Science.gov (United States)

    Bureau of Indian Affairs (Dept. of Interior), Washington, DC.

    A brief historical review of the American Indian in California from prehistoric to modern times indicates the hardships and economic disadvantages which the Indians have suffered in the acculturation process. Discussion of the treaties which were negotiated and the Federal legislation which was passed indicates an attempt on the part of modern day…

  1. Computerevolution in California.

    Science.gov (United States)

    Kobryn, Nancy M.

    The introduction of the microcomputer is producing complex changes in the cosmopolitan culture of Californians, including the way people live and learn at home, in school, and at the office. Recently, many bills have been proposed in California to introduce computer science and technology into the public education system; in addition, tax credits…

  2. Does multiple paternity improve fitness of the frog Crinia georgiana?

    Science.gov (United States)

    Byrne, P G; Roberts, J D

    2000-06-01

    In the Australian myobatrachid frog Crinia georgiana simultaneous polyandry occurs in about half of all matings, which leads to multiple paternity, but reduced fertilization success and occasional female mortality. Multiple paternity may provide benefits to females that compensate for these costs, for example, through enhanced genetic diversity of a clutch. In nature, embryos and tadpoles of C. georgiana develop in shallow, temporary pools and may be exposed to fluctuating water levels and the risk of desiccation between rain events. Fertilization by genetically diverse sires may act as a bet hedge against these conditions. To evaluate this hypothesis, females were artificially mated with one or two males in the field and eggs and larvae reared in the laboratory under constant or fluctuating developmental conditions. Experiment 1 exposed embryos from single- and multiple-paternity clutches to conditions where eggs were completely covered during development or eggs sat in air on a moist substrate. Experiment 2 exposed freshly hatched larvae from single- and multiple-paternity clutches to constant wet conditions, where larvae were completely covered, or fluctuating wet conditions, where larvae ranged from being completely submersed to partially exposed over a 13-day cycle. We measured mean performance and best performance as alternate measures of genetic benefits. There were no effects of paternity on percent survival to hatching, time to hatching, body size at hatching, percent survival to metamorphosis, time to metamorphosis, or body size at metamorphosis. We also analyzed variance within clutches as a measure of genetic diversity. Again there were no predictable effects of multiple paternity. Polyandry does not appear to provide any genetic benefits that compensate for the high costs of polyandry in this species. PMID:10937269

  3. A tree of tree frogs around the Black Sea.

    Science.gov (United States)

    Irwin, Darren E

    2016-09-01

    Speciation, the process by which one species evolves into two or more, is a major focus of ongoing debate, particularly regarding the geographic context in which it occurs. Geographic models of speciation tend to fall into discrete categories, typically referred to as allopatric, parapatric and sympatric speciation, according to whether two groups evolve reproductive isolation while geographically isolated, differentiated but connected by gene flow, or completely co-occurring. Yet molecular studies indicate that full development of reproductive isolation can take very long compared with the timescale at which climatic oscillations occur, such that the geographic context of differentiating forms might change often during the long process to full species. Studies of genetic relationships across the ranges of organisms with low-dispersal distances have the potential to reveal these complex histories. In a particularly elegant example in this issue, Dufresnes et al. () use genetic variation and ecological niche modelling to show that a ring of populations of the eastern tree frog (Hyla orientalis) surrounding the Black Sea had a complex history of geographic differentiation. Alternating phases of geographic fragmentation and phases of gene flow between neighbouring populations have produced a pattern of gradual genetic change connecting the western, southern and eastern sides of the ring, with the northwestern and northeastern forms being most differentiated. In the north, a population in Crimea appears to have been produced through mixture of the two extreme forms. The overall genetic relationships are reminiscent of those found in ring species, which have been used as prime demonstrations of the process of speciation. The difference, however, is that the terminal forms appear to have mixed rather than be reproductively isolated, although more research is needed to infer whether there might be some reproductive isolation on the northern side of the ring. PMID

  4. Cost-effective conservation of an endangered frog under uncertainty.

    Science.gov (United States)

    Rose, Lucy E; Heard, Geoffrey W; Chee, Yung En; Wintle, Brendan A

    2016-04-01

    How should managers choose among conservation options when resources are scarce and there is uncertainty regarding the effectiveness of actions? Well-developed tools exist for prioritizing areas for one-time and binary actions (e.g., protect vs. not protect), but methods for prioritizing incremental or ongoing actions (such as habitat creation and maintenance) remain uncommon. We devised an approach that combines metapopulation viability and cost-effectiveness analyses to select among alternative conservation actions while accounting for uncertainty. In our study, cost-effectiveness is the ratio between the benefit of an action and its economic cost, where benefit is the change in metapopulation viability. We applied the approach to the case of the endangered growling grass frog (Litoria raniformis), which is threatened by urban development. We extended a Bayesian model to predict metapopulation viability under 9 urbanization and management scenarios and incorporated the full probability distribution of possible outcomes for each scenario into the cost-effectiveness analysis. This allowed us to discern between cost-effective alternatives that were robust to uncertainty and those with a relatively high risk of failure. We found a relatively high risk of extinction following urbanization if the only action was reservation of core habitat; habitat creation actions performed better than enhancement actions; and cost-effectiveness ranking changed depending on the consideration of uncertainty. Our results suggest that creation and maintenance of wetlands dedicated to L. raniformis is the only cost-effective action likely to result in a sufficiently low risk of extinction. To our knowledge we are the first study to use Bayesian metapopulation viability analysis to explicitly incorporate parametric and demographic uncertainty into a cost-effective evaluation of conservation actions. The approach offers guidance to decision makers aiming to achieve cost

  5. Induction of apoptosis in frog virus 3-infected cells.

    Science.gov (United States)

    Chinchar, V G; Bryan, Locke; Wang, J; Long, Scott; Chinchar, G D

    2003-02-15

    The ability of frog virus 3 (FV3), the type species of the family Iridoviridae, to induce apoptosis was examined by monitoring DNA cleavage, chromatin condensation, and cell-surface expression of phosphotidylserine (PS) in fathead minnow (FHM) and baby hamster kidney (BHK) cells. In productively infected FHM cells, DNA fragmentation was first noted at 6-7 h postinfection and was clearly seen by 17 h postinfection, while chromatin condensation was detected at 8.5 h postinfection. As with some other viruses, FV3-induced apoptosis did not require de novo viral gene expression as both heat-inactivated and UV-inactivated virus readily triggered DNA fragmentation in FHM cells. Moreover, FV3-induced apoptosis was blocked in FHM cells by the pan-caspase inhibitor Z-VAD-FMK, suggesting that virus infection triggers programmed cell death through activation of the caspase cascade. FV3 infection also triggered apoptosis in BHK cells as monitored by TUNEL and annexin V binding assays. To determine whether FV3, similar to other large DNA viruses, encoded proteins that block or delay apoptosis, mock- and FV3-infected FHM cells were osmotically shocked and assayed for DNA fragmentation 3 hours later. DNA fragmentation was clearly seen whether or not shocked cells were previously infected with FV3, indicating that infection with FV3 did not block apoptosis induced by osmotic shock in FHM cells. The above results demonstrate that iridoviruses triggered apoptosis and that the induction of programmed cell death did not require viral gene expression. However, it remains to be determined if virion attachment to target cells is sufficient to induce cell death, or if apoptosis is triggered directly or indirectly by one or more virion-associated proteins. PMID:12642103

  6. Light-dependent magnetic compass in Iberian green frog tadpoles

    Science.gov (United States)

    Diego-Rasilla, Francisco Javier; Luengo, Rosa Milagros; Phillips, John B.

    2010-12-01

    Here, we provide evidence for a wavelength-dependent effect of light on magnetic compass orientation in Pelophylax perezi (order Anura), similar to that observed in Rana catesbeiana (order Anura) and Notophthalmus viridescens (order Urodela), and confirm for the first time in an anuran amphibian that a 90° shift in the direction of magnetic compass orientation under long-wavelength light (≥500 nm) is due to a direct effect of light on the underlying magnetoreception mechanism. Although magnetic compass orientation in other animals (e.g., birds and some insects) has been shown to be influenced by the wavelength and/or intensity of light, these two amphibian orders are the only taxa for which there is direct evidence that the magnetic compass is light-dependent. The remarkable similarities in the light-dependent magnetic compasses of anurans and urodeles, which have evolved as separate clades for at least 250 million years, suggest that the light-dependent magnetoreception mechanism is likely to have evolved in the common ancestor of the Lissamphibia (Early Permian, ~294 million years) and, possibly, much earlier. Also, we discuss a number of similarities between the functional properties of the light-dependent magnetic compass in amphibians and blue light-dependent responses to magnetic stimuli in Drosophila melanogaster, which suggest that the wavelength-dependent 90° shift in amphibians may be due to light activation of different redox forms of a cryptochrome photopigment. Finally, we relate these findings to earlier studies showing that the pineal organ of newts is the site of the light-dependent magnetic compass and recent neurophysiological evidence showing magnetic field sensitivity in the frog frontal organ (an outgrowth of the pineal).

  7. Response of the Italian agile frog (Rana latastei) to a Ranavirus, frog virus 3: a model for viral emergence in naïve populations.

    Science.gov (United States)

    Pearman, Peter B; Garner, Trenton W J; Straub, Monika; Greber, Urs F

    2004-10-01

    Ranavirus (family Iridoviridae) is a genus of pathogens of poikilotherms, and some ranaviruses may play a role in widespread mortality of amphibians. Ecology of viral transmission in amphibians is poorly known but can be addressed through experimentation in the laboratory. In this study, we use the Ranavirus frog virus 3 (FV3) as an experimental model for pathogen emergence in naive populations of tadpoles. We simulated emerging disease by exposing tadpoles of the Italian agile frog (Rana latastei), to the North American Ranavirus FV3. We demonstrated that mortality occurred due to viral exposure, exposure of tadpoles to decreasing concentrations of FV3 in the laboratory produced dose-dependent survival rates, and cannibalism of virus-carrying carcasses increased mortality due to FV3. These experiments suggest the potential for ecological mechanisms to affect the level of exposure of tadpoles to Ranavirus and to impact transmission of viral pathogens in aquatic systems. PMID:15650083

  8. Medicinal use of secretions (“the frog vaccine” from the kambô frog (Phyllomedusa bicolor by non-indigenous peoples in Rondônia, Brazil

    Directory of Open Access Journals (Sweden)

    Paulo Sérgio Bernarde

    2009-09-01

    Full Text Available Amphibians have pharmaceutically active skin secretions that protect against infections and predation. Some indigenous people in southwestern Amazonia use these secretions from P. bicolor for medicinal purposes. While the use of these secretions by indigenous people is relatively well-known, the use by non-indigenous peoples is very poorly studied. Here we describe the use of the “frog vaccine” by non-indigenous populations in the Brazilian state of Rondônia. Thirty-one people who had received this “vaccine” were interviewed. The use of this vaccine is not typical or habitual in this region, and the person who administers the vaccine must travel from another part of Amazonia. Users of the vaccine come from middle and upper social classes with reasonable levels of education (primary, secondary and university. Approximately half the people vaccinated felt that their health had improved after vaccination and if need be, they would take the vaccination again. Most of the people do not know the frog species from which the secretions are taken. While the people who use this treatment believe that it is good for any infirmity, the medicinal properties, if any, of the “frog vaccine” are under study and are still unknown.

  9. Frogs in the spotlight: a 16-year survey of native frogs and invasive toads on a floodplain in tropical Australia.

    Science.gov (United States)

    Brown, Gregory P; Shine, Richard

    2016-07-01

    Although widespread declines in anuran populations have attracted considerable concern, the stochastic demographics of these animals make it difficult to detect consistent trends against a background of spatial and temporal variation. To identify long-term trends, we need datasets gathered over long time periods, especially from tropical areas where anuran biodiversity is highest. We conducted road surveys of four anurans in the Australian wet-dry tropics on 4637 nights over a 16-year period. Our surveys spanned the arrival of invasive cane toads (Rhinella marina), allowing us to assess the invader's impact on native anuran populations. Our counts demonstrate abrupt and asynchronous shifts in abundance and species composition from one year to the next, not clearly linked to rainfall patterns. Typically, periods of decline in numbers of a species were limited to 1-2 years and were followed by 1- to 2-year periods of increase. No taxa showed consistent declines over time, although trajectories for some species showed significant perturbations coincident with the arrival of toads. None of the four focal frog species was less common at the end of the study than at the beginning, and three of the species reached peak abundances after toad arrival. Survey counts of cane toads increased rapidly during the initial stage of invasion but have subsequently declined and fluctuated. Distinguishing consistent declines versus stochastic fluctuations in anuran populations requires extensive time-series analysis, coupled with an understanding of the shifts expected under local climatic conditions. This is especially pertinent when assessing impacts of specific perturbations such as invasive species. PMID:27386087

  10. Chilled frogs are hot: hibernation and reproduction of the Endangered mountain yellow-legged frog Rana muscosa

    Science.gov (United States)

    Santana, Frank E.; Swaisgood, Ronald R.; Lemm, Jeffrey M.; Fisher, Robert N.; Clark, Rulon W.

    2015-01-01

    In the face of the sixth great extinction crisis, it is imperative to establish effective breeding protocols for amphibian conservation breeding programs. Captive efforts should not proceed by trial and error, nor should they jump prematurely to assisted reproduction techniques, which can be invasive, difficult, costly, and, at times, counterproductive. Instead, conservation practitioners should first look to nature for guidance, and replicate key conditions found in nature in the captive environment, according to the ecological and behavioral requirements of the species. We tested the effect of a natural hibernation regime on reproductive behaviors and body condition in the Endangered mountain yellow-legged frog Rana muscosa. Hibernation had a clear positive effect on reproductive behavior, manifesting in vocal advertisement signaling, female receptivity, amplexus, and oviposition. These behaviors are critical components of courtship that lead to successful reproduction. Our main finding was that captive R. muscosa require a hibernation period for successful reproduction, as only hibernated females produced eggs and only hibernated males successfully fertilized eggs. Although hibernation also resulted in a reduced body condition, the reduction appeared to be minimal with no associated mortality. The importance of hibernation for reproduction is not surprising, since it is a major component of the conditions that R. muscosa experiences in the wild. Other amphibian conservation breeding programs can also benefit from a scientific approach that tests the effect of natural ecological conditions on reproduction. This will ensure that captive colonies maximize their role in providing genetic reservoirs for assurance and reintroduction efforts.

  11. The Lombard effect in male ultrasonic frogs: Regulating antiphonal signal frequency and amplitude in noise

    Science.gov (United States)

    Shen, Jun-Xian; Xu, Zhi-Min

    2016-01-01

    Acoustic communication in noisy environments presents a significant challenge for vocal animals because noise can interfere with animal acoustic signals by decreasing signal-to-noise ratios and masking signals. Birds and mammals increase call intensity or frequency as noise levels increase, but it is unclear to what extend this behavior is shared by frogs. Concave-eared torrent frogs (Odorrana tormota) have evolved the capacity to produce various calls containing ultrasonic harmonics and to communicate beside noisy streams. However, it is largely unclear how frogs regulate vocalization in response to increasing noise levels. We exposed male frogs to various levels of noise with playback of conspecific female courtship calls and recorded antiphonal signals and spontaneous short calls. Males were capable of rapidly adjusting fundamental frequency and amplitude of antiphonal signals as noise levels increased. The increment in fundamental frequency and amplitude was approximately 0.5 kHz and 3 dB with every 10 dB increase in noise level, indicating the presence of noise-dependent signal characteristics. Males showed the noise-tolerant adaption in response to female calls in noise level from 40 to 90 dB SPL. The results suggest that the noise-dependent signal characteristics in O. tormota have evolved as a strategy to cope with varying torrent noise. PMID:27345957

  12. Evidence for selection on coloration in a Panamanian poison frog : a coalescent-based approach

    NARCIS (Netherlands)

    Brown, Jason L.; Maan, Martine E.; Cummings, Molly E.; Summers, Kyle

    2010-01-01

    Aim The strawberry poison frog, Oophaga pumilio, has undergone a remarkable radiation of colour morphs in the Bocas del Toro archipelago in Panama. This species shows extreme variation in colour and pattern between populations that have been geographically isolated for <10,000 years. While previous

  13. Effect of primycin on some electric properties of the frog skeletal muscle

    International Nuclear Information System (INIS)

    The effect of primycin (a quanidine-type antibiotic) on the electric properties and 42K-uptake of frog muscles was studied. Primycin inhibited the 42K-uptake and caused depolarization of the plasma membrane. It is concluded that primycin blocks the resting K+-channels. (L.E.)

  14. The action spectra for photoreactivation and photorepair in ICR 2A frog cells

    International Nuclear Information System (INIS)

    Action spectra for photoreactivation (enhancement of colony forming ability) and photorepair (monomerization of pyrimidine dimers in DNA) were obtained for ICR 2A frog cells over the 334-577 nm range. These spectra were very similar with peaks at 435 nm and little effectiveness at wavelengths greater than 500 nm. (author)

  15. A gas chromatographic method for the identification of gamma-irradiated frog legs

    International Nuclear Information System (INIS)

    When triglycerides or fatty acids are irradiated, some of the major stable products formed are hydrocarbons with one less carbon than the parent fatty acids. These hydrocarbons are formed as the result of the loss of CO2 via various free radical reactions. A procedure has been developed utilizing capillary gas chromatography (GC) to monitor the formation of these hydrocarbons in gamma-irradiated frog legs. Since frog legs contain large amounts of palmitic, stearic, oleic, and linoleic acids, the formation of the hydrocarbons (pentadecane, heptadecane, 8-heptadecene, and 6,9-heptadecadiene, respectively) from the decarboxylation of these fatty acids was monitored. The yield of these hydrocarbons was found to be linear with applied dose. A sample from a lot of imported frog legs that were believed to have been irradiated was also analyzed. The results obtained from the GC determination of the hydrocarbons compared favorably with those obtained by using electron spin resonance to monitor the free radicals trapped in the frog leg bone after irradiation. (author)

  16. Sensitivity of frogs (Rana arvalis) which live in radionuclide contaminated territories to additional colchicine treatment

    International Nuclear Information System (INIS)

    Frogs (Rana arvalis) were caught in villages Babichi (> 2.0 kBq/kg) and Ratomka (< 0.1 kBq/kg). Bone marrow and spleen have been tested to leucocyte with apoptosis indication. After injection of colchicines (10 mg/kg) it was discovered increasing number of cells with pycnosis symptom. The result depends on type of analysed tissue and season

  17. The Frog Pond Revisited: High School Academic Context, Class Rank, and Elite College Admission

    Science.gov (United States)

    Espenshade, Thomas J.; Hale, Lauren E.; Chung, Chang Y.

    2005-01-01

    In this article, the authors test a "frog-pond" model of elite college admission proposed by Attewell, operationalizing high school academic context as the secondary school-average SAT score and number of Advanced Placement tests per high school senior. Data on more than 45,000 applications to three elite universities show that a high school's…

  18. Current-voltage curve of sodium channels and concentration dependence of sodium permeability in frog skin

    DEFF Research Database (Denmark)

    Fuchs, W; Larsen, Erik Hviid; Lindemann, B

    1977-01-01

    1. The inward facing membranes of in vitro frog skin epithelium were depolarized with solutions of high K concentration. The electrical properties of the epithelium are then expected to be governed by the outward facing, Na-selective membrane.2. In this state, the transepithelial voltage (V...

  19. A Novel Vasoactive Proline-Rich Oligopeptide from the Skin Secretion of the Frog Brachycephalus ephippium

    DEFF Research Database (Denmark)

    Arcanjo, Daniel Dias Rufino; Vasconcelos, Andreanne Gomes; Comerma-Steffensen, Simón Gabriel;

    2015-01-01

    , PROs decrease blood pressure in animals. In the present study, the isolation and biological characterization of a novel vasoactive BPP isolated from the skin secretion of the frog Brachycephalus ephippium is described. This new PRO, termed BPP-Brachy, has the primary structure WPPPKVSP and the amidated...

  20. Schellackia (Apicomplexa: Eimeriidae of the brazilian tree-frog, Phrynohyas venulosa (Amphibia: Anura from Amazonian Brazil

    Directory of Open Access Journals (Sweden)

    I. Paperna

    1995-10-01

    Full Text Available Endogenous stages of a Schellackia species are described in histological sections of the intestine of the tree-frog, Phrynohyas venulosa, from North Brazil. Most oocysts sporulate within the epithelial cells of the gut, but a few were detected in the lamina propria.

  1. BIOMETRIC STUDY TO RANA RIDIBUNDA FROG SPECIES NEARNESS TO TIMISOARA LOCALITY

    Directory of Open Access Journals (Sweden)

    M. BURA

    2013-12-01

    Full Text Available Speciality literature provides little informations regarding Rana ridibunda frogbiometry. For supply this gap we studied the size and weight of 54 frogs sampled fromnearby Timişoara area ponds.The mean body lenght was 8,08 ± 0,54 cm for the females and respectively 6,17 ± 0,45cm for the males. Before evisceration on a par females weighted 62,28 ± 12,87 g andthe males 22,46 ± 5,3 g whereas after this action the carcase weighted 43,89 ± 8,91 gin the case of females and respectively 18,45 ± 4,42 g in the case of male lake frog. Themean leg lenght measured 12,59 ± 0,68 cm for female frogs and 9,78 ± 0,66 cm in thecase of male frogs. The hind stylopodium was estimated on a par as 13,23 ± 2,57 g forfemales and 5,33 ± 1,26 g for the males.

  2. Space use of Amazonian poison frogs: Testing the reproductive resource defense hypothesis

    NARCIS (Netherlands)

    Poelman, E.H.; Dicke, M.

    2008-01-01

    In most Anuran species, space use includes a lek mating system with defense of a calling site for only a short time period during an individual's lifespan. In contrast, territoriality over a longer time period by one or both of the sexes has been reported in all studied dendrobatid frogs. In most de

  3. Generation of the Dimensional Embryology Application (App) for Visualization of Early Chick and Frog Embryonic Development

    Science.gov (United States)

    Webb, Rebecca L.; Bilitski, James; Zerbee, Alyssa; Symans, Alexandra; Chop, Alexandra; Seitz, Brianne; Tran, Cindy

    2015-01-01

    The study of embryonic development of multiple organisms, including model organisms such as frogs and chicks, is included in many undergraduate biology programs, as well as in a variety of graduate programs. As our knowledge of biological systems increases and the amount of material to be taught expands, the time spent instructing students about…

  4. Mortality and morbidity in African clawed frogs (Xenopus laevis) associated with construction noise and vibrations.

    Science.gov (United States)

    Felt, Stephen A; Cowan, Andrea M; Luong, Richard; Green, Sherril L

    2012-03-01

    In Spring 2008, 175 adult female Xenopus laevis were exposed to construction-related vibrations that caused overt water rippling in the frog tanks. The 3 affected tanks were custom-built static, 300-gal 'pond-style' tanks that sat on the floor of the housing room. The water in the tank developed visible ripples as a result of the vibrations transmitted through the floor during jack-hammering in an adjacent room that was approximately 10 ftaway. All frogs in the tanks displayed buoyancy problems, excessive air gulping, and skin sloughing; ultimately 7 frogs died. In addition, these 7 animals were bloated, and 5 of these 7 had regurgitated and everted their stomach and distal esophagus into the oral cavity, resulting in airway obstruction and death. Gross pathologic findings included regurgitation and eversion of the stomach of the distal portion of the esophagus into the oral cavity, obstruction of the airway, and lung overinflation. No significant histologic lesions were observed. Construction vibrations transmitted through the water appeared to have disrupted the mechanoreceptive function of the lateral line system, resulting in overstimulation of the noxious feeding response, regurgitation, and eversion of the stomach and distal esophagus into the oral cavity and subsequent suffocation due to airway obstruction. After immediate cessation of the jack-hammering and relocation of the remaining frogs, no additional morbidities or mortalities occurred. PMID:22776127

  5. Receptor-mediated endocytosis of lysozyme in renal proximal tubules of the frog Rana temporaria

    Directory of Open Access Journals (Sweden)

    E.V. Seliverstova

    2015-04-01

    Full Text Available The mechanism of protein reabsorption in the kidney of lower vertebrates remains insufficiently investigated in spite of raising interest to the amphibian and fish kidneys as a useful model for physiological and pathophysiological examinations. In the present study, we examined the renal tubular uptake and the internalization rote of lysozyme after its intravenous injection in the wintering frog Rana temporaria using immunohisto- and immunocytochemistry and specific markers for some endocytic compartments. The distinct expression of megalin and cubilin in the proximal tubule cells of lysozyme-injected frogs was revealed whereas kidney tissue of control animals showed no positive immunoreactivity. Lysozyme was detected in the apical endocytic compartment of the tubular cells and colocalized with clathrin 10 min after injection. After 20 min, lysozyme was located in the subapical compartment negative to clathrin (endosomes, and intracellular trafficking of lysozyme was coincided with the distribution of megalin and cubilin. However, internalized protein was retained in the endosomes and did not reach lysosomes within 30 min after treatment that may indicate the inhibition of intracellular trafficking in hibernating frogs. For the first time, we provided the evidence that lysozyme is filtered through the glomeruli and absorbed by receptor-mediated clathrin-dependent endocytosis in the frog proximal tubule cells. Thus, the protein uptake in the amphibian mesonephros is mediated by megalin and cubilin that confirms a critical role of endocytic receptors in the renal reabsorption of proteins in amphibians as in mammals.

  6. Modelling the impact of roads on regional population of Moor frogs (Rana arvalis)

    DEFF Research Database (Denmark)

    Pontoppidan, Maj-Britt

    , called SAIA (Spatial Amphibian Impact Assessment), considers a landscape mosaic of breeding habitat, summer habitat and uninhabitable land. As input I use a GIS-map of the landscape with information on land cover. In addition, data on observed frog populations in the survey area are needed. The dispersal...

  7. Use of olfactory cues by newly metamorphosed wood frogs (Lithobates sylvaticus) during emigration

    Science.gov (United States)

    Zydlewski, Joseph; Popescu, Viorel D.; Brodie, Bekka S.; Hunter, Malcom L.

    2012-01-01

    Juvenile amphibians are capable of long-distance upland movements, yet cues used for orientation during upland movements are poorly understood. We used newly metamorphosed Wood Frogs (Lithobates sylvaticus) to investigate: (1) the existence of innate (i.e., inherited) directionality, and (2) the use of olfactory cues, specifically forested wetland and natal pond cues during emigration. In a circular arena experiment, animals with assumed innate directionality did not orient in the expected direction (suggested by previous studies) when deprived of visual and olfactory cues. This suggests that juvenile Wood Frogs most likely rely on proximate cues for orientation. Animals reared in semi-natural conditions (1500 l cattle tanks) showed a strong avoidance of forested wetland cues in two different experimental settings, although they had not been previously exposed to such cues. This finding is contrary to known habitat use by adult Wood Frogs during summer. Juvenile Wood Frogs were indifferent to the chemical signature of natal pond (cattle tank) water. Our findings suggest that management strategies for forest amphibians should consider key habitat features that potentially influence the orientation of juveniles during emigration movements, as well as adult behavior.

  8. Two new species of fanged frogs from Peninsular Malaysia (Anura: Dicroglossidae).

    Science.gov (United States)

    Matsui, Masafumi; Belabut, Daicus M; Ahmad, Norhayati

    2014-01-01

    Taxonomic status of fanged frogs from the Peninsular Malaysia, previously assigned to Limnonectes kuhlii, is assessed using genetic and morphological approaches. Phylogenetic relationships inferred from sequences of the mitochondrial and nuclear genes revealed that the fanged frogs from the Peninsula form a monophyletic group and are clearly divergent from other species previously, or even now, assigned to L. kuhlii from Mainland Southeast Asia. In both mtDNA and nuDNA phylogeny, the Malay Peninsula clade diverges into two lineages, one from north (Larut Hill, Perak, and Hulu Terengganu, Terengganu) and another from south (Genting Highlands, Pahang, and Gombak, Selangor). These lineages are separated by large genetic distances, comparable with those observed between some other species of L. kuhlii-like frogs. Although the two lineages are very similar morphologically, they are distinguishable in several morphological traits and are considered heterospecific. We therefore describe them as L. utara sp. nov. and L. selatan sp. nov. These new species differ from all other species of kuhlii-like frogs from Mainland Southeast Asia by the surface of tibia, which is densely covered by large warts.  PMID:25543621

  9. Conservation Needs of Batrachophrynus and Telmatobius Frogs of the Andes of Peru

    Directory of Open Access Journals (Sweden)

    Angulo Ariadne

    2008-01-01

    Full Text Available Recent reports indicate that Andean frogs of the genera Batrachophrynus and Telmatobius have under-gone severe population declines across much of their geographical range, with several factors (e.g., pollu-tion, habitat degradation and destruction, climate change, disease and harvesting potentially involved in these declines. However, positive identification and quantification of these factors, as well as that of their interactions, are needed in order to better inform future conservation action. Peru is considered a hotspot for these frogs; it is home to at least 40 percent of all known species of Telmatobius and 100 percent of all known species of Batrachophrynus. An assessment of the current state of conservation knowledge of these Andean frogs in this country is provided, including data from both the Global Amphibian Assess-ment, and Peru′s Instituto Nacional de los Recursos Naturales, with special attention to those factors that may affect population status. Specific research and conservation recommendations for these frogs and their habitats are suggested.

  10. Tolerance of Frogs among High School Students: Influences of Disgust and Culture

    Science.gov (United States)

    Prokop, Pavol; Medina-Jerez, William; Coleman, Joy; Fancovicová, Jana; Özel, Murat; Fedor, Peter

    2016-01-01

    Amphibians play an important role in the functioning of ecosystems and some of them inhabit human gardens where they can successfully reproduce. The decline of amphibian diversity worldwide suggests that people may play a crucial role in their survival. We conducted a cross-cultural study on high school students' tolerance of frogs in Chile,…

  11. Effects of forest fragmentation and habitat degradation on West African leaf-litter frogs

    NARCIS (Netherlands)

    A. Hillers; M. Veith; M.-O. Rödel

    2008-01-01

    Habitat degradation alters the dynamics and composition of anuran assemblages in tropical forests. The effects of forest fragmentation on the composition of anuran assemblages are so far poorly known. We studied the joint influence of forest fragmentation and degradation on leaf-litter frogs. We spe

  12. Dissecting the frog inner ear with Gaussian noise .2. Temperature dependence of inner ear function

    NARCIS (Netherlands)

    vanDijk, P; Wit, HP; Segenhout, JM

    1997-01-01

    The temperature dependence of the response of single primary auditory nerve fibers (n = 31) was investigated in the European edible frog, Rana esculenta (seven ears). Nerve fiber responses were analyzed with Wiener kernel analysis and polynomial correlation. The responses were described with a casca

  13. Active tension changes in frog skeletal muscle during and after mechanical extension

    NARCIS (Netherlands)

    Atteveldt, H. van; Crowe, Alan

    1980-01-01

    Isolated frog sartorious muscle at 4°C has been used to study the phenomenon whereby tetanically stimulated muscle, subjected to a mechanical extension, yields an active tension which is greater than that obtained during an isometric contraction in which the muscle is stretched prior to stimulation.

  14. What's in a frog stomach? Solving a 150 year old mystery (Diptera: Calliphoridae)

    Science.gov (United States)

    The taxon Acanthosoma chrysalis Mayer, 1844, described from Germany on a number of alleged parasites encysted in the peritoneal wall of the stomach of edible frogs, is revised and shown to be first instar larvae of blow flies (Calliphoridae). Based on the shape of mouthhooks and abdominal cuticular ...

  15. Two new species of fanged frogs from Peninsular Malaysia (Anura: Dicroglossidae).

    Science.gov (United States)

    Matsui, Masafumi; Belabut, Daicus M; Ahmad, Norhayati

    2014-11-03

    Taxonomic status of fanged frogs from the Peninsular Malaysia, previously assigned to Limnonectes kuhlii, is assessed using genetic and morphological approaches. Phylogenetic relationships inferred from sequences of the mitochondrial and nuclear genes revealed that the fanged frogs from the Peninsula form a monophyletic group and are clearly divergent from other species previously, or even now, assigned to L. kuhlii from Mainland Southeast Asia. In both mtDNA and nuDNA phylogeny, the Malay Peninsula clade diverges into two lineages, one from north (Larut Hill, Perak, and Hulu Terengganu, Terengganu) and another from south (Genting Highlands, Pahang, and Gombak, Selangor). These lineages are separated by large genetic distances, comparable with those observed between some other species of L. kuhlii-like frogs. Although the two lineages are very similar morphologically, they are distinguishable in several morphological traits and are considered heterospecific. We therefore describe them as L. utara sp. nov. and L. selatan sp. nov. These new species differ from all other species of kuhlii-like frogs from Mainland Southeast Asia by the surface of tibia, which is densely covered by large warts. 

  16. Major histocompatibility complex selection dynamics in pathogen-infected túngara frog (Physalaemus pustulosus) populations.

    Science.gov (United States)

    Kosch, Tiffany A; Bataille, Arnaud; Didinger, Chelsea; Eimes, John A; Rodríguez-Brenes, Sofia; Ryan, Michael J; Waldman, Bruce

    2016-08-01

    Pathogen-driven selection can favour major histocompatibility complex (MHC) alleles that confer immunological resistance to specific diseases. However, strong directional selection should deplete genetic variation necessary for robust immune function in the absence of balancing selection or challenges presented by other pathogens. We examined selection dynamics at one MHC class II (MHC-II) locus across Panamanian populations of the túngara frog, Physalaemus pustulosus, infected by the amphibian chytrid fungus Batrachochytrium dendrobatidis (Bd). We compared MHC-II diversity in highland túngara frog populations, where amphibian communities have experienced declines owing to Bd, with those in the lowland region that have shown no evidence of decline. Highland region frogs had MHC variants that confer resistance to Bd. Variant fixation appeared to occur by directional selection rather than inbreeding, as overall genetic variation persisted in populations. In Bd-infected lowland sites, however, selective advantage may accrue to individuals with only one Bd-resistance allele, which were more frequent. Environmental conditions in lowlands should be less favourable for Bd infection, which may reduce selection for specific Bd resistance in hosts. Our results suggest that MHC selection dynamics fluctuate in túngara frog populations as a function of the favourability of habitat to pathogen spread and the vulnerability of hosts to infection. PMID:27531158

  17. The Lombard effect in male ultrasonic frogs: Regulating antiphonal signal frequency and amplitude in noise.

    Science.gov (United States)

    Shen, Jun-Xian; Xu, Zhi-Min

    2016-01-01

    Acoustic communication in noisy environments presents a significant challenge for vocal animals because noise can interfere with animal acoustic signals by decreasing signal-to-noise ratios and masking signals. Birds and mammals increase call intensity or frequency as noise levels increase, but it is unclear to what extend this behavior is shared by frogs. Concave-eared torrent frogs (Odorrana tormota) have evolved the capacity to produce various calls containing ultrasonic harmonics and to communicate beside noisy streams. However, it is largely unclear how frogs regulate vocalization in response to increasing noise levels. We exposed male frogs to various levels of noise with playback of conspecific female courtship calls and recorded antiphonal signals and spontaneous short calls. Males were capable of rapidly adjusting fundamental frequency and amplitude of antiphonal signals as noise levels increased. The increment in fundamental frequency and amplitude was approximately 0.5 kHz and 3 dB with every 10 dB increase in noise level, indicating the presence of noise-dependent signal characteristics. Males showed the noise-tolerant adaption in response to female calls in noise level from 40 to 90 dB SPL. The results suggest that the noise-dependent signal characteristics in O. tormota have evolved as a strategy to cope with varying torrent noise. PMID:27345957

  18. Isolation of ice-nucleating active bacteria from the freeze-tolerant frog, Rana sylvatica.

    Science.gov (United States)

    Lee, M R; Lee, R E; Strong-Gunderson, J M; Minges, S R

    1995-08-01

    Ice-nucleating active (INA) bacteria were isolated from the gut of field-collected freeze-tolerant wood frogs (Rana sylvatica) collected in winter. Thirteen strains of Pseudomonas fluorescens, four strains of Pseudomonas putida, and two strains of Enterobacter agglomerans had ice-nucleating activity. Each of the INA pseudomonad strains was psychrophilic. P. putida strains were differentiated from P. fluorescens strains by gelatinase, lecithinase, and lipase production. The maximum nucleation temperatures (Tmax) of aqueous suspensions (10(9) bacteria/ml) of the four INA P. putida strains ranged from -1.6 to -3.0 degrees C, which places this INA species among the most potent known biological nucleators. Ingestion of INA P. putida isolated from R. sylvatica by another freeze-tolerant frog. Pseudacris crucifer, decreased the capacity of this frog to supercool and remain unfrozen at -2 degrees C. This is the first report of INA bacteria isolated from a vertebrate, and suggests that, as part of the gut flora in some posthibernation freeze-tolerant wood frogs, these bacteria may play a role in enhancing winter survival by promoting ice nucleation at high subzero temperatures (ca. -2 degrees C). PMID:7656570

  19. Investigation of longitudinal profile of rigid frogs on reinforced concrete sleepers

    Directory of Open Access Journals (Sweden)

    A.M. Orlovs’kyi

    2012-08-01

    Full Text Available In the paper the effect of longitudinal profile of rigid frogs of type R65 mark 1/11 on reinforced concrete sleepers on the interaction in the ‘wheel-rail’ system in the zone of rolling surface irregularities is investigated.

  20. Historical biogeography of Western Palaearctic pelobatid and pelodytid frogs: a molecular phylogenetic perspective

    NARCIS (Netherlands)

    Veith, M.; Fromhage, L.; Kosuch, J.; Vences, M.

    2006-01-01

    Spadefoot toads (Pelobates) and Parsley frogs (Pelodytes) are an enigmatic group of Western Palaearctic anurans. In the genus Pelobates, a fossorial lifestyle has enforced a conserved bauplan that masks their intraspecific evolutionary history. We used partial sequences of the mitochondrial 16S and

  1. Toxin from skin of frogs of the genus Atelopus: differentiation from Dendrobatid toxins.

    Science.gov (United States)

    Fuhrman, F A; Fuhrman, G J; Mosher, H S

    1969-09-26

    A potent, dialyzable toxin (atelopidtoxin) occurs in the skin of frogs of the genus Atelopus. A concentrate of atelopidtoxin from Atelopus zeteki has an LD(50) in mice of 16 micrograms per kilogram. It differs from batrachotoxin, tetrodotoxin, and saxitoxin, the only known nonprotein substances of greater toxicity, as well as from all toxins previously isolated from amphibia. PMID:5807965

  2. No Flower Shall Wither; or, Horticulture in the Kingdom of the Frogs. The Cutting Edge

    Science.gov (United States)

    Clabaugh, Gary K.

    2004-01-01

    Dedicated educators, struggling with the mandates of "No Child Left Behind" will immediately identify with the hero of this allegory. Horace is a small frog, who has a passion for gardening, and watching flowers bloom. As soon as he comes of age, Horace decides to pursue his great love of nurturing tender blooming things. He studies, diligently,…

  3. NEURO-PROTECTION AND NEURO-THERAPY EFFECTS OF Acalypha indica Linn. WATER EXTRACT EX VIVO ON Musculus gastrocnemius Frog

    OpenAIRE

    Arjo Tedjo; Hamdani Zain; Nurhadi Ibrahim; Ernie H. Purwaningsih

    2008-01-01

    The studies of neuro-protection and neuro-therapy effects of Acalypha indica Linn. water extract ex vivo on Musculus gastrocnemius frog have already done at three Departments in Faculty of Medicine, University of Indonesia. The experimental studies were done on 2 groups of frog for neuro-protection and neuro-therapy effects. Each group of frog was divided into 7 subgroups of application, 4 samples each. There were 5 subgroups of doses: 5; 10; 15; 20; 25 mg and 2 subgroups as control. Pancuro...

  4. Diets of three species of anurans from the cache creek watershed, California, USA

    Science.gov (United States)

    Hothem, R.L.; Meckstroth, A.M.; Wegner, K.E.; Jennings, M.R.; Crayon, J.J.

    2009-01-01

    We evaluated the diets of three sympatric anuran species, the native Northern Pacific Treefrog, Pseudacris regilla, and Foothill Yellow-Legged Frog, Rana boylii, and the introduced American Bullfrog, Lithobates catesbeianus, based on stomach contents of frogs collected at 36 sites in 1997 and 1998. This investigation was part of a study of mercury bioaccumulation in the biota of the Cache Creek Watershed in north-central California, an area affected by mercury contamination from natural sources and abandoned mercury mines. We collected R. boylii at 22 sites, L. catesbeianus at 21 sites, and P. regilla at 13 sites. We collected both L. catesbeianus and R. boylii at nine sites and all three species at five sites. Pseudacris regilla had the least aquatic diet (100% of the samples had terrestrial prey vs. 5% with aquatic prey), followed by R. boylii (98% terrestrial, 28% aquatic), and L. catesbeianus, which had similar percentages of terrestrial (81%) and aquatic prey (74%). Observed predation by L. catesbeianus on R. boylii may indicate that interaction between these two species is significant. Based on their widespread abundance and their preference for aquatic foods, we suggest that, where present, L. catesbeianus should be the species of choice for all lethal biomonitoring of mercury in amphibians. Copyright ?? 2009 Society for the Study of Amphibians and Reptiles.

  5. Contraction and relaxation of isolated cardiac myocytes of the frog under varying mechanical loads.

    Science.gov (United States)

    Parikh, S S; Zou, S Z; Tung, L

    1993-02-01

    The mechanics of cardiac systole and relaxation have been studied primarily at the level of the whole heart or intact muscle. End-systolic pressure-volume relations of frog hearts have been found to be load dependent, whereas those of the mammal are relatively load independent. On the other hand, myocardial relaxation as studied at the muscle level is load independent in the frog but markedly load dependent in the mammal. Interpretation of these studies is complicated because of the unknown contribution of extracellular connective tissue, neurohumoral factors, and, in the case of the heart, the complex chamber geometry. Therefore, it is valuable to study cardiac mechanics at the level of the basic unit of contractile activity--the isolated myocyte. The goal of this study was to subject isolated frog cardiomyocytes to mechanical loading paradigms that mimic those presented to the cells within the heart. In the first part of this study, the afterload and preload of contracting cells were varied to study their effects on the end-systolic force-length relation, which was consistently found to be load independent over the range of isotonic shortening tested (typically 5%). We also investigated the force-length-time response of the cells to test the concept of the heart behaving as a time-varying elastance. Our results suggest that in this regard the frog myocyte behaves like mammalian muscle, and they are consistent with the presence of a small viscosity within the cell. We conclude that the tissue structure of the frog heart may contribute to disparity in mechanical behavior at the different structural levels. In the second part of this study, we subjected isolated frog cardiomyocytes to four different loading paradigms to test the hypothesis that myocardial relaxation in the frog is independent of load. These sequences consisted of afterloaded contractions followed by conventional isotonic-isometric relaxation (ACCR) or afterloaded contractions followed by

  6. Persistence at distributional edges: Columbia spotted frog habitat in the arid Great Basin, USA.

    Science.gov (United States)

    Arkle, Robert S; Pilliod, David S

    2015-09-01

    A common challenge in the conservation of broadly distributed, yet imperiled species is understanding which factors facilitate persistence at distributional edges, locations where populations are often vulnerable to extirpation due to changes in climate, land use, or distributions of other species. For Columbia spotted frogs (Rana luteiventris) in the Great Basin (USA), a genetically distinct population segment of conservation concern, we approached this problem by examining (1) landscape-scale habitat availability and distribution, (2) water body-scale habitat associations, and (3) resource management-identified threats to persistence. We found that areas with perennial aquatic habitat and suitable climate are extremely limited in the southern portion of the species' range. Within these suitable areas, native and non-native predators (trout and American bullfrogs [Lithobates catesbeianus]) are widespread and may further limit habitat availability in upper- and lower-elevation areas, respectively. At the water body scale, spotted frog occupancy was associated with deeper sites containing abundant emergent vegetation and nontrout fish species. Streams with American beaver (Castor canadensis) frequently had these structural characteristics and were significantly more likely to be occupied than ponds, lakes, streams without beaver, or streams with inactive beaver ponds, highlighting the importance of active manipulation of stream environments by beaver. Native and non-native trout reduced the likelihood of spotted frog occupancy, especially where emergent vegetation cover was sparse. Intensive livestock grazing, low aquatic connectivity, and ephemeral hydroperiods were also negatively associated with spotted frog occupancy. We conclude that persistence of this species at the arid end of its range has been largely facilitated by habitat stability (i.e., permanent hydroperiod), connectivity, predator-free refugia, and a commensalistic interaction with an ecosystem

  7. VENTANA WILDERNESS, CALIFORNIA.

    Science.gov (United States)

    Pearson, R.C.; Fillo, P.V.

    1984-01-01

    A mineral survey of the Ventana Primitive Area (now the Ventana Wilderness) in California was made. On the basis of known mineral occurrences and geologic and geochemical studies, this part of the Coast Ranges of central California contains little evidence for the existence of mineral resources. Small bodies of good quality marble are scattered through parts of the wilderness. Because of their small size these marble occurrences are not considered as having resource potential. Detailed mapping and sampling of the sulfide-bearing gneiss and schist will be needed to determine the grade and extent of these rocks and the possibility that they, in fact, could represent significant resources. The numerous thermal springs in and near the area suggest a high geothermal gradient and that geothermal-energy resources should be investigated.

  8. Population genetics of the Chilean frog Batrachyla Leptopus (Leptodactylidae

    Directory of Open Access Journals (Sweden)

    J.R. Formas

    2000-03-01

    Full Text Available Electrophoretic variation of proteins encoded by 14 loci was analyzed in eight (five continental and three insular populations of the Chilean leptodactylid frog Batrachyla leptopus. The overall proportion of polymorphic loci was estimated to be 18.7% and the average number of alleles per locus, 1.2, while observed and expected heterozygosities were 1.7 and 5.1%, respectively. The estimated coefficient of genetic identity was 0.940; the corresponding figure for genetic distance was 0.063. F-statistics analysis showed a total inbreeding coefficient (Fit of 0.855 and high levels of genetic subdivision (Fst = 0.596 as well as of inbreeding within populations (Fis = 0.640. However, there was only a moderate level of genetic differentiation (Fst = 0.181 between the insular group of populations and the continental group.A variação eletroforética de proteínas codificadas por 14 loci foi analisada em oito populações (5 continentais e 3 insulares da rã leptodactilídea chilena Batrachyla leptopus. A proporção geral de loci polimórficos foi estimada como sendo de 18,7% e o número médio de alelos por loco, 1,2, enquanto que as heterozigosidades observada e esperada foram 1,7 e 5,1%, respectivamente. O coeficiente esperado de identidade genética foi 0,940; o número correspondente para a distância genética foi 0,063. A análise estatística F mostrou um coeficiente de endogamia total (Fit de 0,855 e altos níveis de subdivisão genética (Fst = 0,596, assim como de endogamia dentro das populações (Fis = 0,640. Contudo, houve apenas um nível moderado de diferenciação genética (Fst = 0,181 entre o grupo insular de populações e o grupo continental.

  9. Accounting for California Water

    OpenAIRE

    Escriva-Bou, Alvar; McCann, Henry; Hanak, Ellen; Lund, Jay; Gray, Brian

    2016-01-01

    Understanding California’s water balance sheet—how much there is, who has claims to it, and what is actually being “spent”—is key to effectively managing the state’s limited water supply in support of a healthy economy and environment. The latest drought has spotlighted serious gaps in California’s water accounting system. California is a large, geographically diverse state, and its water systems are physically interconnected and institutionally fragmented. Water infrastructure connects the s...

  10. Minimal health impacts but detectable tissue residues after exposure of northern leopard frogs (Lithobates pipiens) to commercial naphthenic acids

    International Nuclear Information System (INIS)

    This presentation reported on a study that examined whether naphthenic acids (NAs) are a toxic component in oil sands process-affected materials (OSPM). The study investigated the toxicity of commercial (Refined Merichem) NAs to native amphibians (northern leopard frogs) exposed to saline conditions comparable to those of reclaimed wetlands on oil sand leases. Gas chromatography-mass spectroscopy analysis showed that the exposure of frogs to NAs solutions for 28 days resulted in proportional NA concentrations in extracts of frog muscle tissue. Biological assays were performed to determine if the increasing exposure to NAs caused a proportional compromise in the health of test animals. The innate immune function, thyroid hormones, and hepatic detoxification enzyme induction did not differ in response to increased tissue concentrations of NAs. The commercial NAs were absorbed and deposited in muscle tissue. It was concluded that NAs play only a small, if any, role in the toxicity of OSPM to frogs.

  11. Size-sex variation in survival rates and abundance of pig frogs, Rana grylio, in northern Florida wetlands

    Science.gov (United States)

    Wood, K.V.; Nichols, J.D.; Percival, H.F.; Hines, J.E.

    1998-01-01

    During 1991-1993, we conducted capture-recapture studies on pig frogs, Rana grylio, in seven study locations in northcentral Florida. Resulting data were used to test hypotheses about variation in survival probability over different size-sex classes of pig frogs. We developed multistate capture-recapture models for the resulting data and used them to estimate survival rates and frog abundance. Tests provided strong evidence of survival differences among size-sex classes, with adult females showing the highest survival probabilities. Adult males and juvenile frogs had lower survival rates that were similar to each other. Adult females were more abundant than adult males in most locations at most sampling occasions. We recommended probabilistic capture-recapture models in general, and multistate models in particular, for robust estimation of demographic parameters in amphibian populations.

  12. Minimal health impacts but detectable tissue residues after exposure of northern leopard frogs (Lithobates pipiens) to commercial naphthenic acids

    Energy Technology Data Exchange (ETDEWEB)

    Hersikorn, B. [Saskatchewan Univ., Saskatoon, SK (Canada); Young, R.; Fedorak, P. [Alberta Univ., Edmonton, AB (Canada); Smits, J. [Calgary Univ., AB (Canada)

    2010-07-01

    This presentation reported on a study that examined whether naphthenic acids (NAs) are a toxic component in oil sands process-affected materials (OSPM). The study investigated the toxicity of commercial (Refined Merichem) NAs to native amphibians (northern leopard frogs) exposed to saline conditions comparable to those of reclaimed wetlands on oil sand leases. Gas chromatography-mass spectroscopy analysis showed that the exposure of frogs to NAs solutions for 28 days resulted in proportional NA concentrations in extracts of frog muscle tissue. Biological assays were performed to determine if the increasing exposure to NAs caused a proportional compromise in the health of test animals. The innate immune function, thyroid hormones, and hepatic detoxification enzyme induction did not differ in response to increased tissue concentrations of NAs. The commercial NAs were absorbed and deposited in muscle tissue. It was concluded that NAs play only a small, if any, role in the toxicity of OSPM to frogs.

  13. Ecoregions of California

    Science.gov (United States)

    Griffith, Glenn E.; Omernik, James M.; Smith, David W.; Cook, Terry D.; Tallyn, Ed; Moseley, Kendra; Johnson, Colleen B.

    2016-02-23

    Ecoregions denote areas of general similarity in ecosystems and in the type, quality, and quantity of environmental resources. They are designed to serve as a spatial framework for the research, assessment, management, and monitoring of ecosystems and ecosystem components. By recognizing the spatial differences in the capacities and potentials of ecosystems, ecoregions stratify the environment by its probable response to disturbance (Bryce and others, 1999). These general purpose regions are critical for structuring and implementing ecosystem management strategies across Federal agencies, State agencies, and nongovernment organizations that are responsible for different types of resources in the same geographical areas (Omernik and others, 2000).The approach used to compile this map is based on the premise that ecological regions are hierarchical and can be identified through the analysis of the spatial patterns and the composition of biotic and abiotic phenomena that affect or reflect differences in ecosystem quality and integrity (Wiken, 1986; Omernik, 1987, 1995). These phenomena include geology, physiography, vegetation, climate, soils, land use, wildlife, and hydrology. The relative importance of each characteristic varies from one ecological region to another regardless of the hierarchical level. A Roman numeral hierarchical scheme has been adopted for different levels of ecological regions. Level I is the coarsest level, dividing North America into 15 ecological regions. Level II divides the continent into 50 regions (Commission for Environmental Cooperation Working Group, 1997, map revised 2006). At level III, the continental United States contains 105 ecoregions and the conterminous United States has 85 ecoregions (U.S. Environmental Protection Agency, 2013). Level IV, depicted here for California, is a further refinement of level III ecoregions. Explanations of the methods used to define these ecoregions are given in Omernik (1995), Omernik and others

  14. Low detection of ranavirus DNA in wild postmetamorphic green frogs, Rana (Lithobates) clamitans, despite previous or concurrent tadpole mortality.

    Science.gov (United States)

    Forzán, María J; Wood, John

    2013-10-01

    Ranavirus (Iridoviridae) infection is a significant cause of mortality in amphibians. Detection of infected individuals, particularly carriers, is necessary to prevent and control outbreaks. Recently, the use of toe clips to detect ranavirus infection through PCR was proposed as an alternative to the more frequently used lethal liver sampling in green frogs (Rana [Lithobates] clamitans). We attempted reevaluate the use of toe clips, evaluate the potential use of blood onto filter paper and hepatic fine needle aspirates (FNAs) as further alternatives, and explore the adequacy of using green frogs as a target-sampling species when searching for ranavirus infection in the wild. Samples were obtained from 190 postmetamorphic (≥1-yr-old) green frogs from five ponds on Prince Edward Island (PEI), Canada. Three of the ponds had contemporary or recent tadpole mortalities due to Frog Virus 3 (FV3) ranavirus. PCR testing for ranavirus DNA was performed on 190 toe clips, 188 blood samples, 72 hepatic FNAs, and 72 liver tissue samples. Only two frogs were ranavirus-positive: liver and toe clip were positive in one, liver only was positive in the other; all blood and FNAs, including those from the two positive frogs, were negative. Results did not yield a definitive answer on the efficacy of testing each type of sample, but resemble what is found in salamanders infected with Ambystoma tigrinum (rana)virus. Findings indicate a low prevalence of FV3 in postmetamorphic green frogs on PEI (≤2.78%) and suggest that green frogs are poor reservoirs (carriers) for the virus. PMID:24502715

  15. California community water systems inventory dataset, 2010

    Data.gov (United States)

    California Environmental Health Tracking Program — This data set contains information about all Community Water Systems in California. Data are derived from California Office of Drinking Water (ODW) Water Quality...

  16. Obesity in California, 2012 and 2013

    Data.gov (United States)

    U.S. Department of Health & Human Services — These data are from the 2013 California Dietary Practices Surveys (CDPS), 2012 California Teen Eating, Exercise and Nutrition Survey (CalTEENS), and 2013 California...

  17. Density and richness of leaf litter frogs (Amphibia: Anura of an Atlantic Rainforest area in the Serra dos Órgãos, Rio de Janeiro State, Brazil

    Directory of Open Access Journals (Sweden)

    Carla C. Siqueira

    2009-03-01

    Full Text Available Data on species composition, richness, and density are presented for the leaf litter frog assemblage of an area of Atlantic Rainforest at the Serra dos Órgãos mountain range, in the state of Rio de Janeiro, southeastern Brazil. Three sampling methods were used: plot sampling, visual encounter surveys, and pitfall traps. The local assemblage of leaf litter frogs was composed of 16 species, with the direct-developing species, Euparkerella brasiliensis (Parker, 1926, being the most abundant. The estimated density of the local leaf litter frog assemblage based on plot sampling was 17.1 ind/100 m² and the estimated overall leaf litter frog mass was 684.2 g/ha. The estimated density of leaf litter frogs at the present study is the highest currently reported for Atlantic Rainforest areas, which reinforces the idea of higher densities of leaf litter frogs in the Neotropical Region compared to the Old World tropics.

  18. Characterization of kappa 1 and kappa 2 opioid binding sites in frog (Rana esculenta) brain membrane preparation

    International Nuclear Information System (INIS)

    The distribution and properties of frog brain kappa-opioid receptor subtypes differ not only from those of the guinea pig brain, but also from that of the rat brain. In guinea pig cerebellum the kappa 1 is the dominant receptor subtype, frog brain contains mainly the kappa 2 subtype, and the distribution of the rat brain subtypes is intermediate between the two others. In competition experiments it has been established that ethylketocyclazocine and N-cyclopropylmethyl-norazidomorphine, which are nonselective kappa-ligands, have relatively high affinities to frog brain membranes. The kappa 2 ligands (Met5)enkephalin-Arg6-Phe7 and etorphine also show high affinities to the frog brain. Kappa 1 binding sites measured in the presence of 5 microM/D-Ala2-Leu5/enkephalin represent 25-30% of [3H]ethylketocyclazocine binding in frog brain membranes. The kappa 2 subtype in frog brain resembles more to the mu subtype than the delta subtype of opioid receptors, but it differs from the mu subtype in displaying low affinity toward beta-endorphin and /D-Ala2-(Me)Phe4-Gly5-ol/enkephalin (DAGO). From our data it is evident that the opioid receptor subtypes are already present in the amphibian brain but the differences among them are less pronounced than in mammalian brain

  19. Radiation doses to frogs inhabiting a wetland ecosystem in an area of Sweden contaminated with 137Cs

    International Nuclear Information System (INIS)

    Internal and external radiation doses to frogs living in a wetland ecosystem contaminated with 137Cs were estimated. The external doses were calculated from measured concentrations of 137Cs in soil and in water taking into account changes in the habitat during the frogs' life cycle. The internal dose was estimated from measured concentrations of 137Cs in living frogs (Rana arvalis) using a whole-body counter. The average inventory of 137Cs in the soil was approximately 1000 kBq/m2 of which 86-99 % was found in the top 12 cm. The concentrations of 137Cs in frogs varied between 560 and 3450 Bq/kg ww. The estimated external dose rate was between 21 and 160 mGy/y, while the internal dose of beta and gamma was only between 1 and 6.2 mGy/y. The estimated total dose rate to frogs from 137Cs was below the expected safe level for terrestrial populations but close to the critical dose rate for amphibians suggested in the literature. Therefore, the radiation risk to frogs from radiocaesium in the study area may be one more stressor for an endangered group of animals in this ecosystem. (author)

  20. Tool path planning of hole-making operations in ejector plate of injection mould using modified shuffled frog leaping algorithm

    Directory of Open Access Journals (Sweden)

    Amol M. Dalavi

    2016-07-01

    Full Text Available Optimization of hole-making operations in manufacturing industry plays a vital role. Tool travel and tool switch planning are the two major issues in hole-making operations. Many industrial applications such as moulds, dies, engine block, automotive parts etc. requires machining of large number of holes. Large number of machining operations like drilling, enlargement or tapping/reaming are required to achieve the final size of individual hole, which gives rise to number of possible sequences to complete hole-making operations on the part depending upon the location of hole and tool sequence to be followed. It is necessary to find the optimal sequence of operations which minimizes the total processing cost of hole-making operations. In this work, therefore an attempt is made to reduce the total processing cost of hole-making operations by applying relatively new optimization algorithms known as shuffled frog leaping algorithm and proposed modified shuffled frog leaping algorithm for the determination of optimal sequence of hole-making operations. An industrial application example of ejector plate of injection mould is considered in this work to demonstrate the proposed approach. The obtained results by the shuffled frog leaping algorithm and proposed modified shuffled frog leaping algorithm are compared with each other. It is seen from the obtained results that the results of proposed modified shuffled frog leaping algorithm are superior to those obtained using shuffled frog leaping algorithm.

  1. Cadmium-induced oxidative stress and apoptosis in the testes of frog Rana limnocharis

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Hangjun; Cai Chenchen; Shi Cailei; Cao Hui; Han Ziliu [Department of Environmental Sciences, Hangzhou Normal University, Xuelin Road 16, Xiasha Gaojiao Dongqu, Hangzhou, Zhejiang Province, 310036 (China); Jia Xiuying, E-mail: hznujiaxiuying@126.com [Department of Environmental Sciences, Hangzhou Normal University, Xuelin Road 16, Xiasha Gaojiao Dongqu, Hangzhou, Zhejiang Province, 310036 (China)

    2012-10-15

    Highlights: Black-Right-Pointing-Pointer Cd can cause vacuoles and deformity of the spermatogenic cells in the frog testes. Black-Right-Pointing-Pointer Cd can result in oxidative stress in the frog testes. Black-Right-Pointing-Pointer Cd can induce significantly increase of ROS contents triggered DNA damages in the frog testes. Black-Right-Pointing-Pointer Cd can cause apoptosis in the testes of male R. limnocharis. Black-Right-Pointing-Pointer Apoptosis by Cd in the frog testes is related to Caspase-3, Bax and Bcl-2 genes. - Abstract: This study explored the genetic damage induced by cadmium exposure in the testes of Rana limnocharis. Healthy adult frogs were exposed to 2.5, 5, 7.5, or 10 mg/L of cadmium solution for 14 days. The results showed that exposure to these concentrations increased the levels of reactive oxygen species and malondialdehyde content in the testes, clearly indicating a dose-effect relationship. Moreover, the same dosages of Cd{sup 2+} solution increased glutathione (reduced) content, with the values being significantly different from those observed in the control group (P < 0.01). The comet assay results demonstrated that the DNA damage rate, tail length, and tail moment of samples obtained from frogs exposed to 2.5-7.5 mg/L of cadmium solution significantly increased compared with those of samples obtained from the control group (P < 0.01). These findings suggest that cadmium can induce free radical generation, followed by lipid peroxidation and DNA damage. Ultrastructural observation revealed vacuoles in the spermatogenic cells, cell dispersion, incomplete cell structures, and deformed nucleoli. Moreover, cadmium exposure induced significant down-regulation of Bcl-2 expression and up-regulation of Bax and caspase-3 expressions. Taken together, these data indicate that cadmium can induce testicular cell apoptosis in R. limnocharis. Exploring the effects of cadmium on the mechanism of reproductive toxicity in amphibians will help provide a

  2. Anfíbios Anuros do Distrito Federal The Frogs of the Federal District of Brazil

    Directory of Open Access Journals (Sweden)

    Bertha Lutz

    1954-03-01

    Full Text Available The frogs of the Federal District of Brazil are listed and discussed as to habit, biology and ecology. The F. D is situated 22° 54' 24" S. & 43° 10' 21" W Gr. and comprises 1.356 km². Its topography includes sea-shore, maritime scrub, lagoons, plains and marsh, open slopes, forested mountains and great heads of rock. Three thousand feet of altitude are attained at two points. Fifty two different frogs occur in the F.D. Three fifths of them live in open country. Two fifths of these have never been found above the plains; the others range higher but mostly in open country. Their environment offers conditions suitable for average tadpoles and adults. these frogs are more or less unspecialized. There are six genera and thirty species. Two thirds of the latter belong to the type genera of the large neotropical families Bufonidae, Leptodactylidae and Hylidae. Only in the maritime scrub formation are conditions somewhat different. Water for average tadpoles is provided by the lagoons. The xerophytism of the vegetation is, however, so marked that bromeliads growing on the ground provide almost the only appropriate shelter for adult tree-frogs used to sleeping upright on the vegetation. One large Hylid genus lives entirely in them. It is casque-headed and phragmotic, shutting the lumen of the leaf-cup with head used as a plug. Another large Hylid genus shows a lesser degree of the same specialization. (Lutz A & Lutz B, 1939 II. One genus with two species is entirely saxicolous; it lives on wet ledges of rock at all phases of its life history. (B. Lutz 1948. The other two fifths of the frogs from F. D. are montane forest forms. Their environment offers numerous and varied biotopes and is near optimum for adults. There is,however, hardly any standing water available for larvae. These frogs are ecologically diversified. They also show a general trend towards spawning in the adult biotipe, which leads to delayed hatching, semi-aquatic and terrestrial

  3. Caveolae Restrict Tiger Frog Virus Release in HepG2 cells and Caveolae-Associated Proteins Incorporated into Virus Particles

    OpenAIRE

    Jian He; Yi-Wen Zheng; Yi-Fan Lin; Shu Mi; Xiao-Wei Qin; Shao-Ping Weng; Jian-Guo He; Chang-Jun Guo

    2016-01-01

    Caveolae are flask-shaped invaginations of the plasma membrane. Caveolae play important roles in the process of viruses entry into host cells, but the roles of caveolae at the late stage of virus infection were not completely understood. Tiger frog virus (TFV) has been isolated from the diseased tadpoles of the frog, Rana tigrina rugulosa, and causes high mortality of tiger frog tadpoles cultured in Southern China. In the present study, the roles of caveolae at the late stage of TFV infection...

  4. California Fish Passage Assessment Database [ds69

    Data.gov (United States)

    California Department of Resources — The Passage Assessment Database shapefile contains locations of known and potential barriers to salmonid migration in California streams with additional information...

  5. Giant Reed Distribution - Northern California [ds333

    Data.gov (United States)

    California Department of Resources — The Arundo Distribution layer is a compilation of Arundo donax observations in northern and central California, obtained from several sources, including Arundo...

  6. California Tiger Salamander Range - CWHR [ds588

    Data.gov (United States)

    California Department of Resources — Vector datasets of CWHR range maps are one component of California Wildlife Habitat Relationships (CWHR), a comprehensive information system and predictive model...

  7. Conservation issues: California chaparral

    Science.gov (United States)

    Halsey, Richard W.; Keeley, Jon E.

    2016-01-01

    California chaparral, a sclerophyllous shrub-dominated plant community shaped by a Mediterranean-type climate and infrequent, high-intensity fire, is one of the most biodiverse and threatened habitats on Earth. Distinct forms of chaparral, distinguished by differing species composition, geography, and edaphic characteristics, can cover thousands of hectares with dense vegetation or be restricted to smaller communities identified by the presence of endemic species. To maintain the biodiversity of chaparral, protective land management actions will be required to mitigate the loss due to the impacts of human population growth, development, climate change, and increased fire frequencies.

  8. Diversity of pulsed-field gel electrophoresis pulsotypes, serovars, and antibiotic resistance among Salmonella isolates from wild amphibians and reptiles in the California Central Coast.

    Science.gov (United States)

    Gorski, Lisa; Jay-Russell, Michele T; Liang, Anita S; Walker, Samarpita; Bengson, Yingjia; Govoni, Jessica; Mandrell, Robert E

    2013-06-01

    A survey of cold-blooded vertebrates and associated surface waters in a produce-growing region on the Central California Coast was done between May and September 2011 to determine the diversity of Salmonella. Samples from 460 amphibians and reptiles and 119 water samples were collected and cultured for Salmonella. Animals sampled were frogs (n=331), lizards (n=59), newts (n=5), salamanders (n=6), snakes (n=39), and toads (n=20). Salmonella was isolated from 37 individual animals, including frogs, lizards, snakes, and toads. Snakes were the most likely to contain Salmonella, with 59% testing positive followed by 15.3% of lizards, 5% of toads, and 1.2% of frogs. Fifteen water samples (12.6%) were positive. Twenty-two different serovars were identified, and the majority of isolates were S. enterica subsp. IIIb, with subsp. I, II, and IIIa also found. The serovar isolated most frequently was S. enterica subsp. IIIb 16:z₁₀:e,n,x,z₁₅, from snakes and frogs in five different locations. S. enterica subsp. I serovar Typhimurium and the monophasic I 6,8:d:- were isolated from water, and subspecies I Duisburg and its variants were found in animals and water. Some samples contained more than one type of Salmonella. Analysis of pulsed-field gel electrophoresis pulsotypes indicated that some strains persisted in animals and water collected from the same location. Sixty-six isolates displayed antibiotic resistance, with 27 isolates resistant to more than one antibiotic, including a subspecies IIIb isolate from snake having resistance to five different antibiotics. Twenty-three isolates were resistant to more than one class of antibiotic, and six isolates were resistant to three classes. While these subspecies of IIIa and IIIb cause fewer instances of human illness, they may serve as reservoirs of antibiotic resistance, determinants in the environment, and be sources of contamination of leafy greens associated with product recalls.

  9. Experts Question California's Algebra Edict

    Science.gov (United States)

    Cavanagh, Sean

    2008-01-01

    Business leaders from important sectors of the American economy have been urging schools to set higher standards in math and science--and California officials, in mandating that 8th graders be tested in introductory algebra, have responded with one of the highest such standards in the land. Still, many California educators and school…

  10. Female Superintendent Longevity in California

    Science.gov (United States)

    Rohlfing, Tracy

    2011-01-01

    The purpose of this study was to investigate, through narrative inquiry (Clandinin & Connelly, 2000), the leadership evolution of five female superintendents in California with longevity of 5 or more years in their current school district positions. The research question addressed was, "How do California female superintendents evolve to…

  11. Sex-biased predation by polecats influences the mating system of frogs.

    Science.gov (United States)

    Lodé, Thierry; Holveck, Marie-Jeanne; Lesbarrères, David; Pagano, Alain

    2004-12-01

    In agile frogs, Rana dalmatina, an increase in male-biased operational sex ratio and in male abundance results in the emergence of alternative male mating behaviour in the form of searching. As a consequence, females are coerced into mating with multiple males, which in turn increases the level of conflict between the sexes. Selective predation on males by the European polecat, Mustela putorius, decreases the occurrence of polyandry. In ponds visited by polecats, the sex ratio is less male biased than in ponds where polecats are absent. As a result most males call to attract females and fewer males actively search for females. Females are able to choose between calling males and mate with a single male. Thus, predation by polecats is found to influence sex ratio, male abundance and sexual conflict in a frog mating system, restricting the opportunity for multiple mating. PMID:15801586

  12. Calcium regulation in frog peripheral nerve by the blood-nerve barrier

    International Nuclear Information System (INIS)

    The objectives of this research were: (a) to investigate the characteristics of calcium transport across the perineurium and the endoneurial capillaries, and (b) to gain a better understanding of the extent of calcium homeostasis in the endoneurial space. To study the nature of calcium transport across the perineurium, the flux of radiotracer 45Ca was measured through the perineurial cylinder, isolated from the frog sciatic nerve, and through the perineurium into the nerve in situ. To study the nature of calcium transport across the endoneurial capillaries, the permeability-surface area product (PA) of 45Ca was determined as a function of the calcium concentration in the blood. To study calcium homeostasis, the calcium content of the frog sciatic nerve was determined as a function of chronic changes in plasma [Ca

  13. Leap frog integrator modifications in highly collisional particle-in-cell codes

    Science.gov (United States)

    Hanzlikova, N.; Turner, M. M.

    2014-07-01

    Leap frog integration method is a standard, simple, fast, and accurate way to implement velocity and position integration in particle-in-cell codes. Due to the direct solution of kinetics of particles in phase space central to the particle-in-cell procedure, important information can be obtained on particle velocity distributions, and consequently on transport and heating processes. This approach is commonly associated with physical situations where collisional effects are weak, but can also be profitably applied in some highly collisional cases, such as occur in semiconductor devices and gaseous discharges at atmospheric pressure. In this paper, we show that the implementation of the leap frog integration method in these circumstances can violate some of the assumptions central to the accuracy of this scheme. Indeed, without adaptation, the method gives incorrect results. We show here how the method must be modified to deal correctly with highly collisional cases.

  14. Characteristics of Columbia spotted frog (Rana luteiventris) oviposition sites in northeastern Oregon, USA

    Science.gov (United States)

    Pearl, C.A.; Adams, M.J.; Wente, W.H.

    2007-01-01

    Several western ranid frogs possess a unique strategy of breeding communally over a short temporal window and reusing oviposition sites between years. However, little is published on the characteristics of oviposition sites selected by these explosive breeders. The Columbia spotted frog (Rana luteiventris) is native to northwestern North America and is of conservation concern in the southern portions of its range. As part of a study examining relationships between livestock grazing and R. luteiventris habitat, we assessed characteristics of the species' oviposition sites in 25 fishless ponds in northeastern Oregon. Oviposition sites were generally in shallow water (<25 cm) close to shore and tended to be in the northeastern portion of ponds. Oviposition sites were found more frequently over heavily vegetated substrates and in areas of less substrate slope and shade than random points in littoral zones. We did not quantify temperature differences within ponds, but the patterns we documented are consistent with preferential use of warmer microhabitats for oviposition.

  15. An X-ray diffraction study on a single rod outer segment from frog retina

    International Nuclear Information System (INIS)

    X-ray diffraction was recorded from retinal rod outer segments of frog using a microbeam. X-ray diffraction patterns were recorded from isolated single rod outer segments of frog. The outer segments in Ringer’s solution were exposed to a 6 µm microbeam (15 keV) at the BL40XU beamline, SPring-8. The diffraction pattern demonstrated a remarkable regularity in the stacking and flatness of the disk membranes. The electron density profile calculated from the intensity of up to tenth-order reflections showed a pair of bilayers that comprise a disk membrane. The structure of the disk membrane and the changes in the profile on swelling generally agreed with previous reports. Radiation damage was significant with an irradiation of 5 × 105 Gy which is much lower than the known damaging dose on proteins at the liquid-nitrogen temperature

  16. Bone marrow reconstitution of immune responses following irradiation in the leopard frog, Rana pipiens

    International Nuclear Information System (INIS)

    The bone marrow of Rana is an important source of cells capable of maintaining individual viability, responding to Concanavalin A (Con A) and producing PFC against sheep erythrocyte (SRBC) antigens. Frog marrow is more effective than the spleen in maintaining life. Radiation destroys the ability of frogs to respond to SRBC immunization (lack of bone marrow and spleen PFC, serum antibody) and bone marrow/spleen cells to respond to Con A, i.e., bone marrow and spleen contain radiation-sensitive cells. Shielding one hind leg during irradiation leads to reconstitution of bone marrow/spleen PFC responses, antibody synthesis and individual viability. Our results suggest that bone marrow is: a) the source of stem cells, and b) the source of mature T- and B- lymphocytes that can recirculate within the immune system

  17. Analysis of (3H) Kainic acid binding with rat and Frog brain membranes

    International Nuclear Information System (INIS)

    This paper analyzes the binding of (H 3)-KA with membrances in vitro and the effect of various neuroactive amino acids, suggested as endogenous ligands for binding sites of (H 3)-KA, on binding. Experiments were carried out on male albino rats and on winter frogs. Choice of the frog's brain was determined by the high density of high-affinity binding sites of (H 3)-KA. The concentrations of substances inhibiting binding (H 3)-KA by 50% were calculated by logit-probit analysis, and inhibition constants were also calculated. It is shown that although L-glutamate and folic acid inhibit binding of (H 3)-KA, they do not satisfy the criteria to be met by endogenous ligands, and this inhibition of binding is noncompetitive in character. This suggests that KA binding sites and glutamate receptors are not identical, although they may perhaps be subunits of a single complex

  18. Myofibrils Bear Most of the Resting Tension in Frog Skeletal Muscle

    Science.gov (United States)

    Magid, Alan; Law, Douglas J.

    1985-12-01

    The tension that develops when relaxed muscles are stretched is the resting (or passive) tension. It has recently been shown that the resting tension of intact skeletal muscle fibers is equivalent to that of mechanically skinned skeletal muscle fibers. Laser diffraction measurements of sarcomere length have now been used to show that the exponential relation between resting tension and sarcomere length for whole frog semitendinosus muscle is similar to that of single fibers. Slack sarcomere lengths and the rates of stress relaxation in these muscles were similar to those in skinned fibers, and sarcomere length remained unchanged during stress relaxation, as in skinned fibers. Thus, in intact semitendinosus muscle of the frog up to a sarcomere length of about 3.8 micrometers, resting tension arises, not in the connective tissue as is commonly thought, but in the elastic resistance of the myofibrils.

  19. Evidence for a Na+/Ca2+ exchange mechanism in frog skin epithelium

    DEFF Research Database (Denmark)

    Madsen, K H; Brodin, Birger; Nielsen, R

    1999-01-01

    In the present study we investigated the possible existence of a Na+/Ca2+ exchange mechanism in the basolateral membrane of the frog skin epithelium and whether such a mechanism plays a role in the regulation of transepithelial Na+ transport. Cytosolic calcium ([Ca2+]i) was measured with the probe...... in serosal Na+ were followed by stepwise changes in [Ca2+]i. These observations indicate the existence of a Na+/Ca2+ exchange mechanism in the basolateral membrane of the frog skin epithelium. The transepithelial Na+ transport decreased from 13.2+/-1.8 to 9.2+/-1.5 microA cm-2 (n=8, P=0.049) when Na...

  20. Synchronous polyandry and multiple paternity in the frog Crinia georgiana (Anura: Myobatrachidae).

    Science.gov (United States)

    Roberts; Standish; Byrne; Doughty

    1999-03-01

    Multiple paternity has rarely been reported in anuran amphibians, with only three previous documented examples. For the Australian frog Crinia georgiana, we observed synchronous polyandry in an average of 44% of matings observed at four field sites. This suggests matings involving more than one male are common in this species. One to eight males were observed in amplectant groups with second males amplexed ventrally. Genetic analyses, using allozyme electrophoresis, of offspring from two matings indicated that at least two of three possible males fathered offspring. Third males were unlikely to have shared paternity, explained by their inappropriate position during amplexus. Multiple paternity may be more common in frogs than has been reported. Copyright 1999 The Association for the Study of Animal Behaviour.

  1. Poor alkaloid sequestration by arrow poison frogs of the genus Phyllobates from Costa Rica.

    Science.gov (United States)

    Mebs, Dietrich; Alvarez, Joseph Vargas; Pogoda, Werner; Toennes, Stefan W; Köhler, Gunther

    2014-03-01

    Frogs of the genus Phyllobates from Colombia are known to contain the highly toxic alkaloid batrachotoxin, but species from Central America exhibit only very low levels or are entirely free of this toxin. In the present study alcohol extracts from 101 specimens of Phyllobates lugubris and Phyllobates vittatus and 21 of three sympatric species (Dendrobates pumilio, Dendrobates auratus, Dendrobates granuliferus) from Costa Rica were analyzed by gas chromatography-mass spectrometry. Whereas the extracts of the Dendrobates species exhibited typical profiles of toxic alkaloids, those of the two Phyllobates species contained low levels of few alkaloids only, batrachotoxin was not detected. Although the feeding pattern of the Dendrobates and Phyllobates species are similar as revealed by examination of their stomach content (mainly ants and mites), the Phyllobates species are poorly sequestering alkaloids from their food source in contrast to the Dendrobates frogs. PMID:24467995

  2. Depth perception in frogs and toads a study in neural computing

    CERN Document Server

    House, Donald

    1989-01-01

    Depth Perception in Frogs and Toads provides a comprehensive exploration of the phenomenon of depth perception in frogs and toads, as seen from a neuro-computational point of view. Perhaps the most important feature of the book is the development and presentation of two neurally realizable depth perception algorithms that utilize both monocular and binocular depth cues in a cooperative fashion. One of these algorithms is specialized for computation of depth maps for navigation, and the other for the selection and localization of a single prey for prey catching. The book is also unique in that it thoroughly reviews the known neuroanatomical, neurophysiological and behavioral data, and then synthesizes, organizes and interprets that information to explain a complex sensory-motor task. The book will be of special interest to that segment of the neural computing community interested in understanding natural neurocomputational structures, particularly to those working in perception and sensory-motor coordination. ...

  3. Snake venom-like waprin from the frog of Ceratophrys calcarata contains antimicrobial function.

    Science.gov (United States)

    Liu, Daixi; Wang, Yuwei; Wei, Lin; Ye, Huahu; Liu, Huan; Wang, Ling; Liu, Rui; Li, Dongsheng; Lai, Ren

    2013-02-10

    A 255-bp cDNA encoding an 84-amino acid residue (aa) precursor protein containing 8 half-cysteines was cloned from the skin of the frog, Ceratophrys calcarata. By sequence comparison and signal peptide prediction, the precursor was predicted to release a 63-aa mature peptide with amino acid sequence, NVTPATKPTPSKPGYCRVMDELILCPDPPLSKDLCKNDSDCPGAQKCCYRTCIMQCLPPIFRE. The mature was named ceratoxin. Ceratoxin shares significant sequence similarity with the toxin family of waprins containing the whey acidic protein-type (WAP) four-disulfide core domain found in snake venoms. Antimicrobial and trypsin-inhibitory abilities of recombinant ceratoxin were tested. Recombinant ceratoxin showed strong antimicrobial activities against wide spectrum of microorganisms including Gram-negative and Gram-positive bacteria and fungi. It had no serine protease-inhibitory activity. The current results suggested that the snake venom-like waprin with antimicrobial activities in the frog skin plays a role in innate immunity.

  4. Fires in Southern California

    Science.gov (United States)

    2007-01-01

    In what seemed like the blink of an eye, wildfires ignited in the paper-dry, drought-stricken vegetation of Southern California over the weekend of October 20, 2007, and exploded into massive infernos that forced hundreds of thousands of people to evacuate their communities. Driven by Santa Ana winds, fires grew thousands of acres in just one to two days. The fires sped down from the mountains into the outskirts of coastal cities, including San Diego. Dozens of homes have burned to the ground, and at least one person has died, according to local news reports. Several of the fires were burning completely out of control as of October 22. This image of the fires in California was captured at 1:55 p.m. U.S. Pacific Daylight Time on October 22, 2007. Places where MODIS detected actively burning fires are outlined in red. Thick streamers of smoke unfurl over the Pacific Ocean. The brownish plumes are clouds of dust. Fires northwest of Los Angeles seemed calmer at the time of this image than they were the previous day.

  5. Progress in California

    Energy Technology Data Exchange (ETDEWEB)

    Gipe, P.

    1990-01-01

    Though the wind energy continues to take it on the chin in the rough and tumble of California's celebrity politics, several indicators are pointing toward a modest revival. First several new reports laud wind energy at good sites as now competitive with conventional sources. Second, utility subsidiaries are signaling their approval by cautiously venturing into the technology. Also, technological refinements and reorganizations continue while a demand for new generating capacity may be developing in the state. Three new reports all paint a picture of wind energy finally coming of age. The California Energy Commission's most recent Energy Technology Status report says that wind-generated electricity is competitive with coal, oil, gas, and most other technologies. Similarly, a staff report found that after tallying the economic, social, and environmental costs, wind was one of the least cost sources of new generation. Most recently the Electric Power Research Institute's Journal reported the wind energy, at about 8 cents/k Wh, is equivalent to generation from conventional sources.

  6. Sex-biased predation by polecats influences the mating system of frogs.

    OpenAIRE

    Lodé, Thierry; Holveck, Marie-Jeanne; Lesbarrères, David; Pagano, Alain

    2004-01-01

    In agile frogs, Rana dalmatina, an increase in male-biased operational sex ratio and in male abundance results in the emergence of alternative male mating behaviour in the form of searching. As a consequence, females are coerced into mating with multiple males, which in turn increases the level of conflict between the sexes. Selective predation on males by the European polecat, Mustela putorius, decreases the occurrence of polyandry. In ponds visited by polecats, the sex ratio is less male bi...

  7. Effects of X-irradiation on acetyl cholinesterase activity in the frog Rana hexadactyla

    International Nuclear Information System (INIS)

    Changes in acetylchloinesterase (AChE) activity in brain, muscle and liver tissues of normal and X-irradiated frogs were studied. Low doses of radiation produced an increase in enzyme activity while high doses produced decrement. Post-irradiation studies with sublethal dose showed an early increase followed by reversible decrement in enzyme activity while lethal dose exhibited an early increase followed by irreversible inhibition of enzyme activity. (author)

  8. Parallel changes in mate-attracting calls and female preferences in autotriploid tree frogs

    OpenAIRE

    Tucker, Mitch A.; Gerhardt, H. C.

    2011-01-01

    For polyploid species to persist, they must be reproductively isolated from their diploid parental species, which coexist at the same time and place at least initially. In a complex of biparentally reproducing tetraploid and diploid tree frogs in North America, selective phonotaxis—mediated by differences in the pulse-repetition (pulse rate) of their mate-attracting vocalizations—ensures assortative mating. We show that artificially produced autotriploid females of the diploid species (Hyla c...

  9. Real estate ads in Emei music frog vocalizations: female preference for calls emanating from burrows

    OpenAIRE

    Cui, Jianguo; Tang, Yezhong; Narins, Peter M.

    2011-01-01

    During female mate choice, both the male's phenotype and resources (e.g. his nest) contribute to the chooser's fitness. Animals other than humans are not known to advertise resource characteristics to potential mates through vocal communication; although in some species of anurans and birds, females do evaluate male qualities through vocal communication. Here, we demonstrate that calls of the male Emei music frog (Babina dauchina), vocalizing from male-built nests, reflect nest structure info...

  10. Climate change and frog calls: long-term correlations along a tropical altitudinal gradient

    OpenAIRE

    Narins, Peter M.; Meenderink, Sebastiaan W. F.

    2014-01-01

    Temperature affects nearly all biological processes, including acoustic signal production and reception. Here, we report on advertisement calls of the Puerto Rican coqui frog (Eleutherodactylus coqui) that were recorded along an altitudinal gradient and compared these with similar recordings along the same altitudinal gradient obtained 23 years earlier. We found that over this period, at any given elevation, calls exhibited both significant increases in pitch and shortening of their duration....

  11. An elusive new species of Marsupial Frog (Anura: Hemiphractidae: Gastrotheca from the Andes of northern Peru

    Directory of Open Access Journals (Sweden)

    William E. Duellman

    2013-06-01

    Full Text Available A new species of marsupial frog, genus Gastrotheca, is described from high-elevation grasslands in the Andes in Región Amazonas in northernPeru, where even calling males are well hidden in deep moss. The new species is distinguished from all congeners by its unique color pattern that includes a narrow, blackbordered, yellow middorsal stripe. The species apparently belongs to the Gastrotheca plumbea Group, which ranges in the Andes from northern Colombia to northern Peru.

  12. The use of singleplex and nested PCR to detect Batrachochytrium dendrobatidis in free-living frogs

    Directory of Open Access Journals (Sweden)

    Selene Dall'Acqua Coutinho

    2015-06-01

    Full Text Available Many microorganisms are able to cause diseases in amphibians, and in the past few years one of the most reported has been Batrachochytrium dendrobatidis. This fungus was first reported in Brazil in 2005; following this, other reports were made in specimens deposited in museum collections, captive and free-living frogs. The aim of this study was to compare singleplex and nested-PCR techniques to detect B. dendrobatidis in free-living and apparently healthy adult frogs from the Brazilian Atlantic Forest. The sample collection area was a protected government park, with no general entrance permitted and no management of the animals there. Swabs were taken from the skin of 107 animals without macroscopic lesions and they were maintained in ethanol p.a. Fungal DNA was extracted and identification of B. dendrobatidis was performed using singleplex and nested-PCR techniques, employing specific primers sequences. B. dendrobatidis was detected in 61/107 (57% and 18/107 (17% animals, respectively by nested and singleplex-PCR. Nested-PCR was statistically more sensible than the conventional for the detection of B. dendrobatidis (Chi-square = 37.1; α = 1% and the agreement between both techniques was considered just fair (Kappa = 0.27. The high prevalence obtained confirms that these fungi occur in free-living frogs from the Brazilian Atlantic Forest with no macroscopic lesions, characterizing the state of asymptomatic carrier. We concluded that the nested-PCR technique, due to its ease of execution and reproducibility, can be recommended as one of the alternatives in epidemiological surveys to detect B. dendrobatidis in healthy free-living frog populations.

  13. Block of endplate channels by permeant cations in frog skeletal muscle

    OpenAIRE

    1981-01-01

    Motor endplates of frog semitendinosus muscles were studied under voltage clamp. Current fluctuations induced by iontophoretic application of acetylcholine were analyzed to give the elementary conductance, gamma , and mean open time, tau , of endplate channels. Total replacement of the external Na+ ion by several other metal ions and by many permeant organic cations changed both gamma and tau . Except with NH4+ ions, the gamma values with foreign test ions were all smaller than expected from ...

  14. Historical biogeography of Western Palearctic pelobatid and pelodytid frogs: a molecular phylogenetic perspective

    OpenAIRE

    Veith, M.; Fromhage, L.; Kosuch, J.; Vences, M.

    2006-01-01

    Abstract Spadefoot toads (Pelobates) and Parsley frogs (Pelodytes) are an enigmatic group of Western Palaearctic anurans. In the genus Pelobates, a fossorial lifestyle has enforced a conserved bauplan that masks their intraspecific evolutionary history. We used partial sequences of the mitochondrial 16S and 12S rRNA genes to infer a paleobiogeographic scenario of speciation events in these two anuran genera. Based on two alternative, mutually exclusive calibrations of the Iberian-African spli...

  15. Preliminary report on self-healing minefield (frogs) concepts and utility in battle

    Energy Technology Data Exchange (ETDEWEB)

    Greenwalt, R J; Magnoli, D

    2000-01-13

    The purpose of this study is to determine battlefield effectiveness of the self-healing minefield (''Frogs'') concept system compared to basecases of the standard AP/AT (anti-personnel/anti-tank) mixed minefield, the AT (anti-tank) pure minefield, and no minefields. This involves tactical modeling where a basecase with and without mines is compared to the concept system. However, it is first necessary to establish system characteristics and behavior of the Frog mine and minefield in order to do the tactical modeling. This initial report provides emerging insights into various minefield parameters in order to allow better program definition early in the conceptual development. In the following sections of this report, we investigate the self-healing minefield's ground pattern and several concepts for movement (''jump'') of a mine. Basic enemy breaching techniques are compared for the different mine movement concepts. These results are then used in the (Joint Conflict and Tactical Simulation) JCATS tactical model to evaluate minefield effects in a combat situation. The three basecases and the Frogs concept are used against a North Korean mechanized rifle battalion and outcomes are compared. Preliminary results indicate: (1) Possible breaching techniques for the self-healing minefield were proposed and compared through simulation modeling. Of these, the best breaching counter to the self-healing minefield is the ''wide-lane'' breach technique. (2) Several methods for mine movement are tested and the optimal method from this group was selected for use in the modeling. However, continued work is needed on jump criteria; a more sophisticated model may reduce the advantage of the breach counter. (3) The battle scenario used in this study is a very difficult defense for Blue. In the three baseline cases (no mines, AT mines only, and mixed AT/AP minefield), Blue loses. Only in the Frog case does Blue win, and

  16. A reference system for animal biometrics: application to the northern leopard frog

    Science.gov (United States)

    Petrovska-Delacretaz, D.; Edwards, A.; Chiasson, J.; Chollet, G.; Pilliod, D.S.

    2014-01-01

    Reference systems and public databases are available for human biometrics, but to our knowledge nothing is available for animal biometrics. This is surprising because animals are not required to give their agreement to be in a database. This paper proposes a reference system and database for the northern leopard frog (Lithobates pipiens). Both are available for reproducible experiments. Results of both open set and closed set experiments are given.

  17. Divergence at the edges: peripatric isolation in the montane spiny throated reed frog complex

    OpenAIRE

    Lawson, Lucinda P; Bates, John M.; Menegon, Michele; Loader, Simon P

    2015-01-01

    Background Peripatric speciation and peripheral isolation have uncertain importance in species accumulation, and are largely overshadowed by assumed dominance of allopatric modes of speciation. Understanding the role of different speciation mechanisms within biodiversity hotspots is central to understanding the generation of biological diversity. Here, we use a phylogeographic analysis of the spiny-throated reed frogs and examine sister pairings with unbalanced current distributional ranges f...

  18. Characteristics of hemolytic activity induced by skin secretions of the frog Kaloula pulchra hainana

    OpenAIRE

    Wei, Shuangshuang; Chi, Tingting; Meng, Aiyun; Chen, Congwei; An, Tianchen; Wang, Manchuriga; Zhang, Yingxia

    2013-01-01

    Background The hemolytic activity of skin secretions obtained by stimulating the frog Kaloula pulchra hainana with diethyl ether was tested using human, cattle, rabbit, and chicken erythrocytes. The skin secretions had a significant concentration-dependent hemolytic effect on erythrocytes. The hemolytic activity of the skin secretions was studied in the presence of osmotic protectants (polyethylene glycols and carbohydrates), cations (Mg2+, Ca2+, Ba2+, Cu2+, and K+), or antioxidants (ascorbic...

  19. New material of Beelzebufo, a hyperossified frog (Amphibia: Anura from the late cretaceous of Madagascar.

    Directory of Open Access Journals (Sweden)

    Susan E Evans

    Full Text Available The extant anuran fauna of Madagascar is exceptionally rich and almost completely endemic. In recent years, many new species have been described and understanding of the history and relationships of this fauna has been greatly advanced by molecular studies, but very little is known of the fossil history of frogs on the island. Beelzebufo ampinga, the first named pre-Holocene frog from Madagascar, was described in 2008 on the basis of numerous disarticulated cranial and postcranial elements from the Upper Cretaceous (Maastrichtian Maevarano Formation of Madagascar. These specimens documented the presence of a hyperossified taxon that differed strikingly from extant Malagasy frogs in its large size and heavy coarse cranial exostosis. Here we describe and analyse new, articulated, and more complete material of the skull, vertebral column, and hind limb, as well as additional isolated elements discovered since 2008. μCT scans allow a detailed understanding of both internal and external morphology and permit a more accurate reconstruction. The new material shows Beelzebufo to have been even more bizarre than originally interpreted, with large posterolateral skull flanges and sculptured vertebral spine tables. The apparent absence of a tympanic membrane, the strong cranial exostosis, and vertebral morphology suggest it may have burrowed during seasonally arid conditions, which have been interpreted for the Maevarano Formation from independent sedimentological and taphonomic evidence. New phylogenetic analyses, incorporating both morphological and molecular data, continue to place Beelzebufo with hyloid rather than ranoid frogs. Within Hyloidea, Beelzebufo still groups with the South American Ceratophryidae thus continuing to pose difficulties with both biogeographic interpretations and prior molecular divergence dates.

  20. Thyroid hormone receptor can modulate retinoic acid-mediated axis formation in frog embryogenesis.

    OpenAIRE

    Banker, D E; Eisenman, R N

    1993-01-01

    Thyroid hormone receptor acts as a hormone-dependent transcriptional transactivator and as a transcriptional repressor in the absence of thyroid hormone. Specifically, thyroid hormone receptor can repress retinoic acid-induced gene expression through interactions with retinoic acid receptor. (Retinoic acid is a potent teratogen in the frog Xenopus laevis, acting at early embryonic stages to interfere with the formation of anterior structures. Endogenous retinoic acid is thought to act in norm...

  1. The potential effects of climate change on the status of Seychelles frogs (Anura: Sooglossidae)

    OpenAIRE

    Gerlach, J.

    2011-01-01

    The status of the Seychelles frogs of the family Sooglossidae was investigated, using monitoring data from 1993-2010, climate data from 1998-2010 and studies of populations and local climate effects. Climate monitoring at each plot covered rainfall and temperature, with leaf wetness and soil moisture being monitored additionally at one site. Analysis of the data and ecological modelling of the distribution identify geographical patterns in climate which explain the present distribution of t...

  2. Assessing Historical and Current Threats to Common Frog (Rana Temporaria) Populations in Ireland

    OpenAIRE

    Reid, Neil; Dingerkus, Karina; Stone, Richard; Buckley, John; Beebee, Trevor; Marnell, Ferdia; Wilkinson, John

    2013-01-01

    Ponds are an ephemeral feature of the landscape but their large-scale loss can have profound implications for biodiversity and the persistence of amphibian populations. We quantified rates of pond loss throughout Ireland over a period of approximately 125 yr. Environmental parameters and perceived risk factors associated with the current occurrence and density of the Common Frog, Rana temporaria, were also analyzed. The numbers of farmland ponds declined by 54% between 1887–1913 and 2005–11, ...

  3. Ionomycin-induced acetylcholine release and its inhibition by adenosine at frog motor nerve endings.

    OpenAIRE

    Hunt, J M; Silinsky, E. M.

    1993-01-01

    1. Acetylcholine (ACh) evoked secretion by the calcium ionophore, ionomycin, was studied at frog motor nerve endings. 2. Bath application of ionomycin stimulated an irreversible increase in the rate of spontaneous, quantal ACh release in the presence of extracellular Ca2+. In contrast, local application of ionomycin stimulated a rapid, reversible acceleration of spontaneous ACh release. 3. The magnitude of the secretory response to ionomycin was dependent both upon the concentration of ionoph...

  4. Built for rowing: frog muscle is tuned to limb morphology to power swimming

    OpenAIRE

    Richards, Christopher T.; Clemente, Christofer J.

    2013-01-01

    Rowing is demanding, in part, because drag on the oars increases as the square of their speed. Hence, as muscles shorten faster, their force capacity falls, whereas drag rises. How do frogs resolve this dilemma to swim rapidly? We predicted that shortening velocity cannot exceed a terminal velocity where muscle and fluid torques balance. This terminal velocity, which is below Vmax, depends on gear ratio (GR = outlever/inlever) and webbed foot area. Perhaps such properties of swimmers are ‘tun...

  5. Fundraising Practices of the University of California, the California State University, and California Private Universities

    Science.gov (United States)

    Karsevar, Kent J.

    2012-01-01

    Factors such as a declining tax revenues and an underperforming economy have been justifying the need for additional external private funding to meet the increasing needs of a growing California higher education system and ethnically diverse student body. The purpose of this study was to examine ways in which California private higher education…

  6. Frequency-resolved optical gating for complete reconstruction of attosecond bursts : FROG CRAB

    International Nuclear Information System (INIS)

    Full text: We will show that when an atom is ionized by an XUV pulse in the presence of a low frequency laser field, this laser field acts as an ultrafast electron phase modulator on the electron wave-packet generated in the continuum. This phase modulator has a very large bandwidth and enables to transpose the most efficient techniques used for the temporal characterization of femtosecond pulses - such as SPIDER, FROG, or chronocyclic tomography - to attosecond fields, via continuum electron wave-packets replicas of these fields. We will then detail some of the attosecond metrology techniques derived from this general principle. We will especially insist on a recently proposed technique, FROG CRAB, which allows the complete temporal characterization of arbitrarily complex attosecond fields. FROG CRAB is direct transposition of Frequency-Resolved Optical Gating to attosecond electron wave-packets, using a femtosecond laser pulse as a phase gate. All the experimental tools for the implementation of CRAB are available. Besides its technical interest, CRAB establishes a direct connection between the main attosecond characterization techniques demonstrated experimentally so far, and considerably extends their scope, thus providing a general perspective on attosecond metrology. Refs. 2 (author)

  7. Diffusion of 133Xe through frog skins, toad bladders, and water boundary layers

    International Nuclear Information System (INIS)

    We have measured the total permeability coefficients P as a function of stirring frequency ω for 133Xe through frog skins and toad bladders. The permeability coefficients for the frog skins and toad bladders proper are, respectively, P/sub m/ = (3.9 +- 0.8) x 10-4 cm/s and (7.4 +- 4.2) x 10-4 cm/s. ''Unstirred'' water layer thickness delta is determined concurrently, from the frequency dependence of P(ω); the result for frog skin is delta = (0.060 +- 0.016)/√ω(rad/s) cm. The stirring frequency range is from ω = 7.5 rad/s (72 rpm) to 55 rad/s (530 rpm). The results support the conclusions that the principal barrier to Xe diffusion in these epithelia is inter- and intracellular water, and that the diffusion is passive and rapid. The experimental method may be straightforwardly adapted to the measurement of diffusion or counterdiffusion of any gamma-radioactive soluble or partly soluble solute through any flat membrane or through a solvent. We estimate the amount of total body-absorbed radioactivity due to environmental 133Xe to be 50 fCi for an ambient concentration of 2.6 pCi/m3 of air

  8. Developmental toxicity of two common corn pesticides to the endangered southern bell frog (Litoria raniformis)

    International Nuclear Information System (INIS)

    To examine the link between corn agriculture and the observed decline of the endangered southern bell frog (SBF), the effects of two corn crop pesticides on larval growth and development were investigated. Tadpoles were exposed to terbufos sulfone (10 μg/L), a major breakdown product of the insecticide terbufos, and the herbicide atrazine (25 μg/L) individually and as a mixture until the completion of metamorphosis. Atrazine did not interact synergistically with terbufos sulfone or result in significant effects on growth and development alone, although there was some indication of accelerated metamorphosis in the pilot study. Terbufos sulfone alone and as a mixture (terbufos/atrazine) significantly slowed larval development and ultimately delayed metamorphosis. The observed developmental effects from an environmentally relevant concentration of terbufos sulfone indicates a risk posed by this persistent degradation product to the endangered SBF, which breeds and develops in the rice bays adjacent to corn fields treated with pesticides. - Highlights: → The effect of terbufos sulfone and atrazine on larval growth and development was investigated. → Terbufos sulfone alone significantly slowed development and delayed metamorphosis of tadpoles. → Atrazine had no observable effects alone nor did it interact synergistically with terbufos sulfone. → The developmental effects indicates a risk to endangered southern bell frogs in the irrigation area. → The results highlight the toxicological importance of some pesticide breakdown products. - A breakdown product of the insecticide terbufos retards development and delays metamorphosis of southern bell frog tadpoles.

  9. Effects of oil sands waste water on the wood frog (rana sylvatica)

    International Nuclear Information System (INIS)

    The sustainability of various reclamation strategies can be determined by the growth and health of indigenous amphibians (Wood Frogs). This paper referred to the large quantities of tailings water that are generated by oil sand extraction activities. It presented the results of a study that was conducted in the spring and summer of 2006 and 2007 on reclaimed formation wetlands comprising tailings water. The objective was to understand the impact of these wetlands on native amphibians. Frogs were exposed to wetlands containing oil sands process affected water (OSPW) and reference water (no OSPW). Six experimental trenches were made at one site in the first year. Each trench had 3 enclosures with 50 tadpoles. In the second year, there were 13 sites, including 6 reference and 7 OSPW affected sites, which were classified as old (more than 8 yrs) or young (less than 7 yrs). Four enclosures, with 50 tadpoles each, were placed in each wetland. The study involved the evaluation of growth rate, survival, time to metamorphosis, thyroid hormone concentrations, liver EROD activity, and tissue retinol concentrations. In addition, stable isotopes were used to track carbon flow from primary production plants, through the food chain, to tadpoles and frogs which represent intermediate and higher trophic levels in reclaimed wetlands

  10. Climate change and frog calls: long-term correlations along a tropical altitudinal gradient.

    Science.gov (United States)

    Narins, Peter M; Meenderink, Sebastiaan W F

    2014-05-22

    Temperature affects nearly all biological processes, including acoustic signal production and reception. Here, we report on advertisement calls of the Puerto Rican coqui frog (Eleutherodactylus coqui) that were recorded along an altitudinal gradient and compared these with similar recordings along the same altitudinal gradient obtained 23 years earlier. We found that over this period, at any given elevation, calls exhibited both significant increases in pitch and shortening of their duration. All of the observed differences are consistent with a shift to higher elevations for the population, a well-known strategy for adapting to a rise in ambient temperature. Using independent temperature data over the same time period, we confirm a significant increase in temperature, the magnitude of which closely predicts the observed changes in the frogs' calls. Physiological responses to long-term temperature rises include reduction in individual body size and concomitantly, population biomass. These can have potentially dire consequences, as coqui frogs form an integral component of the food web in the Puerto Rican rainforest. PMID:24718765

  11. Reproductive phenology of the tomato frog, Dyscophus antongili, in an urban pond of Madagascar's east coast

    Directory of Open Access Journals (Sweden)

    Ori Segev

    2012-12-01

    Full Text Available Based on daily monitoring around an urban pond in the coastal town of Maroantsetra, from 2003-2011, we provide an analysis of the yearly reproductive activity of the tomato frog (Dyscophus antongilii, a large-sized and prominent red-coloured microhylid frog from north-eastern Madagascar. Frogs were observed all year round but despite the limited climatic seasonality in the region it was possible to identify a high activity period between January-May and a lower activity period between June-December. Freshly laid eggs were found in all months except November, and with highest incidence between January and May, while calling was heard in all months. We found a positive correlation between daily adult counts and minimum air temperature. On the contrary rainfall did not significantly predict activity, although boosts of calling and egg-laying especially in the austral winter were observed after heavy rainfall events. We define D. antongilii in Maroantsetra as a sporadic wet season breeder that reproduces at irregular intervals following heavy rain events.

  12. Effects of mosquitofish (Gambusia affinis cues on wood frog (Lithobates sylvaticus tadpole activity

    Directory of Open Access Journals (Sweden)

    Katherine F. Buttermore

    2011-06-01

    Full Text Available We examined the changes in activity of wood frog (Lithobates sylvaticus tadpoles exposed to combinations of visual, chemical, and mechanical cues of the invasive mosquitofish (Gambusia affinis. We also examined whether the responses of the tadpoles to the predator cues were influenced by the short-term accumulation of chemical cues in the experimental container. In our experiment, the activity of wood frog (L. sylvaticus tadpoles was not affected by the presence of various cues from mosquitofish. Our experiment demonstrated that the repeated use of trial water can influence the activity level of tadpoles, regardless of the predator cue treatment used. Tadpoles in the first trial tended to be less active than tadpoles in subsequent trials. This effect does not appear to be mediated by the accumulation of predator cues since there was no significant interaction term. Our results suggest that short-term accumulation of predator chemical cues do not affect the behavior of wood frog tadpoles: however, our results suggest that the repeated use of the same water in consecutive trials may affect tadpole behavior, perhaps through the accumulation of conspecific chemical cues.

  13. The chorus environment and the shape of communication systems in frogs

    Science.gov (United States)

    Marshall, Vince

    2003-04-01

    Many species of frogs breed in dense and structurally complex aggregations of calling males termed choruses. Females entering a chorus are faced with the tasks of recognizing and locating mates on the basis of their advertisement calls. The chorus environment poses particular challenges for communication as signalers and receivers will face high levels of background noise and interference between signals. For females, such conditions may decrease the efficiency of communication, with the consequences of increasing the time required to find a mate or errors in mate choice. For males, it will give rise to intense competition for the attention of females. Additionally, the chorus environment for a species is not static, and will vary over both spatial and temporal scales. This complex and dynamic environment has shaped the signals and signaling behaviors of frogs in sometimes surprising ways. In this talk, some of the implications of the chorus environment for both receivers and signalers is discussed. In particular, examples from North American hylid frogs are drawn upon and research on the role of signal timing in influencing the responses of females and plasticity in aggressive behavior between neighbors in choruses are discussed.

  14. Neuronal intermediate filaments in the developing tongue of the frog Rana esculenta

    Directory of Open Access Journals (Sweden)

    K Zuwala

    2009-06-01

    Full Text Available The expression of several neuronal intermediate filament (NIF proteins was investigated in the tongue of metamorphosing tadpoles (stage 38-45 of Gosner and in adult individuals of the frog, Rana esculenta by means of immunohistochemistry. Results showed that nerve fibres at early stages of tongue development expressed peripherin (a NIF protein usually found in differentiating neurones as well as the light- and medium molecular weight NIF polypeptide subunits (NF-L and NF-M, respectively; in the adult frog, peripherin was still found in nerve fibres reaching the fungiform papilla together with NF-M, but NF-L immunoreactivity was absent therein. Clusters of epithelial cells expressing peripherin were found in the early developing tongue before differentiation of taste organs, and NF-L and NF-H immunoreactivities were present in basal (Merkel cells of the adult frog taste disc. Results indicate that neurones innervating the adult frog’s taste disc maintain a certain plasticity in their cytoskeleton and that neuronal-like cells are present in the undifferentiated and differentiated tongue epithelium possibly playing a role in the developing and mature taste organ.

  15. Combined Effects of Pesticides and Trematode Infections on Hourglass Tree Frog Polypedates cruciger.

    Science.gov (United States)

    Jayawardena, Uthpala A; Rohr, Jason R; Navaratne, Ayanthi N; Amerasinghe, Priyanie H; Rajakaruna, Rupika S

    2016-03-01

    The impact of widespread and common environmental factors, such as chemical contaminants, on infectious disease risk in amphibians is particularly important because both chemical contaminants and infectious disease have been implicated in worldwide amphibian declines. Here we report on the lone and combined effects of exposure to parasitic cercariae (larval stage) of the digenetic trematode, Acanthostomum burminis, and four commonly used pesticides (insecticides: chlorpyrifos, dimethoate; herbicides: glyphosate, propanil) at ecologically relevant concentrations on the survival, growth, and development of the common hourglass tree frog, Polypedates cruciger Blyth 1852. There was no evidence of any pesticide-induced mortality on cercariae because all the cercariae successfully penetrated each tadpole host regardless of pesticide treatment. In isolation, both cercarial and pesticide exposure significantly decreased frog survival, development, and growth, and increased developmental malformations, such as scoliosis, kyphosis, and also edema and skin ulcers. The combination of cercariae and pesticides generally posed greater risk to frogs than either factor alone by decreasing survival or growth or increasing time to metamorphosis or malformations. The exception was that lone exposure to chlorpyrifos had higher mortality without than with cercariae. Consistent with mathematical models that suggest that stress should increase the impact of generalist parasites, the weight of the evidence from the field and laboratory suggests that ecologically relevant concentrations of agrochemicals generally increase the threat that trematodes pose to amphibians, highlighting the importance of elucidating interactions between anthropogenic activities and infectious disease in taxa of conservation concern.

  16. Developmental toxicity of two common corn pesticides to the endangered southern bell frog (Litoria raniformis)

    Energy Technology Data Exchange (ETDEWEB)

    Choung, Catherine B., E-mail: Catherine.Choung@mq.edu.au [Department of Biological Sciences, Macquarie University, Sydney, NSW 2109 (Australia); Hyne, Ross V. [Ecotoxicology and Environmental Contaminants Section, Office of Environment and Heritage, PO Box 29, Lidcombe, NSW 1825 (Australia); Mann, Reinier M. [Centre for Environmental Sustainability, University of Technology - Sydney, PO Box 123, Broadway, NSW 2007 (Australia); Stevens, Mark M. [EH Graham Centre for Agricultural Innovation (Industry and Investment NSW and Charles Sturt University), Yanco Agricultural Institute, Private Mail Bag, Yanco, NSW 2703 (Australia); Hose, Grant C. [Department of Biological Sciences, Macquarie University, Sydney, NSW 2109 (Australia)

    2011-10-15

    To examine the link between corn agriculture and the observed decline of the endangered southern bell frog (SBF), the effects of two corn crop pesticides on larval growth and development were investigated. Tadpoles were exposed to terbufos sulfone (10 {mu}g/L), a major breakdown product of the insecticide terbufos, and the herbicide atrazine (25 {mu}g/L) individually and as a mixture until the completion of metamorphosis. Atrazine did not interact synergistically with terbufos sulfone or result in significant effects on growth and development alone, although there was some indication of accelerated metamorphosis in the pilot study. Terbufos sulfone alone and as a mixture (terbufos/atrazine) significantly slowed larval development and ultimately delayed metamorphosis. The observed developmental effects from an environmentally relevant concentration of terbufos sulfone indicates a risk posed by this persistent degradation product to the endangered SBF, which breeds and develops in the rice bays adjacent to corn fields treated with pesticides. - Highlights: > The effect of terbufos sulfone and atrazine on larval growth and development was investigated. > Terbufos sulfone alone significantly slowed development and delayed metamorphosis of tadpoles. > Atrazine had no observable effects alone nor did it interact synergistically with terbufos sulfone. > The developmental effects indicates a risk to endangered southern bell frogs in the irrigation area. > The results highlight the toxicological importance of some pesticide breakdown products. - A breakdown product of the insecticide terbufos retards development and delays metamorphosis of southern bell frog tadpoles.

  17. Effect of intravenous anesthetic propofol on synaptic vesicle exocytosis at the frog neuromuscular junction

    Institute of Scientific and Technical Information of China (English)

    Luciana Ferreira LEITE; Renato Santiago GOMEZ; Matheus de Castro FONSECA; Marcus Vinicius GOMEZ; Cristina GUATIMOSIM

    2011-01-01

    Aim: To investigate the presynaptic effects of propofol, a short-acting intravenous anesthetic, in the frog neuromuscular junction. Methods: Frog cutaneous pectoris nerve muscle preparations were prepared. A fluorescent tool (FM1-43) was used to visualize the effect of propofol on synaptic vesicle exocytosos in the frog neuromuscular junction. Results: Low concentrations of propofol, ranging from 10 to 25 μmol/L, enhanced spontaneous vesicle exocytosis monitored by FM1-43 in a Ca2+-dependent and Na+-independent fashion. Higher concentrations of propofol (50, 100, and 200 μmol/L) had no effect on spontaneous exocytosis. By contrast, higher concentrations of propofol inhibited the Na+-dependent exocytosis evoked by 4-aminopyri-dine but did not affect the Na+-independent exocytosis evoked by KCI. This action was similar and non-additive with that observed by tetrodotoxin, a Na+ channel blocker.Conclusion: Our data suggest that propofol has a dose-dependent presynaptic effect at the neuromuscular transmission which mayhelp to understand some of the clinical effects of this agent on neuromuscular function.

  18. High dispersal in a frog species suggests that it is vulnerable to habitat fragmentation

    Science.gov (United States)

    Funk, W.C.; Greene, A.E.; Corn, P.S.; Allendorf, F.W.

    2005-01-01

    Global losses of amphibian populations are a major conservation concern and their causes have generated substantial debate. Habitat fragmentation is considered one important cause of amphibian decline. However, if fragmentation is to be invoked as a mechanism of amphibian decline, it must first be established that dispersal is prevalent among contiguous amphibian populations using formal movement estimators. In contrast, if dispersal is naturally low in amphibians, fragmentation can be disregarded as a cause of amphibian declines and conservation efforts can be focused elsewhere. We examined dispersal rates in Columbia spotted frogs (Rana luteiventris) using capture–recapture analysis of over 10 000 frogs in combination with genetic analysis of microsatellite loci in replicate basins. We found that frogs had exceptionally high juvenile dispersal rates (up to 62% annually) over long distances (>5 km), large elevation gains (>750 m) and steep inclines (36° incline over 2 km) that were corroborated by genetic data showing high gene flow. These findings show that dispersal is an important life-history feature of some amphibians and suggest that habitat fragmentation is a serious threat to amphibian persistence.

  19. Thyrotropin-releasing hormone (TRH promotes wound re-epithelialisation in frog and human skin.

    Directory of Open Access Journals (Sweden)

    Natalia T Meier

    Full Text Available There remains a critical need for new therapeutics that promote wound healing in patients suffering from chronic skin wounds. This is, in part, due to a shortage of simple, physiologically and clinically relevant test systems for investigating candidate agents. The skin of amphibians possesses a remarkable regenerative capacity, which remains insufficiently explored for clinical purposes. Combining comparative biology with a translational medicine approach, we report the development and application of a simple ex vivo frog (Xenopus tropicalis skin organ culture system that permits exploration of the effects of amphibian skin-derived agents on re-epithelialisation in both frog and human skin. Using this amphibian model, we identify thyrotropin-releasing hormone (TRH as a novel stimulant of epidermal regeneration. Moving to a complementary human ex vivo wounded skin assay, we demonstrate that the effects of TRH are conserved across the amphibian-mammalian divide: TRH stimulates wound closure and formation of neo-epidermis in organ-cultured human skin, accompanied by increased keratinocyte proliferation and wound healing-associated differentiation (cytokeratin 6 expression. Thus, TRH represents a novel, clinically relevant neuroendocrine wound repair promoter that deserves further exploration. These complementary frog and human skin ex vivo assays encourage a comparative biology approach in future wound healing research so as to facilitate the rapid identification and preclinical testing of novel, evolutionarily conserved, and clinically relevant wound healing promoters.

  20. Effect of cyclic aromatics on sodium active transport in frog skin

    Energy Technology Data Exchange (ETDEWEB)

    Blankemeyer, J.T.; Bowerman, M.C. (Oklahoma State Univ., Stillwater (United States))

    1993-01-01

    A modified glass Ussing-chamber was used to mount the skin. The electrical potential difference (PD) was measured by two 3% agar-frog Ringer's bridges. Current (i.e. short-circuit current, or ISC) was passed by Ag-AgCl electrodes placed so that current density was uniform across the skin. Ringer's solution, bathing each side of the frog skin, was stirred and aerated by gas-lift pumps. The effect of toxicants on the ISC was determined by using the 15 min prior to toxicant administration as a control period, then calculating the change in ISC during the toxicant period as a percent of the control ISC. Phenol and benzene are components of crude oil and crude oil waste. These hydrocarbons and phenanthrene were tested for their effect on frog skin. The results show that the effect of organics on sodium active transport of an epithelium is to alter the active transport of sodium ions. 5 refs., 3 figs., 1 tab.

  1. Population recovery following decline in an endangered stream-breeding frog (Mixophyes fleayi from subtropical Australia.

    Directory of Open Access Journals (Sweden)

    David Alan Newell

    Full Text Available Amphibians have undergone dramatic declines and extinctions worldwide. Prominent among these have been the stream-breeding frogs in the rainforests of eastern Australia. The amphibian chytrid fungus Batrachochytrium dendrobatidis (Bd has been postulated as the primary cause of these declines. We conducted a capture-mark-recapture study over a 7-year period on the endangered Fleay's barred frog (Mixophyes fleayi at two independent streams (30 km apart in order to assess the stability of these populations. This species had undergone a severe decline across its narrow geographic range. Mark-recapture modelling showed that the number of individuals increased 3-10 fold along stream transects over this period. Frog detection probabilities were frequently above 50% but declined as the populations increased. Adult survival was important to overall population persistence in light of low recruitment events, suggesting that longevity may be a key factor in this recovery. One male and female were present in the capture record for >6 years. This study provides an unambiguous example of population recovery in the presence of Bd.

  2. Failure of tetracycline as a biomarker in batch-marking juvenile frogs

    Science.gov (United States)

    Hatfield, J.S.; Henry, P.F.P.; Olsen, G.H.; Paul, M.M.; Hammerschlag, R.S.

    2001-01-01

    Recent widespread amphibian declines call for better techniques to assess population dynamics. Tetracycline as a biomarker in capture-recapture studies is one technique used successfully in fish, reptiles, and mammals. A two-phase experimental study was conducted to evaluate tetracycline as a biomarker in green frogs (Rana clamitans) and pickerel frogs (Rana palustris). In the first experimental phase tadpoles were exposed to water containing either 250 mg/l or 500 mg/l tetracycline for a period of 24 hr. During the second phase, juvenile frogs were exposed to tetracycline in water at 500 mg/l or given injections of tetracycline at the dose rate of 100 mg/kg body weight. At selected times several weeks later, under tricaine methanesulfonate anesthesia, a toe was surgically excised from each animal, sectioned and viewed under an ultraviolet microscope. No significant differences were found between the various treatments and control animals (untreated). Therefore, the use of tetracycline as a biomarker in anurans using these techniques is not recommended.

  3. Combined Effects of Pesticides and Trematode Infections on Hourglass Tree Frog Polypedates cruciger

    Science.gov (United States)

    Jayawardena, Uthpala A.; Rohr, Jason R.; Navaratne, Ayanthi N.; Amerasinghe, Priyanie H.; Rajakaruna, Rupika S.

    2016-01-01

    The impact of widespread and common environmental factors, such as chemical contaminants, on infectious disease risk in amphibians is particularly important because both chemical contaminants and infectious disease have been implicated in worldwide amphibian declines. Here we report on the lone and combined effects of exposure to parasitic cercariae (larval stage) of the digenetic trematode, Acanthostomum burminis, and four commonly used pesticides (insecticides: chlorpyrifos, dimethoate; herbicides: glyphosate, propanil) at ecologically relevant concentrations on the survival, growth, and development of the common hourglass tree frog, Polypedates cruciger Blyth 1852. There was no evidence of any pesticide-induced mortality on cercariae because all the cercariae successfully penetrated each tadpole host regardless of pesticide treatment. In isolation, both cercarial and pesticide exposure significantly decreased frog survival, development, and growth, and increased developmental malformations, such as scoliosis, kyphosis, and also edema and skin ulcers. The combination of cercariae and pesticides generally posed greater risk to frogs than either factor alone by decreasing survival or growth or increasing time to metamorphosis or malformations. The exception was that lone exposure to chlorpyrifos had higher mortality without than with cercariae. Consistent with mathematical models that suggest that stress should increase the impact of generalist parasites, the weight of the evidence from the field and laboratory suggests that ecologically relevant concentrations of agrochemicals generally increase the threat that trematodes pose to amphibians, highlighting the importance of elucidating interactions between anthropogenic activities and infectious disease in taxa of conservation concern. PMID:26911919

  4. Spontaneous otoacoustic emissions in the European edible frog (Rana esculenta): spectral details and temperature dependence.

    Science.gov (United States)

    van Dijk, P; Wit, H P; Segenhout, J M

    1989-11-01

    Spontaneous otoacoustic emissions were recorded in 41 ears of 29 European edible frogs (Rana esculenta). Emission frequencies ranged from 450 to 1350 Hz. The distribution of frequencies shows two distinct populations: one above and one below 1 kHz. With one exception, a maximum number of two emissions were recorded per ear, each in a different population. An amplitude distribution of a frog emission was sampled, from which it was concluded that the emission is generated by an active oscillator. The spectral width of an emission ranged from 1 to 200 Hz (average 38 Hz). There was negative correlation between sound pressure level of an emission and spectral width. In 4 frogs the dependence of emission power and frequency on temperature was investigated. An emission could be 'switched on and off' within a few degrees centigrade. At temperatures below the switching interval no emission was recorded; for higher temperatures emission power showed no dependence on temperature. Frequency increased with temperature (Q10 = 1.1 to 1.3). This yields a mismatch with temperature dependence of best frequencies of auditory fibers. The consequences of this mismatch are discussed. PMID:2691473

  5. Effects of oil sands waste water on the wood frog (rana sylvatica)

    Energy Technology Data Exchange (ETDEWEB)

    Hersikorn, B.; Smits, J.E. [Saskatchewan Univ., Regina, SK (Canada)

    2007-07-01

    The sustainability of various reclamation strategies can be determined by the growth and health of indigenous amphibians (Wood Frogs). This paper referred to the large quantities of tailings water that are generated by oil sand extraction activities. It presented the results of a study that was conducted in the spring and summer of 2006 and 2007 on reclaimed formation wetlands comprising tailings water. The objective was to understand the impact of these wetlands on native amphibians. Frogs were exposed to wetlands containing oil sands process affected water (OSPW) and reference water (no OSPW). Six experimental trenches were made at one site in the first year. Each trench had 3 enclosures with 50 tadpoles. In the second year, there were 13 sites, including 6 reference and 7 OSPW affected sites, which were classified as old (more than 8 yrs) or young (less than 7 yrs). Four enclosures, with 50 tadpoles each, were placed in each wetland. The study involved the evaluation of growth rate, survival, time to metamorphosis, thyroid hormone concentrations, liver EROD activity, and tissue retinol concentrations. In addition, stable isotopes were used to track carbon flow from primary production plants, through the food chain, to tadpoles and frogs which represent intermediate and higher trophic levels in reclaimed wetlands.

  6. Purification and characterization of albumin from frog skin of Duttaphrynus melanostictus.

    Science.gov (United States)

    Zhang, Ying-Xia; Chen, Cong-Wei; Wang, Manchuriga; Wei, Shuang-Shuang; Guan, Huai; Chi, Ting-Ting; Qi, Xing-Zhu; Hu, Wen-Ting

    2011-10-01

    Following determination of trypsin inhibitory activity, a serine protease inhibitor was purified and characterized from frog Duttaphrynus melanostictus serum. It was identified as serum albumin, with molecular weight of 67 kDa (DmA-serum). Different from bovine serum albumin, DmA-serum potently inhibited trypsin with similar K(i) values around 1.6 × 10⁻⁷ M. No inhibitory effect on thrombin, chymotrypsin, elastase and subtilisin was observed under the assay conditions. The N-terminal amino acid is EAEPHSRI. Subsequently, a protein with same N-terminal amino acid was purified from skin, termed as DmA-skin. However, DmA-skin is distinct from DmA-serum by binding of a haem b (0.5 mol/mol protein), and with low trypsin inhibitory activity. Frog albumin is distributed in frog skin and exhibited trypsin inhibitory activity, suggesting that it plays important roles in skin physiological functions, like water economy, metabolite exchange and osmoregulation, etc. PMID:21858423

  7. Identification of Miscellaneous Peptides from the Skin Secretion of the European Edible Frog, Pelophylax kl. Esculentus.

    Science.gov (United States)

    Chen, Xiaole; Wang, He; Wang, Lei; Zhou, Mei; Chen, Tianbao; Shaw, Chris

    2016-08-01

    The chemical compounds synthesised and secreted from the dermal glands of amphibian have diverse bioactivities that play key roles in the hosts' innate immune system and in causing diverse pharmacological effects in predators that may ingest the defensive skin secretions. As new biotechnological methods have developed, increasing numbers of novel peptides with novel activities have been discovered from this source of natural compounds. In this study, a number of defensive skin secretion peptide sequences were obtained from the European edible frog, P. kl. esculentus, using a 'shotgun' cloning technique developed previously within our laboratory. Some of these sequences have been previously reported but had either obtained from other species or were isolated using different methods. Two new skin peptides are described here for the first time. Esculentin-2c and Brevinin-2Tbe belong to the Esculentin-2 and Brevinin-2 families, respectively, and both are very similar to their respective analogues but with a few amino acid differences. Further, [Asn-3, Lys-6, Phe-13] 3-14-bombesin isolated previously from the skin of the marsh frog, Rana ridibunda, was identified here in the skin of P. kl. esculentus. Studies such as this can provide a rapid elucidation of peptide and corresponding DNA sequences from unstudied species of frogs and can rapidly provide a basis for related scientific studies such as those involved in systematic or the evolution of a large diverse gene family and usage by biomedical researchers as a source of potential novel drug leads or pharmacological agents. PMID:27402449

  8. Strategies for assessing the implications of malformed frogs for environmental health.

    Science.gov (United States)

    Burkhart, J G; Ankley, G; Bell, H; Carpenter, H; Fort, D; Gardiner, D; Gardner, H; Hale, R; Helgen, J C; Jepson, P; Johnson, D; Lannoo, M; Lee, D; Lary, J; Levey, R; Magner, J; Meteyer, C; Shelby, M D; Lucier, G

    2000-01-01

    The recent increase in the incidence of deformities among natural frog populations has raised concern about the state of the environment and the possible impact of unidentified causative agents on the health of wildlife and human populations. An open workshop on Strategies for Assessing the Implications of Malformed Frogs for Environmental Health was convened on 4-5 December 1997 at the National Institute of Environmental Health Sciences in Research Triangle Park, North Carolina. The purpose of the workshop was to share information among a multidisciplinary group with scientific interest and responsibility for human and environmental health at the federal and state level. Discussions highlighted possible causes and recent findings directly related to frog deformities and provided insight into problems and strategies applicable to continuing investigation in several areas. Possible causes of the deformities were evaluated in terms of diagnostics performed on field amphibians, biologic mechanisms that can lead to the types of malformations observed, and parallel laboratory and field studies. Hydrogeochemistry must be more integrated into environmental toxicology because of the pivotal role of the aquatic environment and the importance of fates and transport relative to any potential exposure. There is no indication of whether there may be a human health factor associated with the deformities. However, the possibility that causal agents may be waterborne indicates a need to identify the relevant factors and establish the relationship between environmental and human health in terms of hazard assessment. PMID:10620528

  9. Combined Effects of Pesticides and Trematode Infections on Hourglass Tree Frog Polypedates cruciger.

    Science.gov (United States)

    Jayawardena, Uthpala A; Rohr, Jason R; Navaratne, Ayanthi N; Amerasinghe, Priyanie H; Rajakaruna, Rupika S

    2016-03-01

    The impact of widespread and common environmental factors, such as chemical contaminants, on infectious disease risk in amphibians is particularly important because both chemical contaminants and infectious disease have been implicated in worldwide amphibian declines. Here we report on the lone and combined effects of exposure to parasitic cercariae (larval stage) of the digenetic trematode, Acanthostomum burminis, and four commonly used pesticides (insecticides: chlorpyrifos, dimethoate; herbicides: glyphosate, propanil) at ecologically relevant concentrations on the survival, growth, and development of the common hourglass tree frog, Polypedates cruciger Blyth 1852. There was no evidence of any pesticide-induced mortality on cercariae because all the cercariae successfully penetrated each tadpole host regardless of pesticide treatment. In isolation, both cercarial and pesticide exposure significantly decreased frog survival, development, and growth, and increased developmental malformations, such as scoliosis, kyphosis, and also edema and skin ulcers. The combination of cercariae and pesticides generally posed greater risk to frogs than either factor alone by decreasing survival or growth or increasing time to metamorphosis or malformations. The exception was that lone exposure to chlorpyrifos had higher mortality without than with cercariae. Consistent with mathematical models that suggest that stress should increase the impact of generalist parasites, the weight of the evidence from the field and laboratory suggests that ecologically relevant concentrations of agrochemicals generally increase the threat that trematodes pose to amphibians, highlighting the importance of elucidating interactions between anthropogenic activities and infectious disease in taxa of conservation concern. PMID:26911919

  10. Multiobjective Optimal Reactive Power Dispatch Considering Voltage Stability Using Shuffled Frog Leaping Algorithm

    Directory of Open Access Journals (Sweden)

    V. Tamilselvan

    2015-05-01

    Full Text Available This study addresses a shuffled frog leaping algorithm for solving the multi-objective reactive power dispatch problem in a power system. Optimal Reactive Power Dispatch (ORPD is formulated as a nonlinear, multi-modal and mixed-variable problem. The intended technique is based on the minimization of the real power loss, minimization of voltage deviation and maximization of the voltage stability margin. Generator voltages, capacitor banks and tap positions of tap changing transformers are used as optimization variables of this problem. A memetic meta-heuristic named as shuffled frog-leaping algorithm is intended to solve multi-objective optimal reactive power dispatch problems considering voltage stability margin and voltage deviation. The Shuffled Frog-Leaping Algorithm (SFLA is a population-based cooperative search metaphor inspired by natural memetics. The algorithm contains elements of local search and global information exchange. The most important benefit of this algorithm is higher speed of convergence to a better solution. The intended method is applied to ORPD problem on IEEE 57 bus power systems and compared with two versions of differential evolutionary algorithm. The simulation results show the effectiveness of the intended method.

  11. DDT exposure of frogs: A case study from Limpopo Province, South Africa.

    Science.gov (United States)

    Viljoen, Ignatius M; Bornman, Riana; Bouwman, Hindrik

    2016-09-01

    Amphibians are globally under pressure with environmental contaminants contributing to this. Despite caution aired more than 80 years ago of threats posed to amphibians by DDT spraying for disease vector control, no data have been published on concentrations or effects of DDT contamination in frogs from areas where DDT is actively sprayed to control the insect vectors of malaria. In this study, we sampled fat bodies of Xenopus laevis and Xenopus muelleri naturally occurring in an area where indoor residual spraying of DDT is employed and from adjacent, non-sprayed, areas. ΣDDT concentrations ranged between frogs from the sprayed area, possibly due to endocrine disruption by compounds such as the DDTs. A previous study from the same area found very high concentrations of DDT in the eggs of the Grey Heron Ardea cinerea. This suggests that the DDT we found in frogs may have contributed to DDT loadings higher in the food web. These findings, combined with other studies from this area, support the need to reduce and eventually move away from DDT in malaria control safely and sustainably. PMID:27317939

  12. When to approach novel prey cues? Social learning strategies in frog-eating bats.

    Science.gov (United States)

    Jones, Patricia L; Ryan, Michael J; Flores, Victoria; Page, Rachel A

    2013-12-01

    Animals can use different sources of information when making decisions. Foraging animals often have access to both self-acquired and socially acquired information about prey. The fringe-lipped bat, Trachops cirrhosus, hunts frogs by approaching the calls that frogs produce to attract mates. We examined how the reliability of self-acquired prey cues affects social learning of novel prey cues. We trained bats to associate an artificial acoustic cue (mobile phone ringtone) with food rewards. Bats were assigned to treatments in which the trained cue was either an unreliable indicator of reward (rewarded 50% of the presentations) or a reliable indicator (rewarded 100% of the presentations), and they were exposed to a conspecific tutor foraging on a reliable (rewarded 100%) novel cue or to the novel cue with no tutor. Bats whose trained cue was unreliable and who had a tutor were significantly more likely to preferentially approach the novel cue when compared with bats whose trained cue was reliable, and to bats that had no tutor. Reliability of self-acquired prey cues therefore affects social learning of novel prey cues by frog-eating bats. Examining when animals use social information to learn about novel prey is key to understanding the social transmission of foraging innovations.

  13. Shuffled Frog Leaping Algorithm for Preemptive Project Scheduling Problems with Resource Vacations Based on Patterson Set

    Directory of Open Access Journals (Sweden)

    Yi Han

    2013-01-01

    Full Text Available This paper presents a shuffled frog leaping algorithm (SFLA for the single-mode resource-constrained project scheduling problem where activities can be divided into equant units and interrupted during processing. Each activity consumes 0–3 types of resources which are renewable and temporarily not available due to resource vacations in each period. The presence of scarce resources and precedence relations between activities makes project scheduling a difficult and important task in project management. A recent popular metaheuristic shuffled frog leaping algorithm, which is enlightened by the predatory habit of frog group in a small pond, is adopted to investigate the project makespan improvement on Patterson benchmark sets which is composed of different small and medium size projects. Computational results demonstrate the effectiveness and efficiency of SFLA in reducing project makespan and minimizing activity splitting number within an average CPU runtime, 0.521 second. This paper exposes all the scheduling sequences for each project and shows that of the 23 best known solutions have been improved.

  14. Introduction of ranavirus to isolated wood frog populations could cause local extinction.

    Science.gov (United States)

    Earl, Julia E; Gray, Matthew J

    2014-12-01

    Amphibian declines and extinction have been attributed to many causes, including disease such as chytridiomycosis. Other pathogens may also contribute to declines, with ranavirus as the most likely candidate given reoccurring die-offs observed in the wild. We were interested in whether it is possible for ranavirus to cause extinction of a local, closed population of amphibians. We used susceptibility data from experimental challenges on different life stages combined with estimates of demographic parameters from a natural population to predict the likelihood of extinction using a stage-structured population model for wood frogs (Lithobates sylvaticus). Extinction was most likely when the larval or metamorph stage was exposed under frequent intervals in smaller populations. Extinction never occurred when only the egg stage was exposed to ranavirus. Under the worst-case scenario, extinction could occur in as quickly as 5 years with exposure every year and 25-44 years with exposure every 2 years. In natural wood frog populations, die-offs typically occur in the larval stage and can reoccur in subsequent years, indicating that our simulations represent possible scenarios. Additionally, wood frog populations are particularly sensitive to changes in survival during the pre-metamorphic stages when ranavirus tends to be most pathogenic. Our results suggest that ranavirus could contribute to amphibian species declines, especially for species that are very susceptible to ranavirus with closed populations. We recommend that ranavirus be considered in risk analyses for amphibian species. PMID:24962849

  15. Pulmonary and cutaneous O₂gas exchange: a student laboratory exercise in the frog.

    Science.gov (United States)

    Tattersall, Glenn J; Currie, Suzanne; LeBlanc, Danielle M

    2013-03-01

    Gas exchange in animals is ultimately diffusion based, generally occurring across dedicated respiratory organs. In many aquatic amphibians, however, multiple modes of gas exchange exist, allowing for the partitioning of O2 uptake and CO2 excretion between respiratory organs with different efficiencies. For example, due to the physical properties of O2 being vastly different between air and water phases, the lung and skin play disproportionately important roles in O2 uptake. Many aquatic frogs are renowned for their cutaneous gas exchange capacity, where often the majority of CO2 is excreted across the skin. Furthermore, the roles of these gas exchange organs change with the animal's behavior. Under diving conditions, most of the frog's gas exchange needs must be met by the skin. In this article, we describe an interactive undergraduate laboratory that allows a class of students to share equipment while assessing pulmonary and cutaneous respiration in frogs provided with an air/water choice and under enforced dive conditions. Concepts explored in this laboratory exercise include animal energetics, diving reflex, pulmonary and cutaneous gas exchange processes, diffusion-based gas flux, and O2 debt.

  16. Comparative pathology and ecological implications of two myxosporean parasites in native Australian frogs and the invasive cane toad.

    Directory of Open Access Journals (Sweden)

    Ashlie Hartigan

    Full Text Available Myxosporean parasites Cystodiscus axonis and C. australis are pathogens of native and exotic Australian frog species. The pathology and ecological outcomes of infection with these parasites were investigated in this study. Gliosis was correlated to Cystodiscus axonis plasmodia in the brains of (9/60 tadpoles and (3/9 adult endangered Green and golden bell frogs using ordinal regression. Severe host reactions to C. axonis (haemorrhage, necrosis, and vasulitis were observed in the brains of threatened Southern bell frogs (8/8, critically endangered Booroolong frogs (15/44 and Yellow spotted bell frogs (3/3. Severe brain lesions were associated with behavioural changes, neurological dysfunction, and spontaneous death. Both C. axonis and C. australis develop in the bile ducts of tadpoles, the plasmodia were significantly associated with biliary hyperplasia, inflammation and the loss of hepatocytes in (34/72 Green and golden bell frog tadpoles using ordinal regression. These lesions were so severe that in some cases 70% of the total liver was diseased. Normal liver function in tadpoles is necessary for metamorphosis, metabolism, and immune function. We postulate that this extensive liver damage would have significant host health impacts. Severe hepatic myxosporidiosis was more prevalent in tadpoles examined in autumn and winter (overwintered, suggestive of delayed metamorphosis in infected tadpoles, which would have serious flow-on effects in small populations. We compared the sensitivity of histopathology and species-specific PCR in the detection of C. australis and C. axonis. PCR was determined to be the most sensitive method (detection limit 1 myxospore equivalent of ribosomal DNA. Histology, however, had the advantage of assessing the impact of the parasite on the host. It was concluded that these parasites have the potential for significant ecological impacts, because of their high prevalence of infection and their ability to cause disease in

  17. Trichobothrial mediation of an aquatic escape response: Directional jumps by the fishing spider, Dolomedes triton, foil frog attacks

    Directory of Open Access Journals (Sweden)

    Robert B. Suter

    2003-07-01

    Full Text Available Fishing spiders (Pisauridae frequent the surfaces of ponds and streams and thereby expose themselves to predation by a variety of aquatic and semi-aquatic vertebrates. To assess the possibility that the impressive jumps of fishing spiders from the water surface function in evading attacks by frogs, attacks by bullfrogs (Rana catesbiana and green frogs (R. clamitans on Dolomedes triton were studied. Both the attack dynamics of the frogs and the evasive behaviors of the spiders were recorded at 250 frames per second. A freeze-dried bullfrog, propelled toward spiders with acceleration, posture, and position that approximated the natural attack posture and dynamics, was used to assess the spiders' behavior. Qualitatively, the spiders responded to these mock-attacks just as they had to attacks by live frogs: jumping (N=29 jumps, 56.9% of instances, rearing the legs nearest the attacking frog (N=15, 29.4%, or showing no visible response (N=7, 13.7%. Spiders that jumped always did so away (in the vertical plane from the attack (mean =137° vs. vertical at 90° or horizontally toward the frog at 0°. The involvement of the trichobothria (leg hairs sensitive to air movements, and the eyes as sensory mediators of the evasion response was assessed. Spiders with deactivated trichobothria were significantly impaired relative to intact and sham-deactivated spiders, and relative to spiders in total darkness. Thus, functional trichobothria, unlike the eyes, are both necessary and sufficient mediators of the evasion response. Measurements of air flow during frog attacks suggest that an exponential rise in flow velocity is the airborne signature of an attack.

  18. Rapid sexual maturity and short life span in the blue-legged frog and the rainbow frog from the arid Isalo Massif, southern-central Madagascar.

    Science.gov (United States)

    Guarino, Fabio M; Tessa, Giulia; Mercurio, Vincenzo; Andreone, Franco

    2010-12-01

    Longevity and age at sexual maturity were estimated in two anurans from the arid Isalo Massif (southern-central Madagascar), the blue-legged frog (Mantella expectata) and the rainbow frog (Scaphiophryne gottlebei). Phalanges from 69 individuals of M. expectata and 38 individuals of S. gottlebei were analyzed, using the skeletochronological method, in samples collected during two periods: January-February and November-December 2004. The male gonads of both species were also analyzed in order to better correlate reproductive activity with phenology. The phalangeal diaphysis in adults of both species was composed of two concentric bone layers: an innermost endosteal bone, which was less developed or sometimes lacking in S. gottlebei, and an outermost and broader layer of periosteal bone. Lines of arrested growth (LAGs) were observed in both species, although their recognition was more problematic and their distinctiveness much less evident in S. gottlebei. The results presented here indicate that M. expectata and S. gottlebei have a short life span and attain sexual maturity within the first active season after metamorphosis. Maximum longevity was 3 years in M. expectata and 2 years in S. gottlebei. In S. gottlebei the adult body size is likely attained during the same season in which metamorphosis occurs, but then breeding occurs only after the first latency period. Thus, mature individuals have only one LAG, corresponding to 1 year. The low number of individuals with two LAGs suggests that most animals die before the second latency period.

  19. Restless red legs: an association of the restless legs syndrome with arborizing telangiectasia of the lower limbs.

    OpenAIRE

    Metcalfe, R A; MacDermott, N; Chalmers, R J

    1986-01-01

    Two patients are reported with Ekbom's syndrome of "restless legs" occurring in association with arborizing telangiectasia of the lower limbs. Sensory complaints have previously been reported in this skin condition but not described in detail. The co-existence of the two conditions is discussed in the context of previous explanations of the restless legs syndrome.

  20. PYRAMID ROADLESS AREA, CALIFORNIA.

    Science.gov (United States)

    Armstrong, Augustus K.; Scott, Douglas F.

    1984-01-01

    A geologic and mineral survey was conducted in the Pyramid Roadless Area, California. The area contains mineral showings, but no mineral-resource potential was identified during our studies. Three granodiorite samples on the west side of the roadless area contained weakly anomalous concentrations of uranium. Two samples of roof-pendant rocks, one metasedimentary rock and one metavolcanic rock, contain low concentrations of copper, and of copper and molybdenum, respectively. Although none was identified, the geologic terrane is permissive for mineral occurrences and large-scale, detailed geologic mapping of the areas of metasedimentary and metavolcanic roof pendants in the Pyramid Roadless Area could define a mineral-resource potential for tungsten and precious metals.

  1. REGULATING EFFECTS OF VASCULAR ENDOTHELIAL GROWTH FACTOR AND ANGⅡ ON FROG'S PERICARDIAL STOMATA, MESOTHELIUM AND ANGIOGENESIS

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Objective. To observe the regulating effects of vascular endothelial growth factor (VEGF) and angiotensinⅡ (ANG II) on the frog's pericardium, lymphatic stomata and angiogenesis so as to reveal their effects and mechanism on the mesothelial permeability, lymphatic stoma regulation and myocardial hypertrophy. Methods. VEGF and ANGⅡ were injected into the frog's peritoneal cavity so as to examine the changes of the pericardial stromata by using transmission electron microscopy, scanning electron microscopy and computerized imaging analysis. Results. Scattered distributed pericardial stomata were found on the parietal pericardium of the frog with a few sinusoid mesothelial cells, whose blood supply was directly from the cardiac chambers flowing into the trabecular spaces of the myocardium (because there are no blood vessels in the myocardium of the frog). The average diameters of the pericardial stomata in VEGF and ANGⅡ groups were 1.50 μ m and 1.79 μ m respectively, which were much larger than those in the control group (0.72 μ m, P< 0.01); the average distribution densities of the stomata were 8.25/0.1 mm2 and 12.80/0.1 mm2 in VEGF and ANGⅡ groups, which were also much higher than those in the control group (3.57/0.1 mm2, P< 0.01); the sinusoid areas in VEGF and ANGⅡ groups were 2442.95 μ m2/0.1 mm2 and 2121.79 μ m2/0.1 mm2, which were larger than that in the control group (995.08 μ m2 /0.1 mm2 , P< 0.01); no angiogenesis was found in the frogs of the experimental groups. Conclusions. VEGF and ANGⅡ could strongly regulate the pericardial stomata by increasing their numbers and openings with larger diameters and higher distribution density. They could also increase the sinusoid areas with the result of the higher permeability of the pericardium, which clearly indicated that VEGF and ANGⅡ could speed up the material transfer of the pericardial cavity and play an important role in preventing myocardial interstitial edema. Yet there was no strong

  2. Predicting the Invasion Potential of a Puerto Rican Frog in Hawaii using MODIS Satellite Imagery

    Science.gov (United States)

    Bisrat, S. A.; White, M. A.

    2008-12-01

    The Puerto Rican coqui frog (Eleutherodactylus coqui, hereafter coqui), which was introduced into Hawaii accidentally via commercial nurseries, is an aggressive invasive species in Hawaii. The coqui threatens Hawaii's unique ecological communities because it predates upon endemic invertebrates, which comprise the large majority of Hawaii's endemic fauna. Coqui frogs also affect real estate valuations because of their loud mating calls. Despite this widespread problem, the potential coqui range in Hawaii is currently unknown, making control and management efforts difficult. We fitted linear discriminant analysis (LDA), logistic regression (LR) via generalized linear models (GLMs), generalized additive models (GAMs), classification trees (CTs), random forests (RF), and support vector machine (SVM) to model the species distribution and map their invasion potential. We used five MODIS satellite imagery-derived biophysical variables as explanatory variables: leaf area index (LAI), fraction of photosynthetically active radiation absorbed by vegetation (FPAR), enhanced vegetation index (EVI), normalized difference vegetation index (NDVI), and land surface temperature (LST) from three MODIS products: MOD11 (LST), MOD13 (LAI and FPAR), and MOD15 (Vegetation Index) (collection 4). We used 2000-2005 MODIS data from Aqua and Terra satellites to generate monthly climatologies for each biophysical variable. We collected presence/absence data from Puerto Rico and Hawaii using a 1 km grid overlaid over the entire islands of Puerto Rico and the Island of Hawaii by sampling every other pixel of the grid intersecting with the road network. We then used the dataset from Puerto Rico to train the six models while the Hawaii dataset was used as a test set. All six models predicted the invasion potential of coqui frogs in Hawaii with a moderate success with mean Kappa value of 0.31, mean area under the curve of receiver operating characteristics (AUC) of 0.75 and mean classification

  3. Recovery of frog and lizard communities following primary habitat alteration in Mizoram, Northeast India

    Directory of Open Access Journals (Sweden)

    Rawat Gopal S

    2004-08-01

    Full Text Available Abstract Background Community recovery following primary habitat alteration can provide tests for various hypotheses in ecology and conservation biology. Prominent among these are questions related to the manner and rate of community assembly after habitat perturbation. Here we use space-for-time substitution to analyse frog and lizard community assembly along two gradients of habitat recovery following slash and burn agriculture (jhum in Mizoram, Northeast India. One recovery gradient undergoes natural succession to mature tropical rainforest, while the other involves plantation of jhum fallows with teak Tectona grandis monoculture. Results Frog and lizard communities accumulated species steadily during natural succession, attaining characteristics similar to those from mature forest after 30 years of regeneration. Lizards showed higher turnover and lower augmentation of species relative to frogs. Niche based classification identified a number of guilds, some of which contained both frogs and lizards. Successional change in species richness was due to increase in the number of guilds as well as the number of species per guild. Phylogenetic structure increased with succession for some guilds. Communities along the teak plantation gradient on the other hand, did not show any sign of change with chronosere age. Factor analysis revealed sets of habitat variables that independently determined changes in community and guild composition during habitat recovery. Conclusions The timescale of frog and lizard community recovery was comparable with that reported by previous studies on different faunal groups in other tropical regions. Both communities converged on primary habitat attributes during natural vegetation succession, the recovery being driven by deterministic, nonlinear changes in habitat characteristics. On the other hand, very little faunal recovery was seen even in relatively old teak plantation. In general, tree monocultures are unlikely to

  4. Population status and population genetics of northern leopard frogs in Arizona

    Science.gov (United States)

    Theimer, Tad C.; Drost, Charles A.; O'Donnell, Ryan P.; Mock, Karen E.

    2011-01-01

    Increasing isolation of populations by habitat fragmentation threatens the persistence of many species, both from stochastic loss of small isolated populations, and from inbreeding effects in populations that have become genetically isolated. In the southwestern United States, amphibian habitat is naturally patchy in occurrence because of the prevailing aridity of the region. Streams, rivers, and other wetlands are important both as habitat and as corridors that connect populations. However, populations of some species have become more fragmented and isolated by habitat degradation and loss. Northern leopard frogs (Rana pipiens) have experienced serious declines in the Southwest. We conducted an extensive survey across the known range of northern leopard frogs in Arizona to determine the current distribution and abundance of the species. From a range that once spanned much of the northern and central part of the State, northern leopard frogs have been reduced to three or four widely separated populations, near Lyman Lake in east-central Arizona, in the Stoneman Lake area south of Flagstaff, along Truxton Wash near Peach Springs, and a population of uncertain extent on Navajo Nation lands. The Lyman Lake and Truxton Wash populations are small and extremely isolated. The Stoneman Lake population, however, is an extensive metapopulation spread across several stream drainages, including numerous ponds, wetlands, and artificial tanks. This is the only population in Arizona that is increasing in extent and numbers, but there is concern about the apparent introduction of nonnative genetic stock from eastern North America into this area. We analyzed genetic diversity within and genetic divergence among populations of northern leopard frogs, across both extant and recently extirpated populations in Arizona. We also analyzed mitochondrial DNA to place these populations into a larger phylogenetic framework and to determine whether any populations contained genetic material

  5. Tribute to R. G. Boutilier: the role for skeletal muscle in the hypoxia-induced hypometabolic responses of submerged frogs.

    Science.gov (United States)

    West, T G; Donohoe, P H; Staples, J F; Askew, G N

    2006-04-01

    Much of Bob Boutilier's research characterised the subcellular, organ-level and in vivo behavioural responses of frogs to environmental hypoxia. His entirely integrative approach helped to reveal the diversity of tissue-level responses to O(2) lack and to advance our understanding of the ecological relevance of hypoxia tolerance in frogs. Work from Bob's lab mainly focused on the role for skeletal muscle in the hypoxic energetics of overwintering frogs. Muscle energy demand affects whole-body metabolism, not only because of its capacity for rapid increases in ATP usage, but also because hypometabolism of the large skeletal muscle mass in inactive animals impacts so greatly on in vivo energetics. The oxyconformance and typical hypoxia-tolerance characteristics (e.g. suppressed heat flux and preserved membrane ion gradients during O(2) lack) of skeletal muscle in vitro suggest that muscle hypoperfusion in vivo is possibly a key mechanism for (i) downregulating muscle and whole-body metabolic rates and (ii) redistributing O(2) supply to hypoxia-sensitive tissues. The gradual onset of a low-level aerobic metabolic state in the muscle of hypoxic, cold-submerged frogs is indeed important for slowing depletion of on-board fuels and extending overwintering survival time. However, it has long been known that overwintering frogs cannot survive anoxia or even severe hypoxia. Recent work shows that they remain sensitive to ambient O(2) and that they emerge rapidly from quiescence in order to actively avoid environmental hypoxia. Hence, overwintering frogs experience periods of hypometabolic quiescence interspersed with episodes of costly hypoxia avoidance behaviour and exercise recovery. In keeping with this flexible physiology and behaviour, muscle mechanical properties in frogs do not deteriorate during periods of overwintering quiescence. On-going studies inspired by Bob Boutilier's integrative mindset continue to illuminate the cost-benefit(s) of intermittent locomotion in

  6. Antioxidative responses of the tissues of two wild populations of Pelophylax kl. esculentus frogs to heavy metal pollution.

    Science.gov (United States)

    Prokić, Marko D; Borković-Mitić, Slavica S; Krizmanić, Imre I; Mutić, Jelena J; Vukojević, Vesna; Nasia, Mohammed; Gavrić, Jelena P; Despotović, Svetlana G; Gavrilović, Branka R; Radovanović, Tijana B; Pavlović, Slađan Z; Saičić, Zorica S

    2016-06-01

    Heavy metal pollution of the aquatic environment is of great concern worldwide. Heavy metals are capable of inducing oxidative stress by increasing the formation of reactive oxygen species (ROS), and directly affecting the antioxidant defense system (AOS) in living organisms. The frog Pelophylax kl. esculentus is a semiaquatic species with semipermeable skin and a complex lifecycle, and represents a potentially useful bioindicator organism. The aim of this study was to investigate the accumulation of several heavy metals (Cd, Co, Cr, Cu, Fe, Hg, Ni, Pb and Zn), and their effects on selected parameters of the AOS, including the activities of superoxide dismutase (SOD), catalase (CAT), glutathione peroxidase (GSH-Px), glutathione reductase (GR), phase II biotransformation enzyme glutathione-S-transferase (GST), the total glutathione (GSH) contents and sulfhydryl (SH) group concentrations, as well as cholinesterases (ChEs) activities in the liver, skin and muscle of P. kl. esculentus. Frog samples were collected at two sites (the Danube-Tisza-Danube canal (DTDC) and the river Ponjavica) in Serbia, which are characterized by different levels of metal pollution. Differences between the metal contents in different tissues showed that the skin of frogs from the DTDC accumulated statistically higher concentrations of Cd, Cu, Pb and Zn, while only the Fe concentration was lower. No significant differences between metal concentrations in muscle tissues of frogs from the DTDC and Ponjavica were observed. Examination of the parameters of the AOS revealed that frogs from the DTDC had higher concentrations of GSH in the liver and of SH groups in the skin and muscle, whereas the activities of the antioxidative enzymes SOD, GHS-Px and GR in the liver and of GR in the skin were lower than in frogs from the Ponjavica. The relationship between metal concentrations and AOS parameters showed the highest number of correlations with GSH, GR and CAT, and with Ni, Zn, Hg, Cr and Cd. Based

  7. An Effective Hybrid Cuckoo Search Algorithm with Improved Shuffled Frog Leaping Algorithm for 0-1 Knapsack Problems

    Directory of Open Access Journals (Sweden)

    Yanhong Feng

    2014-01-01

    Full Text Available An effective hybrid cuckoo search algorithm (CS with improved shuffled frog-leaping algorithm (ISFLA is put forward for solving 0-1 knapsack problem. First of all, with the framework of SFLA, an improved frog-leap operator is designed with the effect of the global optimal information on the frog leaping and information exchange between frog individuals combined with genetic mutation with a small probability. Subsequently, in order to improve the convergence speed and enhance the exploitation ability, a novel CS model is proposed with considering the specific advantages of Lévy flights and frog-leap operator. Furthermore, the greedy transform method is used to repair the infeasible solution and optimize the feasible solution. Finally, numerical simulations are carried out on six different types of 0-1 knapsack instances, and the comparative results have shown the effectiveness of the proposed algorithm and its ability to achieve good quality solutions, which outperforms the binary cuckoo search, the binary differential evolution, and the genetic algorithm.

  8. An effective hybrid cuckoo search algorithm with improved shuffled frog leaping algorithm for 0-1 knapsack problems.

    Science.gov (United States)

    Feng, Yanhong; Wang, Gai-Ge; Feng, Qingjiang; Zhao, Xiang-Jun

    2014-01-01

    An effective hybrid cuckoo search algorithm (CS) with improved shuffled frog-leaping algorithm (ISFLA) is put forward for solving 0-1 knapsack problem. First of all, with the framework of SFLA, an improved frog-leap operator is designed with the effect of the global optimal information on the frog leaping and information exchange between frog individuals combined with genetic mutation with a small probability. Subsequently, in order to improve the convergence speed and enhance the exploitation ability, a novel CS model is proposed with considering the specific advantages of Lévy flights and frog-leap operator. Furthermore, the greedy transform method is used to repair the infeasible solution and optimize the feasible solution. Finally, numerical simulations are carried out on six different types of 0-1 knapsack instances, and the comparative results have shown the effectiveness of the proposed algorithm and its ability to achieve good quality solutions, which outperforms the binary cuckoo search, the binary differential evolution, and the genetic algorithm. PMID:25404940

  9. Odorous and non-fatal skin secretion of adult wrinkled frog (Rana rugosa is effective in avoiding predation by snakes.

    Directory of Open Access Journals (Sweden)

    Yuri Yoshimura

    Full Text Available The roles played by nonfatal secretions of adult anurans in the avoidance of predation remain unknown. The adult Wrinkled frog (Rana rugosa has warty skin with the odorous mucus secretion that is not fatal to the snake Elaphe quadrivirgata. We fed R. rugosa or Fejervarya limnocharis, which resembles R. rugosa in appearance and has mucus secretion, to snakes and compared the snakes' responses to the frogs. Compared to F. limnocharis, R. rugosa was less frequently bitten or swallowed by snakes. The snakes that bit R. rugosa spat out the frogs and showed mouth opening (gaping behavior, while the snakes that bit F. limnocharis did not show gaping behavior. We also compared the responses of the snakes to R. rugosa and F. limnocharis secretions. We coated palatable R. japonica with secretions from R. rugosa or F. limnocharis. The frogs coated by R. rugosa secretion were less frequently bitten or swallowed than those coated by F. limnocharis secretion. We concluded that compared to different frog species of similar sizes, the adult R. rugosa was less frequently preyed upon by, and that its skin secretion was effective in avoiding predation by snakes.

  10. Odorous and non-fatal skin secretion of adult wrinkled frog (Rana rugosa) is effective in avoiding predation by snakes.

    Science.gov (United States)

    Yoshimura, Yuri; Kasuya, Eiiti

    2013-01-01

    The roles played by nonfatal secretions of adult anurans in the avoidance of predation remain unknown. The adult Wrinkled frog (Rana rugosa) has warty skin with the odorous mucus secretion that is not fatal to the snake Elaphe quadrivirgata. We fed R. rugosa or Fejervarya limnocharis, which resembles R. rugosa in appearance and has mucus secretion, to snakes and compared the snakes' responses to the frogs. Compared to F. limnocharis, R. rugosa was less frequently bitten or swallowed by snakes. The snakes that bit R. rugosa spat out the frogs and showed mouth opening (gaping) behavior, while the snakes that bit F. limnocharis did not show gaping behavior. We also compared the responses of the snakes to R. rugosa and F. limnocharis secretions. We coated palatable R. japonica with secretions from R. rugosa or F. limnocharis. The frogs coated by R. rugosa secretion were less frequently bitten or swallowed than those coated by F. limnocharis secretion. We concluded that compared to different frog species of similar sizes, the adult R. rugosa was less frequently preyed upon by, and that its skin secretion was effective in avoiding predation by snakes.

  11. The effect of verapamil and diltiazem on cardiac stimulant effect of adrenaline and calcium chloride on isolated frog heart

    Directory of Open Access Journals (Sweden)

    Lakhavat Sudhakar, Naveen Kumar T, Tadvi NA, Venkata Rao Y

    2013-04-01

    Full Text Available Background: Calcium channel blockers block voltage dependent L-type of calcium channel and thus reduce the frequency of opening of these channels in response to depolarization. The result is a marked decrease in transmembrane calcium current associated with long lasting relaxation of vascular smooth muscle, reduction in contractility in cardiac muscle, decrease in pacemaker activity in the SA node and decrease in conduction velocity in the AV node. Among Calcium channel blockers verapamil, is cardio selective, nifedipine is vascular smooth muscle selective, while diltiazem exhibits intermediate selectivity. Methods: In the present study, the effect of two Ca++ channel blocker, Verapamil and Diltiazem were compared on the isolated frog heart by using adrenaline & calcium chloride as standard on frog heart contractility. Results and conclusion: Adrenaline and calcium chloride increased the amplitude of contraction of isolated perfused frog heart. The L- type of Ca2+ channel blockers verapamil and diltiazem produced dose dependent (2mg, 4mg, 8mg, and 16mg reduction in the amplitude of contraction produced by calcium chloride in isolated perfused frog heart. There was no statistical significant difference (p > 0.05 between the inhibitory effect of diltiazem and verapamil on calcium chloride induced contraction of isolated frog heart.

  12. Effects of Cutrine-Plus® algaecide and predators on wood frog (Lithobates sylvaticus) tadpole survival and growth.

    Science.gov (United States)

    Christenson, Tia A; Horton, Marisa E; Jackson, Brian C; Smith, Geoffrey R; Rettig, Jessica E

    2014-11-01

    Copper contamination is increasing in many aquatic ecosystems. One mode by which copper can be introduced into aquatic ecosystems is as an algaecide, such as Cutrine-Plus®. Using a mesocosm experiment, we examined the effects of Cutrine-Plus® on wood frog (Lithobates sylvaticus) tadpoles. In addition, we examined how the presence of a nonnative predator the Western mosquitofish (Gambusia affinis) may interact with exposure to Cutrine-Plus®. Exposure to our low and high Cutrine-Plus® treatments had a strong negative effect on the wood frog tadpoles, and survivorship was greatly decreased in the low treatment, and no tadpoles survived in the high treatment. Additionally, the tadpoles that survived the low treatment were significantly smaller than those in the control treatment. Mosquitofish had no effect on the survivorship or growth of wood frog tadpoles, and mosquitofish presence did not have a significant interaction with the Cutrine-Plus® treatments. Cutrine-Plus® clearly had a negative effect on wood frog tadpoles at the concentrations used in our experiment, which were at and below the label-recommended dosages, suggesting that the use of Cutrine-Plus® in natural ponds may have negative consequences for wood frog populations and possibly other amphibians. PMID:24943889

  13. Whole-genome sequence of the Tibetan frog Nanorana parkeri and the comparative evolution of tetrapod genomes.

    Science.gov (United States)

    Sun, Yan-Bo; Xiong, Zi-Jun; Xiang, Xue-Yan; Liu, Shi-Ping; Zhou, Wei-Wei; Tu, Xiao-Long; Zhong, Li; Wang, Lu; Wu, Dong-Dong; Zhang, Bao-Lin; Zhu, Chun-Ling; Yang, Min-Min; Chen, Hong-Man; Li, Fang; Zhou, Long; Feng, Shao-Hong; Huang, Chao; Zhang, Guo-Jie; Irwin, David; Hillis, David M; Murphy, Robert W; Yang, Huan-Ming; Che, Jing; Wang, Jun; Zhang, Ya-Ping

    2015-03-17

    The development of efficient sequencing techniques has resulted in large numbers of genomes being available for evolutionary studies. However, only one genome is available for all amphibians, that of Xenopus tropicalis, which is distantly related from the majority of frogs. More than 96% of frogs belong to the Neobatrachia, and no genome exists for this group. This dearth of amphibian genomes greatly restricts genomic studies of amphibians and, more generally, our understanding of tetrapod genome evolution. To fill this gap, we provide the de novo genome of a Tibetan Plateau frog, Nanorana parkeri, and compare it to that of X. tropicalis and other vertebrates. This genome encodes more than 20,000 protein-coding genes, a number similar to that of Xenopus. Although the genome size of Nanorana is considerably larger than that of Xenopus (2.3 vs. 1.5 Gb), most of the difference is due to the respective number of transposable elements in the two genomes. The two frogs exhibit considerable conserved whole-genome synteny despite having diverged approximately 266 Ma, indicating a slow rate of DNA structural evolution in anurans. Multigenome synteny blocks further show that amphibians have fewer interchromosomal rearrangements than mammals but have a comparable rate of intrachromosomal rearrangements. Our analysis also identifies 11 Mb of anuran-specific highly conserved elements that will be useful for comparative genomic analyses of frogs. The Nanorana genome offers an improved understanding of evolution of tetrapod genomes and also provides a genomic reference for other evolutionary studies.

  14. TaFROG, a novel plant orphan gene, interacts with SnRK1 and enhances resistance to a mycotoxigenic fungus

    Science.gov (United States)

    All genomes encode taxonomically restricted ‘orphan’ genes, most of which are of unknown function. We report the functional characterization of the orphan gene TaFROG as a component of the wheat resistance to the globally important Fusarium head blight (FHB) disease. TaFROG is taxonomically restrict...

  15. DS796 California Groundwater Units

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The California Groundwater Units dataset classifies and delineates the State into one of three groundwater based polygon units: (1) those areas defined as alluvial...

  16. Contours--Offshore Aptos, California

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents data for the bathymetric contours for several seafloor maps of the Offshore of Aptos map area, California. The vector data file is...

  17. Flight tracks, Northern California TRACON

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset contains the records of all the flights in the Northern California TRACON. The data was provided by the aircraft noise abatement office...

  18. Invertebrate diversity in southern California

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This shapefile displays mean invertebrate diversity within 5 minute grid cells. The Shannon Index of diversity was calculated from Southern California Coastal Water...

  19. Chukar Range - California [ds570

    Data.gov (United States)

    California Department of Resources — This layer was created from regional biologist input on paper maps. All paper maps were collected and sent to a single Research Analyst to digitize. Some liberties...

  20. Contours--Offshore Monterey, California

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents bathymetric contours for several seafloor maps of the Monterey Canyon and Vicinity map area, California. The raster data file is...

  1. Bathymetry--Offshore Bolinas, California

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents data for the bathymetry and shaded-relief maps of the Offshore of Bolinas, California (raster data file is included in...

  2. Bathymetry--Offshore Pacifica, California

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents data for the bathymetry and shaded-relief maps of Offshore Pacifica, California. The raster data file is included in...

  3. Habitat--Offshore Monterey, California

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents data for the habitat map of the seafloor of the Offshore of Monterey map area, California. The vector data file is included in...

  4. The California cogeneration success story

    International Nuclear Information System (INIS)

    This chapter describes the involvement of Southern California Gas Company(SoCalGas) in the promotion and demonstration of the benefits of cogeneration in California. The topics covered in this chapter are market strategy, cogeneration program objectives, cogeneration program, incentive cofunding, special gas rate, special service priority, special gas pressure and main options, advertising, promotional brochures and handbooks, technical support, program accomplishments, cogeneration outlook, and reasons for success of the program

  5. California Gnatcatcher Observations - 2004-2009 [ds457

    Data.gov (United States)

    California Department of Resources — In southern California, the coastal California gnatcatcher (CAGN) has become both the flagship species and an umbrella species identified with conservation, where...

  6. Oligocene tectonics and sedimentation, California

    Science.gov (United States)

    Nilsen, T.H.

    1984-01-01

    During the Oligocene epoch, California was marked by extensive nonmarine sedimentation, in contrast to its pre-Oligocene and post-Oligocene depositional history. The Oligocene continental deposits are especially widespread in southern California and fill a number of small and generally partly restricted basins. Fluvial facies in many basins prograded over previously deposited lower Tertiary turbidites. Volcanism, from widespread centers, was associated with the nonmarine sedimentation. However, some basins remained marine and a few contain Oligocene turbidites and pelagic sediments deposited at bathyal depths. The Oligocene redbeds of California do not form a post-orogenic molasse sequence comparable to the Old Red Sandstone or Alpine molasse. They are synorogenic and record local uplift of basins and surrounding source areas. Late Cretaceous to contemporary orogenesis in California has been generally characterized by the formation of small restricted basins of variable depth adjacent to small upland areas in response to strike-slip faulting. Deposition of Oligocene redbeds was associated with climatic change from warm and humid to cold and semiarid, and a global lowering of sea level. Oligocene tectonism occurred during the transition from subduction of the Farallon Plate to initiation of the modern San Andreas transform system. However, the major influence that caused uplift, formation of fault-bounded basins, and extensive redbed deposition, especially in southern California, was the approach of the Pacific-Farallon spreading ridge to the western margin of California. ?? 1984.

  7. Stereo Pair, Pasadena, California

    Science.gov (United States)

    2000-01-01

    This stereoscopic image pair is a perspective view that shows the western part of the city of Pasadena, California, looking north toward the San Gabriel Mountains. Portions of the cities of Altadena and La Canada Flintridge are also shown. The cluster of large buildings left of center, at the base of the mountains, is the Jet Propulsion Laboratory. This image shows the power of combining data from different sources to create planning tools to study problems that affect large urban areas. In addition to the well-known earthquake hazards, Southern California is affected by a natural cycle of fire and mudflows. Data shown in this image can be used to predict both how wildfires spread over the terrain and how mudflows are channeled down the canyons.The image was created from three datasets: the Shuttle Radar Topography Mission (SRTM) supplied the elevation, U. S. Geological Survey digital aerial photography provided the image detail, and the Landsat Thematic Mapper provided the color. The United States Geological Survey's Earth Resources Observations Systems (EROS) Data Center, Sioux Falls, South Dakota, provided the Landsat data and the aerial photography. The image can be viewed in 3-D by viewing the left image with the right eye and the right image with the left eye (cross-eyed viewing), or by downloading and printing the image pair, and viewing them with a stereoscope.The Shuttle Radar Topography Mission (SRTM), launched on February 11, 2000, used the same radar instrument that comprised the Spaceborne Imaging Radar-C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR) that flew twice on the Space Shuttle Endeavour in 1994. The mission was designed to collect three-dimensional measurements of the Earth's surface. To collect the 3-D data, engineers added a 60-meter-long (200-foot) mast, an additional C-band imaging antenna and improved tracking and navigation devices. The mission is a cooperative project between the National Aeronautics and Space Administration (NASA

  8. Helminth communities of two green frogs (Rana perezi and Rana saharica from both shores of the Alboran Sea

    Directory of Open Access Journals (Sweden)

    Navarro P.

    2006-12-01

    Full Text Available The helminth communities of two populations of green frogs from both shores of the Alborán Sea (Western Mediterranean were studied. Of the 79 frogs examined for helminths, 39 individuals of the species Rana saharica were collected from Bab-Taza (Morocco, and 40 of the species Rana perezi were collected from the Natural Park of the Sierra de Grazalema (Spain. Although the species richness of helminths was identical in the two sampled areas, the differences observed in the structure of the helminth infracommunities were quite important. Statistically, significant differences were found between the species richness and the diversity of the infracommunities of R. perezi female population and the other three studied statistical populations. The helminth component communities of these two green frogs can be considered as depauperate, although their infracommunities present interactive features.

  9. Climate scenarios for California

    Science.gov (United States)

    Cayan, Daniel R.; Maurer, Ed; Dettinger, Mike; Tyree, Mary; Hayhoe, Katharine; Bonfils, Celine; Duffy, Phil; Santer, Ben

    2006-01-01

    Possible future climate changes in California are investigated from a varied set of climate change model simulations. These simulations, conducted by three state-of-the-art global climate models, provide trajectories from three greenhouse gas (GHG) emission scenarios. These scenarios and the resulting climate simulations are not “predictions,” but rather are a limited sample from among the many plausible pathways that may affect California’s climate. Future GHG concentrations are uncertain because they depend on future social, political, and technological pathways, and thus the IPCC has produced four “families” of emission scenarios. To explore some of these uncertainties, emissions scenarios A2 (a medium-high emissions) and B1 (low emissions) were selected from the current IPCC Fourth climate assessment, which provides several recent model simulations driven by A2 and B1 emissions. The global climate model simulations addressed here were from PCM1, the Parallel Climate Model from the National Center for Atmospheric Research (NCAR) and U.S. Department of Energy (DOE) group, and CM2.1 from the National Oceanic and Atmospheric Administration (NOAA) Geophysical Fluids Dynamics Laboratory (GFDL).

  10. Endocrine-disrupting effects and reproductive toxicity of low dose MCLR on male frogs (Rana nigromaculata) in vivo

    International Nuclear Information System (INIS)

    Highlights: • Low-dose MCLR (1 μg/L) elicits a potential ecological effect on amphibian populations. • MCLR can induce abnormal sperm morphologies and activities on male frogs. • MCLR can induce a decrease in serum testosterone and an increase in serum estradiol of male frogs. • MCLR can increase SF-1 protein levels and decrease P450 aromatase levels in the gonads of frogs. - Abstract: Toxic cyanobacterial blooms are potential global threats to aquatic ecosystems and human health. The World Health Organization has set a provisional guideline limit of 1 μg/L microcystin-LR (MCLR) in freshwater. However, MCLR concentrations in several water bodies have exceeded this level. Despite this recommended human safety standard, MCLR-induced endocrine-disrupting effects and reproductive toxicity on male frog (Rana nigromaculata) were demonstrated in this study. Results showed that sperm motility and sperm count were significantly and negatively correlated with exposure time and concentration. By contrast, abnormal sperm rate was positively correlated with both parameters. Ultrastructural observation results revealed abnormal sperm morphologies, vacuoles in spermatogenic cells, cell dispersion, incomplete cell structures, and deformed nucleoli. These results indicated that MCLR could induce toxic effects on the reproductive system of frogs, significantly decrease testosterone content, and rapidly increase estradiol content. Prolonged exposure and increased concentration enhanced the relative expression levels of P450 aromatase and steroidogenic factor 1; thus, endocrine function in frogs was disrupted. This study is the first to demonstrate in vivo MCLR toxicity in the reproductive system of male R. nigromaculata. This study provided a scientific basis of the global decline in amphibian populations

  11. Breeding Guild Determines Frog Distributions in Response to Edge Effects and Habitat Conversion in the Brazil's Atlantic Forest.

    Science.gov (United States)

    Ferreira, Rodrigo B; Beard, Karen H; Crump, Martha L

    2016-01-01

    Understanding the response of species with differing life-history traits to habitat edges and habitat conversion helps predict their likelihood of persistence across changing landscape. In Brazil's Atlantic Forest, we evaluated frog richness and abundance by breeding guild at four distances from the edge of a reserve: i) 200 m inside the forest, ii) 50 m inside the forest, iii) at the forest edge, and iv) 50 m inside three different converted habitats (coffee plantation, non-native Eucalyptus plantation, and abandoned pastures, hereafter matrix types). By sampling a dry and a wet season, we recorded 622 individual frogs representing 29 species, of which three were undescribed. Breeding guild (i.e. bromeliad, leaf-litter, and water-body breeders) was the most important variable explaining frog distributions in relation to edge effects and matrix types. Leaf-litter and bromeliad breeders decreased in richness and abundance from the forest interior toward the matrix habitats. Water-body breeders increased in richness toward the matrix and remained relatively stable in abundance across distances. Number of large trees (i.e. DBH > 15 cm) and bromeliads best explained frog richness and abundance across distances. Twenty species found in the interior of the forest were not found in any matrix habitat. Richness and abundance across breeding guilds were higher in the rainy season but frog distributions were similar across the four distances in the two seasons. Across matrix types, leaf-litter species primarily used Eucalyptus plantations, whereas water-body species primarily used coffee plantations. Bromeliad breeders were not found inside any matrix habitat. Our study highlights the importance of primary forest for bromeliad and leaf-litter breeders. We propose that water-body breeders use edge and matrix habitats to reach breeding habitats along the valleys. Including life-history characteristics, such as breeding guild, can improve predictions of frog distributions in

  12. Breeding Guild Determines Frog Distributions in Response to Edge Effects and Habitat Conversion in the Brazil's Atlantic Forest.

    Directory of Open Access Journals (Sweden)

    Rodrigo B Ferreira

    Full Text Available Understanding the response of species with differing life-history traits to habitat edges and habitat conversion helps predict their likelihood of persistence across changing landscape. In Brazil's Atlantic Forest, we evaluated frog richness and abundance by breeding guild at four distances from the edge of a reserve: i 200 m inside the forest, ii 50 m inside the forest, iii at the forest edge, and iv 50 m inside three different converted habitats (coffee plantation, non-native Eucalyptus plantation, and abandoned pastures, hereafter matrix types. By sampling a dry and a wet season, we recorded 622 individual frogs representing 29 species, of which three were undescribed. Breeding guild (i.e. bromeliad, leaf-litter, and water-body breeders was the most important variable explaining frog distributions in relation to edge effects and matrix types. Leaf-litter and bromeliad breeders decreased in richness and abundance from the forest interior toward the matrix habitats. Water-body breeders increased in richness toward the matrix and remained relatively stable in abundance across distances. Number of large trees (i.e. DBH > 15 cm and bromeliads best explained frog richness and abundance across distances. Twenty species found in the interior of the forest were not found in any matrix habitat. Richness and abundance across breeding guilds were higher in the rainy season but frog distributions were similar across the four distances in the two seasons. Across matrix types, leaf-litter species primarily used Eucalyptus plantations, whereas water-body species primarily used coffee plantations. Bromeliad breeders were not found inside any matrix habitat. Our study highlights the importance of primary forest for bromeliad and leaf-litter breeders. We propose that water-body breeders use edge and matrix habitats to reach breeding habitats along the valleys. Including life-history characteristics, such as breeding guild, can improve predictions of frog

  13. Tolerance of fungal infection in European water frogs exposed to Batrachochytrium dendrobatidis after experimental reduction of innate immune defenses

    Directory of Open Access Journals (Sweden)

    Woodhams Douglas C

    2012-10-01

    Full Text Available Abstract Background While emerging diseases are affecting many populations of amphibians, some populations are resistant. Determining the relative contributions of factors influencing disease resistance is critical for effective conservation management. Innate immune defenses in amphibian skin are vital host factors against a number of emerging pathogens such as ranaviruses and the amphibian chytrid fungus Batrachochytrium dendrobatidis (Bd. Adult water frogs from Switzerland (Pelophylax esculentus and P. lessonae collected in the field with their natural microbiota intact were exposed to Bd after experimental reduction of microbiota, skin peptides, both, or neither to determine the relative contributions of these defenses. Results Naturally-acquired Bd infections were detected in 10/51 P. lessonae and 4/19 P. esculentus, but no disease outbreaks or population declines have been detected at this site. Thus, this population was immunologically primed, and disease resistant. No mortality occurred during the 64 day experiment. Forty percent of initially uninfected frogs became sub-clinically infected upon experimental exposure to Bd. Reduction of both skin peptide and microbiota immune defenses caused frogs to gain less mass when exposed to Bd than frogs in other treatments. Microbiota-reduced frogs increased peptide production upon Bd infection. Ranavirus was undetectable in all but two frogs that appeared healthy in the field, but died within a week under laboratory conditions. Virus was detectable in both toe-clips and internal organs. Conclusion Intact skin microbiota reduced immune activation and can minimize subclinical costs of infection. Tolerance of Bd or ranavirus infection may differ with ecological conditions.

  14. Endocrine-disrupting effects and reproductive toxicity of low dose MCLR on male frogs (Rana nigromaculata) in vivo

    Energy Technology Data Exchange (ETDEWEB)

    Jia, Xiuying; Cai, Chenchen; Wang, Jia; Gao, Nana; Zhang, Hangjun, E-mail: zhanghangjun@gmail.com

    2014-10-15

    Highlights: • Low-dose MCLR (1 μg/L) elicits a potential ecological effect on amphibian populations. • MCLR can induce abnormal sperm morphologies and activities on male frogs. • MCLR can induce a decrease in serum testosterone and an increase in serum estradiol of male frogs. • MCLR can increase SF-1 protein levels and decrease P450 aromatase levels in the gonads of frogs. - Abstract: Toxic cyanobacterial blooms are potential global threats to aquatic ecosystems and human health. The World Health Organization has set a provisional guideline limit of 1 μg/L microcystin-LR (MCLR) in freshwater. However, MCLR concentrations in several water bodies have exceeded this level. Despite this recommended human safety standard, MCLR-induced endocrine-disrupting effects and reproductive toxicity on male frog (Rana nigromaculata) were demonstrated in this study. Results showed that sperm motility and sperm count were significantly and negatively correlated with exposure time and concentration. By contrast, abnormal sperm rate was positively correlated with both parameters. Ultrastructural observation results revealed abnormal sperm morphologies, vacuoles in spermatogenic cells, cell dispersion, incomplete cell structures, and deformed nucleoli. These results indicated that MCLR could induce toxic effects on the reproductive system of frogs, significantly decrease testosterone content, and rapidly increase estradiol content. Prolonged exposure and increased concentration enhanced the relative expression levels of P450 aromatase and steroidogenic factor 1; thus, endocrine function in frogs was disrupted. This study is the first to demonstrate in vivo MCLR toxicity in the reproductive system of male R. nigromaculata. This study provided a scientific basis of the global decline in amphibian populations.

  15. Effects of temperature and hydric environment on survival of the Panamanian Golden Frog infected with a pathogenic chytrid fungus.

    Science.gov (United States)

    Bustamante, Heidi M; Livo, Lauren J; Carey, Cynthia

    2010-06-01

    Considerable controversy exists concerning whether or not climate changes (particularly global warming) are causing outbreaks of a lethal amphibian pathogen, the chytrid fungus Batrachochytrium dendrobatidis (Longcore, Pessier & D.K. Nichols 1999). In the present study, groups of Panamanian golden frogs (Atelopus zeteki Dunn, 1993), a critically endangered amphibian thought to be nearly extinct in Panama, were exposed to varying dosages of zoospores of Batrachochytrium dendrobatidis, temperatures and hydric environments in order to learn whether this species is susceptible to this pathogen and, if so, how environmental factors affect survival. This pathogen proved to be highly lethal for A. zeteki. Frogs exposed to a dosage of 100 Bd zoospores survived significantly (P<0.0001) longer than those that had been exposed to 10(4) or 10(6) zoospores. Exposed frogs housed at 23 °C survived significantly (P<0.0001) longer than those that were housed at 17 °C. Exposed frogs held in dry conditions survived significantly longer than those in wet conditions (P<0.0001). As a laboratory study, these results do not directly test hypotheses about the relation between climate change and the decline of these frogs in the field, but they inform the discussion about how environmental conditions can have an impact on the interaction between a susceptible amphibian and this pathogen. These data do not support the contention that rising global temperatures are necessary to cause the death of amphibians infected with this pathogen because the pathogen was equally lethal at 17 as at 23 °C, and frogs at the warmer temperature lived significantly longer than those at the cooler one. PMID:21392332

  16. Phylogenetic relationships of leopard frogs (Rana pipiens complex) from an isolated coastal mountain range in southern Sonora, Mexico.

    Science.gov (United States)

    Pfeiler, E; Markow, T A

    2008-10-01

    Mitochondrial DNA sequence data from the control region and 12S rRNA in leopard frogs from the Sierra El Aguaje of southern Sonora, Mexico, together with GenBank sequences, were used to infer taxonomic identity and provide phylogenetic hypotheses for relationships with other members of the Rana pipiens complex. We show that frogs from the Sierra El Aguaje belong to the Rana berlandieri subgroup, or Scurrilirana clade, of the R. pipiens group, and are most closely related to Rana magnaocularis from Nayarit, Mexico. We also provide further evidence that Rana magnaocularis and R. yavapaiensis are close relatives.

  17. Phylogenetic relationships of leopard frogs (Rana pipiens complex) from an isolated coastal mountain range in southern Sonora, Mexico.

    Science.gov (United States)

    Pfeiler, E; Markow, T A

    2008-10-01

    Mitochondrial DNA sequence data from the control region and 12S rRNA in leopard frogs from the Sierra El Aguaje of southern Sonora, Mexico, together with GenBank sequences, were used to infer taxonomic identity and provide phylogenetic hypotheses for relationships with other members of the Rana pipiens complex. We show that frogs from the Sierra El Aguaje belong to the Rana berlandieri subgroup, or Scurrilirana clade, of the R. pipiens group, and are most closely related to Rana magnaocularis from Nayarit, Mexico. We also provide further evidence that Rana magnaocularis and R. yavapaiensis are close relatives. PMID:18625327

  18. Studies of the uptake and release of [3H]β-alanine by frog spinal slices

    International Nuclear Information System (INIS)

    [3H]β-alanine was accumulated by frog spinal cord slices by two transport components with estimated Ksub(m) values of μM ('high-affinity') and 11 mM ('low affinity') respectively. The high affinity uptake exhibited sodium ion and energy dependence, temperature sensitivity, had a very low Vsub(max) (10.4 nmol/g/min) compared to GABA and glycine, was competitively inhibited by GABA (Ksub(i) 2μM), and was significantly reduced by the presence of glycine and of taurine in the incubating medium. When slices preloaded with [3H]β-alanine were superfused with medium containing depolarizing concentrations of potassium ions, there was a small, but consistent, increase in [3H]β-alanine efflux: 1.4 times prestimulation rates in 40 mM potassium. When the superfusate was altered by omission of calcium and addition of concentrations of magnesium (10 mM), manganese (1 mM), and cobalt (1 mM) ions sufficient to block reflex transmission in the isolated in vitro frog cord, the potassium-evoked release was not blocked. Release was decreased by lanthanum ions (1 mM). Release of [3H]GABA and [3H]glycine in parallel experiments was inhibited by magnesium, manganese, cobalt and lanthanum. Veratridine significantly increased the release of [3H]GABA and [3H]glycine but not of [3H]β-alanine. These observations demonstrate the non-specificity of β-alanine uptake and the unconventional nature of the calcium-dependence of β-alanine release and therefore do not lend support to the hypothesis that β-alanine functions as a neurotransmitter in frog spinal cord. (author)

  19. The pathogen Batrachochytrium dendrobatidis disturbs the frog skin microbiome during a natural epidemic and experimental infection.

    Science.gov (United States)

    Jani, Andrea J; Briggs, Cheryl J

    2014-11-25

    Symbiotic microbial communities may interact with infectious pathogens sharing a common host. The microbiome may limit pathogen infection or, conversely, an invading pathogen can disturb the microbiome. Documentation of such relationships during naturally occurring disease outbreaks is rare, and identifying causal links from field observations is difficult. This study documented the effects of an amphibian skin pathogen of global conservation concern [the chytrid fungus Batrachochytrium dendrobatidis (Bd)] on the skin-associated bacterial microbiome of the endangered frog, Rana sierrae, using a combination of population surveys and laboratory experiments. We examined covariation of pathogen infection and bacterial microbiome composition in wild frogs, demonstrating a strong and consistent correlation between Bd infection load and bacterial community composition in multiple R. sierrae populations. Despite the correlation between Bd infection load and bacterial community composition, we observed 100% mortality of postmetamorphic frogs during a Bd epizootic, suggesting that the relationship between Bd and bacterial communities was not linked to variation in resistance to mortal disease and that Bd infection altered bacterial communities. In a controlled experiment, Bd infection significantly altered the R. sierrae microbiome, demonstrating a causal relationship. The response of microbial communities to Bd infection was remarkably consistent: Several bacterial taxa showed the same response to Bd infection across multiple field populations and the laboratory experiment, indicating a somewhat predictable interaction between Bd and the microbiome. The laboratory experiment demonstrates that Bd infection causes changes to amphibian skin bacterial communities, whereas the laboratory and field results together strongly support Bd disturbance as a driver of bacterial community change during natural disease dynamics.

  20. Learning, memorizing and apparent forgetting of chemical cues from new predators by Iberian green frog tadpoles.

    Science.gov (United States)

    Gonzalo, Adega; López, Pilar; Martín, José

    2009-09-01

    Many antipredator adaptations are induced by the prey's ability to recognize chemical cues from predators. However, predator recognition often requires learning by prey individuals. Iberian green frog tadpoles (Pelophylax perezi) have the ability to learn new potential predators. Here, we tested the memory capabilities of Iberian green frog tadpoles. We conditioned tadpoles with chemicals cues from a non-predatory fish in conjunction with conspecific alarm cues, and examined whether tadpoles retained their conditioned response (reduction of activity level). We found that conditioned tadpoles reduced their activity levels in subsequent exposures to the non-predatory fish cues alone. Tadpoles were able to remember this association and reduced movement rate at least for 9 days after. The ability to learn and memorize potential predators may be especially important for the survivorship of prey species that are likely to find a high variety of predators. However, after those 9 days, there was a lack of response to the non-predatory fish cues alone in the absence of reinforcement. This could be explained if tadpoles behave according to the threat-sensitive predator avoidance hypothesis, and the perceived risk to the learning cue diminished over time, or it could be due to an apparent forgetting process to avoid non-adaptative responses to chemical cues of non-dangerous species that were randomly paired with alarm cues. Thus, this study demonstrates that green frog tadpoles in the absence of reinforcement remember the chemical cues of a learned predator only for a limited time that may be adaptative in a threat-sensitive context. PMID:19449191