WorldWideScience

Sample records for calder hall b-3 reactor

  1. Neutronic design of MYRRHA reactor hall shielding

    Science.gov (United States)

    Celik, Yurdunaz; Stankovskiy, Alexey; Eynde, Gert Van den

    2017-09-01

    The lateral shielding of a 600 MeV proton linear accelerator beam line in the MYRRHA reactor hall has been assessed using neutronic calculations by the MCNPX code complemented with analytical predictions. Continuous beam losses were considered to define the required shielding thickness that meets the requirements for the dose rate limits. Required shielding thicknesses were investigated from the viewpoint of accidental full beam loss as well as beam loss on collimator. The results confirm that the required shielding thicknesses are highly sensitive to the spatial shape of the beam and strongly divergent beam losses. Therefore shielding barrier should be designed according to the more conservative assumptions.

  2. Metal Hall sensors for the new generation fusion reactors of DEMO scale

    Science.gov (United States)

    Bolshakova, I.; Bulavin, M.; Kargin, N.; Kost, Ya.; Kuech, T.; Kulikov, S.; Radishevskiy, M.; Shurygin, F.; Strikhanov, M.; Vasil'evskii, I.; Vasyliev, A.

    2017-11-01

    For the first time, the results of on-line testing of metal Hall sensors based on nano-thickness (50-70) nm gold films, which was conducted under irradiation by high-energy neutrons up to the high fluences of 1 · 1024 n · m-2, are presented. The testing has been carried out in the IBR-2 fast pulsed reactor in the neutron flux with the intensity of 1.5 · 1017 n · m-2 · s-1 at the Joint Institute for Nuclear Research. The energy spectrum of neutron flux was very close to that expected for the ex-vessel sensors locations in the ITER experimental reactor. The magnetic field sensitivity of the gold sensors was stable within the whole fluence range under research. Also, sensitivity values at the start and at the end of irradiation session were equal within the measurement error (fusion reactors of DEMO scale.

  3. Optimal Protection of Reactor Hall Under Nuclear Fuel Container Drop Using Simulation Methods

    Directory of Open Access Journals (Sweden)

    Králik Juraj

    2014-12-01

    Full Text Available This paper presents of the optimal design of the damping devices cover of reactor hall under impact of nuclear fuel container drop of type TK C30. The finite element idealization of nuclear power plant structure is used in software ANSYS. The steel pipe damper system is proposed for dissipation of the kinetic energy of the container free fall in comparison with the experimental results. The probabilistic and sensitivity analysis of the damping devices was considered on the base of the simulation methods in program AntHill using the Monte Carlo method.

  4. Calderón de la Barca y Toledo

    Directory of Open Access Journals (Sweden)

    Colomina Torner, Jaime

    2001-12-01

    Full Text Available In the last Year 2000, it was expired the fourth Centenary of Pedro Calderón de la Barca's birth. On the ocassion of this, He was remembered with several ceremonies in Spain. In Toledo the Royal Academy of FineArts and Historic Science, and the Cathedral Chapter give Him a great homage in the Royal Chapel in what occuped a post and job, being priest in 1653. The author of this biographic note participated in this homage, and when he looked into in same archives he found these dates that here are published apparently unknown, and they light up aspects of His biography.En el pasado año 2000 se cumplió el IV centenario del nacimiento de D. Pedro Calderón de la Barca. Con este motivo fue recordado en España con diversos actos. En Toledo, la Real Academia de B. Artes y C. Históricas y el Cabildo de la catedral le tributaron un solemne homenaje en la misma Real Capilla en la que ocupó una plaza, siendo ya sacerdote, a partir de 1653. El autor de esta nota biográfica participó en dicho homenaje, y al investigar en varios archivos halló estos datos, que aquí se publican, al parecer, inéditos y que iluminan aspectos de su biografía.

  5. Description of the magnox type of gas cooled reactor (MAGNOX)

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, S.E.; Nonboel, E

    1999-05-01

    The present report comprises a technical description of the MAGNOX type of reactor as it has been build in Great Britain. The Magnox reactor is gas cooled (CO{sub 2}) with graphite moderators. The fuels is natural uranium in metallic form, canned with a magnesium alloy called 'Magnox'. The Calder Hall Magnox plant on the Lothian coastline of Scotland, 60 km east of Edinburgh, has been chosen as the reference plant and is described in some detail. Data on the other stations are given in tables with a summary of design data. Special design features are also shortly described. Where specific data for Calder Hall Magnox has not been available, corresponding data from other Magnox plants has been used. The information presented is based on the open literature. The report is written as a part of the NKS/RAK-2 sub-project 3: 'Reactors in Nordic Surroundings', which comprises a description of nuclear power plants neighbouring the Nordic countries. (au)

  6. First Calderón Prize

    Science.gov (United States)

    Rundell, William; Somersalo, Erkki

    2008-07-01

    The Inverse Problems International Association (IPIA) awarded the first Calderón Prize to Matti Lassas for his outstanding contributions to the field of inverse problems, especially in geometric inverse problems. The Calderón Prize is given to a researcher under the age of 40 who has made distinguished contributions to the field of inverse problems broadly defined. The first Calderón Prize Committee consisted of Professors Adrian Nachman, Lassi Päivärinta, William Rundell (chair), and Michael Vogelius. William Rundell For the Calderón Prize Committee Prize ceremony The ceremony awarding the Calderón Prize. Matti Lassas is on the left. He and William Rundell are on the right. Photos by P Stefanov. Brief Biography of Matti Lassas Matti Lassas was born in 1969 in Helsinki, Finland, and studied at the University of Helsinki. He finished his Master's studies in 1992 in three years and earned his PhD in 1996. His PhD thesis, written under the supervision of Professor Erkki Somersalo was entitled `Non-selfadjoint inverse spectral problems and their applications to random bodies'. Already in his thesis, Matti demonstrated a remarkable command of different fields of mathematics, bringing together the spectral theory of operators, geometry of Riemannian surfaces, Maxwell's equations and stochastic analysis. He has continued to develop all of these branches in the framework of inverse problems, the most remarkable results perhaps being in the field of differential geometry and inverse problems. Matti has always been a very generous researcher, sharing his ideas with his numerous collaborators. He has authored over sixty scientific articles, among which a monograph on inverse boundary spectral problems with Alexander Kachalov and Yaroslav Kurylev and over forty articles in peer reviewed journals of the highest standards. To get an idea of the wide range of Matti's interests, it is enough to say that he also has three US patents on medical imaging applications. Matti is

  7. Mr. Degas and Mr. Calder Go to the Ballet.

    Science.gov (United States)

    Cross, Kate

    2003-01-01

    Describes an art project that taught students about the work of two different artists: (1) Edgar Degas; and (2) Alexander Calder. Explains that students created drawings of ballerinas, created sculptures in the style of Calder, and created sculptures of ballerinas. (CMK)

  8. Decommissioning of commercial reactor

    Energy Technology Data Exchange (ETDEWEB)

    Yui, Kohei [Japan Atomic Power Co., Tokyo (Japan)

    1997-02-01

    In the case of nuclear reactors, the diversion is often difficult as they are highly purposive, the disassembling is not easy as they are robust, and attention is required to handle the equipment containing radioactive substances. Decommissioning is defined as all the measures taken from the state that facilities become unused to the state of becoming green field. In Japan, already 40 years have elapsed since the effort for nuclear power was begun, and in this paper, the present state and future subjects of the decommissioning of nuclear power stations are summarized at the opportunity that the stop of commercial operation of Tokai Nuclear Power Station was decided recently. In the Tokai Nuclear Power Station, 166 MWe graphite-moderated, carbon dioxide-cooled reactor called improved Calder Hall type is installed, which started the operation in 1966. The circumstances of the decision to stop its operation are explained. The basic policy of the decommissioning of commercial nuclear power stations has been already published by the Advisory Committee for Energy. The state of the decommissioning in various foreign countries is reported. In Japan, the state of green field was realized in 1996 in the decommissioning of the JPDR in Japan Atomic Energy Research institute, and the decommissioning of the atomic powered ship ``Mutsu`` was completed. (K.I.)

  9. Rereading Ventura García Calderón

    Science.gov (United States)

    Goldberg, Nancy Sloan

    2014-01-01

    Ventura García Calderón (1886-1959) was a Peruvian man of letters and a diplomat who was at the center of the hispanophone community in Paris in the first half of the twentieth century. Known as a proponent of Spanish American literature, García Calderón achieved a global celebrity for his dramatic, colorful, and ironic short stories. These…

  10. Fabrication of the CALDER light detectors

    Science.gov (United States)

    Colantoni, I.; Bellini, F.; Cardani, L.; Casali, N.; Castellano, M. G.; Coppolecchia, A.; Cosmelli, C.; Cruciani, A.; D`Addabbo, A.; Di Domizio, S.; Martinez, M.; Tomei, C.; Vignati, M.

    2016-07-01

    CALDER (Cryogenic wide-Area Light Detectors with Excellent Resolution) is a project for the development of large area phonon mediated KIDs (Kinetic Inductance Detectors), for the detection of Cherenkov radiation emitted in TeO2 bolometers to search for neutrinoless double beta decay (0 νββ). The KIDs are superconducting detectors made of high quality factor superconducting resonators, which are coupled to a transmission line for signal readout. We designed and fabricated KIDs using aluminum. The Al thin films (40 nm) were evaporated on Si(100) high resistivity silicon wafers using an electron beam evaporator in a HV chamber. In this work we report the steps of the fabrication process. All devices are made in direct-write using Electron Beam Lithography (EBL), positive tone resist poly-methyl methacrylate (PMMA) and lift off process. In order to improve the sensitivity of the detectors we have started recently to use sub-stoichiometric TiN deposited by means of DC magnetron sputtering and we will optimize a different fabrication process.

  11. CALDER: Cryogenic light detectors for background-free searches

    Science.gov (United States)

    Di Domizio, S.; Bellini, F.; Cardani, L.; Casali, N.; Castellano, M. G.; Colantoni, I.; Cosmelli, C.; Cruciani, A.; D'Addabbo, A.; Martinez, M.; Minutolo, L.; Tomei, C.; Vignati, M.

    2018-01-01

    CALDER is a R&D project for the development of cryogenic light detectors with an active surface of 5x5cm2 and an energy resolution of 20 eV RMS for visible and UV photons. These devices can enhance the sensitivity of next generation large mass bolometric detectors for rare event searches, providing an active background rejection method based on particle discrimination. A CALDER detector is composed by a large area Si absorber substrate with superconducting kinetic inductance detectors (KIDs) deposited on it. The substrate converts the incoming light into athermal phonons, that are then sensed by the KIDs. KID technology combine fabrication simplicity with natural attitude to frequency-domain multiplexing, making it an ideal candidate for a large scale bolometric experiments. We will give an overview of the CALDER project and show the performances obtained with prototype detectors both in terms of energy resolution and efficiency.

  12. The Calderón problem with corrupted data

    Science.gov (United States)

    Caro, Pedro; Garcia, Andoni

    2017-08-01

    We consider the inverse Calderón problem consisting of determining the conductivity inside a medium by electrical measurements on its surface. Ideally, these measurements determine the Dirichlet-to-Neumann map and, therefore, one usually assumes the data to be given by such a map. This situation corresponds to having access to infinite-precision measurements, which is totally unrealistic. In this paper, we study the Calderón problem assuming the data to contain measurement errors and provide formulas to reconstruct the conductivity and its normal derivative on the surface. Additionally, we state the rate convergence of the method. Our approach is theoretical and has a stochastic flavour.

  13. Lp -continuity for Calderón–Zygmund operator

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Department of Mathematics, Wuhan University, 430072 Hubei, China. E-mail: yangqi99@public.wh.hb.cn. MS received 22 July 2004; revised 10 December 2004. Abstract. Given a Calderón–Zygmund (C–Z for short) operator T , which satisfies. Hörmander condition, we prove that: if T maps all the characteristic atoms to ...

  14. The boundedness of multilinear Calderón–Zygmund operators on ...

    Indian Academy of Sciences (India)

    Beijing 100083, China. E-mail: hjzheng@163.com; ustbliuyu@tom.com. MS received 4 June 2012; revised 15 October 2012. Abstract. In this paper, we study the boundedness of the multilinear Calderón–. Zygmund operators on products of Hardy spaces. Keywords. Multilinear Calderón–Zygmund operators; Hardy spaces; ...

  15. Hall C

    Data.gov (United States)

    Federal Laboratory Consortium — Hall C's initial complement of equipment (shown in the figure), includes two general-purpose magnetic spectrometers. The High Momentum Spectrometer (HMS) has a large...

  16. Hall A

    Data.gov (United States)

    Federal Laboratory Consortium — The instrumentation in Hall A at the Thomas Jefferson National Accelerator Facility was designed to study electroand photo-induced reactions at very high luminosity...

  17. High-Order Calderón Preconditioned Time Domain Integral Equation Solvers

    KAUST Repository

    Valdes, Felipe

    2013-05-01

    Two high-order accurate Calderón preconditioned time domain electric field integral equation (TDEFIE) solvers are presented. In contrast to existing Calderón preconditioned time domain solvers, the proposed preconditioner allows for high-order surface representations and current expansions by using a novel set of fully-localized high-order div-and quasi curl-conforming (DQCC) basis functions. Numerical results demonstrate that the linear systems of equations obtained using the proposed basis functions converge rapidly, regardless of the mesh density and of the order of the current expansion. © 1963-2012 IEEE.

  18. Perspectivas para las bibliotecas universitarias : entrevista a Mónica Calderón

    OpenAIRE

    Calderón-Carranza, Mónica; Manco-Vega, Alejandra

    2010-01-01

    Mónica Calderón is a librarian of the Library System of the Pontifical Catholic University of Peru, also is the president of Altamira, a consortium of academic libraries and currently is coordinating the Funnel-NACO Peru project.

  19. A Direct Numerical Reconstruction Algorithm for the 3D Calderón Problem

    DEFF Research Database (Denmark)

    Delbary, Fabrice; Hansen, Per Christian; Knudsen, Kim

    2011-01-01

    In three dimensions Calderón's problem was addressed and solved in theory in the 1980s in a series of papers, but only recently the numerical implementation of the algorithm was initiated. The main ingredients in the solution of the problem are complex geometrical optics solutions to the conducti...

  20. An Approximation Method for Convolution Calderón-Zygmund Operators

    Directory of Open Access Journals (Sweden)

    Yunxia Yu

    2013-01-01

    Full Text Available We present an approximation method for convolution Calderón-Zygmund operators. We give a uniform approximation accuracy of the operators on the endpoint Triebel-Lizorkin space F˙1 0;q   (2

  1. Mujer y travestismo en el teatro de Calderón

    Directory of Open Access Journals (Sweden)

    Escalonilla López, Rosa Ana

    2001-06-01

    Full Text Available After a brief exposition regarding the situation, Calderón's recourse to travestism appears as the symbol of this theatre, mechanism of ideological transmission and unifying element of the whole of this dramatic production (profane, sacramental and brief. The ideological aspect is analysed and therein its relationship with womanhood. Herewith Calderón appears as a forerunner of modernism, since femenine roles distort the restriction imposed by a baroque society. As a result of travestism. Calderón's women do not fit the epoch's stereotypes. They transgress the activities and spaces assigned to their sex, protecting their honour and facing male authority. Definitely, women behave as complete human beings in equal condition to men.Tras una breve exposición del estado de la cuestión, se contempla el recurso del travestismo en Calderón desde su consideración como símbolo de su teatro, mecanismo de transmisión ideológica y elemento unificador de toda su dramaturgia (profana, sacramental y breve. Se analiza el aspecto ideológico y, dentro de éste, la conexión con el tema de la mujer. Calderón se nos revela, así, como precursor de la modernidad, pues los papeles femeninos violentan las restricciones impuestas por la sociedad barroca. Gracias al travestismo, las mujeres calderonianas se sitúan fuera de los estereotipos de la época, transgreden las actividades y los espacios destinados a su sexo, defienden su propio honor y se enfrentan a la autoridad masculina. La mujer es presentada, en definitiva, como un ser humano completo en igualdad de condiciones con el hombre.

  2. Variant texts of Calderón’s plays in unreliable editions: Las manos blancas no ofenden

    Directory of Open Access Journals (Sweden)

    Fernando Rodríguez-Gallego

    2017-07-01

    Full Text Available This article outlines the state of the question regarding Calderón’s re-writing of his own plays, with attention to the kind of version in which the different texts have been preserved, and focusing on those cases in which none of the editions has been supervised in any sense by Calderón. The problems arising from this situation are exemplified in the textual transmission of the play Las manos blancas no ofenden.

  3. A calderón multiplicative preconditioner for the combined field integral equation

    KAUST Repository

    Bagci, Hakan

    2009-10-01

    A Calderón multiplicative preconditioner (CMP) for the combined field integral equation (CFIE) is developed. Just like with previously proposed Caldern-preconditioned CFIEs, a localization procedure is employed to ensure that the equation is resonance-free. The iterative solution of the linear system of equations obtained via the CMP-based discretization of the CFIE converges rapidly regardless of the discretization density and the frequency of excitation. © 2009 IEEE.

  4. La t??cnica de las obras en colaboraci??n de Calder??n de la Barca = The technique of Calder??n de la Barca in the colaboration works

    OpenAIRE

    Yano, Akihiro

    2017-01-01

    237 p. Hasta ahora, muchos importantes investigadores del teatro del Siglo de Oro se han dedicado a estudiar las comedias de Calder??n y han descubierto las t??cnicas dram??ticas del gran autor. Gracias a las m??ltiples y valiosas aportaciones cr??ticas al teatro de Calder??n de la Barca, hoy en d??a podemos ver sus obras de manera ingeniosa desde varios puntos de vista. Sin embargo, a??n quedan algunas comedias interesantes que todav??a necesitan la atenci??n de la cr??tica; nos referimos...

  5. Un Grand Jour

    CERN Multimedia

    ACE Film

    1956-01-01

    On 17 October 1956, Her Majesty the Queen opened Reactor number 1 at Calder Hall, on the Cumbrian coast in northwest England, bringing into service the world's first industrial scale nuclear power station.The reactor at Calder Hall was a prototype of the Magnox gas cooled reactor(The Queen'speech. Much propagand for atomic energy. Scenes from the construction of the center.)

  6. El bestiario de Cristo en los Autos Sacramentales de Calderón

    OpenAIRE

    Alonso Rey, Maria Dolores

    2005-01-01

    communication en attente de publication. El maravilloso mundo de los autos sacramentales. Casa de Velázquez. Madrid. 2005; Del conjunto de figuras y símbolos con los que Calderón representa a Cristo nos interesa analizar los símbolos zoomórficos. Nos interrogaremos sobre su utilización, los contextos en los que aparecen, sus valores visuales y sus potencialidades expresivas. No se elige más que a cinco de ellos : ciervo, león, cordero, pelícano y serpiente.

  7. The Court Drama of Ben Jonson and Calderón

    OpenAIRE

    González Fernández de Sevilla, José Manuel

    1997-01-01

    Una versión de este artículo fue publicada en forma de capítulo en el libro: Spanish studies in Shakespeare and his contemporaries / edited by José Manuel González. Newark, DE : The University of Delaware Press, 2006. ISBN 0-87413-903-1, pp. 250-261. Este estudio trata de comparar el teatro cortesano de Ben Jonson y Calderón, que ofrecen aspectos de interés común, como la preocupación política, a la vez que utilizan una escenografía muy cuidada y espectacular.

  8. El escritor y su paisaje: Eduardo Caballero Calderón

    OpenAIRE

    Luis González

    2003-01-01

    A Eduardo Caballero Calderón lo vi por primera vez una noche de diciembre de 1974. Recuerdo las paredes blancas de su casa de Teusaquillo, la puerta verde, las vigas de madera al aire en la fachada y el olor ácido de su biblioteca. Pero sobre todo, recuerdo la imagen del viejo calvo, de barba gris, sentado en un sillón de cuero, rodeado por un bastón, un vaso de güisqui aguado y un cenicero lleno de colillas. Porque en esa época, Eduardo todavía fumaba: Pielroja, dos paquetes al día.

  9. El escritor y su paisaje: Eduardo Caballero Calderón

    Directory of Open Access Journals (Sweden)

    Luis González

    2003-01-01

    Full Text Available A Eduardo Caballero Calderón lo vi por primera vez una noche de diciembre de 1974. Recuerdo las paredes blancas de su casa de Teusaquillo, la puerta verde, las vigas de madera al aire en la fachada y el olor ácido de su biblioteca. Pero sobre todo, recuerdo la imagen del viejo calvo, de barba gris, sentado en un sillón de cuero, rodeado por un bastón, un vaso de güisqui aguado y un cenicero lleno de colillas. Porque en esa época, Eduardo todavía fumaba: Pielroja, dos paquetes al día.

  10. Stability estimates for the Calderón problem with partial data

    Science.gov (United States)

    Caro, Pedro; Dos Santos Ferreira, David; Ruiz, Alberto

    2016-02-01

    This is a follow-up of our previous article [4] where we proved local stability estimates for a potential in a Schrödinger equation on an open bounded set in dimension n = 3 from the Dirichlet-to-Neumann map with partial data. The region under control was the penumbra delimited by a source of light outside of the convex hull of the open set. These local estimates provided stability of log-log type corresponding to the uniqueness results in Calderón's inverse problem with partial data proved by Kenig, Sjöstrand and Uhlmann [14]. In this article, we prove the corresponding global estimates in all dimensions higher than three. The estimates are based on the construction of solutions of the Schrödinger equation by complex geometrical optics developed in the anisotropic setting by Dos Santos Ferreira, Kenig, Salo and Uhlmann [7] to solve the Calderón problem in certain admissible geometries.

  11. The Cuatrocientos milagros de la cruz of Jaime Bleda: a bedside book for Calderón?

    Directory of Open Access Journals (Sweden)

    Adrián J. Sáez

    2013-04-01

    Full Text Available Abstract:This paper explores the possible knowledge that some authors of the Golden Age may have about certain treatises of historical, philosophical and political nature, besides the well-known relations with other literary works, like the critics frequently have pointed out. So, this investigation compares the series of miracles that appear in La devoción de la cruz of Calderón with the book Cuatrocientos milagros de la cruz of Jaime Bleda, a religious treaty that Calderón might recalled in order to write some passages of this comedy. Overall, this paper reveals data about the prodigious miscellany that may serve to other studies about this matter. Resumen:Este trabajo explora el posible conocimiento que algunos autores del Siglo de Oro pudieron tener de ciertos tratados de tema histórico, filosófico, político, etc., al margen de las relaciones con otras obras literarias, frecuentemente estudiadas por la crítica. Así, se pone en diálogo la serie de milagros que aparecen en La devoción de la cruz de Calderón con los Cuatrocientos milagros de la cruz de Jaime Bleda, un repertorio de milagros que Calderón pudo recordar a la hora de escribir algunos pasajes de esta comedia. Conjuntamente se da noticia de esta miscelánea de prodigios, que puede resultar de gran utilidad para otros estudios.

  12. Skyrmions and Hall viscosity

    OpenAIRE

    Kim, Bom Soo

    2017-01-01

    We discuss the contribution of magnetic Skyrmions to the Hall viscosity and propose a simple way to identify it in experiments. The topological Skyrmion charge density has a distinct signature in the electric Hall conductivity that is identified in existing experimental data. In an electrically neutral system, the Skyrmion charge density is directly related to the thermal Hall conductivity. These results are direct consequences of the field theory Ward identities, which relate various physica...

  13. Quantum Spin Hall Effect

    Energy Technology Data Exchange (ETDEWEB)

    Bernevig, B.Andrei; Zhang, Shou-Cheng; /Stanford U., Phys. Dept.

    2010-01-15

    The quantum Hall liquid is a novel state of matter with profound emergent properties such as fractional charge and statistics. Existence of the quantum Hall effect requires breaking of the time reversal symmetry caused by an external magnetic field. In this work, we predict a quantized spin Hall effect in the absence of any magnetic field, where the intrinsic spin Hall conductance is quantized in units of 2 e/4{pi}. The degenerate quantum Landau levels are created by the spin-orbit coupling in conventional semiconductors in the presence of a strain gradient. This new state of matter has many profound correlated properties described by a topological field theory.

  14. 32 CFR 806b.3 - Violation penalties.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Violation penalties. 806b.3 Section 806b.3 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE ADMINISTRATION PRIVACY ACT PROGRAM Overview of the Privacy Act Program § 806b.3 Violation penalties. An individual may file a civil...

  15. A Calderón multiplicative preconditioner for coupled surface-volume electric field integral equations

    KAUST Repository

    Bagci, Hakan

    2010-08-01

    A well-conditioned coupled set of surface (S) and volume (V) electric field integral equations (S-EFIE and V-EFIE) for analyzing wave interactions with densely discretized composite structures is presented. Whereas the V-EFIE operator is well-posed even when applied to densely discretized volumes, a classically formulated S-EFIE operator is ill-posed when applied to densely discretized surfaces. This renders the discretized coupled S-EFIE and V-EFIE system ill-conditioned, and its iterative solution inefficient or even impossible. The proposed scheme regularizes the coupled set of S-EFIE and V-EFIE using a Calderón multiplicative preconditioner (CMP)-based technique. The resulting scheme enables the efficient analysis of electromagnetic interactions with composite structures containing fine/subwavelength geometric features. Numerical examples demonstrate the efficiency of the proposed scheme. © 2006 IEEE.

  16. El camino de la mina, vehículo de emociones en Calderón

    Directory of Open Access Journals (Sweden)

    Rull, Enrique

    2002-12-01

    Full Text Available Calderón uses some scenic devices to stablish certain dramatic situations in the plays. The studied here is related to the function of the mine, which possessed important polisemic values. Not only it is used for stablishing a belie religious or a reat loving environement but also to use this motif with the metaphoric value of passion or as a true laberinto of love, includying trascendental mitological symbols. Everything together is aimed to create a very fast and mysterious activity mixing both comic and tragic effects in which the nonexpected becomes not only dramatical essence but also a personal experience about destinity and life.Calderón utiliza varios recursos escénicos para establecer determinadas situaciones dramáticas en sus obras. El que se estudia aquí se refiere a la función de la mina, que posee valores polisémicos muy notables, los cuales van desde los que le sirven para establecer un ámbito guerrero, religioso, amoroso de carácter real, hasta la utilización de este motivo con carácter metafórico de la pasión amorosa o como verdadero laberinto de amor que incluye incluso una mitologización trascendente de la misma. Todo ello le sirve para configurar en sus obras una acción trepidante, misteriosa, en la que se mezcla lo cómico con lo trágico, y en donde lo inesperado cobra un valor no sólo de esencia dramática sino también de vivencia existencial acerca del destino de la vida.

  17. Halls Lake 1990

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Salt marsh habitats along the shoreline of Halls Lake are threatened by wave erosion, but the reconstruction of barrier islands to reduce this erosion will modify or...

  18. General footage ISOLDE experimental hall

    CERN Multimedia

    2016-01-01

    Overview of the ISOLDE experimental hall. Equipment and experiments. Taken from the WITCH / EBIS platform: ISOLDE hall infrastructure, GHM line, LA1, LA2, LA0, central beamline, COLLAPS experiment, CRIS experiment, ISOLTRAP experiment, laser guidance from building 508 into the hall for laser spectroscopy COLLAPS and CRIS. Taken from the HIE ISOLDE shielding tunnel roof: ISOLDE hall infrastructure, WITCH experiment, VITO line, TAS experiment. General footage: High Tension room entrance and EBIS platform, staircases and passages in the experimental hall.

  19. Extraordinary hall balance

    Science.gov (United States)

    Zhang, S. L.; Liu, Y.; Collins-McIntyre, L. J.; Hesjedal, T.; Zhang, J. Y.; Wang, S. G.; Yu, G. H.

    2013-01-01

    Magnetoresistance (MR) effects are at the heart of modern information technology. However, future progress of giant and tunnelling MR based storage and logic devices is limited by the usable MR ratios of currently about 200% at room-temperature. Colossal MR structures, on the other hand, achieve their high MR ratios of up to 106% only at low temperatures and high magnetic fields. We introduce the extraordinary Hall balance (EHB) and demonstrate room-temperature MR ratios in excess of 31,000%. The new device concept exploits the extraordinary Hall effect in two separated ferromagnetic layers with perpendicular anisotropy in which the Hall voltages can be configured to be carefully balanced or tipped out of balance. Reprogrammable logic and memory is realised using a single EHB element. PACS numbers: 85.75.Nn,85.70.Kh,72.15.Gd,75.60.Ej. PMID:23804036

  20. HEDSA Town Hall Meeting

    Science.gov (United States)

    Afeyan, Bedros

    2017-10-01

    HEDSA will hold its Town Hall meeting on Wednesday October 25 at 12:30pm in the Wisconsin Center. The new steering committee members and HEDSA leadership will be announced. A report will be given on 2017 HEDSA activities. Program Managers from Federal Funding Agencies such as OFES, NNSA, AFOSR and NSF will provide updates on the state of sponsored research in HED plasmas, and to engage the community in an open dialogue. The HEDSA Town Hall is a ``bring your own lunch'' meeting. Current members of HEDSA and all graduate students are strongly encouraged to attend. To join HEDSA please visit HEDSA.org

  1. Laurance David Hall.

    Science.gov (United States)

    Coxon, Bruce

    2011-01-01

    An account is given of the life, scientific contributions, and passing of Laurance David Hall (1938-2009), including his early history and education at the University of Bristol, UK, and the synthesis and NMR spectroscopy of carbohydrates and other natural products during ∼20 years of research and teaching at the University of British Columbia in Vancouver, Canada. Lists of graduate students, post-doctoral fellows, and sabbatical visitors are provided for this period. Following a generous endowment by Dr. Herchel Smith, Professor Hall built a new Department of Medicinal Chemistry at Cambridge University, UK, and greatly expanded his researches into the technology and applications of magnetic resonance imaging (MRI) and zero quantum NMR. MRI technology was applied both to medical problems such as the characterization of cartilage degeneration in knee joints, the measurement of ventricular function, lipid localization in animal models of atherosclerosis, paramagnetic metal complexes of polysaccharides as contrast agents, and studies of many other anatomical features, but also to several aspects of materials analysis, including food analyses, process control, and the elucidation of such physical phenomena as the flow of liquids through porous media, defects in concrete, and the visualization of fungal damage to wood. Professor Hall's many publications, patents, lectures, and honors and awards are described, and also his successful effort to keep the Asilomar facility in Pacific Grove, California as the alternating venue for the annual Experimental NMR Conference. Two memorial services for Professor Hall are remembered. Copyright © 2011 Elsevier Inc. All rights reserved.

  2. The Monty Hall Dilemma

    NARCIS (Netherlands)

    Barteld Kooi, [No Value

    2006-01-01

    Samenvatting: In het begin van de jaren negentig brak een wereldwijde discussie los over een probleem dat in het Engels 'The Monty Hall Dilemma' wordt genoemd. Marilyn vos Savant, die in het Guinness Book of World Records wordt genoemd als degene met het

  3. Halle, Prof. Thore Gustaf.

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 1947 Honorary. Halle, Prof. Thore Gustaf. Date of birth: 25 September 1884. Date of death: 12 May 1964. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Theory Of Evolution. Posted on 23 January 2018. Joint Statement by the Three Science Academies of India on ...

  4. Hall Sweet Home

    Science.gov (United States)

    Oguntoyinbo, Lekan

    2011-01-01

    Many urban and commuter universities have their sights set on students who are unlikely to connect with the college and likely to fail unless the right strategies are put in place to help them graduate. In efforts to improve retention rates, commuter colleges are looking to an unusual suspect: residence halls. The author discusses how these…

  5. Magnetometria por efeito Hall

    OpenAIRE

    Fernández Pinto, Janeth

    2010-01-01

    Construímos um magnetômetro utilizando dois sensores Hall de GaAs (Toshiba- THS118) operando em um modo diferencial. Cada sensor tem um circuito préamplificador associado a ele e a diferencia de voltagem entre eles é amplificada com um ganho variável de 30 - 7000. Os sensores Hall têm dimensões típicas de 1,5 x 1,7 x 0,6 mm3 e foram montados separados um do outro de 0,71 mm, em uma configuração espacial planar. O magnetômetro foi testado usando tanto correntes dc (Idc) quant...

  6. Relativistic Hall effect.

    Science.gov (United States)

    Bliokh, Konstantin Y; Nori, Franco

    2012-03-23

    We consider the relativistic deformation of quantum waves and mechanical bodies carrying intrinsic angular momentum (AM). When observed in a moving reference frame, the centroid of the object undergoes an AM-dependent transverse shift. This is the relativistic analogue of the spin-Hall effect, which occurs in free space without any external fields. Remarkably, the shifts of the geometric and energy centroids differ by a factor of 2, and both centroids are crucial for the Lorentz transformations of the AM tensor. We examine manifestations of the relativistic Hall effect in quantum vortices and mechanical flywheels and also discuss various fundamental aspects of this phenomenon. The perfect agreement of quantum and relativistic approaches allows applications at strikingly different scales, from elementary spinning particles, through classical light, to rotating black holes.

  7. 216-B-3 expansion ponds closure plan

    Energy Technology Data Exchange (ETDEWEB)

    1994-10-01

    This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA.

  8. Quantum critical Hall exponents

    CERN Document Server

    Lütken, C A

    2014-01-01

    We investigate a finite size "double scaling" hypothesis using data from an experiment on a quantum Hall system with short range disorder [1-3]. For Hall bars of width w at temperature T the scaling form is w(-mu)T(-kappa), where the critical exponent mu approximate to 0.23 we extract from the data is comparable to the multi-fractal exponent alpha(0) - 2 obtained from the Chalker-Coddington (CC) model [4]. We also use the data to find the approximate location (in the resistivity plane) of seven quantum critical points, all of which closely agree with the predictions derived long ago from the modular symmetry of a toroidal sigma-model with m matter fields [5]. The value nu(8) = 2.60513 ... of the localisation exponent obtained from the m = 8 model is in excellent agreement with the best available numerical value nu(num) = 2.607 +/- 0.004 derived from the CC-model [6]. Existing experimental data appear to favour the m = 9 model, suggesting that the quantum Hall system is not in the same universality class as th...

  9. Stability of the Hall sensors performance under neutron irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Duran, I.; Hron, M.; Stockel, J. [Institute of Plasma Physics, Association EURATOM/IPP.CR, Praha (Czech Republic); Viererbl, L.; Vsolak, R.; Cerva, V. [Nuclear Research Institute plc (Czech Republic); Bolshakova, I.; Holyaka, R. [Lviv Polytechnic National Univ. (Ukraine); Vayakis, G. [ITER International Team, Naka Joint Work Site, Naka, Ibaraki (Japan)

    2004-07-01

    A principally new diagnostic method must be developed for magnetic measurements in steady state regime of operation of fusion reactor. One of the options is the use of transducers based on Hall effect. The use of Hall sensors in ITER is presently limited by their questionable radiation and thermal stability. Issues of reliable operation in ITER like radiation and thermal environment are addressed in the paper. The results of irradiation tests of candidate Hall sensors in LVR-15 and IBR-2 experimental fission reactors are presented. Stable operation (deterioration of sensitivity below one percent) of the specially prepared sensors was demonstrated during irradiation by the total fluence of 3.10{sup 16} n/cm{sup 2} in IBR-2 reactor. Increasing the total neutron fluence up to 3.10{sup 17} n/cm{sup 2} resulted in deterioration of the best sensor's output still below 10% as demonstrated during irradiation in LVR-15 fission reactor. This level of neutron is already higher than the expected ITER life time neutron fluence for a sensor location just outside the ITER vessel. (authors)

  10. Magnesium Hall Thruster

    Science.gov (United States)

    Szabo, James J.

    2015-01-01

    This Phase II project is developing a magnesium (Mg) Hall effect thruster system that would open the door for in situ resource utilization (ISRU)-based solar system exploration. Magnesium is light and easy to ionize. For a Mars- Earth transfer, the propellant mass savings with respect to a xenon Hall effect thruster (HET) system are enormous. Magnesium also can be combusted in a rocket with carbon dioxide (CO2) or water (H2O), enabling a multimode propulsion system with propellant sharing and ISRU. In the near term, CO2 and H2O would be collected in situ on Mars or the moon. In the far term, Mg itself would be collected from Martian and lunar regolith. In Phase I, an integrated, medium-power (1- to 3-kW) Mg HET system was developed and tested. Controlled, steady operation at constant voltage and power was demonstrated. Preliminary measurements indicate a specific impulse (Isp) greater than 4,000 s was achieved at a discharge potential of 400 V. The feasibility of delivering fluidized Mg powder to a medium- or high-power thruster also was demonstrated. Phase II of the project evaluated the performance of an integrated, highpower Mg Hall thruster system in a relevant space environment. Researchers improved the medium power thruster system and characterized it in detail. Researchers also designed and built a high-power (8- to 20-kW) Mg HET. A fluidized powder feed system supporting the high-power thruster was built and delivered to Busek Company, Inc.

  11. A calderón-preconditioned single source combined field integral equation for analyzing scattering from homogeneous penetrable objects

    KAUST Repository

    Valdés, Felipe

    2011-06-01

    A new regularized single source equation for analyzing scattering from homogeneous penetrable objects is presented. The proposed equation is a linear combination of a Calderón-preconditioned single source electric field integral equation and a single source magnetic field integral equation. The equation is immune to low-frequency and dense-mesh breakdown, and free from spurious resonances. Unlike dual source formulations, this equation involves operator products that cannot be discretized using standard procedures for discretizing standalone electric, magnetic, and combined field operators. Instead, the single source equation proposed here is discretized using a recently developed technique that achieves a well-conditioned mapping from div- to curl-conforming function spaces, thereby fully respecting the space mapping properties of the operators involved, and guaranteeing accuracy and stability. Numerical results show that the proposed equation and discretization technique give rise to rapidly convergent solutions. They also validate the equation\\'s resonant free character. © 2006 IEEE.

  12. Hall Potential Distribution in Anti-Hall bar Geometry

    Science.gov (United States)

    Tarquini, Vinicio; Knighton, Talbot; Wu, Zhe; Huang, Jian; Pfeiffer, Loren; West, Ken

    A high quality system has been fabricated in an Anti-Hall bar geometry, by opening a 1.4 x 2.0 mm rectangular window using wet etching in the middle of a 2.4 x 3.0 mm two-dimensional high-mobility (μ = 2 . 6 × 106 cm2/(V .s)) hole system confined in a 20 nm wide (100) GaAs quantum well. Topologically this system is equivalent to a normal Hall bar even though there is an extra set of edges in the center. This configuration allows us to probe the Hall potential distribution in relation to the formation of edge channels. The Quantum Hall measurements at 30 mK show a standard behavior of the outer edges. At each Hall plateau the inner edge becomes an equipotential and the Hall voltage between the inner and outer edges exhibits a drastic asymmetry for the upper and lower arms of the sample. At various integer fillings, depending on the chirality, the voltage drop across one of the arms measures 0 while the drop across the other one is equal to the Hall voltage. This behavior will be explained in terms of the dynamical process of forming the edge channels which also will account for the more irregular behavior of the Hall potential in more disordered systems. NSF DMR-1410302.

  13. Non-Euclidean Space, Movement and Astronomy in Modern Art: Alexander Calder's Mobiles and Ben Nicholson's Reliefs

    Science.gov (United States)

    Malloy, Vanja

    2013-09-01

    John Keats once wrote that `there is no such thing as time and space' rather, believing that time and space are mental constructs that are subject to a variety of forms and as diverse as the human mind. In the 1920s through the 1930s, modern physics in many ways supported this idea through the various philosophical writings on the Theory of General Relativity to the masses by scientists such as Arthur Eddington and Albert Einstein. These new concepts of modern physics fundamentally changed our understanding of time and space and had substantial philosophical implications, which were absorbed by modern artists resulting in the 1936 Dimensionist Manifesto. Seeking to internalize the developments of modern science within modern art, this manifesto was widely endorsed by the most prominent figures of the avant-garde such as Marcel Duchamp, Jean Arp, Naum Gabo, Joan Miró, László Moholy-Nagy, Wassily Kandinsky and Alexander Calder. Of particular interest to this manifesto was the new concept of the fourth-dimension, which in many ways revolutionized the arts. Importantly, its interpretation varied widely in the artistic community, ranging from a purely physical four-dimensional space, to a kinetic concept of space in which space and time are linked, to a metaphysical interest in a space that exists beyond the material realm. The impact of modern science and astronomy on avant-garde art is currently a bourgeoning area of research with considerable implications to our rethinking of substantial artistic figures of this era. Through a case study of Alexander Calder's Mobiles and Ben Nicholson's Reliefs, this paper explores how these artworks were informed by an interest in modern science.

  14. Quantum Hall Electron Nematics

    Science.gov (United States)

    MacDonald, Allan

    In 2D electron systems hosted by crystals with hexagonal symmetry, electron nematic phases with spontaneously broken C3 symmetry are expected to occur in the quantum Hall regime when triplets of Landau levels associated with three different Fermi surface pockets are partially filled. The broken symmetry state is driven by intravalley Coulombic exchange interactions that favor spontaneously polarized valley occupations. I will discuss three different examples of 2D electron systems in which this type of broken symmetry state is expected to occur: i) the SnTe (111) surface, ii) the Bi (111) surface. and iii) unbalanced bilayer graphene. This type of quantum Hall electron nematic state has so far been confirmed only in the Bi (111) case, in which the anisotropic quasiparticle wavefunctions of the broken symmetry state were directly imaged. In the SnTe case the nematic state phase boundary is controlled by a competition between intravalley Coulomb interactions and intervalley scattering processes that increase in relative strength with magnetic field. An in-plane Zeeman field alters the phase diagram by lifting the three-fold Landau level degeneracy, yielding a ground state energy with 2 π/3 periodicity as a function of Zeeman-field orientation angle. I will comment on the possibility of observing similar states in the absence of a magnetic field. Supported by DOE Division of Materials Sciences and Engineering Grant DE-FG03-02ER45958.

  15. The ISOLDE hall

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    Since 1992, after its move from the 600 MeV SC, ISOLDE is a customer of the Booster (then 1 GeV, now 1.4 GeV). The intense Booster beam (some 3E13 protons per pulse) is directed onto a target, from which a mixture of isotopes emanates. After ionization and electrostatic acceleration to 60 keV, they enter one of the 2 spectrometers (General Purpose Separator: GPS, and High Resolution Separator: HRS) from which the selected ions are directed to the experiments. The photos show: the REX-ISOLDE post accelerator; the mini-ball experiment; an overview of the ISOLDE hall. In the picture (_12) of the hall, the separators are behind the wall. From either of them, beams can be directed into any of the many beamlines towards the experiments, some of which are visible in the foreground. The elevated cubicle at the left is EBIS (Electron Beam Ion Source), which acts as a charge-state multiplier for the REX facility. The ions are further mass analzyzed and passed on to the linac which accelerates them to higher energies. T...

  16. Cosmopolitanism - Conversation with Stuart Hall

    OpenAIRE

    Hall, Stuart

    2006-01-01

    Forty minute conversation between Stuart Hall and Pnina Werbner, filmed and edited by Haim Bresheeth. Synopsis by Sarah Harrison. Conversation between Stuart Hall and Pnina Werbner on the theme of Cosmopolitanism (to be shown at the Association of Social Anthropologists Silver Jubilee conference in 2006), in March 2006

  17. Farm Hall: The Play

    Science.gov (United States)

    Cassidy, David C.

    2013-03-01

    It's July 1945. Germany is in defeat and the atomic bombs are on their way to Japan. Under the direction of Samuel Goudsmit, the Allies are holding some of the top German nuclear scientists-among them Heisenberg, Hahn, and Gerlach-captive in Farm Hall, an English country manor near Cambridge, England. As secret microphones record their conversations, the scientists are unaware of why they are being held or for how long. Thinking themselves far ahead of the Allies, how will they react to the news of the atomic bombs? How will these famous scientists explain to themselves and to the world their failure to achieve even a chain reaction? How will they come to terms with the horror of the Third Reich, their work for such a regime, and their behavior during that period? This one-act play is based upon the transcripts of their conversations as well as the author's historical work on the subject.

  18. Annual report on JEN-1 reactor; Informe periodico del Reactor JEN-1 correspondiente al ano 1971

    Energy Technology Data Exchange (ETDEWEB)

    Montes, J.

    1972-07-01

    In the annual report on the JEN-1 reactor the main features of the reactor operations and maintenance are described. The reactor has been critical for 1831 hours, what means 65,8% of the total working time. Maintenance and pool water contamination have occupied the rest of the time. The maintenance schedule is shown in detail according to three subjects. The main failures and reactor scrams are also described. The daily maximum values of the water activity are given so as the activity of the air in the reactor hall. (Author)

  19. Leiomioma esofágico: Experiencia con diez casos operados en el "Hospital Dr. Rafael Ángel Calderón Guardia"

    OpenAIRE

    Giovanna Mainieri-Breedy; José-Alberto Mainieri-Hidalgo

    2012-01-01

    Objetivo: informar la experiencia adquirida con la cirugía para leiomiomas esofágicos en el Servicio de Cirugía de Tórax del Hospital Dr. R. A. Calderón Guardia. Métodos: durante el período de 12 años comprendido entre 1999 y 2011, fueron referidos 14 pacientes con tumores submucosos del esófago al Servicio de Cirugía de Tórax del Hospital Calderón Guardia. En cuatro pacientes asintomáticos con tumores pequeños se decidió observar, y diez fueron operados, confirmándose el diagnóstico histológ...

  20. Hall Effect Gyrators and Circulators

    Directory of Open Access Journals (Sweden)

    Giovanni Viola

    2014-05-01

    Full Text Available The electronic circulator and its close relative the gyrator are invaluable tools for noise management and signal routing in the current generation of low-temperature microwave systems for the implementation of new quantum technologies. The current implementation of these devices using the Faraday effect is satisfactory but requires a bulky structure whose physical dimension is close to the microwave wavelength employed. The Hall effect is an alternative nonreciprocal effect that can also be used to produce desired device functionality. We review earlier efforts to use an Ohmically contacted four-terminal Hall bar, explaining why this approach leads to unacceptably high device loss. We find that capacitive coupling to such a Hall conductor has much greater promise for achieving good circulator and gyrator functionality. We formulate a classical Ohm-Hall analysis for calculating the properties of such a device, and show how this classical theory simplifies remarkably in the limiting case of the Hall angle approaching 90°. In this limit, we find that either a four-terminal or a three-terminal capacitive device can give excellent circulator behavior, with device dimensions far smaller than the ac wavelength. An experiment is proposed to achieve GHz-band gyration in millimeter (and smaller scale structures employing either semiconductor heterostructure or graphene Hall conductors. An inductively coupled scheme for realizing a Hall gyrator is also analyzed.

  1. Topological Hall and spin Hall effects in disordered skyrmionic textures

    KAUST Repository

    Ndiaye, Papa Birame

    2017-02-24

    We carry out a thorough study of the topological Hall and topological spin Hall effects in disordered skyrmionic systems: the dimensionless (spin) Hall angles are evaluated across the energy-band structure in the multiprobe Landauer-Büttiker formalism and their link to the effective magnetic field emerging from the real-space topology of the spin texture is highlighted. We discuss these results for an optimal skyrmion size and for various sizes of the sample and find that the adiabatic approximation still holds for large skyrmions as well as for nanoskyrmions. Finally, we test the robustness of the topological signals against disorder strength and show that the topological Hall effect is highly sensitive to momentum scattering.

  2. Topological Hall and Spin Hall Effects in Disordered Skyrmionic Textures

    Science.gov (United States)

    Ndiaye, Papa Birame; Akosa, Collins; Manchon, Aurelien; Spintronics Theory Group Team

    We carry out a throughout study of the topological Hall and topological spin Hall effects in disordered skyrmionic systems: the dimensionless (spin) Hall angles are evaluated across the energy band structure in the multiprobe Landauer-Büttiker formalism and their link to the effective magnetic field emerging from the real space topology of the spin texture is highlighted. We discuss these results for an optimal skyrmion size and for various sizes of the sample and found that the adiabatic approximation still holds for large skyrmions as well as for few atomic size-nanoskyrmions. Finally, we test the robustness of the topological signals against disorder strength and show that topological Hall effect is highly sensitive to momentum scattering. This work was supported by the King Abdullah University of Science and Technology (KAUST) through the Award No OSR-CRG URF/1/1693-01 from the Office of Sponsored Research (OSR).

  3. Planar Hall effect bridge magnetic field sensors

    DEFF Research Database (Denmark)

    Henriksen, A.D.; Dalslet, Bjarke Thomas; Skieller, D.H.

    2010-01-01

    Until now, the planar Hall effect has been studied in samples with cross-shaped Hall geometry. We demonstrate theoretically and experimentally that the planar Hall effect can be observed for an exchange-biased ferromagnetic material in a Wheatstone bridge topology and that the sensor signal can...... Hall effect bridge sensors....

  4. "Hall mees" Linnateatris / Triin Sinissaar

    Index Scriptorium Estoniae

    Sinissaar, Triin

    1999-01-01

    Tallinn Linnateatri ja Raadioteatri ühislavastus "Hall mees" Gill Adamsi näidendi järgi, lavastaja Eero Spriit, osades Helene Vannari ja Väino Laes, kunstnik Kustav - Agu Püüman. Esietendus 22. okt

  5. Herstructurering Stageprocessen Van Hall Larenstein

    NARCIS (Netherlands)

    Schelvis-Smit, A.A.M.

    2009-01-01

    Verslag van de herstructurering van het stageproces bij het Onderwijsbureau van Hogelschool VanHall Larenstein. Uitgangspunt hierbij was het onderling uitwisselbaar worden van personeel bij het uitvoeren van werkzaamheden met betrekking tot stages.

  6. Shared Magnetics Hall Thruster Project

    Data.gov (United States)

    National Aeronautics and Space Administration — In the proposed Phase II program, Busek Co. will demonstrate an innovative methodology for clustering Hall thrusters into a high performance, very high power...

  7. A game generalizing Hall's theorem

    OpenAIRE

    Rabern, Landon

    2012-01-01

    We characterize the initial positions from which the first player has a winning strategy in a certain two-player game. This provides a generalization of Hall's theorem. Vizing's edge coloring theorem follows from a special case.

  8. Shared Magnetics Hall Thruster Project

    Data.gov (United States)

    National Aeronautics and Space Administration — In the proposed Phase I program, Busek Co. will demonstrate an innovative methodology for clustering Hall thrusters into a high performance, very high power...

  9. Sheldon-Hall syndrome

    Directory of Open Access Journals (Sweden)

    Bamshad Michael J

    2009-03-01

    Full Text Available Abstract Sheldon-Hall syndrome (SHS is a rare multiple congenital contracture syndrome characterized by contractures of the distal joints of the limbs, triangular face, downslanting palpebral fissures, small mouth, and high arched palate. Epidemiological data for the prevalence of SHS are not available, but less than 100 cases have been reported in the literature. Other common clinical features of SHS include prominent nasolabial folds, high arched palate, attached earlobes, mild cervical webbing, short stature, severe camptodactyly, ulnar deviation, and vertical talus and/or talipes equinovarus. Typically, the contractures are most severe at birth and non-progressive. SHS is inherited in an autosomal dominant pattern but about half the cases are sporadic. Mutations in either MYH3, TNNI2, or TNNT3 have been found in about 50% of cases. These genes encode proteins of the contractile apparatus of fast twitch skeletal muscle fibers. The diagnosis of SHS is based on clinical criteria. Mutation analysis is useful to distinguish SHS from arthrogryposis syndromes with similar features (e.g. distal arthrogryposis 1 and Freeman-Sheldon syndrome. Prenatal diagnosis by ultrasonography is feasible at 18–24 weeks of gestation. If the family history is positive and the mutation is known in the family, prenatal molecular genetic diagnosis is possible. There is no specific therapy for SHS. However, patients benefit from early intervention with occupational and physical therapy, serial casting, and/or surgery. Life expectancy and cognitive abilities are normal.

  10. Transport Signatures of the Hall Viscosity.

    Science.gov (United States)

    Delacrétaz, Luca V; Gromov, Andrey

    2017-12-01

    Hall viscosity is a nondissipative response function describing momentum transport in two-dimensional systems with broken parity. It is quantized in the quantum Hall regime, and contains information about the topological order of the quantum Hall state. Hall viscosity can distinguish different quantum Hall states with identical Hall conductances, but different topological order. To date, an experimentally accessible signature of Hall viscosity is lacking. We exploit the fact that Hall viscosity contributes to charge transport at finite wavelengths, and can therefore be extracted from nonlocal resistance measurements in inhomogeneous charge flows. We explain how to determine the Hall viscosity from such a transport experiment. In particular, we show that the profile of the electrochemical potential close to contacts where current is injected is sensitive to the value of the Hall viscosity.

  11. General footage ISOLDE experimental hall HD

    CERN Multimedia

    2016-01-01

    Overview of the ISOLDE experimental hall. Equipment and experiments. Taken from the WITCH / EBIS platform: ISOLDE hall infrastructure, GHM line, LA1, LA2, LA0, central beamline, COLLAPS experiment, CRIS experiment, ISOLTRAP experiment, laser guidance from building 508 into the hall for laser spectroscopy COLLAPS and CRIS. Taken from the HIE ISOLDE shielding tunnel roof: ISOLDE hall infrastructure, WITCH experiment, VITO line, TAS experiment. General footage: High Tension room entrance and EBIS platform, staircases and passages in the experimental hall.

  12. EphrinB3 blocks EphB3 dependence receptor functions to prevent cell death following traumatic brain injury.

    Science.gov (United States)

    Theus, M H; Ricard, J; Glass, S J; Travieso, L G; Liebl, D J

    2014-05-08

    Eph receptor tyrosine kinases and their membrane-bound ligands, ephrins, have a variety of roles in the developing and adult central nervous system that require direct cell-cell interactions; including regulating axon path finding, cell proliferation, migration and synaptic plasticity. Recently, we identified a novel pro-survival role for ephrins in the adult subventricular zone, where ephrinB3 blocks Eph-mediated cell death during adult neurogenesis. Here, we examined whether EphB3 mediates cell death in the adult forebrain following traumatic brain injury and whether ephrinB3 infusion could limit this effect. We show that EphB3 co-labels with microtubule-associated protein 2-positive neurons in the adult cortex and is closely associated with ephrinB3 ligand, which is reduced following controlled cortical impact (CCI) injury. In the complete absence of EphB3 (EphB3(-/-)), we observed reduced terminal deoxynucleotidyl transferase-dUTP nick end labeling (TUNEL), and functional improvements in motor deficits after CCI injury as compared with wild-type and ephrinB3(-/-) mice. We also demonstrated that EphB3 exhibits dependence receptor characteristics as it is cleaved by caspases and induces cell death, which is not observed in the presence of ephrinB3. Following trauma, infusion of pre-clustered ephrinB3-Fc molecules (eB3-Fc) into the contralateral ventricle reduced cortical infarct volume and TUNEL staining in the cortex, dentate gyrus and CA3 hippocampus of wild-type and ephrinB3(-/-) mice, but not EphB3(-/-) mice. Similarly, application of eB3-Fc improved motor functions after CCI injury. We conclude that EphB3 mediates cell death in the adult cortex through a novel dependence receptor-mediated cell death mechanism in the injured adult cortex and is attenuated following ephrinB3 stimulation.

  13. Iodine Hall Thruster

    Science.gov (United States)

    Szabo, James

    2015-01-01

    Iodine enables dramatic mass and cost savings for lunar and Mars cargo missions, including Earth escape and near-Earth space maneuvers. The demonstrated throttling ability of iodine is important for a singular thruster that might be called upon to propel a spacecraft from Earth to Mars or Venus. The ability to throttle efficiently is even more important for missions beyond Mars. In the Phase I project, Busek Company, Inc., tested an existing Hall thruster, the BHT-8000, on iodine propellant. The thruster was fed by a high-flow iodine feed system and supported by an existing Busek hollow cathode flowing xenon gas. The Phase I propellant feed system was evolved from a previously demonstrated laboratory feed system. Throttling of the thruster between 2 and 11 kW at 200 to 600 V was demonstrated. Testing showed that the efficiency of iodine fueled BHT-8000 is the same as with xenon, with iodine delivering a slightly higher thrust-to-power (T/P) ratio. In Phase II, a complete iodine-fueled system was developed, including the thruster, hollow cathode, and iodine propellant feed system. The nominal power of the Phase II system is 8 kW; however, it can be deeply throttled as well as clustered to much higher power levels. The technology also can be scaled to greater than 100 kW per thruster to support megawatt-class missions. The target thruster efficiency for the full-scale system is 65 percent at high specific impulse (Isp) (approximately 3,000 s) and 60 percent at high thrust (Isp approximately 2,000 s).

  14. H Reactor

    Data.gov (United States)

    Federal Laboratory Consortium — The H Reactor was the first reactor to be built at Hanford after World War II.It became operational in October of 1949, and represented the fourth nuclear reactor on...

  15. Ventilation systems for high halls

    Energy Technology Data Exchange (ETDEWEB)

    Sodec, F.; Veldboer, W.

    1982-02-01

    A ventilation system for high halls is described which meets the demands of steady air flow in spite of inverse thermal currents, intensive ventilation of working areas during heating and cooling and ventilation free of draught. The main element of the ventilation system is the air outlet in the ceiling, with variable beam direction. The horizontal, rotated beams are superimposed by a vertical beam whose strength may be varied. This way, the beam direction can be adapted to the thermal load of the hall and the height of blowout. The blowout angle is large for heating and small for cooling. Studies have shown that halls are ventilated thoroughly and free of draught by this system. The variable, rotary outlet presented in the article is best suited for heights of 4.00 to 12.00 m. The outlet, with a rated diameter of 400 mm, has been in use for two years now in fields as varied as diecasting works, halls at fairs, sports halls, etc. The air volume flow rate is 1000 to 3000 m/sup 3//h per outlet. A bigger version is now being developed; it will have a rated diameter of 710 mm and an air volume flow rate of 3000 to 9000 m/sup 3//h.

  16. Novel concepts in Hall sensors

    Science.gov (United States)

    Mani, R. G.

    1996-03-01

    Hall effect devices are widely used as position sensors and contactless switches in applications ranging from electric motors to soft drink machines and automobiles. Such devices typically operate in an adverse environment where offset voltages originating from various physical effects limit the effective sensitivity of the sensor to the weak magnetic field (B device that automatically reduces such spurious offsets is desirable because improved 'signal to offset' would relax manufacturing tolerances and other constraints within the sensor system. Here, we examine some techniques and sensor configurations (R. G. Mani, K. von Klitzing, F. Jost, K. Marx, S. Lindenkreuz, and H. P. Trah, Appl. Phys. Lett. 67, 2223, 1995.) based on the so called 'anti Hall bar' geometry that promise the possibility of a Silicon based Hall sensor with a field equivalent offset well below 1 mT.

  17. La identidad nacional y Calderón en la polémica teatral de 1762-1764

    Directory of Open Access Journals (Sweden)

    Bezhanova, Olga

    2004-06-01

    Full Text Available Drawing on contemporary theories about national identity, legitimacy and intellectual authority this article explores identitarian issues at stake during the 1762-1764 controversy on Spanish theater. Re-reading texts by Clavijo y Fajardo (El Pensador, Nicolás Fernández de Moratín (Desengaños al teatro español and other writings, Mariano José Nipho (Diario Estrangero and La nación española defendida and José Romea y Tapia (El escritor sin título we contend that what these authors are debating indeed is not theater but the legitimacy and authority they are claiming for, and ultimately opposing conceptions of national identity. Calderón becoming a cultural icon of such identity. Particularly significant is the role of autos sacramentales in this context. In effect, acrimony and irritation are part of this polemics because orthodox Catholicism is, from a conservative point of view, an essential component of what they consider Spanish national identity. The prohibition of the autos is just a sign of a temporary change in the relationship of forces.A partir de teorías actuales sobre la identidad nacional, la legitimidad y la autoridad intelectual, este artículo explora los puntos clave identitarios que se ponen en juego durante la polémica sobre el teatro español de los años 1762-1764. Mediante una re-lectura de los textos de Clavijo y Fajardo (El Pensador, Nicolás Fernández de Moratín (Desengaños al teatro español y otros escritos, Mariano José Nipho (Diario Estrangero y La nación española defendida y José Romea y Tapia (El escritor sin título, sostenemos que lo que estos autores discuten realmente no es sobre el teatro, sino sobre la legitimidad y autoridad que reclaman, y en último término concepciones enfrentadas sobre la identidad nacional, de la que Calderón parece convertirse en icono cultural. De particular significación es el papel de los autos sacramentales en este contexto. En efecto, la acritud y la irritaci

  18. Una revisión y puesta en escena dieciochesca de El golfo de las sirenas de Calderón

    OpenAIRE

    Tobar, María Luisa

    2011-01-01

    Un fenómeno interesante que nos ayuda a completar la historia del teatro dieciochesco, es sin duda, la transmisión de textos del teatro áureo, y sobre todo de Calderón, el autor más representado por lo menos hasta la primera mitad del siglo. Pero si queremos tener una idea clara de lo que queda del teatro barroco en las puestas en escena del siglo XVIII y cuanto hay en cambio de renovación o reelaboración, es fundamental hacer una revisión crítica de las representaciones teatra...

  19. Epidemiología de la tuberculosis extrapulmonar en el Hospital Rafael Ángel Calderón Guardia: 2009-2013

    OpenAIRE

    Brenes Madrigal, Mary Yesenia; Marchena Picado, Margarita

    2014-01-01

    La tuberculosis extrapulmonar es una enfermedad de dificil abordaje por lo tanto, conocer las características epidemiológicas de la enfermedad es un elemento básico para su manejo. La población del estudio se conformó por los pacientes diagnosticados con tuberculosis extrapulmonar en el Hospital Rafael Ángel Calderón Guardia en el periodo comprendido entre el año 2009 y 2013. La tuberculosis extrapulmonar representó el 41% de todos los casos de tuberculosis diagnosticados en los 5 años. Se es...

  20. High-order Div- and Quasi Curl-Conforming Basis Functions for Calderón Multiplicative Preconditioning of the EFIE

    KAUST Repository

    Valdes, Felipe

    2011-04-01

    A new high-order Calderón multiplicative preconditioner (HO-CMP) for the electric field integral equation (EFIE) is presented. In contrast to previous CMPs, the proposed preconditioner allows for high-order surface representations and current expansions by using a novel set of high-order quasi curl-conforming basis functions. Like its predecessors, the HO-CMP can be seamlessly integrated into existing EFIE codes. Numerical results demonstrate that the linear systems of equations obtained using the proposed HO-CMP converge rapidly, regardless of the mesh density and of the order of the current expansion. © 2006 IEEE.

  1. ATLAS Assembly Hall Open Day

    CERN Multimedia

    Patrice Loiez

    2004-01-01

    To mark the 50th Anniversary of the founding of CERN, a day of tours, displays and presentations was held in October 2004. The assembly halls for the experiments that were waiting to be installed on the LHC, such as ATLAS shown here, were transformed into display areas and cafés.

  2. Reactor Physics

    Energy Technology Data Exchange (ETDEWEB)

    Ait Abderrahim, A

    2001-04-01

    The Reactor Physics and MYRRHA Department of SCK-CEN offers expertise in various areas of reactor physics, in particular in neutronics calculations, reactor dosimetry, reactor operation, reactor safety and control and non-destructive analysis of reactor fuel. This expertise is applied in the Department's own research projects in the VENUS critical facility, in the BR1 reactor and in the MYRRHA project (this project aims at designing a prototype Accelerator Driven System). Available expertise is also used in programmes external to the Department such as the reactor pressure steel vessel programme, the BR2 reactor dosimetry, and the preparation and interpretation of irradiation experiments by means of neutron and gamma calculations. The activities of the Fuzzy Logic and Intelligent Technologies in Nuclear Science programme cover several domains outside the department. Progress and achievements in these topical areas in 2000 are summarised.

  3. 17 CFR 270.8b-3 - Title of securities.

    Science.gov (United States)

    2010-04-01

    ... funded debt, the rate of interest; the date of maturity, or if the issue matures serially, a brief... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Title of securities. 270.8b-3 Section 270.8b-3 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES...

  4. Reactor safeguards

    CERN Document Server

    Russell, Charles R

    1962-01-01

    Reactor Safeguards provides information for all who are interested in the subject of reactor safeguards. Much of the material is descriptive although some sections are written for the engineer or physicist directly concerned with hazards analysis or site selection problems. The book opens with an introductory chapter on radiation hazards, the construction of nuclear reactors, safety issues, and the operation of nuclear reactors. This is followed by separate chapters that discuss radioactive materials, reactor kinetics, control and safety systems, containment, safety features for water reactor

  5. Reactor operation

    CERN Document Server

    Shaw, J

    2013-01-01

    Reactor Operation covers the theoretical aspects and design information of nuclear reactors. This book is composed of nine chapters that also consider their control, calibration, and experimentation.The opening chapters present the general problems of reactor operation and the principles of reactor control and operation. The succeeding chapters deal with the instrumentation, start-up, pre-commissioning, and physical experiments of nuclear reactors. The remaining chapters are devoted to the control rod calibrations and temperature coefficient measurements in the reactor. These chapters also exp

  6. Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Martens, Frederick H. [Argonne National Laboratory; Jacobson, Norman H.

    1968-09-01

    This booklet discusses research reactors - reactors designed to provide a source of neutrons and/or gamma radiation for research, or to aid in the investigation of the effects of radiation on any type of material.

  7. Rare bile duct anomaly: B3 duct draining to gallbladder

    Directory of Open Access Journals (Sweden)

    Seung Eun Lee

    2016-01-01

    Full Text Available A 10-year-old girl presented with recurrent right upper abdominal pain and dyspepsia. Magnetic resonance cholangiopancreatography revealed a dilated common channel of intrahepatic bile duct of segment 3 (B3 and segment 4 (B4 drained into the gallbladder directly. The patient underwent laparoscopic cholecystectomy and Roux-en Y hepaticojejunostomy (B3-jejunostomy. Among the anatomical variability of the biliary system, the cholecystohepatic ducts are controversial in existence and incidence. We report a very rare variant of a cholecystohepatic duct in which the B3 duct drained into gallbladder directly and to the best of our knowledge this is the first report.

  8. City Hall and Territorial Development

    Directory of Open Access Journals (Sweden)

    Carlos Borrás Querol

    1999-10-01

    Full Text Available The current economic conditions impose a new role upon the local administration, a new one added to its traditional role as administrators of public services and managers of the local territory. City Halls are increasingly widening their action area to include spheres of interest that were previously not dealt with: fundamentally – jobs promotion and encouraging economic development. With respect to this, the article describes the important experience of the City Hall of Alcalá la Real (Jaén, whose trajectory of enacting strategies for local development are alternatives to the model of speculative development, strategies whose objective is to direct the potential for local community development by matching the interests of the citizens and the system of productivity in a balanced and sustainable manner, thereby contributing not only to the creation of new businesses and favoring the creation of jobs, but the advancement of territorial balance and social cohesion.

  9. Hall Sensors for Extreme Temperatures

    Directory of Open Access Journals (Sweden)

    Maciej Oszwaldowski

    2011-01-01

    Full Text Available We report on the preparation of the first complete extreme temperature Hall sensor. This means that the extreme-temperature magnetic sensitive semiconductor structure is built-in an extreme-temperature package especially designed for that purpose. The working temperature range of the sensor extends from −270 °C to +300 °C. The extreme-temperature Hall-sensor active element is a heavily n-doped InSb layer epitaxially grown on GaAs. The magnetic sensitivity of the sensor is ca. 100 mV/T and its temperature coefficient is less than 0.04 %/K. This sensor may find applications in the car, aircraft, spacecraft, military and oil and gas industries.

  10. Symmetric functions and Hall polynomials

    CERN Document Server

    MacDonald, Ian Grant

    1998-01-01

    This reissued classic text is the acclaimed second edition of Professor Ian Macdonald's groundbreaking monograph on symmetric functions and Hall polynomials. The first edition was published in 1979, before being significantly expanded into the present edition in 1995. This text is widely regarded as the best source of information on Hall polynomials and what have come to be known as Macdonald polynomials, central to a number of key developments in mathematics and mathematical physics in the 21st century Macdonald polynomials gave rise to the subject of double affine Hecke algebras (or Cherednik algebras) important in representation theory. String theorists use Macdonald polynomials to attack the so-called AGT conjectures. Macdonald polynomials have been recently used to construct knot invariants. They are also a central tool for a theory of integrable stochastic models that have found a number of applications in probability, such as random matrices, directed polymers in random media, driven lattice gases, and...

  11. Photovoltaic Hall effect in graphene

    Science.gov (United States)

    Oka, Takashi; Aoki, Hideo

    2009-02-01

    Response of electronic systems in intense lights (ac electric fields) to dc source-drain fields is formulated with the Floquet method. We have then applied the formalism to graphene, for which we show that a nonlinear effect of a circularly polarized light can open a gap in the Dirac cone, which is predicted to lead to a photoinduced dc Hall current. This is numerically confirmed for a graphene ribbon attached to electrodes with the Keldysh Green’s function.

  12. Library rooms or Library halls

    OpenAIRE

    Alfredo Serrai

    2013-01-01

    Library Halls, understood as Renaissance and Baroque architectural creations, along with the furnishings and decorations, accomplish a cognitive task and serve to transmit knowledge. The design of these spaces based on the idea that they should reflect the merits and content of the collections housed within them, in order to prepare the mind of the reader to respect and admire the volumes. In accordance with this principle, in the fifteenth century library rooms had a basilican shape, with tw...

  13. La cisma de Enrique VIII: ambición y dignidad. Catalina de Aragón y Ana Bolena en el imaginario de Calderón y Shakespeare

    OpenAIRE

    Vallejo Mateo, María Luisa

    2015-01-01

    El artículo tiene como finalidad comparar el tratamiento que dan Calderón y Shakespeare a sus personajes femeninos principales en La cisma de Ingalaterra y Enrique VIII, en torno a los conceptos de dignidad y ambición, que marcan su manera de ser y est

  14. CONVECTION REACTOR

    Science.gov (United States)

    Hammond, R.P.; King, L.D.P.

    1960-03-22

    An homogeneous nuclear power reactor utilizing convection circulation of the liquid fuel is proposed. The reactor has an internal heat exchanger looated in the same pressure vessel as the critical assembly, thereby eliminating necessity for handling the hot liquid fuel outside the reactor pressure vessel during normal operation. The liquid fuel used in this reactor eliminates the necessity for extensive radiolytic gas rocombination apparatus, and the reactor is resiliently pressurized and, without any movable mechanical apparatus, automatically regulates itself to the condition of criticality during moderate variations in temperature snd pressure and shuts itself down as the pressure exceeds a predetermined safe operating value.

  15. Decommissioning of the Salaspils Research Reactor

    Directory of Open Access Journals (Sweden)

    Abramenkovs Andris

    2011-01-01

    Full Text Available In May 1995, the Latvian government decided to shut down the Salaspils Research Reactor and to dispense with nuclear energy in the future. The reactor has been out of operation since July 1998. A conceptual study on the decommissioning of the Salaspils Research Reactor was drawn up by Noell-KRC-Energie- und Umwelttechnik GmbH in 1998-1999. On October 26th, 1999, the Latvian government decided to start the direct dismantling to “green-field” in 2001. The upgrading of the decommissioning and dismantling plan was carried out from 2003-2004, resulting in a change of the primary goal of decommissioning. Collecting and conditioning of “historical” radioactive wastes from different storages outside and inside the reactor hall became the primary goal. All radioactive materials (more than 96 tons were conditioned for disposal in concrete containers at the radioactive wastes depository “Radons” at the Baldone site. Protective and radiation measurement equipment of the personnel was upgraded significantly. All non-radioactive equipment and materials outside the reactor buildings were released for clearance and dismantled for reuse or conventional disposal. Contaminated materials from the reactor hall were collected and removed for clearance measurements on a weekly basis.

  16. Spin Hall effect by surface roughness

    KAUST Repository

    Zhou, Lingjun

    2015-01-08

    The spin Hall and its inverse effects, driven by the spin orbit interaction, provide an interconversion mechanism between spin and charge currents. Since the spin Hall effect generates and manipulates spin current electrically, to achieve a large effect is becoming an important topic in both academia and industries. So far, materials with heavy elements carrying a strong spin orbit interaction, provide the only option. We propose here a new mechanism, using the surface roughness in ultrathin films, to enhance the spin Hall effect without heavy elements. Our analysis based on Cu and Al thin films suggests that surface roughness is capable of driving a spin Hall angle that is comparable to that in bulk Au. We also demonstrate that the spin Hall effect induced by surface roughness subscribes only to the side-jump contribution but not the skew scattering. The paradigm proposed in this paper provides the second, not if only, alternative to generate a sizable spin Hall effect.

  17. Observation of the Zero Hall Plateau in a Quantum Anomalous Hall Insulator

    Energy Technology Data Exchange (ETDEWEB)

    Feng, Yang; Feng, Xiao; Ou, Yunbo; Wang, Jing; Liu, Chang; Zhang, Liguo; Zhao, Dongyang; Jiang, Gaoyuan; Zhang, Shou-Cheng; He, Ke; Ma, Xucun; Xue, Qi-Kun; Wang, Yayu

    2015-09-16

    We report experimental investigations on the quantum phase transition between the two opposite Hall plateaus of a quantum anomalous Hall insulator. We observe a well-defined plateau with zero Hall conductivity over a range of magnetic field around coercivity when the magnetization reverses. The features of the zero Hall plateau are shown to be closely related to that of the quantum anomalous Hall effect, but its temperature evolution exhibits a significant difference from the network model for a conventional quantum Hall plateau transition. We propose that the chiral edge states residing at the magnetic domain boundaries, which are unique to a quantum anomalous Hall insulator, are responsible for the novel features of the zero Hall plateau.

  18. Anomalous Hall effect in polycrystalline Ni films

    KAUST Repository

    Guo, Zaibing

    2012-02-01

    We systematically studied the anomalous Hall effect in a series of polycrystalline Ni films with thickness ranging from 4 to 200 nm. It is found that both the longitudinal and anomalous Hall resistivity increased greatly as film thickness decreased. This enhancement should be related to the surface scattering. In the ultrathin films (46 nm thick), weak localization corrections to anomalous Hall conductivity were studied. The granular model, taking into account the dominated intergranular tunneling, has been employed to explain this phenomenon, which can explain the weak dependence of anomalous Hall resistivity on longitudinal resistivity as well. © 2011 Elsevier Ltd. All rights reserved.

  19. REACTOR COOLING

    Science.gov (United States)

    Quackenbush, C.F.

    1959-09-29

    A nuclear reactor with provisions for selectively cooling the fuel elements is described. The reactor has a plurality of tubes extending throughout. Cylindrical fuel elements are disposed within the tubes and the coolant flows through the tubes and around the fuel elements. The fuel elements within the central portion of the reactor are provided with roughened surfaces of material. The fuel elements in the end portions of the tubes within the reactor are provlded with low conduction jackets and the fuel elements in the region between the central portion and the end portions are provided with smooth surfaces of high heat conduction material.

  20. The concept of “just war” in El príncipe constante, by Calderón de la Barca

    OpenAIRE

    Worley, R. D. (Robert D.) Jr.

    2009-01-01

    “El príncipe constante” por Pedro Calderón de la Barca es una comedia basada en la historia de Portugal. Se sitúa en el marco histórico de la expansión inicial del imperio portugués. Después de la conquista de la Ceuta musulmana en 1415, dos príncipes, Enrique y su hermano menor Fernando, llevan a cabo en 1437 un ataque a la ciudad marroquí de Tánger. La obra se centra en la cautividad de Fernando, resultado de la derrota de los portugueses. A lo largo de la comedia, hay un contraste entre el...

  1. “Los dos amantes del cielo” de Calderón: fuentes y novedades en la leyenda de los santos Crisanto y Daría

    OpenAIRE

    Tobar Quintanar, M. J. (María José)

    2015-01-01

    El artículo establece la fuente probable de “Los dos amantes del cielo” de Calderón, una comedia de santos que dramatiza la leyenda de los mártires Crisanto y Daría. El estudio de su tradición hagiográfica determina la dependencia textual de la pieza dramática respecto a los santorales castellanos áureos que derivan del “De probatis sanctorum historiis” de Lorenzo Surio: el “Flos sanctorum” de Alonso de Villegas, el de Pedro de Ribadeneyra, y la “Segunda parte de la hagiografía y vidas de los...

  2. Library rooms or Library halls

    Directory of Open Access Journals (Sweden)

    Alfredo Serrai

    2013-12-01

    Full Text Available Library Halls, understood as Renaissance and Baroque architectural creations, along with the furnishings and decorations, accomplish a cognitive task and serve to transmit knowledge. The design of these spaces based on the idea that they should reflect the merits and content of the collections housed within them, in order to prepare the mind of the reader to respect and admire the volumes. In accordance with this principle, in the fifteenth century library rooms had a basilican shape, with two or three naves, like churches, reflecting thus the spiritual value of the books contained there. Next to that inspiring function, library rooms had also the task of representing the entire logical and conceptual universe of human knowledge in a figurative way, including for this purpose also the and Kunst- und Wunderkammern, namely the collections of natural, artficial objects, and works of art. The importance of library rooms and their function was understood already in the early decades of the seventeenth century, as underlined in the treatise, Musei sive Bibliothecae tam privatae quam publicae Extructio, Instructio, Cura, Usus, written by the Jesuit Claude Clément and published in 1635. Almost the entire volume is dedicated to the decoration and ornamentation of the Saloni, and the function of the library is identified exclusively with the preservation and decoration of the collection, neglecting more specifically bibliographic aspects or those connected to library science. The architectural structure of the Saloni was destined to change in relation to two factors, namely the form of books, and the sources of light. As a consequence, from the end of the sixteenth century – or perhaps even before if one considers the fragments of the Library of Urbino belonging to Federico da Montefeltro – shelves and cabinets have been placed no longer in the center of the room, but were set against the walls. This new disposition of the furniture, surmounted by

  3. The Duesseldorf fairground. New building of hall 6; Messe Duesseldorf. Neubau der Halle 6

    Energy Technology Data Exchange (ETDEWEB)

    Gampfer, W.; Wendt, W.; Paar, A.; Schwarz, A.; Klemp, P.; Ambaum, P.; Joppen, H.; Hesse, D.; Hauser, K. [Messe Duesseldorf GmbH (Germany)

    2001-07-01

    The Duesseldorf fairground is highly successful and is constantly growing. With the inauguration of the new Hall 6 in May 2000, the former twelve halls have now become 17. The new Hall 6 will also be used for sports events, concerts, meetings etc. [German] Der Erfolg der Messe Duesseldorf laesst sich am stetigen Wachstum der Ausstellungsbereiche ablesen. So wurden aus den ehemals zwoelf Hallen bis heute mit der Einweihung der Neuen Halle 6 im Mai 2000 17 Hallen. Die zuletzt hinzugekommene Halle 6 wird neben der ueberwiegenden Nutzung als Messehalle auch als tagesbelichtete Mehrzweckhalle fuer Veranstaltungen, wie z.B. Sportveranstaltungen, Grosskonzerte, Versammlungen etc., genutzt. (orig.)

  4. Effects of hypervitaminosis of vitamin B3 on silkworm biology

    Indian Academy of Sciences (India)

    Unknown

    A high-dose of vitamin B3 in silkworm diet interrupts larval feeding and normal growth. High mortality of lar- vae occurs during molting and they cannot complete this process normally. Also the larvae exhibit nicotinamide hypervitaminosis symptoms such as immobility, dyspepsia, darkening of the skin, inability to excrete ...

  5. Effects of hypervitaminosis of vitamin B3 on silkworm biology

    Indian Academy of Sciences (India)

    A high-dose of vitamin B3 in silkworm diet interrupts larval feeding and normal growth. High mortality of larvae occurs during molting and they cannot complete this process normally. Also the larvae exhibit nicotinamide hypervitaminosis symptoms such as immobility, dyspepsia, darkening of the skin, inability to excrete ...

  6. 26 CFR 1.652(b)-3 - Allocation of deductions.

    Science.gov (United States)

    2010-04-01

    ....652(b)-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX.... Items of deduction of a trust that enter into the computation of distributable net income are to be...) included in computing distributable net income, but a portion must be allocated to nontaxable income...

  7. Mesoscopic effects in the quantum Hall regime

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 58; Issue 2 ... Mesoscopic effects; quantum Hall transitions; finite-size scaling. ... When band mixing between multiple Landau levels is present, mesoscopic effects cause a crossover from a sequence of quantum Hall transitions for weak disorder to classical behavior ...

  8. Kelvin's Canonical Circulation Theorem in Hall Magnetohydrodynamics

    CERN Document Server

    Shivamoggi, B K

    2016-01-01

    The purpose of this paper is to show that, thanks to the restoration of the legitimate connection between the current density and the plasma flow velocity in Hall magnetohydrodynamics (MHD), Kelvin's Circulation Theorem becomes valid in Hall MHD. The ion-flow velocity in the usual circulation integral is now replaced by the canonical ion-flow velocity.

  9. Mesoscopic effects in the quantum Hall regime

    Indian Academy of Sciences (India)

    may be of relevance to experimentally observed transitions between quantum Hall states and the insulating phase ... In this paper, we discuss the mesoscopic effects in the quantum Hall regime, in particu- lar the effects of ...... finite sizes, due to the presence of long length scales, quantum interference effects can be cut-off at ...

  10. Novel optical probe for quantum Hall system

    Indian Academy of Sciences (India)

    Surface photovoltage spectroscopy; quantum Hall effect; Landau levels; edge states. Abstract. Surface photovoltage (SPV) spectroscopy has been used for the first time to explore Landau levels of a two-dimensional electron gas (2DEG) in modulation doped InP/InGaAs/InP QW in the quantum Hall regime. The technique ...

  11. Hall devices improve electric motor efficiency

    Science.gov (United States)

    Haeussermann, W.

    1979-01-01

    Efficiency of electric motors and generators is reduced by radial magnetic forces created by symmetric fields within device. Forces are sensed and counteracted by Hall devices on excitation or control windings. Hall generators directly measure and provide compensating control of anu asymmetry, eliminating additional measurements needed for calibration feedback control loop.

  12. Multifunctional reactors

    NARCIS (Netherlands)

    Westerterp, K.R.

    1992-01-01

    Multifunctional reactors are single pieces of equipment in which, besides the reaction, other functions are carried out simultaneously. The other functions can be a heat, mass or momentum transfer operation and even another reaction. Multifunctional reactors are not new, but they have received much

  13. The quantum Hall impedance standard

    Science.gov (United States)

    Schurr, J.; Kučera, J.; Pierz, K.; Kibble, B. P.

    2011-02-01

    Alternating current measurements of double-shielded quantum Hall devices have revealed a fascinating property of which only a quantum effect is capable: it can detect its own frequency dependence and convert it to a current dependence which can be used to eliminate both of them. According to an experimentally verified model, the residual frequency dependence is smaller than the measuring uncertainty of 1.3 × 10-9 kHz-1. In this way, a highly precise quantum standard of impedance can be established, without having to correct for any calculated frequency dependence and without the need for any artefact with a calculated frequency dependence. Nothing else like that is known to us and we hope that our results encourage other national metrology institutes to also apply it to impedance metrology and further explore its beautiful properties.

  14. Potassium zinc borate, KZnB(3)O(6).

    Science.gov (United States)

    Wu, Yang; Yao, Ji-Yong; Zhang, Jian-Xiu; Fu, Pei-Zhen; Wu, Yi-Cheng

    2010-04-30

    The title compound, KZnB(3)O(6) contains a remarkable [B(6)O(12)](6-) group ( symmetry) formed by two rings linked by edge-sharing BO(4) tetra-hedra, a feature that has only been observed previously under high pressure conditions. These borate groups are connected through distorted ZnO(4) tetra-hedra in edge-shared pairs ( symmetry), forming a three-dimensional network whose cavities are filled by K(+) cations.

  15. Potassium zinc borate, KZnB3O6

    OpenAIRE

    Yang Wu; Ji-Yong Yao; Jian-Xiu Zhang; Pei-Zhen Fu; Yi-Cheng Wu

    2010-01-01

    The title compound, KZnB3O6 contains a remarkable [B6O12]6− group (overline{1} symmetry) formed by two rings linked by edge-sharing BO4 tetrahedra, a feature that has only been observed previously under high pressure conditions. These borate groups are connected through distorted ZnO4 tetrahedra in edge-shared pairs (overline{1} symmetry), forming a three-dimensional network whose cavities are filled by K+ cations.

  16. Potassium zinc borate, KZnB3O6

    Directory of Open Access Journals (Sweden)

    Yang Wu

    2010-05-01

    Full Text Available The title compound, KZnB3O6 contains a remarkable [B6O12]6− group (overline{1} symmetry formed by two rings linked by edge-sharing BO4 tetrahedra, a feature that has only been observed previously under high pressure conditions. These borate groups are connected through distorted ZnO4 tetrahedra in edge-shared pairs (overline{1} symmetry, forming a three-dimensional network whose cavities are filled by K+ cations.

  17. Espectáculo y construcción espacial en los autos de Pedro Calderón de la Barca: «La cena del rey Baltasar»

    Directory of Open Access Journals (Sweden)

    Antonio Sánchez Jiménez

    2013-11-01

    Full Text Available Este artículo analiza la construcción espectacular y espacial de un auto temprano de Calderón de la Barca, «La cena del rey Baltasar». Para ello, examina cómo funcionaban en este auto los elementos escénicos (carros, tramoya y atrezzo, así como la música, el vestuario y los espacios escénico y dramático. This article analyzes the spectacular and spacial construction of an early auto sacramental by Calderón de la Barca, «La cena del rey Baltasar». In order to do so, we examine the meaning of the different scenic elements (carros, theatrical machinery, and atrezzo, as well as the music, clothing, and scenic and dramatic spaces.

  18. Leiomioma esofágico: Experiencia con diez casos operados en el "Hospital Dr. Rafael Ángel Calderón Guardia" Esophageal leiomyoma: Experience with nine surgical patients

    OpenAIRE

    Giovanna Mainieri-Breedy; José-Alberto Mainieri-Hidalgo

    2012-01-01

    Objetivo: informar la experiencia adquirida con la cirugía para leiomiomas esofágicos en el Servicio de Cirugía de Tórax del Hospital Dr. R. A. Calderón Guardia. Métodos: durante el período de 12 años comprendido entre 1999 y 2011, fueron referidos 14 pacientes con tumores submucosos del esófago al Servicio de Cirugía de Tórax del Hospital Calderón Guardia. En cuatro pacientes asintomáticos con tumores pequeños se decidió observar, y diez fueron operados, confirmándose el diagnóstico histológ...

  19. A new course or simply discourse? : The security discourse strategies of Felipe Calderón Hinojosa and Enrique Peña Nieto in the Mexican war on drugs

    OpenAIRE

    Ölfvingsson, Petter

    2017-01-01

    Since the beginning of the Mexican war on drugs in late 2006, violence has increased dramatically. By examining six presidential speeches from different years and with an analysis grounded in the work of Norman Fairclough and his Critical Discourse Analysis (CDA), this thesis analyses the security discourse strategies used by the two Mexican Presidents Felipe Calderón Hinojosa and Enrique Peña Nieto. By studying the parts where they talk about insecurity and organized crime, the study aims to...

  20. NUCLEAR REACTOR

    Science.gov (United States)

    Miller, H.I.; Smith, R.C.

    1958-01-21

    This patent relates to nuclear reactors of the type which use a liquid fuel, such as a solution of uranyl sulfate in ordinary water which acts as the moderator. The reactor is comprised of a spherical vessel having a diameter of about 12 inches substantially surrounded by a reflector of beryllium oxide. Conventionnl control rods and safety rods are operated in slots in the reflector outside the vessel to control the operation of the reactor. An additional means for increasing the safety factor of the reactor by raising the ratio of delayed neutrons to prompt neutrons, is provided and consists of a soluble sulfate salt of beryllium dissolved in the liquid fuel in the proper proportion to obtain the result desired.

  1. The quantum Hall effects: Philosophical approach

    Science.gov (United States)

    Lederer, P.

    2015-05-01

    The Quantum Hall Effects offer a rich variety of theoretical and experimental advances. They provide interesting insights on such topics as gauge invariance, strong interactions in Condensed Matter physics, emergence of new paradigms. This paper focuses on some related philosophical questions. Various brands of positivism or agnosticism are confronted with the physics of the Quantum Hall Effects. Hacking's views on Scientific Realism, Chalmers' on Non-Figurative Realism are discussed. It is argued that the difficulties with those versions of realism may be resolved within a dialectical materialist approach. The latter is argued to provide a rational approach to the phenomena, theory and ontology of the Quantum Hall Effects.

  2. NUCLEAR REACTOR

    Science.gov (United States)

    Grebe, J.J.

    1959-07-14

    High temperature reactors which are uniquely adapted to serve as the heat source for nuclear pcwered rockets are described. The reactor is comprised essentially of an outer tubular heat resistant casing which provides the main coolant passageway to and away from the reactor core within the casing and in which the working fluid is preferably hydrogen or helium gas which is permitted to vaporize from a liquid storage tank. The reactor core has a generally spherical shape formed entirely of an active material comprised of fissile material and a moderator material which serves as a diluent. The active material is fabricated as a gas permeable porous material and is interlaced in a random manner with very small inter-connecting bores or capillary tubes through which the coolant gas may flow. The entire reactor is divided into successive sections along the direction of the temperature gradient or coolant flow, each section utilizing materials of construction which are most advantageous from a nuclear standpoint and which at the same time can withstand the operating temperature of that particular zone. This design results in a nuclear reactor characterized simultaneously by a minimum critiral size and mass and by the ability to heat a working fluid to an extremely high temperature.

  3. Bound values for Hall conductivity of heterogeneous medium under ...

    Indian Academy of Sciences (India)

    Bound values for Hall conductivity under quantum Hall effect (QHE) conditions in inhomogeneous medium has been studied. It is shown that bound values for Hall conductivity differ from bound values for metallic conductivity. This is due to the unusual character of current percolation under quantum Hall effect conditions.

  4. Iodine Hall Thruster for Space Exploration Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Busek Co. Inc. proposes to develop a high power (high thrust) electric propulsion system featuring an iodine fueled Hall Effect Thruster (HET). The system to be...

  5. Iodine Hall Thruster for Space Exploration Project

    Data.gov (United States)

    National Aeronautics and Space Administration — In the Phase I program, Busek Co. Inc. tested an existing Hall thruster, the BHT-8000, on iodine propellant. The thruster was fed by a high flow iodine feed system,...

  6. AA under construction in its hall

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The Antiproton Accumulator was installed in a specially built hall. Here we see it at an "early" stage of installation, just a few magnets on the floor, no vacuum chamber at all, but: 3 months later there was circulating beam !

  7. Success of Hall technique crowns questioned.

    Science.gov (United States)

    Nainar, S M Hashim

    2012-01-01

    Hall technique is a method of providing stainless steel crowns for primary molars without tooth preparation and requires no local anesthesia. Literature review showed inconclusive evidence and therefore this technique should not be used in clinical practice.

  8. Dual Mode Low Power Hall Thruster Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Sample and return missions desire and missions like Saturn Observer require a low power Hall thruster that can operate at high thrust to power as well as high...

  9. Light Metal Propellant Hall Thruster Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Busek proposes to develop light metal Hall Effect thrusters that will help reduce the travel time, mass, and cost of SMD spacecraft. Busek has identified three...

  10. Two LHC dipole magnets in assembly hall

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    The final LHC components are completed in the assembly hall, prior to installation in the tunnel. These pictures show two 15-m long LHC cryogenic magnets, both before and after insertion into their blue vacuum vessel.

  11. Giant thermal Hall effect in multiferroics

    Science.gov (United States)

    Ideue, T.; Kurumaji, T.; Ishiwata, S.; Tokura, Y.

    2017-08-01

    Multiferroics, in which dielectric and magnetic orders coexist and couple with each other, attract renewed interest for their cross-correlated phenomena, offering a fundamental platform for novel functionalities. Elementary excitations in such systems are strongly affected by the lattice-spin interaction, as exemplified by the electromagnons and the magneto-thermal transport. Here we report an unprecedented coupling between magnetism and phonons in multiferroics, namely, the giant thermal Hall effect. The thermal transport of insulating polar magnets (ZnxFe1-x)2Mo3O8 is dominated by phonons, yet extremely sensitive to the magnetic structure. In particular, large thermal Hall conductivities are observed in the ferrimagnetic phase, indicating unconventional lattice-spin interactions and a new mechanism for the Hall effect in insulators. Our results show that the thermal Hall effect in multiferroic materials can be an effective probe for strong lattice-spin interactions and provide a new tool for magnetic control of thermal currents.

  12. La sublevación de Cataluña de 1640 en Los agravios satisfechos, apócrifo de Calderón de la Barca

    Directory of Open Access Journals (Sweden)

    Deias, Antonia

    2016-06-01

    Full Text Available This essay analyses Los agravios satisfechos y vísperas sicilianas, an apocryphal comedy by Calderón de la Barca, whose subject is the anti-French rebellion that took place at Palermo in 1282. The comparison between the literary text and some historical studies has allowed the identification of possible sources used by the author. On the other hand, the manipulation of History, in addition to the anachronisms related to some events of the third and fourth decade of the XVII century (France’s declaration of war on Spain in 1635, 1640 Catalan revolt and the Pact of Ceret, 1641 conspiracy in Andalusia, led us to establish the date of the Golden Age comedy and to identify the goals pursued by the playwright: to turn the Sicilian Vespers into a foundation myth of the Monarchy in Spain, using them as an anti-French symbol and, at the same time, to criticize the «restoring reformism» that the Count-Duke Olivares undertook.El trabajo analiza Los agravios satisfechos y vísperas cicilianas, comedia apócrifa de Calderón que trata del levantamiento antifrancés acontecido en Palermo en 1282. El cotejo del texto con algunas obras historiográficas ha permitido identificar las posibles fuentes utilizadas por el autor. Por otro lado, la manipulación de los hechos históricos, junto con los anacronismos que remiten a acontecimientos de los años treinta y cuarenta del siglo XVII (la declaración de guerra de Francia a España de 1635, la rebelión de Cataluña y el Pacto de Ceret de 1640, la conspiración de 1641 para levantar a Andalucía, han permitido establecer la datación de la obra e identificar los objetivos perseguidos por el autor: hacer de las Vísperas sicilianas un mito fundador de la monarquía española, utilizándolas en clave anti-francesa y, al mismo tiempo, criticar el «reformismo restaurador» del conde-duque de Olivares.

  13. NAS Decadal Review Town Hall

    Science.gov (United States)

    The National Academies of Sciences, Engineering and Medicine is seeking community input for a study on the future of materials research (MR). Frontiers of Materials Research: A Decadal Survey will look at defining the frontiers of materials research ranging from traditional materials science and engineering to condensed matter physics. Please join members of the study committee for a town hall to discuss future directions for materials research in the United States in the context of worldwide efforts. In particular, input on the following topics will be of great value: progress, achievements, and principal changes in the R&D landscape over the past decade; identification of key MR areas that have major scientific gaps or offer promising investment opportunities from 2020-2030; and the challenges that MR may face over the next decade and how those challenges might be addressed. This study was requested by the Department of Energy and the National Science Foundation. The National Academies will issue a report in 2018 that will offer guidance to federal agencies that support materials research, science policymakers, and researchers in materials research and other adjoining fields. Learn more about the study at http://nas.edu/materials.

  14. The fluctuation Hall conductivity and the Hall angle in type-II superconductor under magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Tinh, Bui Duc, E-mail: tinhbd@hnue.edu.vn [Institute of Research and Development, Duy Tan University, K7/25 Quang Trung, Danang (Viet Nam); Department of Physics, Hanoi National University of Education, 136 Xuan Thuy, Cau Giay, Hanoi (Viet Nam); Hoc, Nguyen Quang; Thu, Le Minh [Department of Physics, Hanoi National University of Education, 136 Xuan Thuy, Cau Giay, Hanoi (Viet Nam)

    2016-02-15

    Highlights: • The time-dependent Ginzburg–Landau was used to calculate fluctuation Hall conductivity and Hall angle in type-II superconductor in 2D and 3D. • We obtain analytical expressions for the fluctuation Hall conductivity and the Hall angle summing all Landau levels without need to cutoff higher Landau levels to treat arbitrary magnetic field. • The results were compared to the experimental data on YBCO. - Abstract: The fluctuation Hall conductivity and the Hall angle, describing the Hall effect, are calculated for arbitrary value of the imaginary part of the relaxation time in the frame of the time-dependent Ginzburg–Landau theory in type II-superconductor with thermal noise describing strong thermal fluctuations. The self-consistent Gaussian approximation is used to treat the nonlinear interaction term in dynamics. We obtain analytical expressions for the fluctuation Hall conductivity and the Hall angle summing all Landau levels without need to cutoff higher Landau levels to treat arbitrary magnetic field. The results are compared with experimental data on high-T{sub c} superconductor.

  15. Whole genome and transcriptome sequencing of a B3 thymoma.

    Directory of Open Access Journals (Sweden)

    Iacopo Petrini

    Full Text Available Molecular pathology of thymomas is poorly understood. Genomic aberrations are frequently identified in tumors but no extensive sequencing has been reported in thymomas. Here we present the first comprehensive view of a B3 thymoma at whole genome and transcriptome levels. A 55-year-old Caucasian female underwent complete resection of a stage IVA B3 thymoma. RNA and DNA were extracted from a snap frozen tumor sample with a fraction of cancer cells over 80%. We performed array comparative genomic hybridization using Agilent platform, transcriptome sequencing using HiSeq 2000 (Illumina and whole genome sequencing using Complete Genomics Inc platform. Whole genome sequencing determined, in tumor and normal, the sequence of both alleles in more than 95% of the reference genome (NCBI Build 37. Copy number (CN aberrations were comparable with those previously described for B3 thymomas, with CN gain of chromosome 1q, 5, 7 and X and CN loss of 3p, 6, 11q42.2-qter and q13. One translocation t(11;X was identified by whole genome sequencing and confirmed by PCR and Sanger sequencing. Ten single nucleotide variations (SNVs and 2 insertion/deletions (INDELs were identified; these mutations resulted in non-synonymous amino acid changes or affected splicing sites. The lack of common cancer-associated mutations in this patient suggests that thymomas may evolve through mechanisms distinctive from other tumor types, and supports the rationale for additional high-throughput sequencing screens to better understand the somatic genetic architecture of thymoma.

  16. Classical and quantum electrodynamics and the B(3) field

    CERN Document Server

    Evans, Myron W

    2001-01-01

    It is well known that classical electrodynamics is riddled with internal inconsistencies springing from the fact that it is a linear, Abelian theory in which the potentials are unphysical. This volume offers a self-consistent hypothesis which removes some of these problems, as well as builds a framework on which linear and nonlinear optics are treated as a non-Abelian gauge field theory based on the emergence of the fundamental magnetizing field of radiation, the B(3) field. Contents: Interaction of Electromagnetic Radiation with One Fermion; The Field Equations of Classical O (3) b Electrodyn

  17. Generic Superweak Chaos Induced by Hall Effect

    OpenAIRE

    Ben-Harush, Moti; Dana, Itzhack

    2016-01-01

    We introduce and study the "kicked Hall system" (KHS), i.e., charged particles periodically kicked in the presence of uniform magnetic ($\\mathbf{B}$) and electric ($\\mathbf{E}$) fields that are perpendicular to each other and to the kicking direction. We show that for resonant values of $B$ and $E$ and in the weak-chaos regime of sufficiently small nonintegrability parameter $\\kappa$ (the kicking strength), there exists a \\emph{generic} family of periodic kicking potentials for which the Hall...

  18. Turbulence Measurements in a Tropical Zoo Hall

    Science.gov (United States)

    Eugster, Werner; Denzler, Basil; Bogdal, Christian

    2017-04-01

    The Masoala rainforest hall of the Zurich Zoo, Switzerland, covers a ground surface area of 10,856 m2 and reaches 30 m in height. With its transparent ETFE foiled roof it provides a tropical climate for a large diversity of plants and animals. In combination with an effort to estimate dry deposition of elemental mercury, we made an attempt to measure turbulent transfer velocity with an ultrasonic anemometer inside the hall. Not surprising, the largest turbulence elements were on the order of the hall dimension. Although the dimensions of the hall seem to be small (200,000 m3) for eddy covariance flux measurements and the air circulation inside the hall was extremely weak, the spectra of wind velocity components and virtual (sonic) temperature obeyed the general statistical description expected under unconstrained outdoor measurement conditions. We will present results from a two-week measurement campaign in the Masoala rainforest hall and make a suggestion for the deposition velocity to be used to estimate dry deposition of atmospheric components to the tropical vegetation surface.

  19. Data of evolutionary structure change: 1B3JA-1TVBD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B3JA-1TVBD 1B3J 1TVB A D EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQ----KCRAKPQ---GQW...LAMNVR------NFLKEDAMADCLQELRRYLKSGVVL-RRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGT...WIEQEGPEYW------DGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTA-ADMAAQTT... 1TVB D 1TVBD 1B3JA SGVVL-RRTVP -

  20. Data of evolutionary structure change: 1B3JA-1TVHA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B3JA-1TVHA 1B3J 1TVH A A EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQ----KCRAKPQ---GQW...LAMNVR------NFLKEDAMADCLQELRRYLKSGVVL-RRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGT...WIEQEGPEYW------DGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAAD-MAAQTT... 1TVH A 1TVHA 1B3JA SGVVL-RRTVP -

  1. Reactor Neutrinos

    CERN Document Server

    Lasserre, T; Lasserre, Thierry; Sobel, Henry W.

    2005-01-01

    We review the status and the results of reactor neutrino experiments, that toe the cutting edge of neutrino research. Short baseline experiments have provided the measurement of the reactor neutrino spectrum, and are still searching for important phenomena such as the neutrino magnetic moment. They could open the door to the measurement of coherent neutrino scattering in a near future. Middle and long baseline oscillation experiments at Chooz and KamLAND have played a relevant role in neutrino oscillation physics in the last years. It is now widely accepted that a new middle baseline disappearance reactor neutrino experiment with multiple detectors could provide a clean measurement of the last undetermined neutrino mixing angle theta13. We conclude by opening on possible use of neutrinos for Society: NonProliferation of Nuclear materials and Geophysics.

  2. NEUTRONIC REACTORS

    Science.gov (United States)

    Wigner, E.P.; Young, G.J.

    1958-10-14

    A method is presented for loading and unloading rod type fuel elements of a neutronic reactor of the heterogeneous, solld moderator, liquid cooled type. In the embodiment illustrated, the fuel rods are disposed in vertical coolant channels in the reactor core. The fuel rods are loaded and unloaded through the upper openings of the channels which are immersed in the coolant liquid, such as water. Unloading is accomplished by means of a coffer dam assembly having an outer sleeve which is placed in sealing relation around the upper opening. A radiation shield sleeve is disposed in and reciprocable through the coffer dam sleeve. A fuel rod engaging member operates through the axial bore in the radiation shield sleeve to withdraw the fuel rod from its position in the reactor coolant channel into the shield, the shield snd rod then being removed. Loading is accomplished in the reverse procedure.

  3. Radiative decay of HeLi+(b3∑+)

    Science.gov (United States)

    Zámečníková, Martina; Soldán, Pavel

    2018-01-01

    Radiative lifetimes of the ro-vibrational bound states of HeLi+ (b3∑+) are calculated quantum-mechanically when both bound-bound and bound-free processes are taken into account. The calculations are restricted to the initial states with low rotational quantum numbers. For the rotationless molecular ion, the shortest lifetime is 1.30 ×10-6 s of the ground vibrational state. With increasing vibration excitations the radiative lifetimes slightly increase, but keep below 10-5 s for the next 17 vibrational states, then they start to increase more rapidly up to 2.41 ×10-2 s for the highest vibrational state. The radiative lifetimes also tend to slightly prolong with increasing rotational excitations but stay on the same magnitude for the low rotational quantum numbers.

  4. Neutronic reactor

    Science.gov (United States)

    Wende, Charles W. J.; Babcock, Dale F.; Menegus, Robert L.

    1983-01-01

    A nuclear reactor includes an active portion with fissionable fuel and neutron moderating material surrounded by neutron reflecting material. A control element in the active portion includes a group of movable rods constructed of neutron-absorbing material. Each rod is movable with respect to the other rods to vary the absorption of neutrons and effect control over neutron flux.

  5. Neutronic reactor

    Energy Technology Data Exchange (ETDEWEB)

    Babcock, D.F.; Menegus, R.L.; Wende, C.W.

    1983-01-04

    A nuclear reactor includes an active portion with fissionable fuel and neutron moderating material surrounded by neutron reflecting material. A control element in the active portion includes a group of movable rods constructed of neutron-absorbing material. Each rod is movable with respect to the other rods to vary the absorption of neutrons and effect control over neutron flux.

  6. Tutorial: Physics and modeling of Hall thrusters

    Science.gov (United States)

    Boeuf, Jean-Pierre

    2017-01-01

    Hall thrusters are very efficient and competitive electric propulsion devices for satellites and are currently in use in a number of telecommunications and government spacecraft. Their power spans from 100 W to 20 kW, with thrust between a few mN and 1 N and specific impulse values between 1000 and 3000 s. The basic idea of Hall thrusters consists in generating a large local electric field in a plasma by using a transverse magnetic field to reduce the electron conductivity. This electric field can extract positive ions from the plasma and accelerate them to high velocity without extracting grids, providing the thrust. These principles are simple in appearance but the physics of Hall thrusters is very intricate and non-linear because of the complex electron transport across the magnetic field and its coupling with the electric field and the neutral atom density. This paper describes the basic physics of Hall thrusters and gives a (non-exhaustive) summary of the research efforts that have been devoted to the modelling and understanding of these devices in the last 20 years. Although the predictive capabilities of the models are still not sufficient for a full computer aided design of Hall thrusters, significant progress has been made in the qualitative and quantitative understanding of these devices.

  7. Air temperature gradient in large industrial hall

    Science.gov (United States)

    Karpuk, Michał; Pełech, Aleksander; Przydróżny, Edward; Walaszczyk, Juliusz; Szczęśniak, Sylwia

    2017-11-01

    In the rooms with dominant sensible heat load, volume airflow depends on many factors incl. pre-established temperature difference between exhaust and supply airflow. As the temperature difference is getting higher, airflow volume drops down, consequently, the cost of AHU is reduced. In high industrial halls with air exhaust grids located under the ceiling additional temperature gradient above working zone should be taken into consideration. In this regard, experimental research of the vertical air temperature gradient in high industrial halls were carried out for the case of mixing ventilation system The paper presents the results of air temperature distribution measurements in high technological hall (mechanically ventilated) under significant sensible heat load conditions. The supply airflow was delivered to the hall with the help of the swirl diffusers while exhaust grids were located under the hall ceiling. Basing on the air temperature distribution measurements performed on the seven pre-established levels, air temperature gradient in the area between 2.0 and 7.0 m above the floor was calculated and analysed.

  8. 16 CFR Appendix B3 to Part 305 - Chest Freezers and All Other Freezers

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Chest Freezers and All Other Freezers B3 Appendix B3 to Part 305 Commercial Practices FEDERAL TRADE COMMISSION REGULATIONS UNDER SPECIFIC ACTS OF...) Pt. 305, App. B3 Appendix B3 to Part 305—Chest Freezers and All Other Freezers Range Information...

  9. Acoustics in rock and pop music halls

    DEFF Research Database (Denmark)

    Adelman-Larsen, Niels Werner; Thompson, Eric Robert; Gade, Anders Christian

    2007-01-01

    The existing body of literature regarding the acoustic design of concert halls has focused almost exclusively on classical music, although there are many more performances of rhythmic music, including rock and pop. Objective measurements were made of the acoustics of twenty rock music venues...... in Denmark and a questionnaire was used in a subjective assessment of those venues with professional rock musicians and sound engineers. Correlations between the objective and subjective results lead, among others, to a recommendation for reverberation time as a function of hall volume. Since the bass...

  10. Prototype dining hall energy efficiency study

    Energy Technology Data Exchange (ETDEWEB)

    Mazzucchi, R.P.; Bailey, S.A.; Zimmerman, P.W.

    1988-06-01

    The energy consumption of food service facilities is among the highest of any commercial building type, owing to the special requirements for food preparation, sanitation, and ventilation. Consequently, the US Air Force Engineering and Services Center (AFESC) contracted with Pacific Northwest Laboratory (PNL) to collect and analyze end-use energy consumption data for a prototypical dining hall and make specific recommendations on cost-effective energy conservation options. This information will be used to establish or update criteria for dining hall designs and retrofits as appropriate. 6 refs., 21 figs., 23 tabs.

  11. EL CROWN HALL. CONTEXTO Y PROYECTO

    Directory of Open Access Journals (Sweden)

    Laura Lizondo Sevilla

    2010-05-01

    Full Text Available RESUMEN El artículo enmarca el edificio del Crown Hall en el contexto docente y arquitectónico de Mies van der Rohe. Revisa sus inicios en la Bauhaus con su primera intervención en un espacio docente para la Bauhaus de Berlín en 1932, así como su marcha a Estados Unidos, los planteamientos arquitectónicos del campus del IIT y el proyecto del Crown Hall. El texto incide en el estudio del proceso proyectual del Crown Hall analizando la evolución de su concepción arquitectónica a través de las diferentes versiones del proyecto. Se constata la transición desde los primeros planteamientos arquitectónicos de los edificios del campus del IIT proyectados por Mies hacia el planteamiento del gran espacio unitario del Crown Hall. Este proyecto se puede entender desde la creciente importancia de la estructura, la claridad constructiva y el manejo del acero y vidrio como únicos materiales de la imagen del edificio y el carácter flexible y unitario del espacio. Finalmente se hace referencia al concepto del "espacio universal" en la arquitectura de Mies, como un concepto abstracto que supera los de flexibilidad de uso o unidad espacial, insinuando, a modo de reflexión, las principales variables que definirían el espacio universal miesiano.SUMMARY The article showcases the Crown Hall building in the educational and architectural context of Mies van der Rohe. It reviews his beginnings in the Bauhaus with his first intervention in an educational space for the Bauhaus of Berlin in 1932, as well as his sojourn to the United States, and the architectural approaches to the IIT campus and the Crown Hall project. The text touches on the study of the planning process for the Crown Hall, analysing the evolution of its architectural conception, through the different versions of the project. The article covers the transition from the first architectural approaches for the IIT campus buildings, planned by Mies, to the approach of the large unitary space of

  12. 76 FR 44964 - Advisory Committee on Reactor Safeguards (ACRS); Meeting of the ACRS Subcommittee on U.S...

    Science.gov (United States)

    2011-07-27

    ... No: 2011-18952] NUCLEAR REGULATORY COMMISSION Advisory Committee on Reactor Safeguards (ACRS); Meeting of the ACRS Subcommittee on U.S. Evolutionary Power Reactor; Notice of Meeting The ACRS Subcommittee on U.S. Evolutionary Power Reactor (U.S. EPR) will hold a meeting on August 18, 2011, Room T-2B3...

  13. Air leakage analysis of research reactor HANARO building in typhoon condition for the nuclear emergency preparedness

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Goany Up; Lee, Hae Cho; Kim, Bong Seok; Kim, Jong Soo; Choi, Pyung Kyu [Dept. of Emergency Preparedness, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-12-15

    To find out the leak characteristic of research reactor 'HANARO' building in a typhoon condition MELCOR code which normally is used to simulate severe accident behavior in a nuclear power plant was used to simulate the leak rate of air and fission products from reactor hall after the shutdown of the ventilation system of HANARO reactor building. For the simulation, HANARO building was designed by MELCOR code and typhoon condition passed through Daejeon in 2012 was applied. It was found that the leak rate is 0.1%·day{sup -1} of air, 0.004%·day{sup -1} of noble gas and 3.7×10{sup -5}%·day{sup -1} of aerosol during typhoon passing. The air leak rate of 0.1%·day can be converted into 1.36 m{sup 3}·hr{sup -1} , but the design leak rate in HANARO safety analysis report was considered as 600 m3·hr{sup -1} under the condition of 20 m·sec{sup -1} wind speed outside of the building by typhoon. Most of fission products during the maximum hypothesis accident at HANARO reactor will be contained in the reactor hall, so the direct radiation by remained fission products in the reactor hall will be the most important factor in designing emergency preparedness for HANARO reactor.

  14. Quantized Anomalous Hall Effect in Magnetic Topological Insulators

    National Research Council Canada - National Science Library

    Rui Yu; Wei Zhang; Hai-Jun Zhang; Shou-Cheng Zhang; Xi Dai; Zhong Fang

    2010-01-01

    .... In a quantum anomalous Hall insulator, spontaneous magnetic moments and spin-orbit coupling combine to give rise to a topologically nontrivial electronic structure, leading to the quantized Hall...

  15. Bound values for Hall conductivity of heterogeneous medium under ...

    Indian Academy of Sciences (India)

    - ditions in inhomogeneous medium has been studied. It is shown that bound values for. Hall conductivity differ from bound values for metallic conductivity. This is due to the unusual character of current percolation under quantum Hall effect ...

  16. Luis Astorga, ¿Qué querían que hiciera? Inseguridad y delincuencia organizada en el gobierno de Felipe Calderón (Reseña)

    OpenAIRE

    Pérez Caballero, Jesús

    2017-01-01

    La pregunta que Felipe Calderón, ex presidente de México en el sexenio 2006-2012, se hizo mientras gobernaba, y que titula este libro, puede plantearse a cada individuo en el país. Como respuesta, Luis Astorga persevera en la línea que, durante décadas, le ha situado como referente en la materia. En esta reseña se destacarán los puntos fuertes, así como los aspectos más discutibles, que presenta su análisis sobre la crisis de seguridad y la delincuencia organizada en el México reciente....

  17. Martyn Lyons, Historia de la lectura y de la escritura en el mundo occidental : Buenos Aires, Editoras del Calderón, 2012, 429 páginas

    OpenAIRE

    Mascioto, María de los Ángeles

    2013-01-01

    El nuevo libro de Martyn Lyons, Historia de la lectura y de la escritura en el mundo occidental, que da comienzo a la colección “Scripta manent” de las Editoras del Calderón, orientada a la traducción de obras pertenecientes al ámbito de la historia social de la cultura escrita, se propone analizar la función de los libros, la lectura y la escritura teniendo en cuenta los principales puntos de inflexión de la historia occidental como el Renacimiento, la Reforma Protestante, el Iluminismo y la...

  18. Topological spin Hall effect resulting from magnetic skyrmions

    Energy Technology Data Exchange (ETDEWEB)

    Yin, Gen; Liu, Yizhou; Barlas, Yafis; Zang, Jiadong; Lake, Roger K.

    2015-07-01

    The intrinsic spin Hall effect originates from the topology of the Bloch bands in momentum space. The duality between real space and momentum space calls for a spin Hall effect induced from a real space topology in analogy to the topological Hall effect of skyrmions. We theoretically demonstrate the topological spin Hall effect in which a pure transverse spin current is generated from a skyrmion spin texture.

  19. Nonexponential sound decay in concert halls

    Science.gov (United States)

    Kanev, N. G.

    2016-01-01

    The paper presents acoustic measurement results for two concert halls in which nonexponential sound decay is observed. Quantitative estimates are given for how the obtained decay laws differ from exponential. Problems are discussed that arise when using reverberation time to assess the quality of room acoustics with nonexponential sound decay.

  20. Concept of Operating Indoor Skiing Halls with

    DEFF Research Database (Denmark)

    Paul, Joachim

    2003-01-01

    Indoor skiing halls are conventionally operated at low temperatures and with either crushed ice as snow substitute or snow made from freezing water in cold air. Both systems have a high energy demand for air cooling, floor freezing and consequently snow harvest. At the same time the snow at the top...

  1. View of CMS in the assembly hall

    CERN Multimedia

    Maximilien Brice

    2006-01-01

    The CMS detector is stored in the assembly hall at Cessy, France. Once the detector has been fully assembled on the surface, it will be lowered into its cathedral-like cavern. A large range of physics will be studied in this experiment, including the possibility of extra dimensions and the search for the Higgs Boson.

  2. Room acoustic properties of concert halls

    DEFF Research Database (Denmark)

    Gade, Anders Christian

    1996-01-01

    A large database of values of various room acoustic parameters has provided the basis for statistical analyses of how and how much the acoustic properties of concert halls are influenced by their size, shape, and absorption area (as deduced from measured reverberation time). The data have been...

  3. Supersymmetry in the Fractional Quantum Hall Regime

    CERN Document Server

    Sagi, Eran

    2016-01-01

    Supersymmetry (SUSY) is a symmetry transforming bosons to fermions and vice versa. Indications of its existence have been extensively sought after in high-energy experiments. However, signatures of SUSY have yet to be detected. In this manuscript we propose a condensed matter realization of SUSY on the edge of a Read-Rezayi quantum Hall state, given by filling factors of the form $\

  4. Massive Skyrmions in quantum Hall ferromagnets

    NARCIS (Netherlands)

    Abolfath, M.; Mullen, K.; Stoof, H.T.C.

    2001-01-01

    We apply the theory of elasticity to study the effects of Skyrmion mass on lattice dynamics in quantum Hall systems. We find that massive Skyrme lattices behave like a Wigner crystal in the presence of a uniform perpendicular magnetic field. We make a comparison with the microscopic Hartree-Fock

  5. Hall Thruster With an External Acceleration Zone

    National Research Council Canada - National Science Library

    Gascon, Nicolas; Corey, Ronald L; Cappelli, Mark A; Hargus, William

    2005-01-01

    ... of wall material, or magnetic field intensity. When operated with a low background pressure, the particular Hall discharge studied here creates an ion accelerating electrostatic field mainly outside of the channel, in a narrow zone located 5-20 mm away from the exit plane.

  6. Large Spin Hall Angle in Vanadium Film

    Science.gov (United States)

    Wang, Tao; Fan, Xin; Wang, Wenrui; Xie, Yunsong; Warsi, Muhammad A.; Wu, Jun; Chen, Yunpeng; Lorenz, Virginia O.; Xiao, John Q.

    We report the large spin Hall angle observed in Vanadium film with small grain size and distorted lattice parameter. The spin Hall angle is quantified by measuring current-induced spin-orbit torque in V/CoFeB bilayer using optical spin torque magnetometer based on polar magneto-optical Kerr effect (MOKE). The spin Hall angle as large as θSH = -0.071 has been observed in V/CoFeB bilayer Structural analysis, using X-ray diffraction (XRD), transmission electron microscopy (TEM) and selected area electron diffraction (SAED), confirms films grown at room temperature have very small grain size and enlarged lattice parameter. The Vanadium films with distorted crystal structure also have high resistivity (>200 μΩ cm) and long spin diffusion length (~16.3 nm) measured via spin pumping experiment. This finding of spin Hall effect enhancement in more disordered structure will provide insights for understanding and exploiting materials with strong spin orbit interaction, especially in light 3d transition metals which promise long spin diffusion length.

  7. Development and applications of mesoscopic hall microprobes

    NARCIS (Netherlands)

    Novoselov, Konstantin S.

    2004-01-01

    This thesis is devoted to the further development of the local Hall magnetometery technique, and its application for studying ferromagnetic domain wall propagation on the sub-atomic scale. First the ballistic electron transport in a strong, non-uniform magnetic field is discussed. Than a possible

  8. Individualization in a Lecture Hall Setting.

    Science.gov (United States)

    Halyard, Rebecca A.

    A two-quarter Human Anatomy and Physiology course for health-science students has been developed which incorporates the principles of individualization while maintaining the lecture hall setting. The lecture method contributes the following components to the course: (1) no special equipment or supplies; (2) personal interaction between instructor…

  9. Prospect of quantum anomalous Hall and quantum spin Hall effect in doped kagome lattice Mott insulators.

    Science.gov (United States)

    Guterding, Daniel; Jeschke, Harald O; Valentí, Roser

    2016-05-17

    Electronic states with non-trivial topology host a number of novel phenomena with potential for revolutionizing information technology. The quantum anomalous Hall effect provides spin-polarized dissipation-free transport of electrons, while the quantum spin Hall effect in combination with superconductivity has been proposed as the basis for realizing decoherence-free quantum computing. We introduce a new strategy for realizing these effects, namely by hole and electron doping kagome lattice Mott insulators through, for instance, chemical substitution. As an example, we apply this new approach to the natural mineral herbertsmithite. We prove the feasibility of the proposed modifications by performing ab-initio density functional theory calculations and demonstrate the occurrence of the predicted effects using realistic models. Our results herald a new family of quantum anomalous Hall and quantum spin Hall insulators at affordable energy/temperature scales based on kagome lattices of transition metal ions.

  10. Inertial-Hall effect: the influence of rotation on the Hall conductivity

    Directory of Open Access Journals (Sweden)

    Julio E. Brandão

    2015-01-01

    Full Text Available Inertial effects play an important role in classical mechanics but have been largely overlooked in quantum mechanics. Nevertheless, the analogy between inertial forces on mass particles and electromagnetic forces on charged particles is not new. In this paper, we consider a rotating non-interacting planar two-dimensional electron gas with a perpendicular uniform magnetic field and investigate the effects of the rotation in the Hall conductivity. The rotation introduces a shift and a split in the Landau levels. As a consequence of the break of the degeneracy, the counting of the states fully occupied below the Fermi energy increases, tuning the Hall quantization steps. The rotation also changes the quantum Hall plateau widths. Additionally, we find the Hall quantization steps as a function of rotation at a fixed value of the magnetic field.

  11. Dust exposure in indoor climbing halls.

    Science.gov (United States)

    Weinbruch, Stephan; Dirsch, Thomas; Ebert, Martin; Hofmann, Heiko; Kandler, Konrad

    2008-05-01

    The use of hydrated magnesium carbonate hydroxide (magnesia alba) for drying the hands is a strong source for particulate matter in indoor climbing halls. Particle mass concentrations (PM10, PM2.5 and PM1) were measured with an optical particle counter in 9 indoor climbing halls and in 5 sports halls. Mean values for PM10 in indoor climbing halls are generally on the order of 200-500 microg m(-3). For periods of high activity, which last for several hours, PM10 values between 1000 and 4000 microg m(-3) were observed. PM(2.5) is on the order of 30-100 microg m(-3) and reaches values up to 500 microg m(-3), if many users are present. In sports halls, the mass concentrations are usually much lower (PM10 indoor climbing were observed. The size distribution and the total particle number concentration (3.7 nm-10 microm electrical mobility diameter) were determined in one climbing hall by an electrical aerosol spectrometer. The highest number concentrations were between 8000 and 12 000 cm(-3), indicating that the use of magnesia alba is no strong source for ultrafine particles. Scanning electron microscopy and energy-dispersive X-ray microanalysis revealed that virtually all particles are hydrated magnesium carbonate hydroxide. In-situ experiments in an environmental scanning electron microscope showed that the particles do not dissolve at relative humidities up to 100%. Thus, it is concluded that solid particles of magnesia alba are airborne and have the potential to deposit in the human respiratory tract. The particle mass concentrations in indoor climbing halls are much higher than those reported for schools and reach, in many cases, levels which are observed for industrial occupations. The observed dust concentrations are below the current occupational exposure limits in Germany of 3 and 10 mg m(-3) for respirable and inhalable dust. However, the dust concentrations exceed the German guide lines for work places without use of hazardous substances. In addition

  12. Digital technology impacts on the Arnhem transfer hall structural design

    NARCIS (Netherlands)

    Van de Straat, R.; Hofman, S.; Coenders, J.L.; Paul, J.C.

    2015-01-01

    The new Transfer Hall in Arnhem is one of the key projects to prepare the Dutch railways for the increased future demands for capacity. UNStudio developed a master plan in 1996 for the station area of which the completion of the Transfer Hall in 2015 will be a final milestone. The Transfer Hall is a

  13. Nuclear Reactors. Revised.

    Science.gov (United States)

    Hogerton, John F.

    This publication is one of a series of information booklets for the general public published by the United States Atomic Energy Commission. Among the topics discussed are: How Reactors Work; Reactor Design; Research, Teaching, and Materials Testing; Reactors (Research, Teaching and Materials); Production Reactors; Reactors for Electric Power…

  14. Topological honeycomb magnon Hall effect: A calculation of thermal Hall conductivity of magnetic spin excitations

    Energy Technology Data Exchange (ETDEWEB)

    Owerre, S. A., E-mail: solomon@aims.ac.za [African Institute for Mathematical Sciences, 6 Melrose Road, Muizenberg, Cape Town 7945, South Africa and Perimeter Institute for Theoretical Physics, 31 Caroline St. N., Waterloo, Ontario N2L 2Y5 (Canada)

    2016-07-28

    Quite recently, the magnon Hall effect of spin excitations has been observed experimentally on the kagome and pyrochlore lattices. The thermal Hall conductivity κ{sup xy} changes sign as a function of magnetic field or temperature on the kagome lattice, and κ{sup xy} changes sign upon reversing the sign of the magnetic field on the pyrochlore lattice. Motivated by these recent exciting experimental observations, we theoretically propose a simple realization of the magnon Hall effect in a two-band model on the honeycomb lattice. The magnon Hall effect of spin excitations arises in the usual way via the breaking of inversion symmetry of the lattice, however, by a next-nearest-neighbour Dzyaloshinsky-Moriya interaction. We find that κ{sup xy} has a fixed sign for all parameter regimes considered. These results are in contrast to the Lieb, kagome, and pyrochlore lattices. We further show that the low-temperature dependence on the magnon Hall conductivity follows a T{sup 2} law, as opposed to the kagome and pyrochlore lattices. These results suggest an experimental procedure to measure thermal Hall conductivity within a class of 2D honeycomb quantum magnets and ultracold atoms trapped in a honeycomb optical lattice.

  15. Photocatalytic reactor

    Science.gov (United States)

    Bischoff, Brian L.; Fain, Douglas E.; Stockdale, John A. D.

    1999-01-01

    A photocatalytic reactor for processing selected reactants from a fluid medium comprising at least one permeable photocatalytic membrane having a photocatalytic material. The material forms an area of chemically active sites when illuminated by light at selected wavelengths. When the fluid medium is passed through the illuminated membrane, the reactants are processed at these sites separating the processed fluid from the unprocessed fluid. A light source is provided and a light transmitting means, including an optical fiber, for transmitting light from the light source to the membrane.

  16. Hybrid adsorptive membrane reactor

    Energy Technology Data Exchange (ETDEWEB)

    Tsotsis, Theodore T [Huntington Beach, CA; Sahimi, Muhammad [Altadena, CA; Fayyaz-Najafi, Babak [Richmond, CA; Harale, Aadesh [Los Angeles, CA; Park, Byoung-Gi [Yeosu, KR; Liu, Paul K. T. [Lafayette Hill, PA

    2011-03-01

    A hybrid adsorbent-membrane reactor in which the chemical reaction, membrane separation, and product adsorption are coupled. Also disclosed are a dual-reactor apparatus and a process using the reactor or the apparatus.

  17. D and DR Reactors

    Data.gov (United States)

    Federal Laboratory Consortium — The world's second full-scale nuclear reactor was the D Reactor at Hanford which was built in the early 1940's and went operational in December of 1944.D Reactor ran...

  18. Diagnostics Systems for Permanent Hall Thrusters Development

    Science.gov (United States)

    Ferreira, Jose Leonardo; Soares Ferreira, Ivan; Santos, Jean; Miranda, Rodrigo; Possa, M. Gabriela

    This work describes the development of Permanent Magnet Hall Effect Plasma Thruster (PHALL) and its diagnostic systems at The Plasma Physics Laboratory of University of Brasilia. The project consists on the construction and characterization of plasma propulsion engines based on the Hall Effect. Electric thrusters have been employed in over 220 successful space missions. Two types stand out: the Hall-Effect Thruster (HET) and the Gridded Ion Engine (GIE). The first, which we deal with in this project, has the advantage of greater simplicity of operation, a smaller weight for the propulsion subsystem and a longer shelf life. It can operate in two configurations: magnetic layer and anode layer, the difference between the two lying in the positioning of the anode inside the plasma channel. A Hall-Effect Thruster-HET is a type of plasma thruster in which the propellant gas is ionized and accelerated by a magneto hydrodynamic effect combined with electrostatic ion acceleration. So the essential operating principle of the HET is that it uses a J x B force and an electrostatic potential to accelerate ions up to high speeds. In a HET, the attractive negative charge is provided by electrons at the open end of the Thruster instead of a grid, as in the case of the electrostatic ion thrusters. A strong radial magnetic field is used to hold the electrons in place, with the combination of the magnetic field and the electrostatic potential force generating a fast circulating electron current, the Hall current, around the axis of the Thruster, mainly composed by drifting electrons in an ion plasma background. Only a slow axial drift towards the anode occurs. The main attractive features of the Hall-Effect Thruster are its simple design and operating principles. Most of the Hall-Effect Thrusters use electromagnet coils to produce the main magnetic field responsible for plasma generation and acceleration. In this paper we present a different new concept, a Permanent Magnet Hall

  19. Reactor transient

    Energy Technology Data Exchange (ETDEWEB)

    Menegus, R.L.

    1956-05-31

    The authors are planning a calculation to be done on the Univac at the Louviers Building to estimate the effect of xenon transients, a high reactor power. This memorandum outlines the reasons why they prefer to do the work at Louviers rather than at another location, such as N.Y.U. They are to calculate the response of the reactor to a sudden change in position of the half rods. Qualitatively, the response will be a change in the rooftop ratio of the neutron flux. The rooftop ratio may oscillate with high damping, or, instead, it may oscillate for many cycles. It has not been possible for them to determine this response by hand calculation because of the complexity of the problem, and yet it is important for them to be certain that high power operation will not lead us to inherently unstable operation. Therefore they have resorted to machine computation. The system of differential equations that describes the response has seven dependent variables; therefore there are seven equations, each coupled with one or more of the others. The authors have discussed the problem with R.R. Haefner at the plant, and it is his opinion that the IBM 650 cannot adequately handle the system of seven equations because the characteristic time constants vary over a range of about 10{sup 8}. The Univac located at the Louviers Building is said to be satisfactory for this computation.

  20. Accurate micro Hall effect measurements on scribe line pads

    DEFF Research Database (Denmark)

    Østerberg, Frederik Westergaard; Petersen, Dirch Hjorth; Wang, Fei

    2009-01-01

    Hall mobility and sheet carrier density are important parameters to monitor in advanced semiconductor production. If micro Hall effect measurements are done on small pads in scribe lines, these parameters may be measured without using valuable test wafers. We report how Hall mobility can...... be extracted from micro four-point measurements performed on a rectangular pad. The dimension of the investigated pad is 400 × 430 ¿m2, and the probe pitches range from 20 ¿m to 50 ¿m. The Monte Carlo method is used to find the optimal way to perform the Hall measurement and extract Hall mobility most...

  1. Identifying concert halls from source presence vs room presence.

    Science.gov (United States)

    Haapaniemi, Aki; Lokki, Tapio

    2014-06-01

    Identification of concert halls was studied to uncover whether the early or late part of the acoustic response is more salient in a hall's fingerprint. A listening test was conducted with auralizations of measured halls using full, hybrid, and truncated impulse responses convolved with anechoic symphonic music. Subjects identified halls more reliably based on differences in early responses rather than late responses, although varying the late response had more effect on acoustic parameters. The results suggest that in a typical situation with running symphonic music, the early response determines the perceptual fingerprint of a hall more than the late response.

  2. Data of evolutionary structure change: 1B3IA-2AANA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B3IA-2AANA 1B3I 2AAN A A ASVQIKMGTDKYAPLYEPKALSISAGDTVE--FVMN-KVGPHNVIFDKVPAGESAP...GPVTIEIGSKGEELAFDKTELTVSAGQTVTIRFKNNSAVQQHNWILV-KGGEAEAANIANAGLSAGPAANYLPADKSNIIAESPLANGNETVEVTFTAPAAGTYLYICTV...2AAN A 2AANA VEVTFTAPAAGTYL...2AAN A 2AANA NWILV-KGGEA

  3. Data of evolutionary structure change: 1B3JA-1TVHD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B3JA-1TVHD 1B3J 1TVH A D EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQ----KCRAKPQ---GQW...LAMNVR------NFLKEDAMADCLQELRRYLKS-GVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGT...WIEQEGPEYW------DGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTA-ADMAAQTT... 1TVH D 1TVHD 1TVH D 1TVHD

  4. Data of evolutionary structure change: 1B3JA-1TVBA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B3JA-1TVBA 1B3J 1TVB A A EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQ----KCRAK--------...LAMNVR------NFLKEDAMADCLQELRRYLKS-GVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGT...GPEYW-----------DGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAAD-MAAQTT... 1TVB A 1TVBA 1TVB A 1TVBA

  5. Up-regulated ephrinB3/EphB3 expression in intractable temporal lobe epilepsy patients and pilocarpine induced experimental epilepsy rat model.

    Science.gov (United States)

    Huang, Hao; Li, Ruohan; Yuan, Jinxian; Zhou, Xin; Liu, Xi; Ou, Shu; Xu, Tao; Chen, Yangmei

    2016-05-15

    EphB family receptor tyrosine kinases, in cooperation with cell surface-bound ephrinB ligands, play a critical role in maintenance of dendritic spine morphogenesis, axons guidance, synaptogenesis, synaptic reorganization and plasticity in the central nervous system (CNS). However, the expression pattern of ephrinB/EphB in intractable temporal lobe epilepsy (TLE) and the underlying molecular mechanisms during epileptogenesis remain poorly understood. Here we investigated the expression pattern and cellular distribution of ephrinB/EphB in intractable TLE patients and lithium chloride-pilocarpine induced TLE rats using real-time quantitative polymerase chain reaction (RT-qPCR), immunohistochemistry, double-labeled immunofluorescence and Western blot analysis. Compared to control groups, ephrinB3 and EphB3 mRNA expression were significantly up-regulated in intractable TLE patients and TLE rats, while the mRNA expression trend of ephrinB1/2 and EphB1/2/4/6 in intractable TLE patients and TLE rats were inconsistent. Western blot analysis and semi-quantitative immunohistochemistry confirmed that ephrinB3 and EphB3 protein level were up-regulated in intractable TLE patients and TLE rats. At the same time, double-labeled immunofluorescence indicate that ephrinB3 was expressed mainly in the cytoplasm and protrusions of glia and neurons, while EphB3 was expressed mainly in the cytoplasm of neurons. Taken together, up-regulated expression of ephrinB3/EphB3 in intractable TLE patients and experimental TLE rats suggested that ephrinB3/EphB3 might be involved in the pathogenesis of TLE. Copyright © 2016 Elsevier B.V. All rights reserved.

  6. 22 CFR 9b.3 - Press correspondents employed by foreign media organizations.

    Science.gov (United States)

    2010-04-01

    ...) Social Security or passport number; (8) Marital status; (9) Spouse name; (10) Office address and... organizations. 9b.3 Section 9b.3 Foreign Relations DEPARTMENT OF STATE GENERAL REGULATIONS GOVERNING DEPARTMENT OF STATE PRESS BUILDING PASSES § 9b.3 Press correspondents employed by foreign media organizations...

  7. Data of evolutionary structure change: 1BS7B-3CMDB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BS7B-3CMDB 1BS7 3CMD B B SVLQ---VLHIPDERLRKVAKPVE-EVNAEIQRIVDDMF...ine> GLU CA 210 3CMD B 3CMD...ne>GLY CA 251 ILE CA 245 3CMD... B 3CMDB ILSHSVQDACL... 296 LEU CA 264 VAL CA 310 3CMD

  8. Data of evolutionary structure change: 1BS5B-3CMDB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BS5B-3CMDB 1BS5 3CMD B B SVLQ---VLHIPDERLRKVAKPVE-EVNAEIQRIVDDMF...ne> GLU CA 209 3CMD B 3CMD...e>GLY CA 253 ILE CA 241 3CMD... B 3CMDB ILSHSVQDACL ...> ARG CA 309 ALA CA 299 LEU CA 263 3CMD

  9. Music hall Markneukirchen; Musikhalle in Markneukirchen

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1996-01-01

    The article presents the new building of the music hall Markneukirchen. From the planned use of the building result very high demands on the ventilation system in order to keep to a sound power level of less than 30 dB(A) in the hall. The building services are dealt with using numerous flowsheets and diagrams: Heat supply, ventilation system, sanitary system, building management, instrumentation and control, electric and lighting systems. (BWI) [Deutsch] Der vorliegende Beitrag stellt den Neubau der Musikhalle Markneukirchen vor. Durch das Nutzungskonzept ergeben sich fuer die Einhaltung eines Schalleistungspegels von weniger als 30 dB(A) im Saalbereich an die Lueftungsanlage sehr hohe Ansprueche. Es werden die raumlufttechnischen Anlagen anhand zahlreicher Flussbilder und Abbildungen vorgestellt: Waermeversorgung, Lueftungstechnik, Sanitaertechnik, Gebaeudeleit- und MSR-Technik, Elektro- und Lichttechnik. (BWI)

  10. Stuart Hall and Cultural Studies, circa 1983

    Directory of Open Access Journals (Sweden)

    Ann Curthoys

    2017-11-01

    Full Text Available Stuart Hall sought to internationalise theoretical debates and to create Cultural Studies as interdisciplinary. We chart his theoretical journey through a detailed examination of a series of lectures delivered in 1983 and now published for the first time. In these lectures, he discusses theorists such as E.P. Thompson, Raymond Williams, Louis Althusser, Levi Strauss and Antonio Gramsci, and explores the relationship between ideas and social structure, the specificities of class and race, and the legacies of slavery. We note his turn towards metaphors of divergence and dispersal and highlight how autobiographical and deeply personal Hall is in these lectures, especially in his ego histoire moment of traumatic memory recovery.

  11. Three halls for music performance in Chile

    Science.gov (United States)

    Delannoy, Jaime; Heuffemann, Carolina; Ramirez, Daniel; Galvez, Fernando

    2002-11-01

    The primary purpose of this work was to investigate about the present acoustic conditions of used architectonic spaces in Santiago of Chile for orchestras of classic music performance. The studied halls were three: Aula Magna Universidad de Santiago, Teatro Municipal de Nunoa, and Teatro Baquedano. The used methodology was based on studies made by L. Beranek, M. Barron, among others, in concert halls worldwide. As it guides, for the measurement procedure, physical parameters RT, EDT, C50, C80, LF, BR, G, U50 were evaluated according to norm ISO 3382. On the other hand, it has been defined, to proposal way, a questionnaire of subjective valuation directed to musicians, specialized conductors, and listeners.

  12. Anyons in Integer Quantum Hall Magnets

    Directory of Open Access Journals (Sweden)

    Armin Rahmani

    2013-08-01

    Full Text Available Strongly correlated fractional quantum Hall liquids support fractional excitations, which can be understood in terms of adiabatic flux insertion arguments. A second route to fractionalization is through the coupling of weakly interacting electrons to topologically nontrivial backgrounds such as in polyacetylene. Here, we demonstrate that electronic fractionalization combining features of both these mechanisms occurs in noncoplanar itinerant magnetic systems, where integer quantum Hall physics arises from the coupling of electrons to the magnetic background. The topologically stable magnetic vortices in such systems carry fractional (in general, irrational electronic quantum numbers and exhibit Abelian anyonic statistics. We analyze the properties of these topological defects by mapping the distortions of the magnetic texture onto effective non-Abelian vector potentials. We support our analytical results with extensive numerical calculations.

  13. Conjunctures, crises, and cultures: Valuing Stuart Hall

    OpenAIRE

    Clarke, John

    2014-01-01

    This article explores the significance of the work of Stuart Hall for social and political anthropology. It identifies the concern with concrete conjunctural analysis, the continuing attention to the problem of hegemony, and the centrality of a politics of articulation in theory and practice as core features of Hall’s work. The article also touches on his complex relationship with theory and theorising while grounding his work in a series of political and ethical commitments within and beyond...

  14. Homotopy arguments for quantized Hall conductivity

    CERN Document Server

    Richter, T

    2002-01-01

    Using the strong localization bounds obtained by the Aizenman-Molcanov method for a particle in a magnetic field and a disordered potential, we show that the zero-temperature Hall conductivity of a gas of such particles is quantized and constant as long as both Fermi energy and disorder coupling parameter vary in a region of strong localization of the corresponding two-dimensional phase diagram.

  15. SERVIR Town Hall - Connecting Space to Village

    Science.gov (United States)

    Limaye, Ashutosh S.; Searby, Nancy D.; Irwin, Daniel; Albers, Cerese

    2013-01-01

    SERVIR, a joint NASA-USAID project, strives to improve environmental decision making through the use of Earth observations, models, and geospatial technology innovations. SERVIR connects these assets with the needs of end users in Mesoamerica, East Africa, and Hindu Kush-Himalaya regions. This Town Hall meeting will engage the AGU community by exploring examples of connecting Space to Village with SERVIR science applications.

  16. Quantum spin Hall phase in multilayer graphene

    OpenAIRE

    García-Martínez, N. A.; Lado, Jose L.; Fernández Rossier, Joaquín

    2015-01-01

    The so-called quantum spin Hall phase is a topologically nontrivial insulating phase that is predicted to appear in graphene and graphenelike systems. In this paper we address the question of whether this topological property persists in multilayered systems. We consider two situations: purely multilayer graphene and heterostructures where graphene is encapsulated by trivial insulators with a strong spin-orbit coupling. We use a four-orbital tight-binding model that includes full atomic spin-...

  17. SPS beam to the West Hall

    CERN Multimedia

    CERN PhotoLab

    1976-01-01

    One of the two target stations feeding the West Hall (see Annual Report 1976). After the proton beam was split into three branches, the outer two were directed on to targets in the cast iron shielding box, the centre one passing through the box to another target station downstream. Five different targets could be put in each beam, controlled by the mechanism seen on top.

  18. Views of the ATLAS experimental hall

    CERN Multimedia

    Maximilien Brice

    2005-01-01

    The shell of the ATLAS detector is seen from many angles within its cavernous underground hall. All of the eight huge toroid magnets have been installed and fixed in place. The core of the detector, the largest of its type in the world, will soon be filled with many different detector-elements to observe the results of proton-proton collisions at the LHC when it is turned on in 2008.

  19. Multipole expansion in the quantum hall effect

    Energy Technology Data Exchange (ETDEWEB)

    Cappelli, Andrea [INFN, Sezione di Firenze,Via G. Sansone 1, 50019 Sesto Fiorentino, Firenze (Italy); Randellini, Enrico [INFN, Sezione di Firenze,Via G. Sansone 1, 50019 Sesto Fiorentino, Firenze (Italy); Dipartimento di Fisica, Università di Firenze,Via G. Sansone 1, 50019 Sesto Fiorentino, Firenze (Italy)

    2016-03-15

    The effective action for low-energy excitations of Laughlin’s states is obtained by systematic expansion in inverse powers of the magnetic field. It is based on the W-infinity symmetry of quantum incompressible fluids and the associated higher-spin fields. Besides reproducing the Wen and Wen-Zee actions and the Hall viscosity, this approach further indicates that the low-energy excitations are extended objects with dipolar and multipolar moments.

  20. Acoustics in rock and pop music halls

    DEFF Research Database (Denmark)

    Larsen, Niels Werner; Thompson, Eric Robert; Gade, Anders Christian

    2007-01-01

    The existing body of literature regarding the acoustic design of concert halls has focused almost exclusively on classical music, although there are many more performances of rhythmic music, including rock and pop. Objective measurements were made of the acoustics of twenty rock music venues...... frequency sounds are typically highly amplified, they play an important role in the subjective ratings and the 63-Hz-band must be included in objective measurements and recommendations....

  1. Nuclear reactor neutron shielding

    Science.gov (United States)

    Speaker, Daniel P; Neeley, Gary W; Inman, James B

    2017-09-12

    A nuclear reactor includes a reactor pressure vessel and a nuclear reactor core comprising fissile material disposed in a lower portion of the reactor pressure vessel. The lower portion of the reactor pressure vessel is disposed in a reactor cavity. An annular neutron stop is located at an elevation above the uppermost elevation of the nuclear reactor core. The annular neutron stop comprises neutron absorbing material filling an annular gap between the reactor pressure vessel and the wall of the reactor cavity. The annular neutron stop may comprise an outer neutron stop ring attached to the wall of the reactor cavity, and an inner neutron stop ring attached to the reactor pressure vessel. An excore instrument guide tube penetrates through the annular neutron stop, and a neutron plug comprising neutron absorbing material is disposed in the tube at the penetration through the neutron stop.

  2. Double Hall sensor structure reducing voltage offset

    Science.gov (United States)

    Oszwaldowski, M.; El-Ahmar, S.

    2017-07-01

    In this paper, we report on the double Hall sensor structure (DHSS) in which the voltage offset can be effectively reduced. The DHSS is composed of two standard Hall sensors that are activated with two currents from electrically independent current sources. The operation principle of the DHSS is explained in detail, and the concluded properties of the DHSS are confirmed in the experimental part of the paper. The measurements are performed on DHSSs based on InSb thin films. The offset is reduced by about three orders of magnitude. The minimum value of the reduced offset obtained is 10 μV. It appears that the minimum reduced offset is limited by the electric noise. The advantage of DHSS is that it can be manufactured with the standard thin film technology enabling effective miniaturization of the system. The DHSS can effectively be used for the measurements of the Hall effect in ultra-thin layers containing the two dimensional electron gas, such as the epitaxial graphene.

  3. Nuclear fission: the interplay of science and technology.

    Science.gov (United States)

    Stoneham, A M

    2010-07-28

    When the UK's Calder Hall nuclear power station was connected to the grid in 1956, the programmes that made this possible involved a powerful combination of basic and applied research. Both the science and the engineering were novel, addressing new and challenging problems. That the last Calder Hall reactor was shut down only in 2003 attests to the success of the work. The strengths of bringing basic science to bear on applications continued to be recognized until the 1980s, when government and management fashions changed. This paper identifies a few of the technology challenges, and shows how novel basic science emerged from them and proved essential in their resolution. Today, as the threat of climate change becomes accepted, it has become clear that there is no credible solution without nuclear energy. The design and construction of new fission reactors will need continuing innovation, with the interplay between the science and technology being a crucial component.

  4. Antiferromagnetic skyrmion crystals: Generation, topological Hall, and topological spin Hall effect

    Science.gov (United States)

    Göbel, Börge; Mook, Alexander; Henk, Jürgen; Mertig, Ingrid

    2017-08-01

    Skyrmions are topologically nontrivial, magnetic quasiparticles that are characterized by a topological charge. A regular array of skyrmions, a skyrmion crystal (SkX), features the topological Hall effect (THE) of electrons, which, in turn, gives rise to the Hall effect of the skyrmions themselves. It is commonly believed that antiferromagnetic skyrmion crystals (AFM-SkXs) lack both effects. In this Rapid Communication, we present a generally applicable method to create stable AFM-SkXs by growing a two-sublattice SkX onto a collinear antiferromagnet. As an example we show that both types of skyrmion crystals, conventional and antiferromagnetic, exist in honeycomb lattices. While AFM-SkXs with equivalent lattice sites do not show a THE, they exhibit a topological spin Hall effect. On top of this, AFM-SkXs on inequivalent sublattices exhibit a nonzero THE, which may be utilized in spintronics devices. Our theoretical findings call for experimental realization.

  5. Hall viscosity: A link between quantum Hall systems, plasmas and liquid crystals

    Energy Technology Data Exchange (ETDEWEB)

    Lingam, Manasvi, E-mail: manasvi@physics.utexas.edu

    2015-07-17

    In this Letter, the assumption of two simple postulates is shown to give rise to a Hall viscosity term via an action principle formulation. The rationale behind the two postulates is clearly delineated, and the connections to an intrinsic angular momentum are emphasized. By employing this methodology, it is shown that Hall viscosity appears in a wide range of fields, and the interconnectedness of quantum Hall systems, plasmas and nematic liquid crystals is hypothesized. Potential avenues for experimental and theoretical work arising from this cross-fertilization are also indicated. - Highlights: • Connections between simple 2D fluid models in different fields of physics presented. • Structure emerges via varied physical mechanisms driven by internal angular momentum. • Properties of these models such as Casimirs, equilibria and stability are analyzed.

  6. Conductivity tensor in a holographic quantum Hall ferromagnet

    Directory of Open Access Journals (Sweden)

    Joel Hutchinson

    2014-11-01

    Full Text Available The Hall and longitudinal conductivities of a recently studied holographic model of a quantum Hall ferromagnet are computed using the Karch–O'Bannon technique. In addition, the low temperature entropy of the model is determined. The holographic model has a phase transition as the Landau level filling fraction is increased from zero to one. We argue that this phase transition allows the longitudinal conductivity to have features qualitatively similar to those of two dimensional electron gases in the integer quantum Hall regime. The argument also applies to the low temperature limit of the entropy. The Hall conductivity is found to have an interesting structure. Even though it does not exhibit Hall plateaux, it has a flattened dependence on the filling fraction with a jump, analogous to the interpolation between Hall plateaux, at the phase transition.

  7. Commemorative Symposium on the Hall Effect and its Applications

    CERN Document Server

    Westgate, C

    1980-01-01

    In 1879, while a graduate student under Henry Rowland at the Physics Department of The Johns Hopkins University, Edwin Herbert Hall discovered what is now universally known as the Hall effect. A symposium was held at The Johns Hopkins University on November 13, 1979 to commemorate the lOOth anniversary of the discovery. Over 170 participants attended the symposium which included eleven in­ vited lectures and three speeches during the luncheon. During the past one hundred years, we have witnessed ever ex­ panding activities in the field of the Hall effect. The Hall effect is now an indispensable tool in the studies of many branches of condensed matter physics, especially in metals, semiconductors, and magnetic solids. Various components (over 200 million!) that utilize the Hall effect have been successfully incorporated into such devices as keyboards, automobile ignitions, gaussmeters, and satellites. This volume attempts to capture the important aspects of the Hall effect and its applications. It includes t...

  8. Basic Instrumentation for Hall A at Jefferson Jab

    Energy Technology Data Exchange (ETDEWEB)

    The Jefferson Lab Hall A Collaboration

    2003-07-01

    The instrumentation in Hall A at the JLab was designed to study electro- and photo-induced reactions at very high luminosity and good momentum and angular resolution for at least one of the reaction products. A collaboration of approximately 50 institutions from all over the world has actively contributed and participated in the design, construction and commissioning of the Hall A instrumentation. The basic Hall A equipment is described herein.

  9. Activation of macrophages by an exopolysaccharide isolated from Antarctic Psychrobacter sp. B-3

    Science.gov (United States)

    Yu, Leiye; Sun, Guojie; Wei, Jingfang; Wang, Yingze; Du, Chao; Li, Jiang

    2016-09-01

    An exopolysaccharide (EPS) was isolated and purified from an Antarctic psychrophilic bacterium B-3, identified as Psychrobacter sp., and the activation of RAW264.7 cells by B-3 EPS was investigated. The results show that B-3 EPS, over a certain concentration range, promoted cell viability, nitric oxide production, tumor necrosis factor (TNF)α secretion, and phagocytic ability. Furthermore, TAK-242, an inhibitor of the toll-like receptor 4 (TLR4) significantly reduced nitric oxide production by these cells after stimulation with B-3 EPS. Moreover, B-3 EPS induced p65 phosphorylation and IκBα degradation in these cells. In conclusion, B-3 EPS might have activated RAW264.7 cells by combining with TLR4 on cell surface and triggering activation of NF-κB signaling pathways, implying that this EPS could activate macrophages and regulate initial immune response.

  10. Roger Calder (1934 – 2014)

    CERN Multimedia

    2014-01-01

    Roger joined CERN’s Accelerator-Research Division in May 1963, at the beginning of the Intersecting Storage Rings (ISR) project. The challenge was to evacuate the two beam pipes of about 1 km each to 10-7 Pa and to obtain a beam lifetime of 20 hours. An ultra-high vacuum system of this size and complexity required the most advanced technologies available.   Among the outstanding contributions by Roger were: the choice of turbomolecular- and ion-pumps, low outgassing rates and an all-metal system bakeable to 300°C. Still today, Roger’s name is linked to "900°C vacuum degassed stainless steel" for very low hydrogen outgassing. The unexpected dynamic pressure run-away during the ISR start-up, at only a few A of beam, was quickly identified as the "ion-induced pressure bump instability". Among Roger’s efforts to mitigate this effect, the pumping system was supplemented with titanium sublimation pumps. In a second s...

  11. Precision of single-engage micro Hall effect measurements

    DEFF Research Database (Denmark)

    Henrichsen, Henrik Hartmann; Hansen, Ole; Kjær, Daniel

    2014-01-01

    Recently a novel microscale Hall effect measurement technique has been developed to extract sheet resistance (RS), Hall sheet carrier density (NHS) and Hall mobility (μH) from collinear micro 4-point probe measurements in the vicinity of an insulating boundary [1]. The technique measures in less......]. In this study we calculate the measurement error on RS, NHS and μH resulting from electrode position errors, probe placement, sample size and Hall signal magnitude. We show the relationship between measurement precision and electrode pitch, which is important when down-scaling the micro 4-point probe to fit...

  12. Hall Sensor Output Signal Fault-Detection & Safety Implementation Logic

    Directory of Open Access Journals (Sweden)

    Lee SangHun

    2016-01-01

    Full Text Available Recently BLDC motors have been popular in various industrial applications and electric mobility. Recently BLDC motors have been popular in various industrial applications and electric mobility. In most brushless direct current (BLDC motor drives, there are three hall sensors as a position reference. Low resolution hall effect sensor is popularly used to estimate the rotor position because of its good comprehensive performance such as low cost, high reliability and sufficient precision. Various possible faults may happen in a hall effect sensor. This paper presents a fault-tolerant operation method that allows the control of a BLDC motor with one faulty hall sensor and presents the hall sensor output fault-tolerant control strategy. The situations considered are when the output from a hall sensor stays continuously at low or high levels, or a short-time pulse appears on a hall sensor signal. For fault detection, identification of a faulty signal and generating a substitute signal, this method only needs the information from the hall sensors. There are a few research work on hall effect sensor failure of BLDC motor. The conventional fault diagnosis methods are signal analysis, model based analysis and knowledge based analysis. The proposed method is signal based analysis using a compensation signal for reconfiguration and therefore fault diagnosis can be fast. The proposed method is validated to execute the simulation using PSIM.

  13. High Efficiency Hall Thruster Discharge Power Converter Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Busek leveraged previous, internally sponsored, high power, Hall thruster discharge converter development which allowed it to design, build, and test new printed...

  14. Quantum Hall effect in multi-terminal suspended graphene devices

    Science.gov (United States)

    Ghahari, Fereshte; Zhao, Yue; Bolotin, Kirill; Kim, Philip

    2010-03-01

    The integer and fractional quantum hall effects have been already observed in two terminal suspended graphene devices. However in this two probe device geometry, mixing between magnetoresistance ρxx and Hall resistance ρxy for incompletely developed quantum Hall states leads to substantial deviation of conductance plateaus values. In this talk, we present the experimental results from four terminal suspended graphene devices. The quality of quantum Hall effect will be discussed in muti-terminal device geometry in conjunction with the current-induced annealing process to improve the quality of graphene samples.

  15. Planar Hall Effect Sensors for Biodetection

    DEFF Research Database (Denmark)

    Rizzi, Giovanni

    as labels and planar Hall effect bridge (PHEB) magnetic field sensor as readout for the beads. The choice of magnetic beads as label is motivated by the lack of virtually any magnetic background from biological samples. Moreover, magnetic beads can be manipulated via an external magnetic field...... system capable of generating both temperature and concentration gradients over the sensor surface. The temperature and buffer concentration can be varied in order to perform denaturation analysis of the DNA hybrids. In this thesis, this kind assay is tested with temperature varying from 20ºC to 70º...

  16. DESIGN OF SUBSOIL IMPROVEMENT BELOW HALL FLOORS

    Directory of Open Access Journals (Sweden)

    Peter Turček

    2017-10-01

    Full Text Available The construction of an industrial park is now being prepared near the town of Nitra. The investor fixed very strict conditions for the bearing capacity and, above all, the settlement of halls and their floors. The geological conditions at the construction site are difficult: there are soft clay soils with high compressibility and low bearing capacity. A detailed analysis of soil improvement was made. Stone columns were prepared to be fitted into an approximately 5 m thick layer of soft clay. The paper shows the main steps used in the design of the stone columns.

  17. Current correlations in quantum spin Hall insulators.

    Science.gov (United States)

    Schmidt, Thomas L

    2011-08-26

    We consider a four-terminal setup of a two-dimensional topological insulator (quantum spin Hall insulator) with local tunneling between the upper and lower edges. The edge modes are modeled as helical Luttinger liquids and the electron-electron interactions are taken into account exactly. Using perturbation theory in the tunneling, we derive the cumulant generating function for the interedge current. We show that different possible transport channels give rise to different signatures in the current noise and current cross correlations, which could be exploited in experiments to elucidate the interplay between electron-electron interactions and the helical nature of the edge states. © 2011 American Physical Society

  18. [Epidemiological profile of traumatic brain injury at the Dr. Rafael A. Calderón Guardia Hospital, Neurosurgery Department, during the period from 2007 to 2012].

    Science.gov (United States)

    Petgrave-Pérez, Alexander; Padilla, Juan I; Díaz, José; Chacón, Rosarito; Chaves, Carlos; Torres, Héctor; Fernández, Jorge

    2016-01-01

    To determine the epidemiological profile of the patients who suffered traumatic brain injury (TBI) and were treated at the Dr. Rafael A. Calderón Guardia Hospital (HCG) Neurosurgery department, during the period from 2007 to 2012. An observational, descriptive, retrospective and cross section study was performed on all the patients with TBI and who were admitted to the emergency room of the HCG during the period 2007 to 2012. There were a total of 721 cases, of which 566 records were obtained of patients who had the variables established in this study, excluding those with incomplete or inconsistent information. The present study established the epidemiological profile of the TBI in the population seen during the period 2007 to 2012 at the HCG. It was determined that the male sex made up the majority of the cases were male, with mean age of 46 years. The mortality rate was 12.69% (n=69). Car accidents were the most frequent cause of TBI (n=259 persons) in the age group of 25 to 44 years, followed by falls (n=174). It was observed that the majority were farmers, followed by students, and then construction workers. No chronic illnesses were recorded in 71.6% of the medical charts. No alcohol or other drugs were reported in 74.9% of the cases, while there was evidence of the presence of alcohol recorded in 22.8%. The clinical and laboratory parameters that had statistical significance (P<.05) were GCS equal to less than 8 (P=.035), presence of mydriasis (P=.00), deviation of the LM (P=.006), cranial fracture (P=.04), lack of endotracheal intubation on admission (P=.007), prolonged PT (P=.04), prolonged PTT (P=.025), and MAP<60 (P=.002). The most frequent surgical procedure in the study population was craniotomy with hematoma drainage alone or associated with some other procedure (esquillectomy or monitoring of PIC) (n=298). There is great difficulty in determining the epidemiology of TBI worldwide, due to the lack of standardisation of the international studies. From

  19. Bimetric Theory of Fractional Quantum Hall States

    Science.gov (United States)

    Gromov, Andrey; Son, Dam Thanh

    2017-10-01

    We present a bimetric low-energy effective theory of fractional quantum Hall (FQH) states that describes the topological properties and a gapped collective excitation, known as the Girvin-Macdonald-Platzman (GMP) mode. The theory consists of a topological Chern-Simons action, coupled to a symmetric rank-2 tensor, and an action à la bimetric gravity, describing the gapped dynamics of a spin-2 mode. The theory is formulated in curved ambient space and is spatially covariant, which allows us to restrict the form of the effective action and the values of phenomenological coefficients. Using bimetric theory, we calculate the projected static structure factor up to the k6 order in the momentum expansion. To provide further support for the theory, we derive the long-wave limit of the GMP algebra, the dispersion relation of the GMP mode, and the Hall viscosity of FQH states. The particle-hole (PH) transformation of the theory takes a very simple form, making the duality between FQH states and their PH conjugates manifest. We also comment on the possible applications to fractional Chern insulators, where closely related structures arise. It is shown that the familiar FQH observables acquire a curious geometric interpretation within the bimetric formalism.

  20. Hypernuclear Spectroscopy at JLab Hall C

    Energy Technology Data Exchange (ETDEWEB)

    Hashimoto, Osamu; Doi, Daisuke; Fujii, Yu; Toshiyuki, Gogami; Kanda, Hiroki; Kaneta, M; Kawama, Daisuke; Maeda, Kazushige; Maruta, Tomofumi; Matsumura, Akihiko; Nagao, Sho; Nakamura, Satoshi; Shichijo, Ayako; Tamura, Hirokazu; Taniya, Naotaka; Yamamoto, Taku; Yokota, Kosuke; Kato, S; Sato, Yoshinori; Takahashi, Toshiyuki; Noumi, Hiroyuki; Motoba, T; Hiyama, E; Albayrak, Ibrahim; Ates, Ozgur; Chen, Chunhua; Christy, Michael; Keppel, Cynthia; Kohl, Karl; Li, Ya; Liyanage, Anusha Habarakada; Tang, Liguang; Walton, T; Ye, Zhihong; Yuan, Lulin; Zhu, Lingyan; Baturin, Pavlo; Boeglin, Werner; Dhamija, Seema; Markowitz, Pete; Raue, Brian; Reinhold, Joerg; Hungerford, Ed; Ent, Rolf; Fenker, Howard; Gaskell, David; Horn, Tanja; Jones, Mark; Smith, Gregory; Vulcan, William; Wood, Stephen; Johnston, C; Simicevic, Neven; Wells, Stephen; Samantha, Chhanda; Hu, Bitao; Shen, Ji; Wang, W; Zhang, Xiaozhuo; Zhang, Yi; Feng, Jing; Fu, Y; Zhou, Jian; Zhou, S; Jiang, Yi; Lu, H; Yan, Xinhu; Ye, Yunxiu; Gan, Liping; Ahmidouch, Abdellah; Danagoulian, Samuel; Gasparian, Ashot; Elaasar, Mostafa; Wesselmann, Frank; Asaturyan, Arshak; Margaryan, Amur; Mkrtchyan, Arthur; Mkrtchyan, Hamlet; Tadevosyan, Vardan; Androic, Darko; Furic, Miroslav; Petkovic, Tomislav; Seva, Tomislav; Niculescu, Gabriel; Niculescu, Maria-Ioana; Rodriguez, Victor; Cisbani, Evaristo; Cusanno, Francesco; Garibaldi, Franco; Urciuoli, Guido; De Leo, Raffaele; Maronne, S; Achenbach, Carsten

    2010-03-01

    Since the 1st generation experiment, E89-009, which was successfully carried out as a pilot experiment of (e,e'K+) hypernuclear spectroscopy at JLab Hall C in 2000, precision hypernuclear spectroscopy by the (e,e'K+) reactions made considerable progress. It has evolved to the 2nd generation experiment, E01-011, in which a newly constructed high resolution kaon spectrometer (HKS) was installed and the “Tilt method” was adopted in order to suppress large electromagnetic background and to run with high luminosity. Preliminary high-resolution spectra of 7ΛHe and 28ΛAl together with that of 12ΛB that achieved resolution better than 500 keV(FWHM) were obtained. The third generation experiment, E05-115, has completed data taking with an experimental setup combining a new splitter magnet, high resolution electron spectrometer (HES) and the HKS used in the 2nd generation experiment. The data were accumulated with targets of 7Li, 9Be, 10B, 12C and 52Cr as well as with those of CH2 and H2O for calibration. The analysis is under way with particular emphasis of determining precision absolute hypernuclear masses. In this article, hypernuclear spectroscopy program in the wide mass range at JLab Hall C that has undergone three generation is described.

  1. Quantum spin Hall phase in multilayer graphene

    Science.gov (United States)

    García-Martínez, N. A.; Lado, J. L.; Fernández-Rossier, J.

    2015-06-01

    The so-called quantum spin Hall phase is a topologically nontrivial insulating phase that is predicted to appear in graphene and graphenelike systems. In this paper we address the question of whether this topological property persists in multilayered systems. We consider two situations: purely multilayer graphene and heterostructures where graphene is encapsulated by trivial insulators with a strong spin-orbit coupling. We use a four-orbital tight-binding model that includes full atomic spin-orbit coupling and we calculate the Z2 topological invariant of the bulk states as well as the edge states of semi-infinite crystals with armchair termination. For homogeneous multilayers we find that even when the spin-orbit interaction opens a gap for all possible stackings, only those with an odd number of layers host gapless edge states while those with an even number of layers are trivial insulators. For heterostructures where graphene is encapsulated by trivial insulators, it turns out that interlayer coupling is able to induce a topological gap whose size is controlled by the spin-orbit coupling of the encapsulating materials, indicating that the quantum spin Hall phase can be induced by proximity to trivial insulators.

  2. Bimetric Theory of Fractional Quantum Hall States

    Directory of Open Access Journals (Sweden)

    Andrey Gromov

    2017-11-01

    Full Text Available We present a bimetric low-energy effective theory of fractional quantum Hall (FQH states that describes the topological properties and a gapped collective excitation, known as the Girvin-Macdonald-Platzman (GMP mode. The theory consists of a topological Chern-Simons action, coupled to a symmetric rank-2 tensor, and an action à la bimetric gravity, describing the gapped dynamics of a spin-2 mode. The theory is formulated in curved ambient space and is spatially covariant, which allows us to restrict the form of the effective action and the values of phenomenological coefficients. Using bimetric theory, we calculate the projected static structure factor up to the k^{6} order in the momentum expansion. To provide further support for the theory, we derive the long-wave limit of the GMP algebra, the dispersion relation of the GMP mode, and the Hall viscosity of FQH states. The particle-hole (PH transformation of the theory takes a very simple form, making the duality between FQH states and their PH conjugates manifest. We also comment on the possible applications to fractional Chern insulators, where closely related structures arise. It is shown that the familiar FQH observables acquire a curious geometric interpretation within the bimetric formalism.

  3. 26 CFR 48.6416(b)(3)-2 - Further manufacture included.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Further manufacture included. 48.6416(b)(3)-2... of Special Application to Retailers and Manufacturers Taxes § 48.6416(b)(3)-2 Further manufacture... overpayment by reason of any use in further manufacture, or sale as part of a second manufactured article...

  4. Band-Gap Engineering of Graphene Heterostructures via Substitutional Doping with B3N3.

    Science.gov (United States)

    Sawahata, Hisaki; Maruyama, Mina; Omachi, Haruka; Shinohara, Hisanori; Cuong, Nguyen Thanh; Okada, Susumu

    2017-10-11

    We investigated the energetics and electronic structures of B3N3-doped graphene using the density functional theory with the generalized gradient approximation. Our calculations showed that all of the B3N3-doped graphene structures were semiconductors, irrespective of the periodicity of the B3N3 embedded into the graphene network, in contrast to graphene nanomeshes which are either semiconductors or metals depending on the mesh arrangement. The B3N3-doped graphene has small effective masses for both electron and hole. The band gap in the B3N3-doped graphene networks was inversely proportional to the B3N3 spacing. The total energy of the B3N3-doped graphene was also inversely proportional to the B3N3 spacing. The band gap and total energy further depended on whether the graphene region possessed a Clar structure or not. In particular, the sheets with a Clar structure had a wider band gap and a slightly lower total energy than those without a Clar structure. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Interaction of vitamins B3 and C and their radicals with (5, 0) single ...

    Indian Academy of Sciences (India)

    Electronic properties of the covalent and noncovalent adsorption of single-walled boron nitride nanotube with vitamins B3 and C and their radicals are investigated through the density functional theory. Results show that noncovalent and covalent adsorption of vitamin B3 on BNNT could make these systems of interest for ...

  6. ErbB3 drives mammary epithelial survival and differentiation during pregnancy and lactation.

    Science.gov (United States)

    Williams, Michelle M; Vaught, David B; Joly, Meghan Morrison; Hicks, Donna J; Sanchez, Violeta; Owens, Philip; Rahman, Bushra; Elion, David L; Balko, Justin M; Cook, Rebecca S

    2017-09-08

    During pregnancy, as the mammary gland prepares for synthesis and delivery of milk to newborns, a luminal mammary epithelial cell (MEC) subpopulation proliferates rapidly in response to systemic hormonal cues that activate STAT5A. While the receptor tyrosine kinase ErbB4 is required for STAT5A activation in MECs during pregnancy, it is unclear how ErbB3, a heterodimeric partner of ErbB4 and activator of phosphatidyl inositol-3 kinase (PI3K) signaling, contributes to lactogenic expansion of the mammary gland. We assessed mRNA expression levels by expression microarray of mouse mammary glands harvested throughout pregnancy and lactation. To study the role of ErbB3 in mammary gland lactogenesis, we used transgenic mice expressing WAP-driven Cre recombinase to generate a mouse model in which conditional ErbB3 ablation occurred specifically in alveolar mammary epithelial cells (aMECs). Profiling of RNA from mouse MECs isolated throughout pregnancy revealed robust Erbb3 induction during mid-to-late pregnancy, a time point when aMECs proliferate rapidly and undergo differentiation to support milk production. Litters nursed by ErbB3 KO dams weighed significantly less when compared to litters nursed by ErbB3 WT dams. Further analysis revealed substantially reduced epithelial content, decreased aMEC proliferation, and increased aMEC cell death during late pregnancy. Consistent with the potent ability of ErbB3 to activate cell survival through the PI3K/Akt pathway, we found impaired Akt phosphorylation in ErbB3 KO samples, as well as impaired expression of STAT5A, a master regulator of lactogenesis. Constitutively active Akt rescued cell survival in ErbB3-depleted aMECs, but failed to restore STAT5A expression or activity. Interestingly, defects in growth and survival of ErbB3 KO aMECs as well as Akt phosphorylation, STAT5A activity, and expression of milk-encoding genes observed in ErbB3 KO MECs progressively improved between late pregnancy and lactation day 5. We found a

  7. The first vineyard concert hall in North America

    Science.gov (United States)

    Jaffe, Christopher; Rivera, Carlos

    2002-11-01

    The first vineyard or surround concert hall designed and built in the Western Hemisphere is the Sala Nezahualcoyotl in Mexico City. The Hall was completed in 1976 and is part of the Cultural Center at the Universidad Nacional Autonoma de Mexico. The hall was named after a Toltec poet, architect, and musician who lived in the 15th century and was the Renaissance man of his day. In order to provide the familiar traditional sound of the rectangular (shoebox) European Hall, the acoustic designers set the criteria for reverberation times through the frequency spectrum and the Initial Time Delay Gap at every seat in the house to match the measurements taken at the Grosser Musik vereinssaal in Vienna and Boston Symphony Hall. In this paper we discuss the techniques used to create the traditional sound in a vineyard hall and the reaction of musicians and audiences to the completed facility. The Sala was the model for Suntory Hall in Japan which in turn spawned a number of vineyard halls in Japan. Most recently, the vineyard style seems to be appealing to more and more symphonic organizations in Europe and North America.

  8. Magnetoresistance in quantum Hall metals due to Pancharatnam ...

    Indian Academy of Sciences (India)

    electron flow is independent of these spacings (require small changes to the phase factor, or negligible changes to the group momentum of a wavefunction). Here, we shall further elaborate on these two processes, and use them to derive and discuss the Hall resistance in quantum Hall metals for both fractional and integer ...

  9. Cultural Composition: Stuart Hall on Ethnicity and the Discursive Turn.

    Science.gov (United States)

    Drew, Julie

    1998-01-01

    Interviews Stuart Hall, a black public intellectual and an activist of the New Left. Discusses the growing disillusionment with cultural studies now that it is no longer in its ascendancy; the proliferation of pedagogical practices given a cultural studies tag; Hall's approval of the use of popular culture in the composition classroom; and the…

  10. Whose Big Prize? A Response to Hall and Gunter

    Science.gov (United States)

    Furlong, John

    2009-01-01

    This article presents the author's response to Hall and Gunter who accuse the author of trying to mount "a stout defence" of New Labour's reforms of the teaching profession. Hall and Gunter go further and accuse the author of "triumphalism" in his use of the title "Tony Blair's big prize". Their second and more…

  11. Spatial sensitivity mapping of Hall crosses using patterned magnetic nanostructures

    NARCIS (Netherlands)

    Alexandrou, M.; Nutter, P.W.; Delalande, M.Y.; de Vries, Jeroen; Hill, E.W.; Schedin, F.; Abelmann, Leon; Thomson, T.

    2010-01-01

    Obtaining an accurate profile of the spatial sensitivity of Hall cross structures is crucial if such devices are to be used to analyze the switching behavior of magnetic nanostructures and determine the switching field distribution of bit patterned media. Here, we have used the anomalous Hall effect

  12. Acoustic investigations of concert halls for rock music

    DEFF Research Database (Denmark)

    Adelman-Larsen, Niels Werner; Thompson, Eric Robert; Gade, Anders Christian

    2007-01-01

    Objective measurement data and subjective evaluations have been collected from 20 small-/medium-sized halls in Denmark used for amplified rhythmic music concerts (pop, rock, jazz). The purpose of the study was to obtain knowledge about optimum acoustic conditions for this type of hall. The study...

  13. Acoustic Requirements for a Multi-Purpose Hall.

    Science.gov (United States)

    Schulte, W. Allen

    2002-01-01

    This case study examines the proposed design of a new lecture/recital hall in Centennial Hall at Lynchburg College that will be used for lectures, public events, a film studies course, and musical recitals. It explores the audio-visual challenges presented by the differing acoustical requirements for the building. (EV)

  14. The Impact of Coed Residence Halls on Self-Actualization

    Science.gov (United States)

    Schroeder, Charles C.; LeMay, Morris L.

    1973-01-01

    The purpose of the present study was to determine if there were initial differences on selected scales of the Personal Orientation Inventory (POI) between students who chose to live in coed residence halls and those who chose to live in traditional single-sex residence halls, and also if residing in coed living units affected the further…

  15. Mary E. Hall: Dawn of the Professional School Librarian

    Science.gov (United States)

    Alto, Teresa

    2012-01-01

    A century ago, a woman named Mary E. Hall convinced school leaders of the need for the professional school librarian--a librarian who cultivated a love of reading, academic achievement, and independent learning skills. After graduating from New York City's Pratt Institute Library School in 1895, Hall developed her vision for the high school…

  16. A Residential Paradox?: Residence Hall Attributes and College Student Outcomes

    Science.gov (United States)

    Bronkema, Ryan; Bowman, Nicholas A.

    2017-01-01

    The researchers of this brief observed that few environments have the potential to shape the outcomes of college students as much as residence halls. As a result, residence halls have the capacity to foster a strong sense of community as well as other important outcomes such as college satisfaction and academic achievement. However, given the high…

  17. G. Stanley Hall's Adolescence: A centennial reappraisal introduction.

    Science.gov (United States)

    Arnett, Jeffrey Jensen; Cravens, Hamilton

    2006-08-01

    This article is an overview of the special issue "G. Stanley Hall's Adolescence: A Centennial Reappraisal." First, a brief biography of Hall is presented. Then each of the six articles in the special issue is summarized. Three of the articles are by historians and three are by psychologists, but all six articles integrate history and psychology.

  18. Stuart Hall on Racism and the Importance of Diasporic Thinking

    Science.gov (United States)

    Rizvi, Fazal

    2015-01-01

    In this article, I want to show how my initial encounter with the work of Stuart Hall was grounded in my reading of the later philosophy of Ludwig Wittgenstein, and was shaped by my interest in understanding the nature of racism across the three countries in which I had lived. Over the years, Hall's various writings have helped me to make sense of…

  19. Hybrid plasmachemical reactor

    Energy Technology Data Exchange (ETDEWEB)

    Lelevkin, V. M., E-mail: lelevkin44@mail.ru; Smirnova, Yu. G.; Tokarev, A. V. [Kyrgyz-Russian Slavic University (Kyrgyzstan)

    2015-04-15

    A hybrid plasmachemical reactor on the basis of a dielectric barrier discharge in a transformer is developed. The characteristics of the reactor as functions of the dielectric barrier discharge parameters are determined.

  20. Attrition reactor system

    Science.gov (United States)

    Scott, Charles D.; Davison, Brian H.

    1993-01-01

    A reactor vessel for reacting a solid particulate with a liquid reactant has a centrifugal pump in circulatory flow communication with the reactor vessel for providing particulate attrition, resulting in additional fresh surface where the reaction can occur.

  1. Guidebook to nuclear reactors

    Energy Technology Data Exchange (ETDEWEB)

    Nero, A.V. Jr.

    1976-05-01

    A general introduction to reactor physics and theory is followed by descriptions of commercial nuclear reactor types. Future directions for nuclear power are also discussed. The technical level of the material is suitable for laymen.

  2. Marine microbial biodiversity, bioinformatics and biotechnology (M2B3) data reporting and service standards.

    Science.gov (United States)

    Ten Hoopen, Petra; Pesant, Stéphane; Kottmann, Renzo; Kopf, Anna; Bicak, Mesude; Claus, Simon; Deneudt, Klaas; Borremans, Catherine; Thijsse, Peter; Dekeyzer, Stefanie; Schaap, Dick Ma; Bowler, Chris; Glöckner, Frank Oliver; Cochrane, Guy

    2015-01-01

    Contextual data collected concurrently with molecular samples are critical to the use of metagenomics in the fields of marine biodiversity, bioinformatics and biotechnology. We present here Marine Microbial Biodiversity, Bioinformatics and Biotechnology (M2B3) standards for "Reporting" and "Serving" data. The M2B3 Reporting Standard (1) describes minimal mandatory and recommended contextual information for a marine microbial sample obtained in the epipelagic zone, (2) includes meaningful information for researchers in the oceanographic, biodiversity and molecular disciplines, and (3) can easily be adopted by any marine laboratory with minimum sampling resources. The M2B3 Service Standard defines a software interface through which these data can be discovered and explored in data repositories. The M2B3 Standards were developed by the European project Micro B3, funded under 7(th) Framework Programme "Ocean of Tomorrow", and were first used with the Ocean Sampling Day initiative. We believe that these standards have value in broader marine science.

  3. Unconventional quantum Hall effect in Floquet topological insulators

    KAUST Repository

    Tahir, M.

    2016-07-27

    We study an unconventional quantum Hall effect for the surface states of ultrathin Floquet topological insulators in a perpendicular magnetic field. The resulting band structure is modified by photon dressing and the topological property is governed by the low-energy dynamics of a single surface. An exchange of symmetric and antisymmetric surface states occurs by reversing the lights polarization. We find a novel quantum Hall state in which the zeroth Landau level undergoes a phase transition from a trivial insulator state, with Hall conductivity αyx = 0 at zero Fermi energy, to a Hall insulator state with αyx = e2/2h. These findings open new possibilities for experimentally realizing nontrivial quantum states and unusual quantum Hall plateaus at (±1/2,±3/2,±5/2, ...)e2/h. © 2016 IOP Publishing Ltd Printed in the UK.

  4. Formulation of the relativistic quantum Hall effect and parity anomaly

    Science.gov (United States)

    Yonaga, Kouki; Hasebe, Kazuki; Shibata, Naokazu

    2016-06-01

    We present a relativistic formulation of the quantum Hall effect on Haldane sphere. An explicit form of the pseudopotential is derived for the relativistic quantum Hall effect with/without mass term. We clarify particular features of the relativistic quantum Hall states with the use of the exact diagonalization study of the pseudopotential Hamiltonian. Physical effects of the mass term to the relativistic quantum Hall states are investigated in detail. The mass term acts as an interpolating parameter between the relativistic and nonrelativistic quantum Hall effects. It is pointed out that the mass term unevenly affects the many-body physics of the positive and negative Landau levels as a manifestation of the "parity anomaly." In particular, we explicitly demonstrate the instability of the Laughlin state of the positive first relativistic Landau level with the reduction of the charge gap.

  5. Asymmetric nonlinear response of the quantized Hall effect

    Science.gov (United States)

    Siddiki, A.; Horas, J.; Kupidura, D.; Wegscheider, W.; Ludwig, S.

    2010-11-01

    An asymmetric breakdown of the integer quantized Hall effect (IQHE) is investigated. This rectification effect is observed as a function of the current value and its direction in conjunction with an asymmetric lateral confinement potential defining the Hall bar. Our electrostatic definition of the Hall bar via Schottky gates allows a systematic control of the steepness of the confinement potential at the edges of the Hall bar. A softer edge (flatter confinement potential) results in more stable Hall plateaus, i.e. a breakdown at a larger current density. For one soft and one hard edge, the breakdown current depends on its direction, resembling rectification. This nonlinear magneto-transport effect confirms the predictions of an emerging screening theory of the IQHE.

  6. Construction and Operation of a Differential Hall Element Magnetometer

    Science.gov (United States)

    Calkins, Matthew W.; Javernick, Philip D.; Quintero, Pedro A.; Calm, Yitzi M.; Meisel, Mark W.

    2012-02-01

    A Differential Hall Element Magnetometer (DHEM) was constructed to measure the magnetic saturation and coercive fields of small samples consisting of magnetic nanoparticles that may have biomedical applications. The device consists of two matched Hall elements that can be moved through the room temperature bore of a 9 Tesla superconducting magnet. The Hall elements are wired in opposition such that a null response, to within a small offset, is measured in the absence of a sample that may be located on top of one unit. A LabVIEW program controls the current through the Hall elements and measures the net Hall voltage while simultaneously moving the probe through the magnetic field by regulating a linear stepper motor. Ultimately, the system will be tested to obtain a figure of merit using successively smaller samples. Details of the apparatus will be provided along with preliminary data.

  7. Suitable reverberation time for halls for rock and pop music

    DEFF Research Database (Denmark)

    Adelman-Larsen, Niels Werner; Thompson, Eric Robert; Gade, Anders Christian

    2010-01-01

    The existing body of literature regarding the acoustic design of concert halls has focused almost exclusively on classical music, although there are many more performances of popular music, including rock and pop. Objective measurements were made of the acoustics of 20 rock music venues in Denmark...... and a questionnaire was used in a subjective assessment of those venues with professional rock musicians and sound engineers as expert listeners. Correlations between the measurements show that clarity, including bass frequencies down to 63 Hz, is important for the general impression of the acoustics of the hall....... The best-rated halls in the study have reverberation times that are approximately frequency independent from 0.6 to 1.2 s for hall volumes from 1000 to 6000 m3. The worst rated halls in the study had significantly higher reverberation times in the 63 and 125 Hz bands. Since most audiences at rock concerts...

  8. Fractional quantum Hall states of bosons on cones

    Science.gov (United States)

    Wu, Ying-Hai; Tu, Hong-Hao; Sreejith, G. J.

    2017-09-01

    Motivated by a recent experiment, which synthesizes Landau levels for photons on cones [Schine et al., Nature (London) 534, 671 (2016), 10.1038/nature17943], and more generally the interest in understanding gravitational responses of quantum Hall states, we study fractional quantum Hall states of bosons on cones. A variety of trial wave functions for conical systems are constructed and compared with exact diagonalization results. The tip of a cone is a localized geometrical defect with singular curvature, which can modify the density profiles of quantum Hall states. The density profiles on cones can be used to extract some universal information about quantum Hall states. The values of certain quantities are computed numerically using the density profiles of some quantum Hall states and they agree with analytical predictions.

  9. NUCLEAR REACTOR CONTROL SYSTEM

    Science.gov (United States)

    Epler, E.P.; Hanauer, S.H.; Oakes, L.C.

    1959-11-01

    A control system is described for a nuclear reactor using enriched uranium fuel of the type of the swimming pool and other heterogeneous nuclear reactors. Circuits are included for automatically removing and inserting the control rods during the course of normal operation. Appropriate safety circuits close down the nuclear reactor in the event of emergency.

  10. Application of the Quantum Cluster Equilibrium (QCE) model for the liquid phase of primary alcohols using B3LYP and B3LYP-D DFT methods.

    Science.gov (United States)

    Matisz, Gergely; Kelterer, Anne-Marie; Fabian, Walter M F; Kunsági-Máté, Sándor

    2011-04-14

    The Quantum Cluster Equilibrium (QCE) model was applied to the liquid phase for the first few members of the homologous series of unbranched aliphatic primary alcohols, methanol, ethanol, propan-1-ol, and butan-1-ol. Cluster structures and energies were calculated by density functional theory [B3LYP/6-311++G(2d,2p)]. For butan-1-ol the dispersion interaction was also considered with the B3LYP-D method. In agreement with previous findings, cyclic cluster structures are the most probable ones. In addition, weak C-H...O interactions as well as dispersion interactions between the longer alkyl chains were found to be important in the cluster formation. The reliability of the model was assessed by the calculated constant pressure heat capacity (C(p)) values. Larger deviations between theory and experiment were found for higher homologes (propan-1-ol, butan-1-ol) with the B3LYP method. When the B3LYP-D method was applied for butan-1-ol, adequate agreement was found between experimental and calculated C(p) values.

  11. On-Chip Microwave Quantum Hall Circulator

    Directory of Open Access Journals (Sweden)

    A. C. Mahoney

    2017-01-01

    Full Text Available Circulators are nonreciprocal circuit elements that are integral to technologies including radar systems, microwave communication transceivers, and the readout of quantum information devices. Their nonreciprocity arises from the interference of microwaves over the centimeter scale of the signal wavelength, in the presence of bulky magnetic media that breaks time-reversal symmetry. Here, we realize a completely passive on-chip microwave circulator with size 1/1000th the wavelength by exploiting the chiral, “slow-light” response of a two-dimensional electron gas in the quantum Hall regime. For an integrated GaAs device with 330  μm diameter and about 1-GHz center frequency, a nonreciprocity of 25 dB is observed over a 50-MHz bandwidth. Furthermore, the nonreciprocity can be dynamically tuned by varying the voltage at the port, an aspect that may enable reconfigurable passive routing of microwave signals on chip.

  12. Layered quantum Hall insulators with ultracold atoms

    Energy Technology Data Exchange (ETDEWEB)

    Zamora, A. [ICFO-Institut de Ciencies Fotoniques, Av. Carl Friedrich Gauss 3, E-08860 Castelldefels (Barcelona) (Spain); Szirmai, G. [ICFO-Institut de Ciencies Fotoniques, Av. Carl Friedrich Gauss 3, E-08860 Castelldefels (Barcelona) (Spain); Research Institute for Solid State Physics and Optics, P.O. Box 49, H-1525 Budapest (Hungary); Lewenstein, M. [ICFO-Institut de Ciencies Fotoniques, Av. Carl Friedrich Gauss 3, E-08860 Castelldefels (Barcelona) (Spain); ICREA-Institucio Catalana de Recerca i Estudis Avancats, Passeig Lluis Companys 23, E-08010 Barcelona (Spain)

    2011-11-15

    We consider a generalization of the two-dimensional (2D) quantum Hall insulator to a noncompact, non-Abelian gauge group, the Heisenberg-Weyl group. We show that this kind of insulator is actually a layered three-dimensional (3D) insulator with nontrivial topology. We further show that nontrivial combinations of quantized transverse conductivities can be engineered with the help of a staggered potential. We investigate the robustness and topological nature of this conductivity and connect it to the surface modes of the system. We also propose a simple experimental realization with ultracold atoms in 3D confined to a 2D square lattice with the third dimension being mapped to a gauge coordinate.

  13. Magnetic circuit for hall effect plasma accelerator

    Science.gov (United States)

    Manzella, David H. (Inventor); Jacobson, David T. (Inventor); Jankovsky, Robert S. (Inventor); Hofer, Richard (Inventor); Peterson, Peter (Inventor)

    2009-01-01

    A Hall effect plasma accelerator includes inner and outer electromagnets, circumferentially surrounding the inner electromagnet along a thruster centerline axis and separated therefrom, inner and outer magnetic conductors, in physical connection with their respective inner and outer electromagnets, with the inner magnetic conductor having a mostly circular shape and the outer magnetic conductor having a mostly annular shape, a discharge chamber, located between the inner and outer magnetic conductors, a magnetically conducting back plate, in magnetic contact with the inner and outer magnetic conductors, and a combined anode electrode/gaseous propellant distributor, located at a bottom portion of the discharge chamber. The inner and outer electromagnets, the inner and outer magnetic conductors and the magnetically conducting back plate form a magnetic circuit that produces a magnetic field that is largely axial and radially symmetric with respect to the thruster centerline.

  14. Quantum Hall Effect in Hydrogenated Graphene

    Science.gov (United States)

    Guillemette, J.; Sabri, S. S.; Wu, Binxin; Bennaceur, K.; Gaskell, P. E.; Savard, M.; Lévesque, P. L.; Mahvash, F.; Guermoune, A.; Siaj, M.; Martel, R.; Szkopek, T.; Gervais, G.

    2013-04-01

    The quantum Hall effect is observed in a two-dimensional electron gas formed in millimeter-scale hydrogenated graphene, with a mobility less than 10cm2/V·s and corresponding Ioffe-Regel disorder parameter (kFλ)-1≫1. In a zero magnetic field and low temperatures, the hydrogenated graphene is insulating with a two-point resistance of the order of 250h/e2. The application of a strong magnetic field generates a negative colossal magnetoresistance, with the two-point resistance saturating within 0.5% of h/2e2 at 45 T. Our observations are consistent with the opening of an impurity-induced gap in the density of states of graphene. The interplay between electron localization by defect scattering and magnetic confinement in two-dimensional atomic crystals is discussed.

  15. Performance of Diesel Engine Using Diesel B3 Mixed with Crude Palm Oil

    Science.gov (United States)

    Namliwan, Nattapong; Wongwuttanasatian, Tanakorn

    2014-01-01

    The objective of this study was to test the performance of diesel engine using diesel B3 mixed with crude palm oil in ratios of 95 : 5, 90 : 10, and 85 : 15, respectively, and to compare the results with diesel B3. According to the tests, they showed that the physical properties of the mixed fuel in the ratio of 95 : 5 were closest to those of diesel B3. The performance of the diesel engine that used mixed fuels had 5–17% lower torque and power than that of diesel B3. The specific fuel consumption of mixed fuels was 7–33% higher than using diesel B3. The components of gas emissions by using mixed fuel had 1.6–52% fewer amount of carbon monoxide (CO), carbon dioxide (CO2), sulfur dioxide (SO2), and oxygen (O2) than those of diesel B3. On the other hand, nitric oxide (NO) and nitrogen oxides (NOX) emissions when using mixed fuels were 10–39% higher than diesel B3. By comparing the physical properties, the performance of the engine, and the amount of gas emissions of mixed fuel, we found out that the 95 : 5 ratio by volume was a suitable ratio for agricultural diesel engine (low-speed diesel engine). PMID:24688402

  16. Performance of diesel engine using diesel B3 mixed with crude palm oil.

    Science.gov (United States)

    Namliwan, Nattapong; Wongwuttanasatian, Tanakorn

    2014-01-01

    The objective of this study was to test the performance of diesel engine using diesel B3 mixed with crude palm oil in ratios of 95 : 5, 90 : 10, and 85 : 15, respectively, and to compare the results with diesel B3. According to the tests, they showed that the physical properties of the mixed fuel in the ratio of 95 : 5 were closest to those of diesel B3. The performance of the diesel engine that used mixed fuels had 5-17% lower torque and power than that of diesel B3. The specific fuel consumption of mixed fuels was 7-33% higher than using diesel B3. The components of gas emissions by using mixed fuel had 1.6-52% fewer amount of carbon monoxide (CO), carbon dioxide (CO2), sulfur dioxide (SO2), and oxygen (O2) than those of diesel B3. On the other hand, nitric oxide (NO) and nitrogen oxides (NO X ) emissions when using mixed fuels were 10-39% higher than diesel B3. By comparing the physical properties, the performance of the engine, and the amount of gas emissions of mixed fuel, we found out that the 95 : 5 ratio by volume was a suitable ratio for agricultural diesel engine (low-speed diesel engine).

  17. Evolution of the B3 DNA binding superfamily: new insights into REM family gene diversification.

    Directory of Open Access Journals (Sweden)

    Elisson A C Romanel

    Full Text Available BACKGROUND: The B3 DNA binding domain includes five families: auxin response factor (ARF, abscisic acid-insensitive3 (ABI3, high level expression of sugar inducible (HSI, related to ABI3/VP1 (RAV and reproductive meristem (REM. The release of the complete genomes of the angiosperm eudicots Arabidopsis thaliana and Populus trichocarpa, the monocot Orysa sativa, the bryophyte Physcomitrella patens,the green algae Chlamydomonas reinhardtii and Volvox carteri and the red algae Cyanidioschyzon melorae provided an exceptional opportunity to study the evolution of this superfamily. METHODOLOGY: In order to better understand the origin and the diversification of B3 domains in plants, we combined comparative phylogenetic analysis with exon/intron structure and duplication events. In addition, we investigated the conservation and divergence of the B3 domain during the origin and evolution of each family. CONCLUSIONS: Our data indicate that showed that the B3 containing genes have undergone extensive duplication events, and that the REM family B3 domain has a highly diverged DNA binding. Our results also indicate that the founding member of the B3 gene family is likely to be similar to the ABI3/HSI genes found in C. reinhardtii and V. carteri. Among the B3 families, ABI3, HSI, RAV and ARF are most structurally conserved, whereas the REM family has experienced a rapid divergence. These results are discussed in light of their functional and evolutionary roles in plant development.

  18. Antibody-mediated neutralization of myelin-associated EphrinB3 accelerates CNS remyelination.

    Science.gov (United States)

    Syed, Yasir A; Zhao, Chao; Mahad, Don; Möbius, Wiebke; Altmann, Friedrich; Foss, Franziska; González, G A; Sentürk, Aycan; Acker-Palmer, Amparo; Lubec, Gert; Lilley, Kathryn; Franklin, Robin J M; Nave, Klaus-A; Kotter, Mark R N

    2016-02-01

    Remyelination in multiple sclerosis (MS) lesions often remains incomplete despite the presence of oligodendrocyte progenitor cells (OPCs). Amongst other factors, successful remyelination depends on the phagocytic clearance of myelin debris. However, the proteins in myelin debris that act as potent and selective inhibitors on OPC differentiation and inhibit CNS remyelination remain unknown. Here, we identify the transmembrane signalling protein EphrinB3 as important mediator of this inhibition, using a protein analytical approach in combination with a primary rodent OPC assay. In the presence of EphrinB3, OPCs fail to differentiate. In a rat model of remyelination, infusion of EphrinB3 inhibits remyelination. In contrast, masking EphrinB3 epitopes using antibodies promotes remyelination. Finally, we identify EphrinB3 in MS lesions and demonstrate that MS lesion extracts inhibit OPC differentiation while antibody-mediated masking of EphrinB3 epitopes promotes it. Our findings suggest that EphrinB3 could be a target for therapies aiming at promoting remyelination in demyelinating disease.

  19. Nuclear reactor overflow line

    Science.gov (United States)

    Severson, Wayne J.

    1976-01-01

    The overflow line for the reactor vessel of a liquid-metal-cooled nuclear reactor includes means for establishing and maintaining a continuous bleed flow of coolant amounting to 5 to 10% of the total coolant flow through the overflow line to prevent thermal shock to the overflow line when the reactor is restarted following a trip. Preferably a tube is disposed concentrically just inside the overflow line extending from a point just inside the reactor vessel to an overflow tank and a suction line is provided opening into the body of liquid metal in the reactor vessel and into the annulus between the overflow line and the inner tube.

  20. Light water reactor safety

    CERN Document Server

    Pershagen, B

    2013-01-01

    This book describes the principles and practices of reactor safety as applied to the design, regulation and operation of light water reactors, combining a historical approach with an up-to-date account of the safety, technology and operating experience of both pressurized water reactors and boiling water reactors. The introductory chapters set out the basic facts upon which the safety of light water reactors depend. The central section is devoted to the methods and results of safety analysis. The accidents at Three Mile Island and Chernobyl are reviewed and their implications for light wate

  1. Nuclear reactor physics

    CERN Document Server

    Stacey, Weston M

    2010-01-01

    Nuclear reactor physics is the core discipline of nuclear engineering. Nuclear reactors now account for a significant portion of the electrical power generated worldwide, and new power reactors with improved fuel cycles are being developed. At the same time, the past few decades have seen an ever-increasing number of industrial, medical, military, and research applications for nuclear reactors. The second edition of this successful comprehensive textbook and reference on basic and advanced nuclear reactor physics has been completely updated, revised and enlarged to include the latest developme

  2. Spinning fluids reactor

    Science.gov (United States)

    Miller, Jan D; Hupka, Jan; Aranowski, Robert

    2012-11-20

    A spinning fluids reactor, includes a reactor body (24) having a circular cross-section and a fluid contactor screen (26) within the reactor body (24). The fluid contactor screen (26) having a plurality of apertures and a circular cross-section concentric with the reactor body (24) for a length thus forming an inner volume (28) bound by the fluid contactor screen (26) and an outer volume (30) bound by the reactor body (24) and the fluid contactor screen (26). A primary inlet (20) can be operatively connected to the reactor body (24) and can be configured to produce flow-through first spinning flow of a first fluid within the inner volume (28). A secondary inlet (22) can similarly be operatively connected to the reactor body (24) and can be configured to produce a second flow of a second fluid within the outer volume (30) which is optionally spinning.

  3. 17 CFR 275.203(b)(3)-2 - Methods for counting clients in certain private funds.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Methods for counting clients....203(b)(3)-2 Methods for counting clients in certain private funds. (a) For purposes of section 203(b)(3) of the Act (15 U.S.C. 80b-3(b)(3)), you must count as clients the shareholders, limited partners...

  4. The Hall Technique 10 years on: Questions and answers.

    Science.gov (United States)

    Innes, N P T; Evans, D J P; Bonifacio, C C; Geneser, M; Hesse, D; Heimer, M; Kanellis, M; Machiulskiene, V; Narbutaité, J; Olegário, I C; Owais, A; Araujo, M P; Raggio, D P; Splieth, C; van Amerongen, E; Weber-Gasparoni, K; Santamaria, R M

    2017-03-24

    It is ten years since the first paper on the Hall Technique was published in the British Dental Journal and almost 20 years since the technique first came to notice. Dr Norna Hall a (now retired) general dental practitioner from the north of Scotland had, for many years, been managing carious primary molar teeth by cementing preformed metal crowns over them, with no local anaesthesia, tooth preparation or carious tissue removal. This first report, a retrospective analysis of Dr Hall's treatments, caused controversy. How could simply sealing a carious lesion, with all the associated bacteria and decayed tissues, possibly be clinically successful? Since then, growing understanding that caries is essentially a biofilm driven disease rather than an infectious disease, explains why the Hall Technique, and other 'sealing in' carious lesion techniques, are successful. The intervening ten years has seen robust evidence from several randomised control trials that are either completed or underway. These have found the Hall Technique superior to comparator treatments, with success rates (no pain or infection) of 99% (UK study) and 100% (Germany) at one year, 98% and 93% over two years (UK and Germany) and 97% over five years (UK). The Hall Technique is now regarded as one of several biological management options for carious lesions in primary molars. This paper covers commonly asked questions about the Hall Technique and speculates on what lies ahead.

  5. Feasibility of ultra-sensitive 2D layered Hall elements

    Science.gov (United States)

    Joo, Min-Kyu; Kim, Joonggyu; Lee, Gwanmu; Kim, Hyun; Lee, Young Hee; Suh, Dongseok

    2017-06-01

    A Hall effect sensor is an analog transducer that detects a magnetic flux. The general requirements for its high magnetic sensitivity in conventional semiconductors are high carrier mobility and ultra-thin conduction channel in the material’s and the device’s point of view. Recently, graphene Hall elements (GHEs) that satisfy those conditions have been demonstrated with a current-normalized magnetic sensitivity (S I) superior to that of Si-based Hall sensors. Nevertheless, the feasibility of Hall elements based on an atomically thin monolayer transition metal dichalcogenide (TMD) system has not been studied thus far, although such a system would further enable a largely suppressed 2D carrier density. Herein, we show the strategy how to achieve the highest possible S I in a TMD-based Hall element in terms of the device structure as well as the operating bias condition. A monolayer molybdenum disulfide Hall element (MHE) on a hexagonal boron nitride (h-BN) thin film was fabricated, and the best bias conditions were selected based on the analytical model for zero-field transconductance data. Finally, the maximum S I of MHE/h-BN was found to be ~3000 V/AT. This work sheds light on the feasibility of TMD-based Hall element systems.

  6. Data of evolutionary structure change: 1AO5B-3BSQC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-3BSQC 1AO5 3BSQ B C VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTA...AHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSDDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPT-WQKPDDLQC...bChain>C 3BSQC TTTSPDVTFPS 3BSQ C 3BSQC DT

  7. Aplicación del modelo de psicoterapia breve intensiva de Leopold Bellak con mujeres en situación de violencia intrafamiliar que acuden al Centro de Equidad y Justicia de Calderón entre mayo y agosto de 2015

    OpenAIRE

    Fuertes Lagos, Alexandra Elizabeth

    2016-01-01

    Women in situations of domestic violence are the segment of the population widely demanding psychological care at the Centro de Equidad y Justicia de Calderón. To respond to this requirement, the application of the Intensive Brief Psychotherapy by Leopold Bellak is proposed. This model consists of 5 therapeutic sessions, plus a follow-up appointment, in which an entire understanding of the person is sought; main symptoms are identified and progressively treated in a positi...

  8. Proceso de intervención psicoterapéutica desde la perspectiva cognitivo conductual para la reducción de los niveles de ansiedad y depresión en mujeres víctimas de violencia intrafamiliar de la zona rural de Calderón abril- agosto 2016.

    OpenAIRE

    Castillo Pastor, Marcela Estefanía

    2017-01-01

    The following work postulates a therapeutic treatment that has been developed in the community of Calderón, made up of women victims of violence based on gender. They were evaluated with Test de ISRA to assess the level of anxiety and Beck Test for depression and, later, six participants entered a workshop to improve anxiety and depression symptoms. The paper contains chapters describing the context in which the research is developed, providing a conceptual framework of how gender-based vi...

  9. Sensitivity of resistive and Hall measurements to local inhomogeneities

    DEFF Research Database (Denmark)

    Koon, Daniel W.; Wang, Fei; Petersen, Dirch Hjorth

    2014-01-01

    We derive exact, analytic expressions for the sensitivity of sheet resistance and Hall sheet resistance measurements to local inhomogeneities for the cases of nonzero magnetic fields, strong perturbations, and perturbations over a finite area, extending our earlier results on weak perturbations. We...... express these sensitivities for conductance tensor components and for other charge transport quantities. Both resistive and Hall sensitivities, for a van der Pauw specimen in a finite magnetic field, are a superposition of the zero-field sensitivities to both sheet resistance and Hall sheet resistance...

  10. Effective Field Theory of Fractional Quantized Hall Nematics

    Energy Technology Data Exchange (ETDEWEB)

    Mulligan, Michael; /MIT, LNS; Nayak, Chetan; /Station Q, UCSB; Kachru, Shamit; /Stanford U., Phys. Dept. /SLAC

    2012-06-06

    We present a Landau-Ginzburg theory for a fractional quantized Hall nematic state and the transition to it from an isotropic fractional quantum Hall state. This justifies Lifshitz-Chern-Simons theory - which is shown to be its dual - on a more microscopic basis and enables us to compute a ground state wave function in the symmetry-broken phase. In such a state of matter, the Hall resistance remains quantized while the longitudinal DC resistivity due to thermally-excited quasiparticles is anisotropic. We interpret recent experiments at Landau level filling factor {nu} = 7/3 in terms of our theory.

  11. Anomalous Hall effect in Fe/Gd bilayers

    KAUST Repository

    Xu, W. J.

    2010-04-01

    Non-monotonic dependence of anomalous Hall resistivity on temperature and magnetization, including a sign change, was observed in Fe/Gd bilayers. To understand the intriguing observations, we fabricated the Fe/Gd bilayers and single layers of Fe and Gd simultaneously. The temperature and field dependences of longitudinal resistivity, Hall resistivity and magnetization in these films have also been carefully measured. The analysis of these data reveals that these intriguing features are due to the opposite signs of Hall resistivity/or spin polarization and different Curie temperatures of Fe and Gd single-layer films. Copyright (C) EPLA, 2010

  12. Signal conditioning and processing for metallic Hall sensors.

    Czech Academy of Sciences Publication Activity Database

    Entler, Slavomír; Ďuran, Ivan; Sládek, P.; Vayakis, G.; Kočan, M.

    2017-01-01

    Roč. 123, November (2017), s. 783-786 ISSN 0920-3796. [SOFT 2016: Symposium on Fusion Technology /29./. Prague, 05.09.2016-09.09.2016] R&D Projects: GA MŠk LG14002 Institutional support: RVO:61389021 Keywords : Hall sensor * Lock-in * Synchronous detection * Current spinning * Hall effect * Planar hall effect suppression Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.319, year: 2016 http://www.sciencedirect.com/science/article/pii/S0920379617305070

  13. TCC2, the target hall of the SPS North Area

    CERN Multimedia

    1978-01-01

    In the foreground can be seen the three proton beam branches leading to the targets enclosed in an assembly of iron blocks with the positioning mechanism on top. In the background, the six secondary beams lead off towards the experimental areas, H2/P2, H4/E4/P4 (from T2 via TT81) and H6, H8 (from T4 via TT82) towards the hall EHN1, M2 from T6 via TT83 towards the hall EHN2. The development proton beam line P0 leads off from T4 via TT83 towards TCC8 and hall ECN3 (NAHIF).

  14. Hall effect in CNT doped YBCO high temperature superconductor

    Directory of Open Access Journals (Sweden)

    S Dadras

    2010-09-01

    Full Text Available In order to study Hall effect in pure and CNT doped YBCO polycrystalline samples, we have measured longitudinal and transverse voltages at the different magnetic field (0-9T in the vortex state. We found a sign reversal for pure sample near 3T and double sign reversal of the Hall coefficient for CNT doped sample near 3 and 5T. It can be deduced that CNT doping caused strong flux pinning and Hall double sign reversal in this compound.

  15. 17 CFR 275.203(b)(3)-1 - Definition of “client” of an investment adviser.

    Science.gov (United States)

    2010-04-01

    ... Definition of “client” of an investment adviser. Preliminary Note to § 275.203(b)(3)-1. This section is a... single client for purposes of section 203(b)(3) of the Act. Under paragraph (b)(6) of this section, the... be a single client for purposes of section 203(b)(3) of the Act (15 U.S.C. 80b-3(b)(3)): (1) A...

  16. Neutron fluxes in test reactors

    Energy Technology Data Exchange (ETDEWEB)

    Youinou, Gilles Jean-Michel [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2017-01-01

    Communicate the fact that high-power water-cooled test reactors such as the Advanced Test Reactor (ATR), the High Flux Isotope Reactor (HFIR) or the Jules Horowitz Reactor (JHR) cannot provide fast flux levels as high as sodium-cooled fast test reactors. The memo first presents some basics physics considerations about neutron fluxes in test reactors and then uses ATR, HFIR and JHR as an illustration of the performance of modern high-power water-cooled test reactors.

  17. From University Heights to Cooperstown: Halls of Fame and American Memory

    Science.gov (United States)

    Friss, Evan J.

    2005-01-01

    This article examines the development and function of American halls of fame as cultural memory institutions. By comparing the Hall of Fame for Great Americans with the National Baseball Hall of Fame, the author posits that halls of fame illuminate the ways in which cultural memory institutions can, through an archival process, preserve, instill,…

  18. HORIZONTAL BOILING REACTOR SYSTEM

    Science.gov (United States)

    Treshow, M.

    1958-11-18

    Reactors of the boiling water type are described wherein water serves both as the moderator and coolant. The reactor system consists essentially of a horizontal pressure vessel divided into two compartments by a weir, a thermal neutronic reactor core having vertical coolant passages and designed to use water as a moderator-coolant posltioned in one compartment, means for removing live steam from the other compartment and means for conveying feed-water and water from the steam compartment to the reactor compartment. The system further includes auxiliary apparatus to utilize the steam for driving a turbine and returning the condensate to the feed-water inlet of the reactor. The entire system is designed so that the reactor is self-regulating and has self-limiting power and self-limiting pressure features.

  19. Fast Spectrum Reactors

    CERN Document Server

    Todd, Donald; Tsvetkov, Pavel

    2012-01-01

    Fast Spectrum Reactors presents a detailed overview of world-wide technology contributing to the development of fast spectrum reactors. With a unique focus on the capabilities of fast spectrum reactors to address nuclear waste transmutation issues, in addition to the well-known capabilities of breeding new fuel, this volume describes how fast spectrum reactors contribute to the wide application of nuclear power systems to serve the global nuclear renaissance while minimizing nuclear proliferation concerns. Readers will find an introduction to the sustainable development of nuclear energy and the role of fast reactors, in addition to an economic analysis of nuclear reactors. A section devoted to neutronics offers the current trends in nuclear design, such as performance parameters and the optimization of advanced power systems. The latest findings on fuel management, partitioning and transmutation include the physics, efficiency and strategies of transmutation, homogeneous and heterogeneous recycling, in addit...

  20. Magnesium Hall Thruster for Solar System Exploration Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The innovation being developed in this program is a Mg Hall Effect Thruster system that would open the door for In-Situ Resource Utilization based solar system...

  1. High Throughput Hall Thruster for Small Spacecraft Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Busek is developing a high throughput nominal 100-W Hall Effect Thruster. This device is well sized for spacecraft ranging in size from several tens of kilograms to...

  2. High Throughput Hall Thruster for Small Spacecraft Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Busek Co. Inc. proposes to develop a high throughput, nominal 100 W Hall Effect Thruster (HET). This HET will be sized for small spacecraft (< 180 kg), including...

  3. Pragmatic data fusion uncertainty concerns: Tribute to Dave L. Hall

    CSIR Research Space (South Africa)

    Blasch, E

    2016-07-01

    Full Text Available Over the course of Dave Hall's career, he highlighted various concerns associated with the implementation of data fusion methods. Many of the issues included the role of uncertainty in data fusion, practical implementation of sensor fusion systems...

  4. High Input Voltage Hall Thruster Discharge Converter Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The overall scope of this Phase I/II effort is the development of a high efficiency 15kW (nominal) Hall thruster discharge converter. In Phase I, Busek Co. Inc. will...

  5. Recent concert halls and opera house in Japan

    Science.gov (United States)

    Hidaka, Takayuki

    2004-05-01

    Since we invited Dr. Beranek to Japan for the first time in 1989, we had been working together with him for a period of 13 years, until 2001, on seven hall projects as acoustic design consultants. All of these halls are of premium importance to Japan. Dr. Beranek always came up with innovative concepts and helped create halls endowed with high acoustic originality. These halls are now loved by music-related people and music fanciers and regarded as the pride of Japan. The reviews and studies achieved through these projects were published as seven J. Acoust Soc. Am papers to disclose the outcome in an objective way to the public. A brief outline of the history of our collaboration and its background are presented.

  6. Quantum Theory of Conducting Matter Superconductivity and Quantum Hall Effect

    CERN Document Server

    Fujita, Shigeji; Godoy, Salvador

    2009-01-01

    Explains major superconducting properties including zero resistance, Meissner effect, sharp phase change, flux quantization, excitation energy gap, and Josephson effects using quantum statistical mechanical calculations. This book covers the 2D superconductivity and the quantum Hall effects

  7. Investigating Anisotropic Quantum Hall States with Bimetric Geometry

    Science.gov (United States)

    Gromov, Andrey; Geraedts, Scott D.; Bradlyn, Barry

    2017-10-01

    We construct a low energy effective theory of anisotropic fractional quantum Hall (FQH) states. We develop a formalism similar to that used in the bimetric approach to massive gravity, and apply it to describe Abelian anisotropic FQH states in the presence of external electromagnetic and geometric backgrounds. We derive a relationship between the shift, the Hall viscosity, and a new quantized coupling to anisotropy, which we term anisospin. We verify this relationship by numerically computing the Hall viscosity for a variety of anisotropic quantum Hall states using the density matrix renormalization group. Finally, we apply these techniques to the problem of nematic order and clarify certain disagreements that exist in the literature about the meaning of the coefficient of the Berry phase term in the nematic effective action.

  8. A High Performance Cathode Heater for Hall Thrusters Project

    Data.gov (United States)

    National Aeronautics and Space Administration — High current hollow cathodes are the baseline electron source for next generation high power Hall thrusters. Currently for electron sources providing current levels...

  9. Quantized anomalous Hall effect in magnetic topological insulators.

    Science.gov (United States)

    Yu, Rui; Zhang, Wei; Zhang, Hai-Jun; Zhang, Shou-Cheng; Dai, Xi; Fang, Zhong

    2010-07-02

    The anomalous Hall effect is a fundamental transport process in solids arising from the spin-orbit coupling. In a quantum anomalous Hall insulator, spontaneous magnetic moments and spin-orbit coupling combine to give rise to a topologically nontrivial electronic structure, leading to the quantized Hall effect without an external magnetic field. Based on first-principles calculations, we predict that the tetradymite semiconductors Bi2Te3, Bi2Se3, and Sb2Te3 form magnetically ordered insulators when doped with transition metal elements (Cr or Fe), in contrast to conventional dilute magnetic semiconductors where free carriers are necessary to mediate the magnetic coupling. In two-dimensional thin films, this magnetic order gives rise to a topological electronic structure characterized by a finite Chern number, with the Hall conductance quantized in units of e2/h (where e is the charge of an electron and h is Planck's constant).

  10. Magnesium Hall Thruster for Solar System Exploration Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Busek proposes to prove the feasibility of a Mg Hall effect thruster system that would open the door for In-Situ Resource Utilization (ISRU) based solar system...

  11. Positive operator valued measures and the quantum Monty Hall problem

    Directory of Open Access Journals (Sweden)

    Claudia Zander

    2006-09-01

    Full Text Available A quantum version of the Monty Hall problem, based upon the Positive Operator Valued Measures (POVM formalism, is proposed. It is shown that basic normalization and symmetry arguments lead univocally to the associated POVM elements, and that the classical probabilities associated with the Monty Hall scenario are recovered for a natural choice of the measurement operators.Uma visão quântica do problema Monty Hall é proposta baseada no formalismo das Medidas Avaliadas do Operador Positivo (POVM. Demonstra-se que os argumentos de normalização básica e simetria levam de maneira inequívoca para elementos associados a POVM e que as probabilidades clássicas associadas ao cenário Monty Hall são recuperadas para uma escolha natural de medidas operadoras.

  12. Survey of the Fermilab D0 detector collision hall

    Energy Technology Data Exchange (ETDEWEB)

    Babatunde O' Sheg Oshinowo

    2001-07-20

    The Fermilab D0 detector was used for the discovery of the top quark during Run I in 1996. It had been upgraded to exploit the physics potential to be presented by the Main Injector and the Tevatron Collider during Run II. The upgrade of the D0 detector was fully commissioned on March 1, 2001, and thus marked the official start of the Run II experiment. The detector which weighs about 5500 tons, was assembled in the Assembly Hall. Prior to moving the detector into the Collision Hall, the existing survey monuments were densified in the Collision Hall with new monuments. This paper discusses the survey of the Collision Hall using a combination of the Laser Tracker, BETS, V-Stars, and other Optical systems to within the specified accuracy of {+-}0.5mm.

  13. Hall Mobility of Amorphous Ge2Sb2Te5

    National Research Council Canada - National Science Library

    Baily, S. A; Emin, David; Li, Heng

    2006-01-01

    The electrical conductivity, Seebeck coefficient, and Hall coefficient of 3 micron thick films of amorphous Ge2Sb2Te5 have been measured as functions of temperature from room temperature down to as low as 200 K...

  14. Acoustics in Halls for Speech and Music

    Science.gov (United States)

    Gade, Anders C.

    This chapter deals specifically with concepts, tools, and architectural variables of importance when designing auditoria for speech and music. The focus will be on cultivating the useful components of the sound in the room rather than on avoiding noise from outside or from installations, which is dealt with in Chap. 11. The chapter starts by presenting the subjective aspects of the room acoustic experience according to consensus at the time of writing. Then follows a description of their objective counterparts, the objective room acoustic parameters, among which the classical reverberation time measure is only one of many, but still of fundamental value. After explanations on how these parameters can be measured and predicted during the design phase, the remainder of the chapter deals with how the acoustic properties can be controlled by the architectural design of auditoria. This is done by presenting the influence of individual design elements as well as brief descriptions of halls designed for specific purposes, such as drama, opera, and symphonic concerts. Finally, some important aspects of loudspeaker installations in auditoria are briefly touched upon.

  15. Quantum Spin Hall phase in multilayer graphene

    Science.gov (United States)

    Garcia, Noel; Lado, Jose Luis; Fernandez-Rossier, Joaquin; Theory of Nanostructures Team

    2015-03-01

    We address the question of whether multilayer graphene systems are Quantum Spin Hall (QSH) insulators. Since interlayer coupling coples pz orbitals to s orbitals of different layers and Spin-Orbit (SO) couples pz orbitals with px and py of opposite spins, new spins mixing channels appear in the multilayer scenario that were not present in the monolayer. These new spin-mixing channels cast a doubt on the validity of the spin-conserving Kane-Mele model for multilayers and motivates our choice of a four orbital tight-binding model in the Slater-Koster approximation with intrinsic Spin-Orbit interaction. To completely determine if the QSH phase is present we calculate for different number of layers both the Z2 invariant for different stackings (only for inversion symmetric systems), and the density of states at the edge of semi-infinite graphene ribbon with armchair termination. We find that systems with even number of layers are normal insulators while systems with odd number of layers are QSH insulators, regardless of the stacking. We acknowledge financial support by Marie-Curie-ITN 607904-SPINOGRAPH.

  16. The integer quantum hall effect revisited

    Energy Technology Data Exchange (ETDEWEB)

    Michalakis, Spyridon [Los Alamos National Laboratory; Hastings, Matthew [Q STATION, CALIFORNIA

    2009-01-01

    For T - L x L a finite subset of Z{sup 2}, let H{sub o} denote a Hamiltonian on T with periodic boundary conditions and finite range, finite strength intetactions and a unique ground state with a nonvanishing spectral gap. For S {element_of} T, let q{sub s} denote the charge at site s and assume that the total charge Q = {Sigma}{sub s {element_of} T} q{sub s} is conserved. Using the local charge operators q{sub s}, we introduce a boundary magnetic flux in the horizontal and vertical direction and allow the ground state to evolve quasiadiabatically around a square of size one magnetic flux, in flux space. At the end of the evolution we obtain a trivial Berry phase, which we compare, via a method reminiscent of Stokes Theorem. to the Berry phase obtained from an evolution around an exponentially small loop near the origin. As a result, we show, without any averaging assumption, that the Hall conductance is quantized in integer multiples of e{sup 2}/h up to exponentially small corrections of order e{sup -L/{zeta}}, where {zeta}, is a correlation length that depends only on the gap and the range and strength of the interactions.

  17. Brand new hall in the main building

    CERN Multimedia

    Corinne Pralavorio

    2014-01-01

    The renovation of the UNIQA and post office premises is getting under way, with their reopening scheduled for the spring.   The renovation of the large hall in the main building (Building 500) has finally reached the home straight. As of this week, building contractors will get to work on the last part – the offices of UNIQA and La Poste. In the last week of November, the two concessions moved their offices across Route Scherrer to the same part of Building 510 where UBS was temporarily housed during the bank’s refurbishment. Their services were therefore unavailable for one day. The renovation work will last until the spring, with the new offices expected to open in May 2015. Between now and then, the windows and insulation will be completely refitted, with a view to reducing heat loss considerably, and, above all, the premises will be modernised to improve customer reception and service. For example, UNIQA’s new premises will feature a confidential area, guarantee...

  18. Supersymmetry in the fractional quantum Hall regime

    Science.gov (United States)

    Sagi, Eran; Santos, Raul A.

    2017-05-01

    Supersymmetry (SUSY) is a symmetry transforming bosons to fermions and vice versa. Indications of its existence have been extensively sought after in high-energy experiments. However, signatures of SUSY have yet to be detected. In this paper we study a condensed matter realization of SUSY on the edge of a Read-Rezayi quantum Hall state, given by filling factors of the form ν =k/k +2 , where k is an integer. As we show explicitly, this strongly interacting state exhibits an N =2 SUSY. This allows us to use a topological invariant—the Witten index—defined specifically for supersymmetric theories, to count the difference between the number of bosonic and fermionic zero modes in a circular edge. In this system, we argue that the edge hosts k +1 protected zero modes. We further discuss the stability of SUSY with respect to generic perturbations and find that much of the above results remain unchanged. In particular, these results directly apply to the well-established ν =1 /3 Laughlin state, in which case SUSY is a robust property of the edge theory. These results unveil a hidden topological structure on the long-studied Read-Rezayi states.

  19. THERMAL NEUTRONIC REACTOR

    Science.gov (United States)

    Spinrad, B.I.

    1960-01-12

    A novel thermal reactor was designed in which a first reflector formed from a high atomic weight, nonmoderating material is disposed immediately adjacent to the reactor core. A second reflector composed of a moderating material is disposed outwardly of the first reflector. The advantage of this novel reflector arrangement is that the first reflector provides a high slow neutron flux in the second reflector, where irradiation experiments may be conducted with a small effect on reactor reactivity.

  20. ErbB3 mRNA leukocyte levels as a biomarker for major depressive disorder

    Directory of Open Access Journals (Sweden)

    Milanesi Elena

    2012-09-01

    Full Text Available Abstract Background In recent years, the identification of peripheral biomarkers that are associated with psychiatric diseases, such as Major Depressive Disorder (MDD, has become relevant because these biomarkers may improve the efficiency of the differential diagnosis process and indicate targets for new antidepressant drugs. Two recent candidate genes, ErbB3 and Fgfr1, are growth factors whose mRNA levels have been found to be altered in the leukocytes of patients that are affected by bipolar disorder in a depressive state. On this basis, the aim of the study was to determine if ErbB3 and Fgfr1 mRNA levels could be a biomarkers of MDD. Methods We measured by Real Time PCR ErbB3 and Fgfr1 mRNA expression levels in leukocytes of MDD patients compared with controls. Successively, to assess whether ErbB3 mRNA levels were influenced by previous antidepressant treatment we stratified our patients sample in two cohorts, comparing drug-naive versus drug-free patients. Moreover, we evaluated the levels of the transcript in MDD patients after 12 weeks of antidepressant treatment, and in prefrontal cortex of rats stressed and treated with an antidepressant drug of the same class. Results These results showed that ErbB3 but not Fgfr1 mRNA levels were reduced in leukocytes of MDD patients compared to healthy subjects. Furthermore, ErbB3 levels were not affected by antidepressant treatment in either human or animal models Conclusions Our data suggest that ErbB3 might be considered as a biomarker for MDD and that its deficit may underlie the pathopsysiology of the disease and is not a consequence of treatment. Moreover the study supports the usefulness of leukocytes as a peripheral system for identifying biomarkers in psychiatric diseases.

  1. Low-Cost, High-Performance Hall Thruster Support System

    Science.gov (United States)

    Hesterman, Bryce

    2015-01-01

    Colorado Power Electronics (CPE) has built an innovative modular PPU for Hall thrusters, including discharge, magnet, heater and keeper supplies, and an interface module. This high-performance PPU offers resonant circuit topologies, magnetics design, modularity, and a stable and sustained operation during severe Hall effect thruster current oscillations. Laboratory testing has demonstrated discharge module efficiency of 96 percent, which is considerably higher than current state of the art.

  2. What is the Hallé? | Smith | Philosophical Papers

    African Journals Online (AJOL)

    I address what I call 'the number issue', which is raised by our ordinary talk and beliefs about certain social groups and institutions, and I take the Hallé orchestra as my example. The number issue is that of whether the Hallé is one individual or several individuals. I observe that if one holds that it is one individual, one faces ...

  3. Pseudospectral Model for Hybrid PIC Hall-effect Thruster Simulation

    Science.gov (United States)

    2015-07-01

    Paper 3. DATES COVERED (From - To) July 2015-July 2015 4. TITLE AND SUBTITLE Pseudospectral model for hybrid PIC Hall-effect thruster simulationect...of a pseudospectral azimuthal-axial hybrid- PIC HET code which is designed to explicitly resolve and filter azimuthal fluctuations in the...661-275-5908 Standard Form 298 (Rev. 8-98) Prescribed by ANSI Std. 239.18 Pseudospectral model for hybrid PIC Hall-effect thruster simulation IEPC

  4. High-performance LED luminaire for sports hall

    Science.gov (United States)

    Lee, Xuan-Hao; Yang, Jin-Tsung; Chien, Wei-Ting; Chang, Jung-Hsuan; Lo, Yi-Chien; Lin, Che-Chu; Sun, Ching-Cherng

    2015-09-01

    In this paper, we present a luminaire design with anti-glare and energy-saving effects for sports hall. Compared with traditional lamps using in a badminton court, the average illuminance on the ground of the proposed LED luminaire is enhanced about 300%. Besides, the uniformity is obviously enhanced and improved. The switch-on speed of lighting in sports hall is greatly reduced from 5-10 minutes to 1 second. The simulation analysis and the corresponding experiment results are demonstrated.

  5. Quantum Hall Mach-Zehnder interferometer at fractional filling factors

    OpenAIRE

    Deviatov, E. V.; Egorov, S. V.; Biasiol, G.; Sorba, L.

    2012-01-01

    We use a Mach-Zehnder quantum Hall interferometer of a novel design to investigate the interference effects at fractional filling factors. Our device brings together the advantages of usual Mach-Zehnder and Fabry-Perot quantum Hall interferometers. It realizes the simplest-for-analysis Mach-Zehnder interference scheme, free from Coulomb blockade effects. By contrast to the standard Mach-Zehnder realization, our device does not contain an etched region inside the interference loop. For the fir...

  6. Hall effect in amorphous calcium-aluminum alloys

    Science.gov (United States)

    Mayeya, F. M.; Howson, M. A.

    1994-02-01

    We present results of the Hall effect measurements in CaAl(Au) amorphous alloys. The Hall coefficients have been found to be negative and independent of temperature. Their magnitudes deviate significantly from the nearly-free-electron calculations, and are reduced by gold doping. These deviations have been accounted for from considerations of the unusual electronic structure of CaAl, and the effects of both s-d hybridization and side-jump mechanism on the conduction electrons.

  7. Stainless Steel Crown Placement Utilizing the Hall Technique

    Science.gov (United States)

    2017-03-23

    Utilizing the Hall Technique 6. TITLE OF MATERIAL TO BE PUBLISHED OR PRESENTED: Stainless Steel Crown Placement Utilizing the Hall Technique 7. FUNDING...40-401 IP. AND 59 MDWI 41-108. I HAVE READ THE FINAL VERSION OF THE ATTACHED MATERIAL AND CERTIFY THAT IT IS AN ACCURATE MANUS-CRIPT FOR PUBLICATION...DEPARTMENT OF THE AIR FORCE 59TH MEDICAL WING (AETC) JOINT BASE SAN ANTONIO - LACKLAND TEXAS MEMORANDUM FOR SGDTG ATIN: LCDR DANIEL J. FUHRMANN

  8. Remote Reactor Monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Bernstein, Adam [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Dazeley, Steve [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Dobie, Doug [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Marleau, Peter [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Brennan, Jim [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Gerling, Mark [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Sumner, Matthew [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Sweany, Melinda [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2014-10-21

    The overall goal of the WATCHMAN project is to experimentally demonstrate the potential of water Cerenkov antineutrino detectors as a tool for remote monitoring of nuclear reactors. In particular, the project seeks to field a large prototype gadolinium-doped, water-based antineutrino detector to demonstrate sensitivity to a power reactor at ~10 kilometer standoff using a kiloton scale detector. The technology under development, when fully realized at large scale, could provide remote near-real-time information about reactor existence and operational status for small operating nuclear reactors out to distances of many hundreds of kilometers.

  9. Development of reactor graphite

    Science.gov (United States)

    Haag, G.; Mindermann, D.; Wilhelmi, G.; Persicke, H.; Ulsamer, W.

    1990-04-01

    The German graphite development programme for High Temperature Reactors has been based on the assumption that reactor graphite for core components with lifetime fluences of up to 4 × 10 22 neutrons per cm 2 (EDN) at 400°C can be manufactured from regular pitch coke. The use of secondary coke and vibrational moulding techniques have allowed production of materials with very small anisotropy, high strength, and high purity which are the most important properties of reactor graphite. A variety of graphite grades has been tested in fast neutron irradiation experiments. The results show that suitable graphites for modern High Temperature Reactors with spherical fuel elements are available.

  10. Oscillatory flow chemical reactors

    National Research Council Canada - National Science Library

    Slavnić Danijela S; Bugarski Branko M; Nikačević Nikola M

    2014-01-01

    .... However, the reactions of interests for the mentioned industry sectors are often slow, thus continuous tubular reactors would be impractically long for flow regimes which provide sufficient heat...

  11. Membrane reactors at Degussa.

    Science.gov (United States)

    Wöltinger, Jens; Karau, Andreas; Leuchtenberger, Wolfgang; Drauz, Karlheinz

    2005-01-01

    The review covers the development of membrane reactor technologies at Degussa for the synthesis of fine chemicals. The operation of fed-batch or continuous biocatalytic processes in the enzyme membrane reactor (EMR) is well established at Degussa. Degussa has experience of running EMRs from laboratory gram scale up to a production scale of several hundreds of tons per year. The transfer of the enzyme membrane reactor from biocatalysis to chemical catalysis in the chemzyme membrane reactor (CMR) is discussed. Various homogeneous catalysts have been investigated in the CMR, and the scope and limitation of this new technique is discussed.

  12. Pressurizing new reactors

    Energy Technology Data Exchange (ETDEWEB)

    Neill, J.S.

    1956-01-30

    The Technical Division was asked recently to consider designs for new reactors that would add 8000 MW capacity to the Savannah River Plant. One modification of the existing SRP design that would enable a higher power rating, and therefore require fewer new reactors, is an increase in the maximum pressure in the D{sub 2}O system. The existing reactors at SRP are designed for a maximum pressure in the gas plenum of only 5 psig. Higher pressures enable higher D{sub 2} temperatures and higher sheath temperatures without local boiling or burnout. The requirements in reactor cooling facilities at any given power level would therefore be reduced by pressurizing.

  13. HOMOGENEOUS NUCLEAR POWER REACTOR

    Science.gov (United States)

    King, L.D.P.

    1959-09-01

    A homogeneous nuclear power reactor utilizing forced circulation of the liquid fuel is described. The reactor does not require fuel handling outside of the reactor vessel during any normal operation including complete shutdown to room temperature, the reactor being selfregulating under extreme operating conditions and controlled by the thermal expansion of the liquid fuel. The liquid fuel utilized is a uranium, phosphoric acid, and water solution which requires no gus exhaust system or independent gas recombining system, thereby eliminating the handling of radioiytic gas.

  14. Tunnelling anomalous and planar Hall effects (Conference Presentation)

    Science.gov (United States)

    Matos-Abiague, Alex; Scharf, Benedikt; Han, Jong E.; Hankiewicz, Ewelina M.; Zutic, Igor

    2016-10-01

    We theoretically show how the interplay between spin-orbit coupling (SOC) and magnetism can result in a finite tunneling Hall conductance, transverse to the applied bias. For two-dimensional tunnel junctions with a ferromagnetic lead and magnetization perpendicular to the current flow, the detected anomalous Hall voltage can be used to extract information not only about the spin polarization but also about the strength of the interfacial SOC. In contrast, a tunneling current across a ferromagnetic barrier on the surface of a three-dimensional topological insulator (TI) can induce a planar Hall response even when the magnetization is oriented along the current flow[1]. The tunneling nature of the states contributing to the planar Hall conductance can be switched from the ordinary to the Klein regimes by the electrostatic control of the barrier strength. This allows for an enhancement of the transverse response and a giant Hall angle, with the tunneling planar Hall conductance exceeding the longitudinal component. Despite the simplicity of a single ferromagnetic region, the TI/ferromagnet system exhibits a variety of functionalities. In addition to a spin-valve operation for magnetic sensing and storing information, positive, negative, and negative differential conductances can be tuned by properly adjusting the barrier potential and/or varying the magnetization direction. Such different resistive behaviors in the same system are attractive for potential applications in reconfigurable spintronic devices. [1] B. Scharf, A. Matos-Abiague, J. E. Han, E. M. Hankiewicz, and I. Zutic, arXiv:1601.01009 (2016).

  15. Analysis of the radiometric survey during the Argonauta reactor operation; Analise do levantamento radiometrico durante operacao do reator Argonauta

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Eara de S.L.; Cardozo, Katia K.M.; Silva, Joao Carlos P.; Santos, Joao Regis dos, E-mail: esluz@ien.gov.br, E-mail: cardozo@ien.gov.br, E-mail: jcarlos@ien.gov.br, E-mail: regis@ien.gov.br [Instituto de Engenharia Nuclear (CNEN-IEN/RJ), Rio de Janeiro - RJ (Brazil)

    2013-07-01

    The Argonaut reactor at the Institute of Nuclear Engineering-IEN/CNEN, operates normally, the powers between 1.7 and 340 W on neutrongraphy procedures, production of radionuclides and experimental reactor physics lessons to postgraduate courses. The doses from neutrons and gamma radiation are measured when the reactor is critical, inside the reactor hall and surrounding regions. A study of the data obtained was performed to evaluate the daily need of this survey in the reactor hall. Taking into account the principle ALARA, which aims to optimize and minimize the dose received by the individual, we propose, in this work, through an analysis of the acquired data in occupational radiometric surveys, a reformulation of the area monitoring routine practiced by the team of radiological protection of the Institute of Nuclear Engineering - IEN/CNEN-RJ, whereas other monitoring routines regarding the radiological protection are also applied in the routine of the reactor. The operations under review occurred with the reactor operating 340 W power at intervals of 60, 120 and 180 minutes, in monitoring points in controlled areas, supervised and free. The results showed significant dose values in the output of the J-Channel 9 when the operation occurs with this open. With 180 minutes of operation, the measured values of dose rate were lower than the values at 60 min and 120 operations min. At the point in the supervised area, offsite to the reactor hall, situated in the direction of the J-Channel 9, the value reduces more than 14% in any operating time in relation to the dose rate measured at the point opposite the canal. There is a 50% reduction in the dose rates for operations with and J-9 closed. The results suggest a new frequency of radiometric survey whose mode of operation is maintained in similar conditions, since combined with other relevant practices of radiation protection.

  16. Mode Transitions in Hall Effect Thrusters

    Science.gov (United States)

    Sekerak, Michael J.; Longmier, Benjamin W.; Gallimore, Alec D.; Brown, Daniel L.; Hofer, Richard R.; Polk, James E.

    2013-01-01

    Mode transitions have been commonly observed in Hall Effect Thruster (HET) operation where a small change in a thruster operating parameter such as discharge voltage, magnetic field or mass flow rate causes the thruster discharge current mean value and oscillation amplitude to increase significantly. Mode transitions in a 6-kW-class HET called the H6 are induced by varying the magnetic field intensity while holding all other operating parameters constant and measurements are acquired with ion saturation probes and ultra-fast imaging. Global and local oscillation modes are identified. In the global mode, the entire discharge channel oscillates in unison and azimuthal perturbations (spokes) are either absent or negligible. Downstream azimuthally spaced probes show no signal delay between each other and are very well correlated to the discharge current signal. In the local mode, signals from the azimuthally spaced probes exhibit a clear delay indicating the passage of "spokes" and are not well correlated to the discharge current. These spokes are localized oscillations propagating in the ExB direction that are typically 10-20% of the mean value. In contrast, the oscillations in the global mode can be 100% of the mean value. The transition between global and local modes occurs at higher relative magnetic field strengths for higher mass flow rates or higher discharge voltages. The thrust is constant through mode transition but the thrust-to-power decreased by 25% due to increasing discharge current. The plume shows significant differences between modes with the global mode significantly brighter in the channel and the near-field plasma plume as well as exhibiting a luminous spike on thruster centerline. Mode transitions provide valuable insight to thruster operation and suggest improved methods for thruster performance characterization.

  17. Fasciola gigantica: production and characterization of a monoclonal antibody against recombinant cathepsin B3.

    Science.gov (United States)

    Anuracpreeda, Panat; Songkoomkrong, Sineenart; Sethadavit, Manussabhorn; Chotwiwatthanakun, Charoonroj; Tinikul, Yotsawan; Sobhon, Prasert

    2011-02-01

    A number of monoclonal antibodies (MoAbs) against a recombinant cathepsin B3 (rCatB3) of Fasciola gigantica were produced in BALB/c mice. Reactivity and specificity of these MoAbs were assessed by indirect ELISA and immunoblotting techniques. Six stable clones, namely 1C4, 1E9, 2E5, 2F9, 5B4, 5D7 were obtained. All MoAbs reacted with rCatB3 at molecular weight (MW) 37 kDa as well as the glycosylated peptide at 55-75 kDa and with the native CatB3 at MW 37 kDa in WB extracts of metacercariae (Met) and newly excysted juveniles (NEJ). It was found to be IgG(1) and λ light chain isotypes. Immunolocalization of CatB3 in metacercariae, NEJ, 4-week-old juvenile and adult F. gigantica performed by immunoperoxidase technique by using these MoAbs as probes indicated that CatB3 was present in high concentration in the caecal epithelium and caecal lumen of the Met and NEJ, but not in the 4-week-old juvenile and adult fluke. The MoAbs show no cross-reactions with antigens of other parasites including Gigantocotyl explanatum, Eurytrema pancreaticum, Paramphistomum cervi, Schistosoma spindale, S. mansoni, Haemonchus placei and Setaria labiato-papillosa. Thus, it is possible that these MoAbs could be a good candidate for immunodiagnosis of fasciolosis. Copyright © 2010 Elsevier Inc. All rights reserved.

  18. Technical specifications, Hanford production reactors

    Energy Technology Data Exchange (ETDEWEB)

    Gilbert, W.D. [comp.

    1962-06-25

    These technical specifications are applicable to the eight operating production reactor facilities, B, C, D, DR, F, H, KE, and KW. Covered are operating and performance restrictions and administrative procedures. Areas covered by the operating and performance restrictions are reactivity, reactor control and safety elements, power level, temperature and heat flux, reactor fuel loadings, reactor coolant systems, reactor confinement, test facilities, code compliance, and reactor scram set points. Administrative procedures include process control procedures, training programs, audits and inspections, and reports and records.

  19. Reactor Materials Research

    Energy Technology Data Exchange (ETDEWEB)

    Van Walle, E

    2001-04-01

    The activities of the Reactor Materials Research Department of the Belgian Nuclear Research Centre SCK-CEN in 2000 are summarised. The programmes within the department are focussed on studies concerning (1) fusion, in particular mechanical testing; (2) Irradiation Assisted Stress Corrosion Cracking (IASCC); (3) nuclear fuel; and (4) Reactor Pressure Vessel Steel (RPVS)

  20. Space Nuclear Reactor Engineering

    Energy Technology Data Exchange (ETDEWEB)

    Poston, David Irvin [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-03-06

    We needed to find a space reactor concept that could be attractive to NASA for flight and proven with a rapid turnaround, low-cost nuclear test. Heat-pipe-cooled reactors coupled to Stirling engines long identified as the easiest path to near-term, low-cost concept.

  1. REFLECTOR FOR NEUTRONIC REACTORS

    Science.gov (United States)

    Fraas, A.P.

    1963-08-01

    A reflector for nuclear reactors that comprises an assembly of closely packed graphite rods disposed with their major axes substantially perpendicular to the interface between the reactor core and the reflector is described. Each graphite rod is round in transverse cross section at (at least) its interface end and is provided, at that end, with a coaxial, inwardly tapering hole. (AEC)

  2. MOLECULAR DYNAMICS STUDY OF INTERACTIONS OF POLYMYXIN B3 AND ITS ALA-MUTANTS WITH LIPOPOLYSACCHARIDE

    Directory of Open Access Journals (Sweden)

    Lisnyak Yu. V.

    2015-12-01

    Full Text Available Introduction. Emergence of nosocomial bacterial pathogens (especially Gram-negative bacteria with multiple resistance against almost all available antibiotics is a growing medical problem. No novel drugs targeting multidrug-resistant Gram-negative bacteria have been developed in recent years. In this context, there has been greatly renewed interest to cyclic lipodecapeptides polymyxins. Polymyxins exhibit rapid bactericidal activity, they are specific and highly potent against Gramnegative bacteria, but have potential nephrotoxic side effects. So polymyxins are attractive lead compounds to develop analogues with improved microbiological, pharmacological and toxicological properties. A detailed knowledge of the molecular mechanisms of polymyxin interactions with its cell targets is a prerequisite for the purposeful improvement of its therapeutic properties. The primary cell target of a polymyxin is a lipopolysaccharide (LPS in the outer membrane of Gram-negative bacteria. The binding site of polymyxin on LPS has been supposed to be Kdo2-lipid A fragment. Methods. For all molecular modeling and molecular dynamics simulation experiments the YASARA suite of programs was used. Complex of antimicrobial peptide polymyxin В3 (PmB3 with Kdo2-lipid A portion of E. coli lipopolysaccharide was constructed by rigid docking with flexible side chains of the peptide. By alanine scanning of polymyxin В3 bound to LPS followed by simulated annealing minimization of the complexes in explicit water environment, the molecular aspects of PmB3-LPS binding have been studied by 20 ns molecular dynamics simulations at 298 K and pH 7.0. The AMBER03 force field was used with a 1.05 nm force cutoff. To treat long range electrostatic interactions the Particle Mesh Ewald algorithm was used. Results. Ala-mutations of polymyxin’s residues Dab1, Dab3, Dab5, Dab8 and Dab9 in the PmB3-LPS complex caused sustained structural changes resulting in the notable loss in stability of

  3. Short syntheses of enantiopure calystegine B-2, B-3, and B-4

    DEFF Research Database (Denmark)

    Skaanderup, Philip Robert; Madsen, Robert

    2001-01-01

    Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps.......Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps....

  4. Fracturas del radio distal tipo B3. Tratamiento quirúrgico.

    OpenAIRE

    Arenas Planelles, Antonio; Ortega Arruti, J.A.; Corchuelo Maíllo, C.; Arenas Miquélez, A.; Ortega Sáez, M. (Marta)

    2007-01-01

    Se presentan 67 casos de fractura de radio distal tipo B3 tratadas en nuestro Servicio. Se utilizó como método de osteosíntesis una placa palmar en 30 casos, agujas de Kirschner en 19 casos, fijadores externos en 17 y fijador externo + agujas en 1 caso. Los mejores resultados se obtuvieron en el grupo de casos tratados con placa palmar (90 % de resultados satisfactorios). A total of 67 cases of B3 type fracture of the distal radius treated in our Department are presented. A volar plate ...

  5. Mirror reactor surface study

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, A. L.; Damm, C. C.; Futch, A. H.; Hiskes, J. R.; Meisenheimer, R. G.; Moir, R. W.; Simonen, T. C.; Stallard, B. W.; Taylor, C. E.

    1976-09-01

    A general survey is presented of surface-related phenomena associated with the following mirror reactor elements: plasma first wall, ion sources, neutral beams, director converters, vacuum systems, and plasma diagnostics. A discussion of surface phenomena in possible abnormal reactor operation is included. Several studies which appear to merit immediate attention and which are essential to the development of mirror reactors are abstracted from the list of recommended areas for surface work. The appendix contains a discussion of the fundamentals of particle/surface interactions. The interactions surveyed are backscattering, thermal desorption, sputtering, diffusion, particle ranges in solids, and surface spectroscopic methods. A bibliography lists references in a number of categories pertinent to mirror reactors. Several complete published and unpublished reports on surface aspects of current mirror plasma experiments and reactor developments are also included.

  6. Nuclear reactor design

    CERN Document Server

    2014-01-01

    This book focuses on core design and methods for design and analysis. It is based on advances made in nuclear power utilization and computational methods over the past 40 years, covering core design of boiling water reactors and pressurized water reactors, as well as fast reactors and high-temperature gas-cooled reactors. The objectives of this book are to help graduate and advanced undergraduate students to understand core design and analysis, and to serve as a background reference for engineers actively working in light water reactors. Methodologies for core design and analysis, together with physical descriptions, are emphasized. The book also covers coupled thermal hydraulic core calculations, plant dynamics, and safety analysis, allowing readers to understand core design in relation to plant control and safety.

  7. Status of French reactors

    Energy Technology Data Exchange (ETDEWEB)

    Ballagny, A. [Commissariat a l`Energie Atomique, Saclay (France)

    1997-08-01

    The status of French reactors is reviewed. The ORPHEE and RHF reactors can not be operated with a LEU fuel which would be limited to 4.8 g U/cm{sup 3}. The OSIRIS reactor has already been converted to LEU. It will use U{sub 3}Si{sub 2} as soon as its present stock of UO{sub 2} fuel is used up, at the end of 1994. The decision to close down the SILOE reactor in the near future is not propitious for the start of a conversion process. The REX 2000 reactor, which is expected to be commissioned in 2005, will use LEU (except if the fast neutrons core option is selected). Concerning the end of the HEU fuel cycle, the best option is reprocessing followed by conversion of the reprocessed uranium to LEU.

  8. Methionine sulfoxide reductase B3 deficiency stimulates heme oxygenase-1 expression via ROS-dependent and Nrf2 activation pathways

    Energy Technology Data Exchange (ETDEWEB)

    Kwak, Geun-Hee; Kim, Ki Young; Kim, Hwa-Young, E-mail: hykim@ynu.ac.kr

    2016-05-13

    Methionine sulfoxide reductase B3 (MsrB3), which is primarily found in the endoplasmic reticulum (ER), is an important protein repair enzyme that stereospecifically reduces methionine-R-sulfoxide residues. We previously found that MsrB3 deficiency arrests the cell cycle at the G{sub 1}/S stage through up-regulation of p21 and p27. In this study, we report a critical role of MsrB3 in gene expression of heme oxygenase-1 (HO-1), which has an anti-proliferative effect associated with p21 up-regulation. Depletion of MsrB3 elevated HO-1 expression in mammalian cells, whereas MsrB3 overexpression had no effect. MsrB3 deficiency increased cellular reactive oxygen species (ROS), particularly in the mitochondria. ER stress, which is associated with up-regulation of HO-1, was also induced by depletion of MsrB3. Treatment with N-acetylcysteine as an ROS scavenger reduced augmented HO-1 levels in MsrB3-depleted cells. MsrB3 deficiency activated Nrf2 transcription factor by enhancing its expression and nuclear import. The activation of Nrf2 induced by MsrB3 depletion was confirmed by increased expression levels of its other target genes, such as γ-glutamylcysteine ligase. Taken together, these data suggest that MsrB3 attenuates HO-1 induction by inhibiting ROS production, ER stress, and Nrf2 activation. -- Highlights: •MsrB3 depletion induces HO-1 expression. •MsrB3 deficiency increases cellular ROS and ER stress. •MsrB3 deficiency activates Nrf2 by increasing its expression and nuclear import. •MsrB3 attenuates HO-1 induction by inhibiting ROS production and Nrf2 activation.

  9. Joule-Heated Molten Regolith Electrolysis Reactor Concepts for Oxygen and Metals Production on the Moon and Mars

    Science.gov (United States)

    Sibille, Laurent; Dominques, Jesus A.

    2012-01-01

    The maturation of Molten Regolith Electrolysis (MRE) as a viable technology for oxygen and metals production on explored planets relies on the realization of the self-heating mode for the reactor. Joule heat generated during regolith electrolysis creates thermal energy that should be able to maintain the molten phase (similar to electrolytic Hall-Heroult process for aluminum production). Self-heating via Joule heating offers many advantages: (1) The regolith itself is the crucible material, it protects the vessel walls (2) Simplifies the engineering of the reactor (3) Reduces power consumption (no external heating) (4) Extends the longevity of the reactor. Predictive modeling is a tool chosen to perform dimensional analysis of a self-heating reactor: (1) Multiphysics modeling (COMSOL) was selected for Joule heat generation and heat transfer (2) Objective is to identify critical dimensions for first reactor prototype.

  10. 75 FR 63052 - Airworthiness Directives; Eurocopter France (ECF) Model AS350B3 and EC130 B4 Helicopters

    Science.gov (United States)

    2010-10-14

    ... (ECF) Model AS350B3 and EC130 B4 Helicopters AGENCY: Federal Aviation Administration (FAA), DOT. ACTION... Model AS350B3 and EC130 B4 helicopters. This amendment is prompted by a mandatory continuing... amend 14 CFR part 39 to include an AD that would apply to ECF Model AS350B3 and EC130 B4 helicopters on...

  11. Determining the frequencies of B1, B2, B3 and E alleles of the ...

    African Journals Online (AJOL)

    Ada

    2016-06-04

    Jun 4, 2016 ... gene and their effects on milk yield and composition in the Saanen goat breed. ... the potential for improving milk composition by selecting for B3 and E allele may be significant in Saanen goats. ... bp of intronic regions with a total similarity with the corresponding bovine sequence of about 57% (Ramunno.

  12. The AFL subfamily of B3 transcription factors: evolution and function in angiosperm seeds.

    Science.gov (United States)

    Carbonero, Pilar; Iglesias-Fernández, Raquel; Vicente-Carbajosa, Jesús

    2017-02-01

    Seed development follows zygotic embryogenesis; during the maturation phase reserves accumulate and desiccation tolerance is acquired. This is tightly regulated at the transcriptional level and the AFL (ABI3/FUS3/LEC2) subfamily of B3 transcription factors (TFs) play a central role. They alter hormone biosynthesis, mainly in regards to abscisic acid and gibberellins, and also regulate the expression of other TFs and/or modulate their downstream activity via protein-protein interactions. This review deals with the origin of AFL TFs, which can be traced back to non-vascular plants such as Physcomitrella patens and achieves foremost expansion in the angiosperms. In green algae, like the unicellular Chlamydomonas reinhardtii or the pluricellular Klebsormidium flaccidum, a single B3 gene and four B3 paralogous genes are annotated, respectively. However, none of them present with the structural features of the AFL subfamily, with the exception of the B3 DNA-binding domain. Phylogenetic analysis groups the AFL TFs into four Major Clusters of Ortologous Genes (MCOGs). The origin and function of these genes is discussed in view of their expression patterns and in the context of major regulatory interactions in seeds of monocotyledonous and dicotyledonous species. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  13. Data of evolutionary structure change: 3EK2B-3FNFC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 90479 3.110795021057129 EVID> 4 3FNF...3EK2B-3FNFC 3EK2 3FNF B C MGFLDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTY...VGDRFKDRITEFAAEFGSE-LVFPCDVADDAQIDALFASLKTHWD---SLDGLVHSIGFAPREAIAG-DFLDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLL...HHHHHH EEEEE GGG -- EVID> 0 3...line>LEU CA 564 3FNF C 3FNF

  14. 17 CFR 270.24b-3 - Sales literature deemed filed.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales literature deemed filed... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.24b-3 Sales literature deemed filed. Any advertisement, pamphlet, circular, form letter or other sales literature addressed to or intended...

  15. Identical Genotype B3 Sequences from Measles Patients in 4 Countries, 2005

    Science.gov (United States)

    Lowe, Luis; Rota, Paul; Bellini, William; Redd, Susan; Dayan, Gustavo; van Binnendijk, Rob; Hahné, Susan; Tipples, Graham; Macey, Jeannette; Espinoza, Rita; Posey, Drew; Plummer, Andrew; Bateman, John; Gudiño, José; Cruz-Ramirez, Edith; Lopez-Martinez, Irma; Anaya-Lopez, Luis; Akwar, Teneg Holy; Giffin, Scott; Carrión, Verónica; Bispo de Filippis, Ana Maria; Vicari, Andrea; Tan, Christina; Wolf, Bruce; Wytovich, Katherine; Borus, Peter; Mbugua, Francis; Chege, Paul; Kombich, Janeth; Akoua-Koffi, Chantal; Smit, Sheilagh; Bukenya, Henry; Bwogi, Josephine; Baliraine, Frederick Ndhoga; Kremer, Jacques; Muller, Claude; Santibanez, Sabine

    2006-01-01

    Surveillance of measles virus detected an epidemiologic link between a refugee from Kenya and a Dutch tourist in New Jersey, USA. Identical genotype B3 sequences from patients with contemporaneous cases in the United States, Canada, and Mexico in November and December 2005 indicate that Kenya was likely to have been the common source of virus. PMID:17283637

  16. Determining the frequencies of B1, B2, B3 and E alleles of the ...

    African Journals Online (AJOL)

    The aim of the study was to determine the frequencies of B1, B2, B3 and E alleles of the CSN1S1 gene and their effects on milk yield and composition in the Saanen goat breed. Milk samples were collected to identify milk composition with Fourier transform ınfrared (FTIR) spectroscopy. The polymerase chain ...

  17. Energy transfer phenomena in lanthanide metaborates (LnB3O6)

    NARCIS (Netherlands)

    Zhiran, Hao; Blasse, G.

    1984-01-01

    It is shown that GdB3O6 is an excellent host lattice to obtain efficient photoluminescent materials. For this purpose we need a sensitizer (S) of the Gd3+ sublattice and an activator (A). Energy transport from S to A occurs via the Gd3+ sublattice. We studied S = Sb3+, Bi3+, Ce3+ and A = Eu3+, Tb3+.

  18. Niacin (Vitamin B-3) Supplementation in Patients with Serotonin-Producing Neuroendocrine Tumor

    NARCIS (Netherlands)

    Bouma, Grietje; van Faassen, Martijn; Kats-Ugurlu, Gursah; Vries, de Elisabeth G. E.; Kema, Ido P.; Walenkamp, Annemiek M. E.

    2016-01-01

    BACKGROUND/AIMS: Tryptophan is the precursor of serotonin and niacin (vitamin B3). The latter is critical for normal cellular metabolism. Tryptophan and niacin can be deficient in patients with serotonin producing neuroendocrine tumors (NETs). Niacin deficiency can lead to severe symptoms including

  19. 2-Bromohydroquinone: structures, vibrational assignments and RHF, B- and B3-based density functional calculations.

    Science.gov (United States)

    Ramoji, Anuradha; Yenagi, Jayashree; Tonannavar, J

    2008-03-01

    Vibrational spectral measurements, namely, infrared (4000-400 cm(-1)) and Raman (3500-50 cm(-1)) spectra have been made for 2-Bromohydroquinone. Optimized geometrical structures, harmonic vibrational frequencies and intensities have been computed by the ab initio (RHF), B-based (BLYP, BP86) and B3-based (B3P86, B3LYP, B3PW91) density functional methods using 6-31G(d) basis set. A complete assignment of the observed spectra has been proposed. Coupling of vibrations has been determined by calculating potential energy distributions (PEDs) at BP86/6-31G(d) level of theory. In the computed equilibrium geometries by all the levels, the bond lengths and bond angles show changes in the neighborhood of Bromine. Similarly, the vibrational spectra exhibit some marked spectral features unlike in hydroquinone and phenol. On the other hand, the infrared spectrum shows a clear evidence of O-H...O bonding near 3200 cm(-1) as in hydroquinone. Evaluation of the theoretical methods demonstrates that all the levels but the RHF have reproduced frequencies fairly accurately in the 2000-500 cm(-1); below 500 cm(-1) the RHF has performed reasonably well.

  20. Probable transmission of coxsackie B3 virus from human to chimpanzee, Denmark

    DEFF Research Database (Denmark)

    Nielsen, Sandra Cathrine Abel; Mourier, Tobias; Baandrup, Ulrik

    2012-01-01

    In 2010, a chimpanzee died at Copenhagen Zoo following an outbreak of respiratory disease among chimpanzees in the zoo. Identification of coxsackie B3 virus, a common human pathogen, as the causative agent, and its severe manifestation, raise questions about pathogenicity and transmissibility among...

  1. Quark structure of the X(3872) and χb(3P) resonances

    Science.gov (United States)

    Ferretti, J.; Galatà, G.; Santopinto, E.

    2014-09-01

    We discuss the nature of the χb(3P) and X(3872) mesons. Are the χb(3P)'s standard bb¯ mesons or bb¯ states with a significative continuum component? Is the X(3872) a cc¯ state with continuum coupling effects or a meson-meson molecule? To do that, we compare quark model and unquenched quark model results for the mass barycenter and splittings of the χb(3P) multiplet. Future and more precise experimental results will discriminate between the two interpretations. In the case of the X(3872), we interpret it as a cc¯ core plus higher Fock components due to the coupling to the meson-meson continuum, and thus we think that it is compatible with the meson χc1(2P), with JPC=1++. The JPC=1++ quantum numbers are in agreement with the experimental results found by the LHCb collaboration. In our view, the X(3872)'s mass is lower than the quark model's predictions because of self-energy shifts. We also provide an estimation of the open charm/bottom strong decay modes of the X(3872) and χb(3P) mesons, such as X(3872)→DD¯* and χb2(3P)→BB¯, and radiative transitions.

  2. Data of evolutionary structure change: 1DR8B-3ICDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DR8B-3ICDA 1DR8 3ICD B A ------------------------MKVAVLPGDGIGPEV...LA CA 264 3ICD ...A 3ICDA AVEKAYKGERKIS HHHH...e>PHE CA 404 PRO CA 327 GLU CA 244 3ICD... A 3ICDA TQVYGQDVWLPA

  3. The promise of anti-ErbB3 monoclonals as new cancer therapeutics

    Science.gov (United States)

    Roscilli, Giuseppe; Mancini, Rita; Ciliberto, Gennaro

    2012-01-01

    In the last 3-5 years strong evidence has been gathered demonstrating ErbB3 as a key node for the progression of several cancer types. From the mechanistic standpoint the intracellular region of this receptor is rich of tyrosine residues that, upon phosphorylation, become high affinity binding sites for PI3K and other proteins involved in signal transduction. The involvement of ErbB3 occurs at different levels, most likely as a consequence of its promiscuity in the interaction with other RTKs of the same or other families. Several efforts are therefore being put in the development of antibodies that target this receptor either singly or in combination with other synergizing receptors. Some of these compounds have already entered clinical development. Although clinical proof-of-concept has not yet been achieved, this is likely to occur soon and will further accelerate the inclusion of anti-ErbB3 monoclonals in the repertoire of anticancer agents for more effective combination therapy. In this paper we review the wealth of anti-ErbB3 antibodies under development and compare their properties and potential to become marketed drugs. PMID:22889873

  4. 17 CFR 240.16b-3 - Transactions between an issuer and its officers or directors.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Transactions between an issuer... Rules and Regulations Under the Securities Exchange Act of 1934 Exemption of Certain Transactions from Section 16(b) § 240.16b-3 Transactions between an issuer and its officers or directors. (a) General. A...

  5. Effects of partial La filling and Sb vacancy defects on CoS b3 skutterudites

    Science.gov (United States)

    Hu, Chongze; Zeng, Xiaoyu; Liu, Yufei; Zhou, Menghan; Zhao, Huijuan; Tritt, Terry M.; He, Jian; Jakowski, Jacek; Kent, Paul R. C.; Huang, Jingsong; Sumpter, Bobby G.

    2017-04-01

    Over the past decade, the open frame ("cagey") structure of CoS b3 skutterudite has invited intensive filling studies with various rare-earth elements for delivering state-of-the-art midtemperature thermoelectric performance. To rationalize previously reported experimental results and provide new insight into the underexplored roles of La fillers and Sb vacancies, ab initio density functional theory studies, along with semiclassical Boltzmann transport theory calculations, are performed for pristine CoS b3 of different lattice settings and La-filled CoS b3 with and without Sb's mono- and divacancy defects. The effects of spin-orbit coupling (SOC), partial La filling, Sb vacancy defects, and spin polarization on the electronic and thermoelectric properties are systematically examined. The SOC shows minor effects on the electronic and thermoelectric properties of CoS b3 . The peculiar quasi-Dirac band in the pristine CoS b3 largely survives La filling but not Sb vacancies, which instead introduce dispersive bands in the band gap region. The non-spin-polarized and spin-polarized solutions of La-filled CoS b3 are nearly degenerate. Importantly, the band structure, density of states, and Fermi surface of the latter are significantly spin polarized, giving rise to spin-dependent thermoelectric properties. Seebeck coefficients directly calculated as a function of chemical potential are interpreted in connection with the electronic structures. Temperature-dependent Seebeck coefficients derived for the experimentally studied materials agree well with available experimental data. Seebeck coefficients obtained as a function of charge carrier concentration corroborate the thermoelectrically favorable role at high filling fractions played by the Fermi electron pockets associated with the degenerate valleys in the conduction bands, and also point toward a similar role of the Fermi hole pockets associated with the degenerate hills in the valence bands. These results serve to

  6. Seville City Hall Chapter Room ceiling decoration

    Directory of Open Access Journals (Sweden)

    Robador, M. D.

    2010-02-01

    Full Text Available The present article describes a chemical and physical study of the colour, chemical composition and mineral phases of the decorative materials in the Seville City Hall Chapter House ceiling. The findings showed that the inner most layer of material, calcite, was covered with white lead, in turn concealed under a layer of gilded bole. The ceiling underwent re-gilding, also over bole, due in all likelihood to wear on the original gold leaf. In the nineteenth century, the entire ceiling with the exception of the inscriptions was whitewashed with calcite and white lead. Silver was employed on King John I’s sword (coffer 27. Gold leaf was used to adorn the royal attributes: crowns, belts, sceptres, swords and rosary beads. The high reliefs were likewise gilded. The pigments identified on the ceiling adornments included azurite, malachite, vermilion and gas black. A lime and ground dolomite mortar was used throughout.

    El objetivo de este trabajo es el estudio de diferentes aspectos, como el color, la composición química y las fases mineralógicas presentes en los diferentes materiales que forman la ornamentación del techo de la Sala Capitular del Ayuntamiento de Sevilla, mediante métodos físicos y químicos. Nuestros resultados muestran que el dorado fue realizado sobre una capa de bol previamente depositada sobre una lámina de blanco de plomo que cubría un estrato de calcita. Posteriormente, y probablemente debido a alteraciones en el dorado original, el techo fue de nuevo dorado usando una técnica similar. En el siglo XIX, casi todo el techo, excepto las zonas con inscripciones, fue blanqueado usando una mezcla de calcita y blanco de plomo. Se empleó plata para cubrir la espada del rey Juan I (casetón 27. Finísimas láminas de oro se usaron para decorar los atributos reales: coronas, cinturones, cetros, espadas y rosarios. En diferentes partes de la decoración fueron detectados pigmentos como azurita, malaquita, bermellón y

  7. Concert hall acoustics assessment with individually elicited attributes.

    Science.gov (United States)

    Lokki, Tapio; Patynen, Jukka; Kuusinen, Antti; Vertanen, Heikki; Tervo, Sakari

    2011-08-01

    Concert hall acoustics was evaluated with a descriptive sensory analysis method by employing an individual vocabulary development technique. The goal was to obtain sensory profiles of three concert halls by eliciting perceptual attributes for evaluation and comparison of the halls. The stimuli were gathered by playing back anechoic symphony music from 34 loudspeakers on stage in each concert hall and recording the sound field with a microphone array. Four musical programs were processed for multichannel 3D sound reproduction in the actual listening test. Twenty screened assessors developed their individual set of attributes and performed a comparative evaluation of nine seats, three in each hall. The results contain the distinctive groups of elicited attributes and show good agreement within assessors, even though they applied individual attributes when rating the samples. It was also found that loudness and distance gave the strongest perceptual direction to the principal component basis. In addition, the study revealed that the perception of reverberance is related to the size of the space or to the enveloping reverberance, depending on the assessor.

  8. Perception of music dynamics in concert hall acoustics.

    Science.gov (United States)

    Pätynen, Jukka; Lokki, Tapio

    2016-11-01

    Dynamics is one of the principal means of expressivity in Western classical music. Still, preceding research on room acoustics has mostly neglected the contribution of music dynamics to the acoustic perception. This study investigates how the different concert hall acoustics influence the perception of varying music dynamics. An anechoic orchestra signal, containing a step in music dynamics, was rendered in the measured acoustics of six concert halls at three seats in each. Spatial sound was reproduced through a loudspeaker array. By paired comparison, naive subjects selected the stimuli that they considered to change more during the music. Furthermore, the subjects described their foremost perceptual criteria for each selection. The most distinct perceptual factors differentiating the rendering of music dynamics between halls include the dynamic range, and varying width of sound and reverberance. The results confirm the hypothesis that the concert halls render the performed music dynamics differently, and with various perceptual aspects. The analysis against objective room acoustic parameters suggests that the perceived dynamic contrasts are pronounced by acoustics that provide stronger sound and more binaural incoherence by a lateral sound field. Concert halls that enhance the dynamics have been found earlier to elicit high subjective preference.

  9. G. Stanley Hall, Child Study, and the American Public.

    Science.gov (United States)

    Young, Jacy L

    2016-01-01

    In the final decades of the 19th century psychologist Granville Stanley Hall was among the most prominent pedagogical experts in the nation. The author explores Hall's carefully crafted persona as an educational expert, and his engagements with the American public, from 1880 to 1900, arguably the height of his influence. Drawing from accounts of Hall's lecture circuit in the popular press, a map of his talks across the nation is constructed to assess the geographic scope of his influence. These talks to educators on the psychology underlying childhood and pedagogy, and his views and research on child life more generally, were regularly discussed in newspapers and popular periodicals. The venues in which Hall's ideas were disseminated, discussed, and in some cases, dismissed are described. His efforts to mobilize popular support for, and assistance with, his research endeavors in child study are also discussed. Such efforts were controversial both within the burgeoning field of psychology and among the public. Through his various involvements in pedagogy, and concerted efforts to engage with the American public, Hall helped establish psychology's relevance to parenting and educational practices.

  10. Optical detection of spin Hall effect in metals

    Science.gov (United States)

    van T Erve, Olaf; Hanbicki, Aubrey; Li, Connie; Jonker, Berend

    Spin Hall effects in metals have been successfully measured using electrical methods such as nonlocal spin valve transport, ferromagnetic resonance or spin torque transfer experiments. These methods require complex processing techniques and measuring setups. Here we present room temperature measurements of the spin Hall effect in non-magnetic metals such as Pt and β-W using a standard bench top magneto-optic Kerr effect (MOKE) system. With this system, one can readily determine the angular dependence of the induced polarization on the bias current direction. When a bias current is applied, the spin Hall effect causes electrons of opposite spin to be scattered in opposite directions, resulting in a spin accumulation at the surface of the film. The MOKE signal tracks the applied square wave bias current with an amplitude and phase directly related to the spin Hall angle. Using this technique, we show that the spin-Hall angle of β-W is opposite in sign and significantly larger than that of Pt. In addition, we use this technique to detect spin diffusion from β-W into Al thin films, as well as spin diffusion from the topological surface states of Bi2Se3 into Al. We will also show direct modulation of the reflected light up to 100 kHz, using Bi doped Cu samples. This work was supported by internal programs at NRL.

  11. Suitable reverberation times for halls for rock and pop music.

    Science.gov (United States)

    Adelman-Larsen, Niels Werner; Thompson, Eric R; Gade, Anders C

    2010-01-01

    The existing body of literature regarding the acoustic design of concert halls has focused almost exclusively on classical music, although there are many more performances of popular music, including rock and pop. Objective measurements were made of the acoustics of 20 rock music venues in Denmark and a questionnaire was used in a subjective assessment of those venues with professional rock musicians and sound engineers as expert listeners. Correlations between the measurements show that clarity, including bass frequencies down to 63 Hz, is important for the general impression of the acoustics of the hall. The best-rated halls in the study have reverberation times that are approximately frequency independent from 0.6 to 1.2 s for hall volumes from 1000 to 6000 m(3). The worst rated halls in the study had significantly higher reverberation times in the 63 and 125 Hz bands. Since most audiences at rock concerts are standing, absorption coefficients were measured with a standing audience from 63 Hz to 4 kHz. These measurements showed that a standing audience absorbs about five times as much energy in mid-/high-frequency bands as in low-frequency bands.

  12. Higher (odd) dimensional quantum Hall effect and extended dimensional hierarchy

    Science.gov (United States)

    Hasebe, Kazuki

    2017-07-01

    We demonstrate dimensional ladder of higher dimensional quantum Hall effects by exploiting quantum Hall effects on arbitrary odd dimensional spheres. Non-relativistic and relativistic Landau models are analyzed on S 2 k - 1 in the SO (2 k - 1) monopole background. The total sub-band degeneracy of the odd dimensional lowest Landau level is shown to be equal to the winding number from the base-manifold S 2 k - 1 to the one-dimension higher SO (2 k) gauge group. Based on the chiral Hopf maps, we clarify the underlying quantum Nambu geometry for odd dimensional quantum Hall effect and the resulting quantum geometry is naturally embedded also in one-dimension higher quantum geometry. An origin of such dimensional ladder connecting even and odd dimensional quantum Hall effects is illuminated from a viewpoint of the spectral flow of Atiyah-Patodi-Singer index theorem in differential topology. We also present a BF topological field theory as an effective field theory in which membranes with different dimensions undergo non-trivial linking in odd dimensional space. Finally, an extended version of the dimensional hierarchy for higher dimensional quantum Hall liquids is proposed, and its relationship to quantum anomaly and D-brane physics is discussed.

  13. Evaluasi Fungsi Insinerator Dalam Memusnahkan Limbah B3 Di Rumah Sakit NI Dr.Ramelan Surabaya

    Directory of Open Access Journals (Sweden)

    Jahn Leonard Saragih

    2013-09-01

    Full Text Available Pengelolaan limbah padat B3 di Rumah Sakit TNI Angkatan Laut Dr. Ramelan sangat penting diperhatikan karena dapat berdampak buruk apabila tidak dikelola dengan baik. Oleh sebab itu diperlukan adanya penelitian untuk mengidentifikasi jumlah timbulan dan penanganan limbah padat B3, mengevaluasi manajemen, penyimpanan sementara serta mengevaluasi proses insinerasi. Evaluasi fungsi incinerator di Rumah Sakit TNI Angkatan Laut Dr. Ramelan dilakukan dengan meneliti jumlah timbulan limbah B3, kapasitas pembakaran insinerator, suhu pembakaran insinerator, densitas limbah dan abu pembakaran, dan tes TCLP residu pembakaran incinerator Rumah Sakit TNI Angkatan Laut Dr. Ramelan. Dalam penelitian ini, Rumkital Dr. Ramelan memusnahkan limbah dengan incinerator. Limbah B3 yang dihasilkan Rumkital Dr. Ramelan dimusnakan dengan satu incinerator dengan type KAMINE TYPE BDR-INC 10. Limbah yang dimusnahkan di Rumkital Dr. Ramelan berasal dari Rumkital Dr. Ramelan dan Lantamal Perak. Setelah dilakukan penelitian langsung selama 14 hari berturut-turut, didapatkan bahwa rata-rata timbulan limbah B3 di Rumkital Dr. Ramelan adalah 89.98 Kg/hari dan dengan densitas rata-rata limbah ialah 166,67 kg/m3. Tinggat removal dari pembakaran limbah dengan incinerator di Rumah Sakit TNI Angkatan Laut Dr. Ramelan ialah 82,63%. Pengelolaan abu sisa incinerator Rumkital Dr. Ramelan belum sesuai dengan peraturan yang berlaku dan dari penelitian yang dilakukan yaitu pengujian kandungan abu incinerator, solidifikasi abu incinerator dengan perbandingan semen:abu adalah 1:3 dan uji TCLP, didapatkan bahwa limbah abu sisa insinerator Rumah Sakit TNI Angkatan Laut Dr. Ramelan Surabaya, dapat ditimbun pada landfill kategori I sesuai dengan Keputusan Kepala Bapedal No.4 Tahun 1995.

  14. Nuclear reactor control column

    Science.gov (United States)

    Bachovchin, Dennis M.

    1982-01-01

    The nuclear reactor control column comprises a column disposed within the nuclear reactor core having a variable cross-section hollow channel and containing balls whose vertical location is determined by the flow of the reactor coolant through the column. The control column is divided into three basic sections wherein each of the sections has a different cross-sectional area. The uppermost section of the control column has the greatest cross-sectional area, the intermediate section of the control column has the smallest cross-sectional area, and the lowermost section of the control column has the intermediate cross-sectional area. In this manner, the area of the uppermost section can be established such that when the reactor coolant is flowing under normal conditions therethrough, the absorber balls will be lifted and suspended in a fluidized bed manner in the upper section. However, when the reactor coolant flow falls below a predetermined value, the absorber balls will fall through the intermediate section and into the lowermost section, thereby reducing the reactivity of the reactor core and shutting down the reactor.

  15. Reactor Safety Research Programs

    Energy Technology Data Exchange (ETDEWEB)

    Edler, S. K.

    1981-07-01

    This document summarizes the work performed by Pacific Northwest Laboratory (PNL) from January 1 through March 31, 1981, for the Division of Reactor Safety Research within the U.S. Nuclear Regulatory Commission (NRC). Evaluations of nondestructive examination (NDE) techniques and instrumentation are reported; areas of investigation include demonstrating the feasibility of determining the strength of structural graphite, evaluating the feasibility of detecting and analyzing flaw growth in reactor pressure boundary systems, examining NDE reliability and probabilistic fracture mechanics, and assessing the integrity of pressurized water reactor (PWR) steam generator tubes where service-induced degradation has been indicated. Experimental data and analytical models are being provided to aid in decision-making regarding pipeto- pipe impacts following postulated breaks in high-energy fluid system piping. Core thermal models are being developed to provide better digital codes to compute the behavior of full-scale reactor systems under postulated accident conditions. Fuel assemblies and analytical support are being provided for experimental programs at other facilities. These programs include loss-ofcoolant accident (LOCA) simulation tests at the NRU reactor, Chalk River, Canada; fuel rod deformation, severe fuel damage, and postaccident coolability tests for the ESSOR reactor Super Sara Test Program, Ispra, Italy; the instrumented fuel assembly irradiation program at Halden, Norway; and experimental programs at the Power Burst Facility, Idaho National Engineering Laboratory (INEL). These programs will provide data for computer modeling of reactor system and fuel performance during various abnormal operating conditions.

  16. Reactor power monitoring device

    Energy Technology Data Exchange (ETDEWEB)

    Oda, Naotaka; Igawa, Shinji; Kitazono, Hideaki

    1998-02-13

    The present invention provides a reactor power monitoring device capable of ensuring circumstance resistance, high reliability and high speed transmission even if an APRM is disposed in a reactor building (R/B). Namely, signal processing sections (APRM) for transmitting data to a central control chamber are distributed in the reactor building at an area at the lowest temperature among areas where the temperature control in an emergency state is regulated, and a transmission processing section (APRM-I/F) for transmitting data to the other systems is disposed to the central control chamber. An LPRM signal transmission processing section is constituted such that LPRM signals can be transmitted at a high speed by DMA. Set values relevant to reactor tripping (neutron flux high, thermal output high and sudden reduction of a reactor core flow rate) are stored in the APRM-I/F, and reactor tripping calculation is conducted in the APRM-I/F. With such procedure, a reactor power monitoring device having enhanced control function can be attained. (N.H.)

  17. Nuclear reactor reflector

    Science.gov (United States)

    Hopkins, R.J.; Land, J.T.; Misvel, M.C.

    1994-06-07

    A nuclear reactor reflector is disclosed that comprises a stack of reflector blocks with vertical water flow passages to cool the reflector. The interface between blocks is opposite support points for reactor fuel rods. Water flows between the reflector and the reactor barrel from passages in a bottom block. The top block contains a flange to limit this flow and the flange has a slot to receive an alignment pin that is welded to the barrel. The pin is held in the slot by two removable shims. Alignment bars extend the length of the stack in slots machined in each block when the stack is assembled. 12 figs.

  18. Fast Breeder Reactor studies

    Energy Technology Data Exchange (ETDEWEB)

    Till, C.E.; Chang, Y.I.; Kittel, J.H.; Fauske, H.K.; Lineberry, M.J.; Stevenson, M.G.; Amundson, P.I.; Dance, K.D.

    1980-07-01

    This report is a compilation of Fast Breeder Reactor (FBR) resource documents prepared to provide the technical basis for the US contribution to the International Nuclear Fuel Cycle Evaluation. The eight separate parts deal with the alternative fast breeder reactor fuel cycles in terms of energy demand, resource base, technical potential and current status, safety, proliferation resistance, deployment, and nuclear safeguards. An Annex compares the cost of decommissioning light-water and fast breeder reactors. Separate abstracts are included for each of the parts.

  19. Reactor flux calculations

    Energy Technology Data Exchange (ETDEWEB)

    Lhuillier, D. [Commissariat à l' Énergie Atomique et aux Énergies Alternatives, Centre de Saclay, IRFU/SPhN, 91191 Gif-sur-Yvette (France)

    2013-02-15

    The status of the prediction of reactor anti-neutrino spectra is presented. The most accurate method is still the conversion of total β spectra of fissionning isotopes as measured at research reactors. Recent re-evaluations of the conversion process led to an increased predicted flux by few percent and were at the origin of the so-called reactor anomaly. The up to date predictions are presented with their main sources of error. Perspectives are given on the complementary ab-initio predictions and upcoming experimental cross-checks of the predicted spectrum shape.

  20. NEUTRONIC REACTOR CONTROL

    Science.gov (United States)

    Metcalf, H.E.

    1958-10-14

    Methods of controlling reactors are presented. Specifically, a plurality of neutron absorber members are adjustably disposed in the reactor core at different distances from the center thereof. The absorber members extend into the core from opposite faces thereof and are operated by motive means coupled in a manner to simultaneously withdraw at least one of the absorber members while inserting one of the other absorber members. This feature effects fine control of the neutron reproduction ratio by varying the total volume of the reactor effective in developing the neutronic reaction.

  1. Nuclear reactor reflector

    Science.gov (United States)

    Hopkins, Ronald J.; Land, John T.; Misvel, Michael C.

    1994-01-01

    A nuclear reactor reflector is disclosed that comprises a stack of reflector blocks with vertical water flow passages to cool the reflector. The interface between blocks is opposite support points for reactor fuel rods. Water flows between the reflector and the reactor barrel from passages in a bottom block. The top block contains a flange to limit this flow and the flange has a slot to receive an alignment pin that is welded to the barrel. The pin is held in the slot by two removable shims. Alignment bars extend the length of the stack in slots machined in each block when the stack is assembled.

  2. Microfluidic electrochemical reactors

    Science.gov (United States)

    Nuzzo, Ralph G [Champaign, IL; Mitrovski, Svetlana M [Urbana, IL

    2011-03-22

    A microfluidic electrochemical reactor includes an electrode and one or more microfluidic channels on the electrode, where the microfluidic channels are covered with a membrane containing a gas permeable polymer. The distance between the electrode and the membrane is less than 500 micrometers. The microfluidic electrochemical reactor can provide for increased reaction rates in electrochemical reactions using a gaseous reactant, as compared to conventional electrochemical cells. Microfluidic electrochemical reactors can be incorporated into devices for applications such as fuel cells, electrochemical analysis, microfluidic actuation, pH gradient formation.

  3. Diaphragm Effect of Steel Space Roof Systems in Hall Structures

    Directory of Open Access Journals (Sweden)

    Mehmet FENKLİ

    2015-09-01

    Full Text Available Hall structures have been used widely for different purposes. They have are reinforced concrete frames and shear wall with steel space roof systems. Earthquake response of hall structures is different from building type structures. One of the most critical nodes is diaphragm effect of steel space roof on earthquake response of hall structures. Diaphragm effect is depending on lateral stiffness capacity of steel space roof system. Lateral stiffness of steel space roof system is related to modulation geometry, support conditions, selected sections and system geometry. In current paper, three representative models which are commonly used in Turkey were taken in to account for investigation. Results of numerical tests were present comparatively

  4. Nonlinear analysis of magnetization dynamics excited by spin Hall effect

    Science.gov (United States)

    Taniguchi, Tomohiro

    2015-03-01

    We investigate the possibility of exciting self-oscillation in a perpendicular ferromagnet by the spin Hall effect on the basis of a nonlinear analysis of the Landau-Lifshitz-Gilbert (LLG) equation. In the self-oscillation state, the energy supplied by the spin torque during a precession on a constant energy curve should equal the dissipation due to damping. Also, the current to balance the spin torque and the damping torque in the self-oscillation state should be larger than the critical current to destabilize the initial state. We find that these conditions in the spin Hall system are not satisfied by deriving analytical solutions of the energy supplied by the spin transfer effect and the dissipation due to the damping from the nonlinear LLG equation. This indicates that the self-oscillation of a perpendicular ferromagnet cannot be excited solely by the spin Hall torque.

  5. Stability of fractional quantum Hall states in disordered photonic systems

    Science.gov (United States)

    DeGottardi, Wade; Hafezi, Mohammad

    2017-11-01

    The possibility of realizing fractional quantum Hall liquids in photonic systems has attracted a great deal of interest of late. Unlike electronic systems, interactions in photonic systems must be engineered from nonlinear elements and are thus subject to positional disorder. The stability of the topological liquid relies on repulsive interactions. In this paper we investigate the stability of fractional quantum Hall liquids to impurities which host attractive interactions. Employing the Bose–Hubbard model with a magnetic field, we find that for sufficiently strong attractive interactions these impurities can destroy the topological liquid. However, we find that the liquid is quite robust to these defects, a fact which bodes well for the realization of topological quantum Hall liquids in photonic systems.

  6. Composed planar Hall effect sensors with dual-mode operation

    Directory of Open Access Journals (Sweden)

    Vladislav Mor

    2016-02-01

    Full Text Available We present a composed planar Hall effect sensor with two modes of operation: (a an ON mode where the composed sensor responds to magnetic field excitations similarly to the response of a regular planar Hall effect sensor, and (b an OFF mode where the response is negligible. The composed planar Hall effect sensor switches from the OFF mode to the ON mode when it is exposed to a magnetic field which exceeds a certain threshold determined by the sensor design. The features of this sensor make it useful as a switch triggered by magnetic field and as a sensing device with memory, as its mode of operation indicates exposure to a magnetic field larger than a certain threshold without the need to be activated during the exposure itself.

  7. Quantum Hall effect in graphene with superconducting electrodes.

    Science.gov (United States)

    Rickhaus, Peter; Weiss, Markus; Marot, Laurent; Schönenberger, Christian

    2012-04-11

    We have realized an integer quantum Hall system with superconducting contacts by connecting graphene to niobium electrodes. Below their upper critical field of 4 T, an integer quantum Hall effect coexists with superconductivity in the leads but with a plateau conductance that is larger than in the normal state. We ascribe this enhanced quantum Hall plateau conductance to Andreev processes at the graphene-superconductor interface leading to the formation of so-called Andreev edge-states. The enhancement depends strongly on the filling-factor and is less pronounced on the first plateau due to the special nature of the zero energy Landau level in monolayer graphene. © 2012 American Chemical Society

  8. Crossover between spin swapping and Hall effect in disordered systems

    KAUST Repository

    Saidaoui, Hamed Ben Mohamed

    2015-07-16

    We theoretically study the crossover between spin Hall effect and spin swapping, a recently predicted phenomenon that consists of the interchange between the current flow and its spin polarization directions [M. B. Lifshits and M. I. Dyakonov, Phys. Rev. Lett. 103, 186601 (2009)]. Using a tight-binding model with spin-orbit coupled disorder, spin Hall effect, spin relaxation, and spin swapping are treated on equal footing. We demonstrate that spin swapping and spin Hall effect present very different dependencies as a function of the spin-orbit coupling and disorder strengths and confirm that the former exceeds the latter in the parameter range considered. Three setups are proposed for the experimental observation of the spin swapping effect.

  9. Metal-to-insulator switching in quantum anomalous Hall states

    Science.gov (United States)

    Pan, Lei; Kou, Xufeng; Wang, Jing; Fan, Yabin; Choi, Eun Sang; Shao, Qiming; Zhang, Shou Cheng; Wang, Kang Lung

    Quantum anomalous Hall effect (QAHE) was recently achieved in magnetic topological insulator films as a form of dissipationless transport without external magnetic field. However, the universal phase diagram of QAHE and its relation with quantum Hall effect (QHE) remain to be investigated. Here, we report the experimental observation of the giant longitudinal resistance peak and zero Hall conductance plateau at the coercive field in the six quintuple-layer (Cr0.12Bi0.26Sb0.62)2 Te3 film, and demonstrate the metal-to-insulator switching between two opposite QAHE plateau states up to 0.3 K. The universal QAHE phase diagram is further confirmed through the angle-dependent measurements. Our results address that the quantum phase transitions in both QAHE and QHE regimes are in the same universality class, yet the microscopic details are different.

  10. Topological Phase Transitions in the Photonic Spin Hall Effect

    Science.gov (United States)

    Kort-Kamp, W. J. M.

    2017-10-01

    The recent synthesis of two-dimensional staggered materials opens up burgeoning opportunities to study optical spin-orbit interactions in semiconducting Dirac-like systems. We unveil topological phase transitions in the photonic spin Hall effect in the graphene family materials. It is shown that an external static electric field and a high frequency circularly polarized laser allow for active on-demand manipulation of electromagnetic beam shifts. The spin Hall effect of light presents a rich dependence with radiation degrees of freedom, and material properties, and features nontrivial topological properties. We discover that photonic Hall shifts are sensitive to spin and valley properties of the charge carriers, providing an unprecedented pathway to investigate spintronics and valleytronics in staggered 2D semiconductors.

  11. Admittance of multiterminal quantum Hall conductors at kilohertz frequencies

    Energy Technology Data Exchange (ETDEWEB)

    Hernández, C. [Departamento de Física, Universidad Militar Nueva Granada, Carrera 11 101-80 Bogotá D.C. (Colombia); Consejo, C.; Chaubet, C., E-mail: christophe.chaubet@univ-montp2.fr [Université Montpellier 2, Laboratoire Charles Coulomb UMR5221, F-34095 Montpellier, France and CNRS, Laboratoire Charles Coulomb UMR5221, F-34095 Montpellier (France); Degiovanni, P. [Université de Lyon, Fédération de Physique Andrée Marie Ampère, CNRS, Laboratoire de Physique de l' Ecole Normale Supérieure de Lyon, 46 allée d' Italie, 69364 Lyon Cedex 07 (France)

    2014-03-28

    We present an experimental study of the low frequency admittance of quantum Hall conductors in the [100 Hz, 1 MHz] frequency range. We show that the frequency dependence of the admittance of the sample strongly depends on the topology of the contacts connections. Our experimental results are well explained within the Christen and Büttiker approach for finite frequency transport in quantum Hall edge channels taking into account the influence of the coaxial cables capacitance. In the Hall bar geometry, we demonstrate that there exists a configuration in which the cable capacitance does not influence the admittance measurement of the sample. In this case, we measure the electrochemical capacitance of the sample and observe its dependence on the filling factor.

  12. Maximizing utilization of sport halls during peak hours

    DEFF Research Database (Denmark)

    Iversen, Evald Bundgård; Forsberg, Peter

    BACKGROUNDDuring peak hours (4.30pm-8pm) demand for timeslots in sport halls in Denmark are high and there are few timeslots available. Further, focus on how public resources are spent most efficient is increasing (Iversen, 2013). This makes it interesting to analyse how utilization could...... be increased during peak hours. DATA AND METHODOLOGYData is collected by observation of activities during two weeks on for example whether halls are used or not; the amount of playing field used; and number of participants (Iversen, 2012). Data on 1.331 activities in 36 sport halls across 4 municipalities have...... been collected. RESULTS The number of participants per activity is higher during peak hours, which is expected when demand is high. However, the usage of sport floor only differs slightly between peak and low hours. Both during peak and low hours on average 80-100 per cent of floor space is used...

  13. Carl Gustav Jung and Granville Stanley Hall on Religious Experience.

    Science.gov (United States)

    Kim, Chae Young

    2016-08-01

    Granville Stanley Hall (1844-1924) with William James (1842-1910) is the key founder of psychology of religion movement and the first American experimental or genetic psychologist, and Carl Gustav Jung (1875-1961) is the founder of the analytical psychology concerned sympathetically about the religious dimension rooted in the human subject. Their fundamental works are mutually connected. Among other things, both Hall and Jung were deeply interested in how the study of religious experience is indispensable for the depth understanding of human subject. Nevertheless, except for the slight indication, this common interest between them has not yet been examined in academic research paper. So this paper aims to articulate preliminary evidence of affinities focusing on the locus and its function of the inner deep psychic dimension as the religious in the work of Hall and Jung.

  14. A topological Dirac insulator in a quantum spin Hall phase.

    Science.gov (United States)

    Hsieh, D; Qian, D; Wray, L; Xia, Y; Hor, Y S; Cava, R J; Hasan, M Z

    2008-04-24

    When electrons are subject to a large external magnetic field, the conventional charge quantum Hall effect dictates that an electronic excitation gap is generated in the sample bulk, but metallic conduction is permitted at the boundary. Recent theoretical models suggest that certain bulk insulators with large spin-orbit interactions may also naturally support conducting topological boundary states in the quantum limit, which opens up the possibility for studying unusual quantum Hall-like phenomena in zero external magnetic fields. Bulk Bi(1-x)Sb(x) single crystals are predicted to be prime candidates for one such unusual Hall phase of matter known as the topological insulator. The hallmark of a topological insulator is the existence of metallic surface states that are higher-dimensional analogues of the edge states that characterize a quantum spin Hall insulator. In addition to its interesting boundary states, the bulk of Bi(1-x)Sb(x) is predicted to exhibit three-dimensional Dirac particles, another topic of heightened current interest following the new findings in two-dimensional graphene and charge quantum Hall fractionalization observed in pure bismuth. However, despite numerous transport and magnetic measurements on the Bi(1-x)Sb(x) family since the 1960s, no direct evidence of either topological Hall states or bulk Dirac particles has been found. Here, using incident-photon-energy-modulated angle-resolved photoemission spectroscopy (IPEM-ARPES), we report the direct observation of massive Dirac particles in the bulk of Bi(0.9)Sb(0.1), locate the Kramers points at the sample's boundary and provide a comprehensive mapping of the Dirac insulator's gapless surface electron bands. These findings taken together suggest that the observed surface state on the boundary of the bulk insulator is a realization of the 'topological metal'. They also suggest that this material has potential application in developing next-generation quantum computing devices that may

  15. New reactor type proposed

    CERN Multimedia

    2003-01-01

    "Russian scientists at the Research Institute of Nuclear Power Engineering in Moscow are hoping to develop a new reactor that will use lead and bismuth as fuel instead of uranium and plutonium" (1/2 page).

  16. Hall effect on tearing mode instabilities in tokamak

    Science.gov (United States)

    Zhang, W.; Ma, Z. W.; Wang, S.

    2017-10-01

    The tearing mode instability is one of the most important dynamic processes in space and laboratory plasmas. Hall effects, resulting from the decoupling of electron and ion motions, can cause fast development and rotation of the perturbation structure of the tearing mode. A high-accuracy nonlinear magnetohydrodynamics code is developed to study Hall effects on the evolution of tearing modes in the Tokamak geometry. It is found that the linear growth rate increases with the increase in the ion skin depth and the self-consistently generated rotation can greatly alter the dynamic behavior of the double tearing mode.

  17. Spin Hall magnetoresistance in antiferromagnet/normal metal bilayers

    KAUST Repository

    Manchon, Aurelien

    2017-01-01

    We investigate the emergence of spin Hall magnetoresistance in a magnetic bilayer composed of a normal metal adjacent to an antiferromagnet. Based on a recently derived drift diffusion equation, we show that the resistance of the bilayer depends on the relative angle between the direction transverse to the current flow and the Néel order parameter. While this effect presents striking similarities with the spin Hall magnetoresistance recently reported in ferromagnetic bilayers, its physical origin is attributed to the anisotropic spin relaxation of itinerant spins in the antiferromagnet.

  18. Disorder Effect of Quantum Anomalous Hall effect in Graphene

    Science.gov (United States)

    Qiao, Zhenhua; Yang, Shengyuan A.; Tse, Wang-Kong; Yao, Yugui; Wang, Jian; Niu, Qian

    2011-03-01

    We investigate the possibility of realizing quantum anomalous Hall effect in graphene. We show that a bulk energy gap can be opened in the presence of both Rashba spin-orbit coupling and an exchange field. We calculate the Berry curvature distribution and find a nonzero Chern number for the valence bands and demonstrate the existence of gapless edge states. Inspired by this finding, we also study, by first-principles method, a concrete example of graphene with Fe atoms adsorbed on top, obtaining the same result. We further study the disorder effect of this quantum anomalous Hall effect and show how this state is localized in the presence of strong disorders.

  19. Porting a Hall MHD Code to a Graphic Processing Unit

    Science.gov (United States)

    Dorelli, John C.

    2011-01-01

    We present our experience porting a Hall MHD code to a Graphics Processing Unit (GPU). The code is a 2nd order accurate MUSCL-Hancock scheme which makes use of an HLL Riemann solver to compute numerical fluxes and second-order finite differences to compute the Hall contribution to the electric field. The divergence of the magnetic field is controlled with Dedner?s hyperbolic divergence cleaning method. Preliminary benchmark tests indicate a speedup (relative to a single Nehalem core) of 58x for a double precision calculation. We discuss scaling issues which arise when distributing work across multiple GPUs in a CPU-GPU cluster.

  20. Inverse spin Hall effect in a closed loop circuit

    Energy Technology Data Exchange (ETDEWEB)

    Omori, Y.; Auvray, F.; Wakamura, T.; Niimi, Y., E-mail: niimi@issp.u-tokyo.ac.jp [Institute for Solid State Physics, University of Tokyo, 5-1-5 Kashiwa-no-ha, Kashiwa, Chiba 277-8581 (Japan); Fert, A. [Unité Mixte de Physique CNRS/Thales, 91767 Palaiseau France associée à l' Université de Paris-Sud, 91405 Orsay (France); Otani, Y. [Institute for Solid State Physics, University of Tokyo, 5-1-5 Kashiwa-no-ha, Kashiwa, Chiba 277-8581 (Japan); RIKEN-CEMS, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan)

    2014-06-16

    We present measurements of inverse spin Hall effects (ISHEs), in which the conversion of a spin current into a charge current via the ISHE is detected not as a voltage in a standard open circuit but directly as the charge current generated in a closed loop. The method is applied to the ISHEs of Bi-doped Cu and Pt. The derived expression of ISHE for the loop structure can relate the charge current flowing into the loop to the spin Hall angle of the SHE material and the resistance of the loop.

  1. Impact of external conditions on energy consumption in industrial halls

    Science.gov (United States)

    Żabnieńśka-Góra, Alina

    2017-11-01

    The energy demand for heating the halls buildings is high. The impact on this may have the technology of production, building construction and technology requirements (HVAC systems). The isolation of the external partitions, the location of the object in relation to the surrounding buildings and the degree of the interior insolation (windows and skylights) are important in the context of energy consumption. The article discusses the impact of external conditions, wind and sunlight on energy demand in the industrial hall. The building model was prepared in IDA ICE 4.0 simulation software. Model validation was done based on measurements taken in the analyzed building.

  2. Skyrmion-induced anomalous Hall conductivity on topological insulator surfaces

    Science.gov (United States)

    Araki, Yasufumi; Nomura, Kentaro

    2017-10-01

    Electron-spin momentum locking together with background magnetic textures can significantly alter the electron transport properties. We investigate theoretically the electron transport at the interface between a topological insulator and a magnetic insulator with magnetic skyrmions on the top. In contrast to the conventional topological Hall effect in normal metals, the skyrmions yield an additional contribution to the anomalous Hall conductivity even in the absence of in-plane magnetic texture, arising from the phase factor characteristic of Dirac electrons acquired at the skyrmion boundary.

  3. Wind tunnel tests of tent halls of different shape

    Directory of Open Access Journals (Sweden)

    Porowska Agnieszka

    2017-01-01

    Full Text Available Aerodynamic investigations of wind pressure distribution on the surfaces of models of tent halls were carried out in the boundary layer wind tunnel at the Cracow University of Technology. Four types of objects of different shapes and construction were tested. Although tent halls are significantly vulnerable with respect to the wind action, there is no information about pressure distribution on objects of such type in standards, codes and normalization documents. Obtained results indicate that it is necessary to take into account different configurations of wind action while designing of the analysed structures.

  4. Quantum inferring acausal structures and the Monty Hall problem

    Science.gov (United States)

    Kurzyk, Dariusz; Glos, Adam

    2016-12-01

    This paper presents a quantum version of the Monty Hall problem based upon the quantum inferring acausal structures, which can be identified with generalization of Bayesian networks. Considered structures are expressed in formalism of quantum information theory, where density operators are identified with quantum generalization of probability distributions. Conditional relations between quantum counterpart of random variables are described by quantum conditional operators. Presented quantum inferring structures are used to construct a model inspired by scenario of well-known Monty Hall game, where we show the differences between classical and quantum Bayesian reasoning.

  5. Spin-Hall nano-oscillator: A micromagnetic study

    Energy Technology Data Exchange (ETDEWEB)

    Giordano, A.; Azzerboni, B.; Finocchio, G. [Department of Electronic Engineering, Industrial Chemistry and Engineering, University of Messina, C.da di Dio, I-98166 Messina (Italy); Carpentieri, M. [Department of Electrical and Information Engineering, Politecnico of Bari, via E. Orabona 4, I-70125 Bari (Italy); Laudani, A. [Department of Engineering, University of Roma Tre, via V. Volterra 62, I-00146 Roma (Italy); Gubbiotti, G. [Istituto Officina dei Materiali del CNR (CNR-IOM), Unità di Perugia c/o Dipartimento di Fisica e Geologia, Via A. Pascoli, 06123 Perugia (Italy)

    2014-07-28

    This Letter studies the dynamical behavior of spin-Hall nanoscillators from a micromagnetic point of view. The model parameters have been identified by reproducing recent experimental data quantitatively. Our results indicate that a strongly localized mode is observed for in-plane bias fields such as in the experiments, while predict the excitation of an asymmetric propagating mode for large enough out-of plane bias field similarly to what observed in spin-torque nanocontact oscillators. Our findings show that spin-Hall nanoscillators can find application as spin-wave emitters for magnonic applications where spin waves are used for transmission and processing information on nanoscale.

  6. Fractional Quantum Hall Plateau Transitions and Composite Fermi Liquids

    Science.gov (United States)

    Cho, Gil Young; Moon, Eun-Gook; Fradkin, Eduardo

    We will investigate relationship between the fractional quantum Hall plateau transition from Laughlin state at ν =1/2 n + 1 to a trivial insulator, and composite Fermi liquid at ν =1/2 (2 n + 1) . We use the recently-developed quantum field theoretic technique, 3d dualities, in combinations with the coupled-wire descriptions for quantum Hall states. We will show that we can also access various other phases, including non-abelian paired states at ν =1/2 (2 n + 1) , from the plateau transition. This work is supported by the Brain Korea 21 PLUS Project of Korea Government and KAIST start-up funding (GYC & EGM).

  7. Department of Reactor Technology

    DEFF Research Database (Denmark)

    Risø National Laboratory, Roskilde

    The general development of the Department of Reactor Technology at Risø during 1981 is presented, and the activities within the major subject fields are described in some detail. Lists of staff, publications, and computer programs are included.......The general development of the Department of Reactor Technology at Risø during 1981 is presented, and the activities within the major subject fields are described in some detail. Lists of staff, publications, and computer programs are included....

  8. Natural convection reactor

    Energy Technology Data Exchange (ETDEWEB)

    Babcock, D.F.; Bernath, L.; Menegus, R.L.; Ring, H.F.

    1956-05-01

    A previous report described the conceptual design of a plutonium producing reactor that may be characterized as follows: Power output (2000 MW); cooling - (natural convection of light water through the reactor, up through a draft tube to an evaporative cooling pond, then back to the reactor, and fuel (400 to 500 tons of uranium enriched to 1.2% U-235). Because this reactor would be cooled by the natural convection of light water, it is believed that the construction costs would be significantly less than for a Savannah or Hanford type reactor. Such expensive items as water treatment and water pumping facilities would be eliminated entirely. The inventory of 500 tons of slightly enriched uranium, however, is an unattractive feature. It represents not only a large dollar investment but also makes the reactor less attractive for construction during periods of national emergency because of the almost certain scarcity of even slightly enriched uranium at that time. The Atomic Energy Commission asked that the design be reviewed with the objective of reducing the inventory of uranium, The results of this review are given in this report.

  9. Revision hip arthroplasty as a treatment of Vancouver B3 periprosthetic femoral fractures without bone grafting.

    Science.gov (United States)

    Wang, Jia-Qi; Gao, You-Shui; Mei, Jiong; Rao, Zhi-Tao; Wang, Shu-Qing

    2013-09-01

    It is conventionally considered that bone grafting is mandatory for Vancouver B3 periprosthetic femoral fractures (PFF) although few clinical studies have challenged the concept previously. The aim of the current study was to investigate the radiographic and functional results of Vancouver B3 PFF treated by revision total hip or hemiarthroplasty (HA) in combination with appropriate internal fixation without bone grafting. 12 patients with Vancouver B3 PFF were treated by revision THA/HA without bone grafting between March 2004 and May 2008. There were nine females and three males, with an average age of 76 years. PFFs were following primary THA/HA in nine patients and following revision THA/HA in three. Postoperative followup was 5.5 years on average (range, 3.5-6.5 years). At the final followup, radiographic results were evaluated with Beals and Tower's criteria and functional outcomes were evaluated using the Merle d'Aubigné scoring system. All fractures healed within an average of 20 weeks (range, 12-28 weeks). There was no significant deformity and shortening of the affected limb and the implant was stable. The average Merle d'Aubigné score was 15.8. Walking ability was regained in 10 patients without additional assistance, while 2 patients had to use crutches. There were 2 patients with numbness of lateral thigh, possibly due to injury to the lateral femoral cutaneous nerve. There were no implant failures, dislocation and refractures. Revision THA/HA in combination with appropriate internal fixation without bone grafting is a good option for treatment of Vancouver B3 periprosthetic femoral fractures in the elderly.

  10. NQRS Data for B3LiO5 (Subst. No. 0180)

    Science.gov (United States)

    Chihara, H.; Nakamura, N.

    This document is part of Subvolume A `Substances Containing Ag … C10H15' of Volume 48 `Nuclear Quadrupole Resonance Spectroscopy Data' of Landolt-Börnstein - Group III `Condensed Matter'. It contains an extract of Section `3.2 Data tables' of the Chapter `3 Nuclear quadrupole resonance data' providing the NQRS data for B3LiO5 (Subst. No. 0180)

  11. Polygonumnolides A1-B3, minor dianthrone derivatives from the roots of Polygonum multiflorum Thunb.

    Science.gov (United States)

    Yang, Jianbo; Yan, Zheng; Ren, Jin; Dai, Zhong; Ma, Shuangcheng; Wang, Aiguo; Su, Yalun

    2017-07-05

    Seven new dianthrone glycosides, named polygonumnolides A1-B3 (1-7), were isolated from the 70 % EtOH extract of the dried roots of Polygonum multiflorum Thunb. using column chromatography and preparative high-performance liquid chromatography. Their structures were determined by 1D and 2D NMR and mass spectroscopy. The isolated compounds were evaluated for their cytotoxic effects against KB tumor cell lines and compounds 1-4 showed moderate cytotoxicity.

  12. El Médico de su Honra (The Doctor of his Own Honor by Calderón de la Barca: The Honor as a Cause of Exemption of the Penal Responsibility in the Baroque Spain

    Directory of Open Access Journals (Sweden)

    José Palacio González

    2014-12-01

    Full Text Available The notion of honor or reputation is at the very core of the Spanish theatre in the baroque period. This fact could not be correctly understood without taking into consideration the obsession about purity of blood, having got a relevant influence in the Spanish society daily life since the expulsion of the Jewish population and the taking over of Grenade in 1492, as well as the first rank role played by the clerical and political power against the reform movement into the Church. One additional element that should be included into this general frame of reference is the structural inability of the Spanish economy to take off, after the end of the middle-age, in a process leading to a beginning of industrial revolution, with the subsequent assumption of modern values that necessarily would come out of that process. The most telling example of the importance of the idea of honor in the Spanish baroque theatre is, with no doubt, The Doctor of his own honor (El medico de su honra, by Calderón de la Barca, which plot turns around the announced death of an innocent lady suspicioned of adultery, just because of an unhappy sets of events. In the play the jealousy is less determinant for the purpose of the plot that the need for the husband to eliminate any element of uncertainty, as far as his reputation is concerned. The King understands the husband’s motivation and forgives him. Such a conception of honor has left, till very recent times, a major mark in the evolution of the Spanish society, even at a legislative level. El concepto de honor o reputación es un elemento fundamental en el teatro barroco español. Este hecho no se puede entender correctamente sin tener en cuenta la obsesión por la pureza de sangre, concepto con una influencia relevante en la vida cotidiana de la sociedad española desde la expulsión de la población judía y la conquista de Granada en 1492, así como por el papel fundamental desempeñado por el poder clerical y pol

  13. [Distribution characteristics of ApoB3'VNTR and hyperlipemia correlation factors in civil aircrew].

    Science.gov (United States)

    Zhu, Feng; Chen, Wei-ru; Chen, Xiao-fei; Liang, Li-quan; Feng, Ying-jin; Zhang, Tao; Yang, Jian; Zhao, Rong-pu; Chen, Liang; Zhu, Hong-hai; Wu, Yu-kun

    2010-03-01

    To study the frequency distribution in polymorphism of the apoprotein B 3' variable number tandem repeat (ApoB3'VNTR) and influence factors on hyperlipemia in civil aircrew. ApoB genotypes were determined by PCR technology and agarose gel electrophoresis. The blood lipids were measured by routine kits. Personal information of flight personnel was collected by questionnaire. Prevalence of the total dyslipidemia (49.5%) and overweight (55.6%) of flight personnel were much higher than that of domestic general population (29.2% and 49.1%) respectively (P abroad (21.50%). The frequency of the big allele (VNTR > or =39) in hyperlipemia groups were higher than that of normal groups. By analysis of co-variance, the body mass index (BMI), low density lipoprotein (LDL) and the total cholesterol(TC) increased with the cumulate flight hours (P independent variable(X), and the BMI as dependent variable(Y), the linearity equations was: Y = 2.730X + 13.584 (R2 = 0.159, P < 0.01). There are perhaps special genetic characteristics in the polymorphism of the ApoB3'VNTR in the aircrew. The big allele is correlated with the hyperlipemia. The flight burden not only directly affects the BMI and blood lipids levels, but also it can indirectly affect the lipids levels by BMI.

  14. B3GALNT2 is a gene associated with congenital muscular dystrophy with brain malformations.

    Science.gov (United States)

    Hedberg, Carola; Oldfors, Anders; Darin, Niklas

    2014-05-01

    Congenital muscular dystrophies associated with brain malformations are a group of disorders frequently associated with aberrant glycosylation of α-dystroglycan. They include disease entities such a Walker-Warburg syndrome, muscle-eye-brain disease and various other clinical phenotypes. Different genes involved in glycosylation of α-dystroglycan are associated with these dystroglycanopathies. We describe a 5-year-old girl with psychomotor retardation, ataxia, spasticity, muscle weakness and increased serum creatine kinase levels. Immunhistochemistry of skeletal muscle revealed reduced glycosylated α-dystroglycan. Magnetic resonance imaging of the brain at 3.5 years of age showed increased T2 signal from supratentorial and infratentorial white matter, a hypoplastic pons and subcortical cerebellar cysts. By whole exome sequencing, the patient was identified to be compound heterozygous for a one-base duplication and a missense mutation in the gene B3GALNT2 (β-1,3-N-acetylgalactosaminyltransferase 2; B3GalNAc-T2). This patient showed a milder phenotype than previously described patients with mutations in the B3GALNT2 gene.

  15. Distinct and Overlapping Requirements for Cyclins A, B, and B3 in Drosophila Female Meiosis

    Directory of Open Access Journals (Sweden)

    Mohammed Bourouh

    2016-11-01

    Full Text Available Meiosis, like mitosis, depends on the activity of the cyclin dependent kinase Cdk1 and its cyclin partners. Here, we examine the specific requirements for the three mitotic cyclins, A, B, and B3 in meiosis of Drosophila melanogaster. We find that all three cyclins contribute redundantly to nuclear envelope breakdown, though cyclin A appears to make the most important individual contribution. Cyclin A is also required for biorientation of homologs in meiosis I. Cyclin B3, as previously reported, is required for anaphase progression in meiosis I and in meiosis II. We find that it also plays a redundant role, with cyclin A, in preventing DNA replication during meiosis. Cyclin B is required for maintenance of the metaphase I arrest in mature oocytes, for spindle organization, and for timely progression through the second meiotic division. It is also essential for polar body formation at the completion of meiosis. With the exception of its redundant role in meiotic maturation, cyclin B appears to function independently of cyclins A and B3 through most of meiosis. We conclude that the three mitotic cyclin-Cdk complexes have distinct and overlapping functions in Drosophila female meiosis.

  16. 77 FR 74697 - Advisory Committee on Reactor Safeguards (ACRS); Meeting of the ACRS Subcommittee on Fukushima...

    Science.gov (United States)

    2012-12-17

    ... From the Federal Register Online via the Government Publishing Office NUCLEAR REGULATORY COMMISSION Advisory Committee on Reactor Safeguards (ACRS); Meeting of the ACRS Subcommittee on Fukushima; Notice of Meeting The ACRS Subcommittee on Fukushima will hold a meeting on January 18, 2013, Room T-2B3...

  17. Los sistemas de barrancos mexicanos, un recurso potencial para el turismo alternativo. El caso de los Barrancos del río Calderón, Estado de México

    Directory of Open Access Journals (Sweden)

    José Isabel Juan Pérez

    2009-01-01

    Full Text Available El sistema de barrancos del río Calderón, ubicado al sureste del Estado de México,que comprende porciones de los municipios de Villa Guerrero, Ixtapan de La Sal y Zumpahuacán, representa un elemento geográfico de trascendencia para las familias de la región. En este lugar coexisten diversos ecosistemas con elementos geográficos, paisajísticos, geomorfológicos, hidrológicos y amplia biodiversidad que pueden ser utilizados para el turismo alternativo. Mediante el método geográfico, incluyendo cartografía automatizada, fotointerpretación y trabajo de campo, se determinó el potencial natural y sociocultural que posee el sistema de barrancos. La investigación se sustentó en la Teoría General de Sistemas y la Ecología Cultural, complementándose con fundamentos de Geografía Cultural y conceptos de Turismo, que permitieron analizar a los barrancos como un sistema integrado en el que convergen componentes físicos, biológicos y socioculturales. El resultado más relevante es que los elementos bióticos y abióticos del sistema de barrancos están siendo impactados por las actividades económicas y extractivas de los pobladores de la región, sin embargo, aún poseen recursos que mediante un programa de manejo pueden ser utilizados para realizar actividades ecoturísticas encaminadas al desarrollo local, las que al mismo tiempo coadyuven a la protección de los elementos naturales más representativos del sistema.

  18. Hall Effect Thruster for High Power Solar Electric Propulsion Technology Demonstration Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Busek proposes to develop a flight version of a high power Hall Effect thruster. While numerous high power Hall Effect thrusters have been demonstrated in the...

  19. Measured Early Lateral Energy Fractions in Concert Halls and Opera Houses

    Science.gov (United States)

    BARRON, M.

    2000-04-01

    In the 30 years since early lateral reflections were first suggested as important for concert halls, spatial impression and source broadening have become almost universally accepted as essential characteristics of halls with good acoustics. Two objective measures of source broadening have been proposed. Measured values of the best defined of these measures, the early lateral energy fraction (LF), are considered here. Results from two independent measurement surveys are discussed. Comparisons of LF values by hall show a significant link between hall mean LF and hall width. There is however considerable overlap between measured LF values in different halls so the relevance of describing halls by their mean early lateral energy fraction values is questionable. The behaviour of LF values within auditoria is discussed for different concert hall plan forms and within opera houses. A measure of source broadening including sound level is proposed and results considered in the context of auditorium design.

  20. Proliferation of colorectal cancer is promoted by two signaling transduction expression patterns: ErbB2/ErbB3/AKT and MET/ErbB3/MAPK.

    Directory of Open Access Journals (Sweden)

    Yong-Liang Yao

    Full Text Available One of the recent breakthroughs in cancer research is the identification of activating mutations in various receptor tyrosine kinase(RTK pathways in many cancers including colorectal cancer(CRC. We hypothesize that, alternative to mutations, overexpression of various oncogenic RTKs may also underpin CRC pathogenesis, and different RTK may couple with distinct downstream signaling pathways in different subtypes of human CRC. By immunohistochemistry, we show here that RTK members ErbB2, ErbB3 and c-Met were in deed differentially overexpressed in colorectal cancer patient samples leading to constitutive activation of RTK signaling pathways. Using ErbB2 specific inhibitor Lapatinib and c-Met specific inhibitor PHA-665752, we further demonstrated that this constitutive activation of RTK signaling is necessary for the survival of colorectal cancer cells. Furthermore, we show that RTK overexpression pattern dictates the use of downstream AKT and/or MAPK pathways. Our data are important additions to current oncogenic mutation models, and further explain the clinical variation in therapeutic responses of colorectal cancer. Our findings advocate for more personalized therapy tailored to individual patients based on their type of RTK expression in addition to their mutation status.

  1. A systematic review of Vancouver B2 and B3 periprosthetic femoral fractures.

    Science.gov (United States)

    Khan, T; Grindlay, D; Ollivere, B J; Scammell, B E; Manktelow, A R J; Pearson, R G

    2017-04-01

    The aim of this study was to investigate the outcomes of Vancouver type B2 and B3 fractures by performing a systematic review of the methods of surgical treatment which have been reported. A systematic search was performed in Ovid MEDLINE, Embase and the Cochrane Central Register of Controlled Trials. For inclusion, studies required a minimum of ten patients with a Vancouver type B2 and/or ten patients with a Vancouver type B3 fracture, a minimum mean follow-up of two years and outcomes which were matched to the type of fracture. Studies were also required to report the rate of re-operation as an outcome measure. The protocol was registered in the PROSPERO database. A total of 22 studies were included based on the eligibility criteria, including 343 B2 fractures and 167 B3 fractures. The mean follow-up ranged from 32 months to 74 months. Of 343 Vancouver B2 fractures, the treatment in 298 (86.8%) involved revision arthroplasty and 45 (12.6%) were treated with internal fixation alone. A total of 37 patients (12.4%) treated with revision arthroplasty and six (13.3%) treated by internal fixation only underwent further re-operation. Of 167 Vancouver B3 fractures, the treatment in 160 (95.8%) involved revision arthroplasty and eight (4.8%) were treated with internal fixation without revision. A total of 23 patients (14.4%) treated with revision arthroplasty and two (28.6%) treated only with internal fixation required re-operation. A significant proportion, particularly of B2 fractures, were treated without revision of the stem. These were associated with a higher rate of re-operation. The treatment of B3 fractures without revision of the stem resulted in a high rate of re-operation. This demonstrates the importance of careful evaluation and accurate characterisation of the fracture at the time of presentation to ensure the correct management. There is a need for improvement in the reporting of data in case series recording the outcome of the surgical treatment of

  2. Finite-temperature effective boundary theory of the quantized thermal Hall effect

    OpenAIRE

    Nakai, Ryota; Ryu, Shinsei; Nomura, Kentaro

    2015-01-01

    A finite-temperature effective free energy of the boundary of a quantized thermal Hall system is derived microscopically from the bulk two-dimensional Dirac fermion coupled with a gravitational field. In two spatial dimensions, the thermal Hall conductivity of fully gapped insulators and superconductors is quantized and given by the bulk Chern number, in analogy to the quantized electric Hall conductivity in quantum Hall systems. From the perspective of effective action functionals, two disti...

  3. Reactor Safety Planning for Prometheus Project, for Naval Reactors Information

    Energy Technology Data Exchange (ETDEWEB)

    P. Delmolino

    2005-05-06

    The purpose of this letter is to submit to Naval Reactors the initial plan for the Prometheus project Reactor Safety work. The Prometheus project is currently developing plans for cold physics experiments and reactor prototype tests. These tests and facilities may require safety analysis and siting support. In addition to the ground facilities, the flight reactor units will require unique analyses to evaluate the risk to the public from normal operations and credible accident conditions. This letter outlines major safety documents that will be submitted with estimated deliverable dates. Included in this planning is the reactor servicing documentation and shipping analysis that will be submitted to Naval Reactors.

  4. Stuart Hall and the Theory and Practice of Articulation

    Science.gov (United States)

    Clarke, John

    2015-01-01

    In this article, I argue that the idea of articulation links three different dimensions of Stuart Hall's work: it is central to the work of cultural politics, to the work of hegemony and to his practice of embodied pedagogy. I claim that his approach to pedagogy entails the art of listening combined with the practice of theorising in the service…

  5. Challenges of scanning hall microscopy using batch fabricated probes

    NARCIS (Netherlands)

    Hatakeyama, Kodai

    2016-01-01

    Scanning Hall probe microscopy is a widely used technique for quantitative high resolution imaging of magnetic stray fields. Up to now probes with nanometer spatial resolution have only been realized by electron beam lithography, which is a slow and expensive fabrication technique. In this thesis,

  6. NASA HERMeS Hall Thruster Electrical Configuration Characterization

    Science.gov (United States)

    Peterson, Peter; Kamhawi, Hani; Huang, Wensheng; Yim, John; Herman, Daniel; Williams, George; Gilland, James; Hofer, Richard

    2016-01-01

    NASAs Hall Effect Rocket with Magnetic Shielding (HERMeS) 12.5 kW Technology Demonstration Unit-1 (TDU-1) Hall thruster has been the subject of extensive technology maturation in preparation for development into a flight ready propulsion system. Part of the technology maturation was to test the TDU-1 thruster in several ground based electrical configurations to assess the thruster robustness and suitability to successful in-space operation. The ground based electrical configuration testing has recently been demonstrated as an important step in understanding and assessing how a Hall thruster may operate differently in space compared to ground based testing, and to determine the best configuration to conduct development and qualification testing. This presentation will cover the electrical configuration testing of the TDU-1 HERMeS Hall thruster in NASA Glenn Research Centers Vacuum Facility 5. The three electrical configurations examined are the thruster body tied to facility ground, thruster floating, and finally the thruster body electrically tied to cathode common. The TDU-1 HERMeS was configured with two different exit plane boundary conditions, dielectric and conducting, to examine the influence on the electrical configuration characterization.

  7. Sensitivity of resistive and Hall measurements to local inhomogeneities

    DEFF Research Database (Denmark)

    Koon, Daniel W.; Wang, Fei; Petersen, Dirch Hjorth

    2013-01-01

    We derive exact, analytic expressions for the sensitivity of resistive and Hall measurements to local inhomogeneities in a specimen's material properties in the combined linear limit of a weak perturbation over an infinitesimal area in a small magnetic field. We apply these expressions both to four...

  8. From quantum confinement to quantum Hall effect in graphene nanostructures

    NARCIS (Netherlands)

    Guimaraes, M. H. D.; Shevtsov, O.; Waintal, X.; van Wees, B. J.

    2012-01-01

    We study the evolution of the two-terminal conductance plateaus with a magnetic field for armchair graphene nanoribbons (GNRs) and graphene nanoconstrictions (GNCs). For GNRs, the conductance plateaus of 2e(2)/h at zero magnetic field evolve smoothly to the quantum Hall regime, where the plateaus in

  9. Composite fermions a unified view of the quantum Hall regime

    CERN Document Server

    1998-01-01

    One of the most exciting recent developments to have emerged from the quantum Hall effect is the subject of composite fermions. This important volume gives a self-contained, comprehensive description of the subject, including fundamentals, more advanced theoretical work, and results from experimental observations of composite fermions.

  10. Tondiraba jäähall = Tondiraba ice arena

    Index Scriptorium Estoniae

    2015-01-01

    Tondiraba jäähall Tallinnas Varraku tänav 14, valminud 2014. Arhitektid Ott Kadarik, Mihkel Tüür, Kadri Tamme (Kadarik Tüür Arhitektid OÜ), insener Paavo Pikand. Eesti Kultuurkapitali Arhitektuuri sihtkapitali aastapreemia 2014

  11. Design of an Efficient Incinerator for Independence Hall, University ...

    African Journals Online (AJOL)

    The menace constituted by improperly disposed solid waste has led to an increase in growing awareness towards solid waste disposal alternatives. The case of Independence Hall in University of Ibadan, Nigeria is not different as delay in the ultimate collection of the waste makes the storage site become an eye-sore and ...

  12. Stop Tobacco in Restaurants: Fifth Grade Students STIR City Hall

    Science.gov (United States)

    Morris, Ronald Vaughan

    2008-01-01

    This article discusses a campaign called STIR: Stop Tobacco in Restaurants, that was started by fourth and fifth grade students. The goal was to end smoking in public places, including restaurants, bowling alleys, sports bars, and pool halls. For two years they motivated their peers, coordinated an information campaign to urge kids and adults to…

  13. Relationship between room shape and acoustics of rectangular concert halls

    DEFF Research Database (Denmark)

    Klosak, Andrzej K.; Gade, Anders Christian

    2008-01-01

    Extensive acoustics computer simulations have been made using Odeon computer simulation software. In 24 rectangular rooms representing "shoe-box" type concert halls with volumes of 8 000 m3, 12 000 m3 and 16 000 m3 from 300 to 850 measurements positions have been analysed. Only room averaged...

  14. Effect of Hall Current and Finite Larmor Radius Corrections on ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 37; Issue 3. Effect of Hall Current and Finite Larmor Radius Corrections on Thermal Instability of Radiative Plasma for Star Formation in Interstellar Medium (ISM). Sachin Kaothekar. Research Article Volume 37 Issue 3 September 2016 Article ID 23 ...

  15. Effect of Hall Current and Finite Larmor Radius Corrections on ...

    Indian Academy of Sciences (India)

    Abstract. The effects of finite ion Larmor radius (FLR) corrections,. Hall current and radiative heat-loss function on the thermal instability of an infinite homogeneous, viscous plasma incorporating the effects of finite electrical resistivity, thermal conductivity and permeability for star formation in interstellar medium have been ...

  16. Quantum Hall physics: Hierarchies and conformal field theory techniques

    Science.gov (United States)

    Hansson, T. H.; Hermanns, M.; Simon, S. H.; Viefers, S. F.

    2017-04-01

    The fractional quantum Hall effect, being one of the most studied phenomena in condensed matter physics during the past 30 years, has generated many ground-breaking new ideas and concepts. Very early on it was realized that the zoo of emerging states of matter would need to be understood in a systematic manner. The first attempts to do this, by Haldane and Halperin, set an agenda for further work which has continued to this day. Since that time the idea of hierarchies of quasiparticles condensing to form new states has been a pillar of our understanding of fractional quantum Hall physics. In the 30 years that have passed since then, a number of new directions of thought have advanced our understanding of fractional quantum Hall states and have extended it in new and unexpected ways. Among these directions is the extensive use of topological quantum field theories and conformal field theories, the application of the ideas of composite bosons and fermions, and the study of non-Abelian quantum Hall liquids. This article aims to present a comprehensive overview of this field, including the most recent developments.

  17. new concepts of a modified hall - petch type relationship

    African Journals Online (AJOL)

    NIJOTECH

    Abstract. A modified form of the Hall - Perch equation, where the average grain diameter is replaced by the surface to volume ratio of internal boundaries (Sv), is considered. Working with this model, a flow stress – Sv relationship dominated by geometrically necessary dislocations (GNDs) is derived for the low strain region.

  18. Virtual Environment of Real Sport Hall and Analyzing Rendering Quality

    Directory of Open Access Journals (Sweden)

    Filip Popovski

    2015-02-01

    Full Text Available Here is presented virtual environment of a real sport hall created in Quest3D VR Edition. All analyzes of the rendering quality, techniques of interaction and performance of the system in real time are presented. We made critical analysis on all of these techniques on different machines and have excellent results.

  19. Magnetoresistance in quantum Hall metals due to Pancharatnam ...

    Indian Academy of Sciences (India)

    We discuss the relevant physical postulates with respect to these physical processes to qualitatively reproduce the measured Hall resistance's zigzag curve for both the integer and the ... Manuscript received: 14 January 2014; Manuscript revised: 15 May 2014; Accepted: 16 June 2014; Early published: 11 January 2015 ...

  20. Acceptability of the Hall Technique to parents and children.

    Science.gov (United States)

    Page, Lyndie A Foster; Boyd, Dorothy H; Davidson, Sarah E; McKay, Samantha K; Thomson, W Murray; Innes, Nicola P

    2014-03-01

    To investigate the acceptability of stainless steel crowns placed by dental therapists on children's primary molars using the Hall Technique. Mixed methods approach, using qualitative inductive analysis and quantitative analysis. Hawke's Bay Community Oral Health Service One focus group was conducted and ten thirty-minute phone interviews were undertaken with parents of children who had previously had a stainless steel crown placed using the Hall Technique (over the period 1 December 2011 to 31 May 2012). An inductive approach was used to analyse the qualitative research data, and the information was arranged into several categories based on the key themes which arose. Children treated with the Hall Technique were asked immediately after treatment whether they had enjoyed their visit to the clinic that day. Common themes were found with regard to appearance, pain, the procedure, and general opinions on acceptability. Nearly all (90%) of the children responded positively about their visit to the clinic. There was a high degree of acceptance among both parents and children for stainless steel crown placement using the Hall Technique in this group.

  1. Hall kirjandus võrgustunud maailmas / Anneli Kuiv

    Index Scriptorium Estoniae

    Kuiv, Anneli

    2003-01-01

    1997. aasta määratluse kohaselt on hall kirjandus "kirjandus, mida toodetakse kõikidel tasanditel valitsus- ja teadusasutuste, äri- ja tootmisringkondade poolt nii trükituna kui ka elektroonselt, kuid mis ei ole kirjastustööstuse kontrolli all"

  2. Planar Hall effect sensor for magnetic micro- and nanobead detection

    DEFF Research Database (Denmark)

    Ejsing, Louise Wellendorph; Hansen, Mikkel Fougt; Menon, Aric Kumaran

    2004-01-01

    Magnetic bead sensors based on the planar Hall effect in thin films of exchange-biased permalloy have been fabricated and characterized. Typical sensitivities are 3 muV/Oe mA. The sensor response to an applied magnetic field has been measured without and with coatings of commercially available 2 ...

  3. Low-frequency noise in planar Hall effect bridge sensors

    DEFF Research Database (Denmark)

    Persson, Anders; Bejhedb, R.S.; Bejhed, R.S.

    2011-01-01

    The low-frequency characteristics of planar Hall effect bridge sensors are investigated as function of the sensor bias current and the applied magnetic field. The noise spectra reveal a Johnson-like spectrum at high frequencies, and a 1/f-like excess noise spectrum at lower frequencies, with a knee...

  4. Decomposition of fractional quantum Hall states: New symmetries and approximations

    NARCIS (Netherlands)

    Thomale, R.; Estienne, B.; Regnault, N.; Bernevig, B.A.

    2010-01-01

    Abstract: We provide a detailed description of a new symmetry structure of the monomial (Slater) expansion coefficients of bosonic (fermionic) fractional quantum Hall states first obtained in Ref. 1, which we now extend to spin-singlet states. We show that the Haldane-Rezayi spin-singlet state can

  5. Ion Velocity Measurements in a Linear Hall Thruster

    National Research Council Canada - National Science Library

    Gascon, Nicolas; Cappelli, Mark A; Hargus, William A., Jr

    2005-01-01

    ... of wall material, or magnetic field intensity. When operated with a low background pressure, the particular Hall discharge studied here creates an ion accelerating electrostatic field mainly outside of the channel, in a narrow zone located 5-20 mm away from the exit plane.

  6. Mini array of quantum Hall devices based on epitaxial graphene

    Energy Technology Data Exchange (ETDEWEB)

    Novikov, S.; Lebedeva, N. [Department of Micro and Nanosciences, Aalto University, Micronova, Tietotie 3, Espoo (Finland); Hämäläinen, J.; Iisakka, I.; Immonen, P.; Manninen, A. J.; Satrapinski, A. [VTT Technical Research Centre of Finland Ltd., Centre for Metrology MIKES, P.O. Box 1000, 02044 VTT (Finland)

    2016-05-07

    Series connection of four quantum Hall effect (QHE) devices based on epitaxial graphene films was studied for realization of a quantum resistance standard with an up-scaled value. The tested devices showed quantum Hall plateaux R{sub H,2} at a filling factor v = 2 starting from a relatively low magnetic field (between 4 T and 5 T) when the temperature was 1.5 K. The precision measurements of quantized Hall resistance of four QHE devices connected by triple series connections and external bonding wires were done at B = 7 T and T = 1.5 K using a commercial precision resistance bridge with 50 μA current through the QHE device. The results showed that the deviation of the quantized Hall resistance of the series connection of four graphene-based QHE devices from the expected value of 4×R{sub H,2} = 2 h/e{sup 2} was smaller than the relative standard uncertainty of the measurement (<1 × 10{sup −7}) limited by the used resistance bridge.

  7. College Sports Fan Aggression: Implications for Residence Hall Discipline.

    Science.gov (United States)

    Coons, Christine Jansen; And Others

    1995-01-01

    Evaluated relationship between spectator aggression at football games and residence hall discipline. Results indicated that there is significant correlation, on five variables tested, between fan behavior and the increase of disciplinary cases during football weekends. Provides suggestions for interventions to reduce disciplinary actions. (JBJ)

  8. The Marketing of Residence Halls: A Question of Positioning.

    Science.gov (United States)

    Parker, R. Stephen; And Others

    1996-01-01

    A survey of 343 college residence hall directors revealed percentages of private and public institutions offering different amenities, main selling points in promotional brochures, and the most common resident complaints. Results were compared with those of a resident survey concerning the importance of various housing attributes. Implications for…

  9. Energy efficient heating and ventilation of large halls

    CERN Document Server

    Hojer, Ondrej; Kabele, Karel; Kotrbaty, Miroslav; Sommer, Klaus; Petras, Dusan

    2011-01-01

    This guidebook is focused on modern methods for design, control and operation of energy efficient heating systems in large spaces and industrial halls. The book deals with thermal comfort, light and dark gas radiant heaters, panel radiant heating, floor heating and industrial air heating systems. Various heating systems are illustrated with case studies. Design principles, methods and modeling tools are presented for various systems.

  10. Darrell Hall Covos-Day Books, Weltevreden Park, South Africa ...

    African Journals Online (AJOL)

    published in 1991 and a second edition in 1994. His second work, entitled Long Tom, deals with the history of the famous 155mm Creusot siege guns of the Boers. His last work, The. Hall handbook of the Anglo-Boer War, was published posthumously in 1999 under the editorship of Fransjohan Pretorius and Gilbert Torlage.

  11. Quantum Hall Ferroelectrics and Nematics in Multivalley Systems

    Directory of Open Access Journals (Sweden)

    Inti Sodemann

    2017-12-01

    Full Text Available We study broken symmetry states at integer Landau-level fillings in multivalley quantum Hall systems whose low-energy dispersions are anisotropic. When the Fermi surface of individual pockets lacks twofold rotational symmetry, like in bismuth (111 [Feldman et al. , Observation of a Nematic Quantum Hall Liquid on the Surface of Bismuth, Science 354, 316 (2016SCIEAS0036-807510.1126/science.aag1715] and in Sn_{1-x}Pb_{x}Se (001 [Dziawa et al., Topological Crystalline Insulator States in Pb_{1-x}Sn_{x}Se, Nat. Mater. 11, 1023 (2012NMAACR1476-112210.1038/nmat3449] surfaces, interactions tend to drive the formation of quantum Hall ferroelectric states. We demonstrate that the dipole moment in these states has an intimate relation to the Fermi surface geometry of the parent metal. In quantum Hall nematic states, like those arising in AlAs quantum wells, we demonstrate the existence of unusually robust Skyrmion quasiparticles.

  12. Exotic galilean symmetry, non-commutativity & the Hall effect

    OpenAIRE

    Horvathy, P.

    2005-01-01

    The ``exotic'' particle model associated with the two-parameter central extension of the planar Galilei group can be used to derive the ground states of the Fractional Quantum Hall Effect. Similar equations arise for a semiclassical Bloch electron. Exotic Galilean symmetry is also be shared by Chern-Simons field theory of the Moyal type.

  13. Interaction Induced Quantum Valley Hall Effect in Graphene

    Directory of Open Access Journals (Sweden)

    E. C. Marino

    2015-03-01

    Full Text Available We use pseudo-quantum electrodynamics in order to describe the full electromagnetic interaction of the p electrons in graphene in a consistent 2D formulation. We first consider the effect of this interaction in the vacuum polarization tensor or, equivalently, in the current correlator. This allows us to obtain the T→0 conductivity after a smooth zero-frequency limit is taken in Kubo’s formula. Thereby, we obtain the usual expression for the minimal conductivity plus corrections due to the interaction that bring it closer to the experimental value. We then predict the onset of an interaction-driven spontaneous quantum valley Hall effect below an activation temperature of the order of 2 K. The transverse (Hall valley conductivity is evaluated exactly and shown to coincide with the one in the usual quantum Hall effect. Finally, by considering the effects of pseudo-quantum electrodynamics, we show that the electron self-energy is such that a set of P- and T-symmetric gapped electron energy eigenstates are dynamically generated, in association with the quantum valley Hall effect.

  14. A two fluid description of the Quantum Hall Soliton

    Energy Technology Data Exchange (ETDEWEB)

    Freivogel, Ben [Stanford Univ., Stanford, CA (United States); Susskind, Leonard [Stanford Univ., Stanford, CA (United States); Toumbas, Nicolaos [Stanford Univ., Stanford, CA (United States)

    2015-02-03

    We show that the Quantum Hall Soliton constructed in [1] is stable under small perturbations. We find that creating quasiparticles actually lowers the energy of the system, and discuss whether this indicates an instability on the time scales relevant to the problem.

  15. A Spreadsheet Simulation of the Monty Hall Problem

    Science.gov (United States)

    Patterson, Mike C.; Harmel, Bob; Friesen, Dan

    2010-01-01

    The "Monty Hall" problem or "Three Door" problem--where a person chooses one of three doors in hope of winning a valuable prize but is subsequently offered the choice of changing his or her selection--is a well known and often discussed probability problem. In this paper, the structure, history, and ultimate solution of the…

  16. Numerical simulation of SMART-1 Hall-thruster plasma interactions

    NARCIS (Netherlands)

    Tajmar, Martin; Sedmik, René; Scharlemann, Carsten

    2009-01-01

    SMART-1 has been the first European mission using a Hall thruster to reach the moon. An onboard plasma diagnostic package allowed a detailed characterization of the thruster exhaust plasma and its interactions with the spacecraft. Analysis of in-flight data revealed, amongst others, an unpredicted

  17. Mechanism of sound absorption by seated audience in halls.

    Science.gov (United States)

    Nishihara, N; Hidaka, T; Beranek, L L

    2001-11-01

    Four methods are explored for predicting the reverberation times in fully occupied halls for music as related to the sound absorption by their audiences. The methods for providing audience absorptions include two that use reverberation chambers, namely, the ISO 354 method (and other similar standards) (ISO) and Kath and Kuhl's method (K & K) [Acustica 15, 127-131 (1965)], and two that use average data from halls, i.e., Beranek's method (COH) [Concert and Opera Halls: How They Sound (Acoustical Society of America, Melville, NY, 1996)], and the average audience power-per-seat absorption which in practice is multiplied by the number of seats (AA). These methods are applied to the calculation of reverberation times in six existing halls, fully occupied, and the results were compared with actual measurements. The COH method was best for predictions over the entire frequency range. The K & K method showed the highest accuracy at mid-frequencies. Both the ISO and the K & K methods yielded wide differences for the measurements in the 125- and 250-Hz bands. The AA method was as good as the COH method when the measurements for the six halls were averaged, but showed a wide spread in the predictions around the average because it does not consider the degree of upholstering of the seats. It was hypothecated by the authors that the principal reasons for the ISO and K & K discrepancies at low frequencies were (a) differences between the degree of sound diffusion in actual halls and that in reverberation chambers, and (b) lack of information on the mechanisms of absorption of sound by people seated side-by-side in rows, particularly for near-grazing incidence sound fields. First, this article explores the sound diffusivity in a reverberation chamber and in the halls using CAD models. A probability density function of the incident angles of the sound rays that impinge on the audiences is defined and was measured for each case. Using a unique method, the sound absorption

  18. Scaleable, High Efficiency Microchannel Sabatier Reactor Project

    Data.gov (United States)

    National Aeronautics and Space Administration — A Microchannel Sabatier Reactor System (MSRS) consisting of cross connected arrays of isothermal or graded temperature reactors is proposed. The reactor array...

  19. The influence of profiled ceilings on sports hall acoustics : Ground effect predictions and scale model measurements

    NARCIS (Netherlands)

    Wattez, Y.C.M.; Tenpierik, M.J.; Nijs, L.

    2018-01-01

    Over the last few years, reverberation times and sound pressure levels have been measured in many sports halls. Most of these halls, for instance those made from stony materials, perform as predicted. However, sports halls constructed with profiled perforated steel roof panels have an unexpected

  20. The use of Hall technique preformed metal crowns by specialist paediatric dentists in the UK

    OpenAIRE

    Roberts, A; McKay, A; Albadri, S

    2018-01-01

    Examines treatment planning involving Hall technique preformed metal crowns by specialists in paediatric dentistry. Explores clinical situations in which specialists in paediatric dentistry feel it is appropriate or not to fit Hall technique preformed metal crowns. Investigates which types of carious lesions are being treated with Hall technique preformed metal crowns by specialists in paediatric dentistry.

  1. Welcome to USA 15, the first large underground hall for the LHC

    CERN Multimedia

    2001-01-01

    The first of the four huge underground halls for LHC is ready. USA 15 will be the service hall for ATLAS. It has taken three years to finish the first underground hall for LHC. It is 62 metres long and 20 metres diameter.

  2. 78 FR 37553 - Maternal Health Town Hall Listening Session; Notice of Meeting

    Science.gov (United States)

    2013-06-21

    ... ideas in support of the National Maternal Health Initiative. The Town Hall Listening Session will serve... HUMAN SERVICES Health Resources and Services Administration Maternal Health Town Hall Listening Session; Notice of Meeting Name: Maternal Health Town Hall Listening Session. Date and Time: August 27, 2013, 2:00...

  3. Gender Differences in the Relationship of Hall Directors' Transformational and Transactional Leadership and Achieving Styles.

    Science.gov (United States)

    Komives, Susan R.

    1991-01-01

    In seven-campus study, found significant gender differences in self-perceptions of leadership and achieving style among hall directors (n=74). Found only hall director relational achieving styles were related to resident assistants' work unit's assessment of their hall director's transformational leadership. (Author)

  4. The Relationship of Hall Directors' Transformational and Transactional Leadership to Select Resident Assistant Outcomes.

    Science.gov (United States)

    Komives, Susan R.

    1991-01-01

    Multicampus study examined transformational and transactional leadership factors of hall directors (n=84) and resident assistants (n=806). Results indicated both male and female hall directors practiced transformational leadership behaviors. Hall director leadership behavior accounted for two-thirds of the variance in resident assistant…

  5. Vancouver type B2 and B3 periprosthetic fractures treated with revision total hip arthroplasty.

    Science.gov (United States)

    Amenabar, Tomas; Rahman, Wael A; Avhad, Vineet V; Vera, Ramiro; Gross, Allan E; Kuzyk, Paul R

    2015-10-01

    Periprosthetic fractures are the fourth most common cause for hip revision and a devastating complication. Our purpose is to report results and quality of life following revision THA for Vancouver B2 and B3 fractures. This was a retrospective review from January 2000 to November 2012 to identify all revision THA performed for Vancouver types B2 and B3 that had a minimum follow-up of two years. Routine post-operative and radiographic evaluation to assess patient survival, implant failure, complications and quality of life was involved. Statistical analysis was made with the Kaplan-Meier survival curve with 95 % confidence interval and the log rank (Mantel-Cox) test. A total of 76 fractures were included, with an average follow-up 74.4 months. Mean age at the revision surgery was 75.7 years (range, 41-97 years; SD, 12.4). Sixty-six cases were classified as Vancouver B2 and treated with distal fixation stem. Ten cases were Vancouver B3 and a proximal femoral allograft technique was used. The overall five-year Kaplan-Meier survival rate for the patients was 77.9 % (95 % CI, 67.4-88.4), and the ten-year rate was 65.1 % (95 % CI, 51.4-78.8). Five-year Kaplan-Meier survival rate for the implants was 89.6 % (95 % CI, 82.2-97); we presented seven failures. The mean SF-12 mental was 55.1 (range, 31-68; SD, 8.1) and the physical was 37.4 (range, 16-55; SD, 9.4). Mortality rate after periprosthetic fractures is high as compared to other hip surgeries; our Kaplan-Meier analysis showed that it tends to plateau after five years. In our series the failure rate was low and occurred early in the post-operative period.

  6. MERCHANT MARINE SHIP REACTOR

    Science.gov (United States)

    Mumm, J.F.; North, D.C. Jr.; Rock, H.R.; Geston, D.K.

    1961-05-01

    A nuclear reactor is described for use in a merchant marine ship. The reactor is of pressurized light water cooled and moderated design in which three passes of the water through the core in successive regions of low, intermediate, and high heat generation and downflow in a fuel region are made. The foregoing design makes a compact reactor construction with extended core life. The core has an egg-crate lattice containing the fuel elements confined between a lower flow baffle and upper grid plate, with the latter serving also as part of a turn- around manifold from which the entire coolant is distributed into the outer fuel elements for the second pass through the core. The inner fuel elements are cooled in the third pass.

  7. Nuclear Rocket Engine Reactor

    CERN Document Server

    Lanin, Anatoly

    2013-01-01

    The development of a nuclear rocket engine reactor (NRER ) is presented in this book. The working capacity of an active zone NRER under mechanical and thermal load, intensive neutron fluxes, high energy generation (up to 30 MBT/l) in a working medium (hydrogen) at temperatures up to 3100 K is displayed. Design principles and bearing capacity of reactors area discussed on the basis of simulation experiments and test data of a prototype reactor. Property data of dense constructional, porous thermal insulating and fuel materials like carbide and uranium carbide compounds in the temperatures interval 300 - 3000 K are presented. Technological aspects of strength and thermal strength resistance of materials are considered. The design procedure of possible emergency processes in the NRER is developed and risks for their origination are evaluated. Prospects of the NRER development for pilotless space devices and piloted interplanetary ships are viewed.

  8. Nuclear reactor safety device

    Science.gov (United States)

    Hutter, Ernest

    1986-01-01

    A safety device is disclosed for use in a nuclear reactor for axially repositioning a control rod with respect to the reactor core in the event of an upward thermal excursion. Such safety device comprises a laminated helical ribbon configured as a tube-like helical coil having contiguous helical turns with slidably abutting edges. The helical coil is disclosed as a portion of a drive member connected axially to the control rod. The laminated ribbon is formed of outer and inner laminae. The material of the outer lamina has a greater thermal coefficient of expansion than the material of the inner lamina. In the event of an upward thermal excursion, the laminated helical coil curls inwardly to a smaller diameter. Such inward curling causes the total length of the helical coil to increase by a substantial increment, so that the control rod is axially repositioned by a corresponding amount to reduce the power output of the reactor.

  9. Heat dissipating nuclear reactor

    Science.gov (United States)

    Hunsbedt, A.; Lazarus, J.D.

    1985-11-21

    Disclosed is a nuclear reactor containment adapted to retain and cool core debris in the unlikely event of a core meltdown and subsequent breach in the reactor vessel. The reactor vessel is seated in a cavity which has a thick metal sidewall that is integral with a thick metal basemat at the bottom of the cavity. The basemat extends beyond the perimeter of the cavity sidewall. Underneath the basemat is a porous bed with water pipes and steam pipes running into it. Water is introduced into the bed and converted into steam which is vented to the atmosphere. A plurality of metal pilings in the form of H-beams extend from the metal base plate downwardly and outwardly into the earth.

  10. Reactor for exothermic reactions

    Science.gov (United States)

    Smith, Jr., Lawrence A.; Hearn, Dennis; Jones, Jr., Edward M.

    1993-01-01

    A liquid phase process for oligomerization of C.sub.4 and C.sub.5 isoolefins or the etherification thereof with C.sub.1 to C.sub.6 alcohols wherein the reactants are contacted in a reactor with a fixed bed acid cation exchange resin catalyst at an LHSV of 5 to 20, pressure of 0 to 400 psig and temperature of 120.degree. to 300.degree. F. Wherein the improvement is the operation of the reactor at a pressure to maintain the reaction mixture at its boiling point whereby at least a portion but less than all of the reaction mixture is vaporized. By operating at the boiling point and allowing a portion of the reaction mixture to vaporize, the exothermic heat of reaction is dissipated by the formation of more boil up and the temperature in the reactor is controlled.

  11. Alien shores

    Energy Technology Data Exchange (ETDEWEB)

    Viermann, Joerg [GNS Gesellschaft fuer Nuklear-Service mbH, Essen (Germany). Dept. Sales Waste Management

    2014-08-15

    The UK nuclear programme started out in the 1950's with some remarkable milestones: Calder Hall 1 was the first commercial reactor worldwide to be erected and was connected to the grid in 1956 with the other three Calder Hall Magnox reactors soon to follow. More Magnox reactors were built along the British coast in the 1950's and 60's. In 1971 the two reactors at Wylfa were the last UK Magnox reactors to be connected to the grid. Low level radioactive waste arising from electricity production went to the Drigg burial site, spent fuel to the Sellafield reprocessing facilities. Intermediate level waste was collected mainly on site, but also in the storage pools at Sellafield. This legacy now has to be dealt with. The UK's only PWR is operated by EDF Energy in Sizewell near Leiston which was connected to the grid in 1995. ILW resins have been collected over its first 18 years of operation. With the storage tanks running out of capacity within the following 2 years it was necessary to start filling these resins into waste containers, ideally into containers suitable for the planned UK repository. German expertise and experience in dealing with different types of ILW can be of benefit for UK operators. GNS products and services ideally match some of the actual challenges which GNS could prove in some initial waste processing projects. GNS also started to develop custom made solutions for the UK market.

  12. An Overview of Reactor Concepts, a Survey of Reactor Designs.

    Science.gov (United States)

    1985-02-01

    implies, this reactor uses gas as the primary coolant . The coolant has a higher exit temperature when leaving the core than the PWR water 6 AFWL-TN-84...nuclear reactors, coolants must be used to ensure material components are not subject to failure due to the temperature exceeding melting points...Reactors that use deu- terium (heavy water) as a coolant can use natural uranium as a fuel. The * Canadian reactor, CANDU , utilizes this concept

  13. Oscillatory flow chemical reactors

    Directory of Open Access Journals (Sweden)

    Slavnić Danijela S.

    2014-01-01

    Full Text Available Global market competition, increase in energy and other production costs, demands for high quality products and reduction of waste are forcing pharmaceutical, fine chemicals and biochemical industries, to search for radical solutions. One of the most effective ways to improve the overall production (cost reduction and better control of reactions is a transition from batch to continuous processes. However, the reactions of interests for the mentioned industry sectors are often slow, thus continuous tubular reactors would be impractically long for flow regimes which provide sufficient heat and mass transfer and narrow residence time distribution. The oscillatory flow reactors (OFR are newer type of tube reactors which can offer solution by providing continuous operation with approximately plug flow pattern, low shear stress rates and enhanced mass and heat transfer. These benefits are the result of very good mixing in OFR achieved by vortex generation. OFR consists of cylindrical tube containing equally spaced orifice baffles. Fluid oscillations are superimposed on a net (laminar flow. Eddies are generated when oscillating fluid collides with baffles and passes through orifices. Generation and propagation of vortices create uniform mixing in each reactor cavity (between baffles, providing an overall flow pattern which is close to plug flow. Oscillations can be created by direct action of a piston or a diaphragm on fluid (or alternatively on baffles. This article provides an overview of oscillatory flow reactor technology, its operating principles and basic design and scale - up characteristics. Further, the article reviews the key research findings in heat and mass transfer, shear stress, residence time distribution in OFR, presenting their advantages over the conventional reactors. Finally, relevant process intensification examples from pharmaceutical, polymer and biofuels industries are presented.

  14. Reactor Materials Research

    Energy Technology Data Exchange (ETDEWEB)

    Van Walle, E

    2002-04-01

    The activities of SCK-CEN's Reactor Materials Research Department for 2001 are summarised. The objectives of the department are: (1) to evaluate the integrity and behaviour of structural materials used in nuclear power industry; (2) to conduct research to unravel and understand the parameters that determine the material behaviour under or after irradiation; (3) to contribute to the interpretation, the modelling of the material behaviour and to develop and assess strategies for optimum life management of nuclear power plant components. The programmes within the department are focussed on studies concerning (1) Irradiation Assisted Stress Corrosion Cracking (IASCC); (2) nuclear fuel; and (3) Reactor Pressure Vessel Steel.

  15. Nuclear reactor apparatus

    Science.gov (United States)

    Wade, Elman E.

    1978-01-01

    A lifting, rotating and sealing apparatus for nuclear reactors utilizing rotating plugs above the nuclear reactor core. This apparatus permits rotation of the plugs to provide under the plug refueling of a nuclear core. It also provides a means by which positive top core holddown can be utilized. Both of these operations are accomplished by means of the apparatus lifting the top core holddown structure off the nuclear core while stationary, and maintaining this structure in its elevated position during plug rotation. During both of these operations, the interface between the rotating member and its supporting member is sealingly maintained.

  16. Perspectives on reactor safety

    Energy Technology Data Exchange (ETDEWEB)

    Haskin, F.E. [New Mexico Univ., Albuquerque, NM (United States). Dept. of Chemical and Nuclear Engineering; Camp, A.L. [Sandia National Labs., Albuquerque, NM (United States)

    1994-03-01

    The US Nuclear Regulatory Commission (NRC) maintains a technical training center at Chattanooga, Tennessee to provide appropriate training to both new and experienced NRC employees. This document describes a one-week course in reactor, safety concepts. The course consists of five modules: (1) historical perspective; (2) accident sequences; (3) accident progression in the reactor vessel; (4) containment characteristics and design bases; and (5) source terms and offsite consequences. The course text is accompanied by slides and videos during the actual presentation of the course.

  17. Safe reactor power

    Energy Technology Data Exchange (ETDEWEB)

    Menegus, R.L.; Ring, H.F.; Bernath, L.

    1956-05-15

    The upper limit on reactor operating power is established not only by safety considerations during steady-state operation but also by the requirement that during an accident no permanent damage be inflicted upon the reactor or the fuel charge. Two general categories of accidents are recognized; they are the ``nuclear runaway`` and the ``loss of coolant flow`` incidents. In this memorandum an incident of the latter type is analyzed. It is assumed that the safety rods function normally, and a method is defined for establishing the highest operating power that may be permitted if the postulated accident is to do no damage.

  18. Magnetic field deformation due to electron drift in a Hall thruster

    OpenAIRE

    Han Liang; Ding Yongjie; Zhang Xu; Wei Liqiu; Yu Daren

    2017-01-01

    The strength and shape of the magnetic field are the core factors in the design of the Hall thruster. However, Hall current can affect the distribution of static magnetic field. In this paper, the Particle-In-Cell (PIC) method is used to obtain the distribution of Hall current in the discharge channel. The Hall current is separated into a direct and an alternating part to calculate the induced magnetic field using Finite Element Method Magnetics (FEMM). The results show that the direct Hall c...

  19. 7 CFR Exhibit B-3 to Subpart B of... - Letter for Notifying Applicants, Lender, Holders and Borrowers of Adverse Decisions Where the...

    Science.gov (United States)

    2010-01-01

    ... Farmer Program Primary Loan Servicing Actions) B Exhibit B-3 to Subpart B of Part 1900 Agriculture... GENERAL Adverse Decisions and Administrative Appeals Pt. 1900, Subpt. B, Exh. B-3 Exhibit B-3 to Subpart B...

  20. High Flux Isotope Reactor (HFIR)

    Data.gov (United States)

    Federal Laboratory Consortium — The HFIR at Oak Ridge National Laboratory is a light-water cooled and moderated reactor that is the United States’ highest flux reactor-based neutron source. HFIR...

  1. Reactor operation environmental information document

    Energy Technology Data Exchange (ETDEWEB)

    Haselow, J.S.; Price, V.; Stephenson, D.E.; Bledsoe, H.W.; Looney, B.B.

    1989-12-01

    The Savannah River Site (SRS) produces nuclear materials, primarily plutonium and tritium, to meet the requirements of the Department of Defense. These products have been formed in nuclear reactors that were built during 1950--1955 at the SRS. K, L, and P reactors are three of five reactors that have been used in the past to produce the nuclear materials. All three of these reactors discontinued operation in 1988. Currently, intense efforts are being extended to prepare these three reactors for restart in a manner that protects human health and the environment. To document that restarting the reactors will have minimal impacts to human health and the environment, a three-volume Reactor Operations Environmental Impact Document has been prepared. The document focuses on the impacts of restarting the K, L, and P reactors on both the SRS and surrounding areas. This volume discusses the geology, seismology, and subsurface hydrology. 195 refs., 101 figs., 16 tabs.

  2. Influence of carbohydrates on the interaction of procyanidin B3 with trypsin.

    Science.gov (United States)

    Gonçalves, Rui; Mateus, Nuno; De Freitas, Victor

    2011-11-09

    The biological properties of procyanidins, in particular their inhibition of digestive enzymes, have received much attention in the past few years. Dietary carbohydrates are an environmental factor that is known to affect the interaction of procyanidins with proteins. This work aimed at understanding the effect of ionic food carbohydrates (polygalacturonic acid, arabic gum, pectin, and xanthan gum) on the interaction between procyanidins and trypsin. Physical-chemical techniques such as saturation transfer difference-NMR (STD-NMR) spectroscopy, fluorescence quenching, and nephelometry were used to evaluate the interaction process. Using STD-NMR, it was possible to identify the binding of procyanidin B3 to trypsin. The tested carbohydrates prevented the association of procyanidin B3 and trypsin by a competition mechanism in which the ionic character of carbohydrates and their ability to encapsulate procyanidins seem crucial leading to a reduction in STD signal and light scattering and to a recovery of the proteins intrinsic fluorescence. On the basis of these results, it was possible to grade the carbohydrates in their aggregation inhibition ability: XG > PA > AG ≫ PC. These effects may be relevant since the coingestion of procyanidins and ionic carbohydrates are frequent and furthermore since these might negatively affect the antinutritional properties ascribed to procyanidins in the past.

  3. The detector system of the Daya Bay reactor neutrino experiment

    Science.gov (United States)

    An, F. P.; Bai, J. Z.; Balantekin, A. B.; Band, H. R.; Beavis, D.; Beriguete, W.; Bishai, M.; Blyth, S.; Brown, R. L.; Butorov, I.; Cao, D.; Cao, G. F.; Cao, J.; Carr, R.; Cen, W. R.; Chan, W. T.; Chan, Y. L.; Chang, J. F.; Chang, L. C.; Chang, Y.; Chasman, C.; Chen, H. Y.; Chen, H. S.; Chen, M. J.; Chen, Q. Y.; Chen, S. J.; Chen, S. M.; Chen, X. C.; Chen, X. H.; Chen, X. S.; Chen, Y. X.; Chen, Y.; Cheng, J. H.; Cheng, J.; Cheng, Y. P.; Cherwinka, J. J.; Chidzik, S.; Chow, K.; Chu, M. C.; Cummings, J. P.; de Arcos, J.; Deng, Z. Y.; Ding, X. F.; Ding, Y. Y.; Diwan, M. V.; Dong, L.; Dove, J.; Draeger, E.; Du, X. F.; Dwyer, D. A.; Edwards, W. R.; Ely, S. R.; Fang, S. D.; Fu, J. Y.; Fu, Z. W.; Ge, L. Q.; Ghazikhanian, V.; Gill, R.; Goett, J.; Gonchar, M.; Gong, G. H.; Gong, H.; Gornushkin, Y. A.; Grassi, M.; Greenler, L. S.; Gu, W. Q.; Guan, M. Y.; Guo, R. P.; Guo, X. H.; Hackenburg, R. W.; Hahn, R. L.; Han, R.; Hans, S.; He, M.; He, Q.; He, W. S.; Heeger, K. M.; Heng, Y. K.; Higuera, A.; Hinrichs, P.; Ho, T. H.; Hoff, M.; Hor, Y. K.; Hsiung, Y. B.; Hu, B. Z.; Hu, L. M.; Hu, L. J.; Hu, T.; Hu, W.; Huang, E. C.; Huang, H. Z.; Huang, H. X.; Huang, P. W.; Huang, X.; Huang, X. T.; Huber, P.; Hussain, G.; Isvan, Z.; Jaffe, D. E.; Jaffke, P.; Jen, K. L.; Jetter, S.; Ji, X. P.; Ji, X. L.; Jiang, H. J.; Jiang, W. Q.; Jiao, J. B.; Johnson, R. A.; Joseph, J.; Kang, L.; Kettell, S. H.; Kohn, S.; Kramer, M.; Kwan, K. K.; Kwok, M. W.; Kwok, T.; Lai, C. Y.; Lai, W. C.; Lai, W. H.; Langford, T. J.; Lau, K.; Lebanowski, L.; Lee, J.; Lee, M. K. P.; Lei, R. T.; Leitner, R.; Leung, J. K. C.; Lewis, C. A.; Li, B.; Li, C.; Li, D. J.; Li, F.; Li, G. S.; Li, J.; Li, N. Y.; Li, Q. J.; Li, S. F.; Li, S. C.; Li, W. D.; Li, X. B.; Li, X. N.; Li, X. Q.; Li, Y.; Li, Y. F.; Li, Z. B.; Liang, H.; Liang, J.; Lin, C. J.; Lin, G. L.; Lin, P. Y.; Lin, S. X.; Lin, S. K.; Lin, Y. C.; Ling, J. J.; Link, J. M.; Littenberg, L.; Littlejohn, B. R.; Liu, B. J.; Liu, C.; Liu, D. W.; Liu, H.; Liu, J. L.; Liu, J. C.; Liu, S.; Liu, S. S.; Liu, X.; Liu, Y. B.; Lu, C.; Lu, H. Q.; Lu, J. S.; Luk, A.; Luk, K. B.; Luo, T.; Luo, X. L.; Ma, L. H.; Ma, Q. M.; Ma, X. Y.; Ma, X. B.; Ma, Y. Q.; Mayes, B.; McDonald, K. T.; McFarlane, M. C.; McKeown, R. D.; Meng, Y.; Mitchell, I.; Mohapatra, D.; Monari Kebwaro, J.; Morgan, J. E.; Nakajima, Y.; Napolitano, J.; Naumov, D.; Naumova, E.; Newsom, C.; Ngai, H. Y.; Ngai, W. K.; Nie, Y. B.; Ning, Z.; Ochoa-Ricoux, J. P.; Olshevskiy, A.; Pagac, A.; Pan, H.-R.; Patton, S.; Pearson, C.; Pec, V.; Peng, J. C.; Piilonen, L. E.; Pinsky, L.; Pun, C. S. J.; Qi, F. Z.; Qi, M.; Qian, X.; Raper, N.; Ren, B.; Ren, J.; Rosero, R.; Roskovec, B.; Ruan, X. C.; Sands, W. R.; Seilhan, B.; Shao, B. B.; Shih, K.; Song, W. Y.; Steiner, H.; Stoler, P.; Stuart, M.; Sun, G. X.; Sun, J. L.; Tagg, N.; Tam, Y. H.; Tanaka, H. K.; Tang, W.; Tang, X.; Taychenachev, D.; Themann, H.; Torun, Y.; Trentalange, S.; Tsai, O.; Tsang, K. V.; Tsang, R. H. M.; Tull, C. E.; Tung, Y. C.; Viaux, N.; Viren, B.; Virostek, S.; Vorobel, V.; Wang, C. H.; Wang, L. S.; Wang, L. Y.; Wang, L. Z.; Wang, M.; Wang, N. Y.; Wang, R. G.; Wang, T.; Wang, W.; Wang, W. W.; Wang, X. T.; Wang, X.; Wang, Y. F.; Wang, Z.; Wang, Z.; Wang, Z. M.; Webber, D. M.; Wei, H. Y.; Wei, Y. D.; Wen, L. J.; Wenman, D. L.; Whisnant, K.; White, C. G.; Whitehead, L.; Whitten, C. A.; Wilhelmi, J.; Wise, T.; Wong, H. C.; Wong, H. L. H.; Wong, J.; Wong, S. C. F.; Worcester, E.; Wu, F. F.; Wu, Q.; Xia, D. M.; Xia, J. K.; Xiang, S. T.; Xiao, Q.; Xing, Z. Z.; Xu, G.; Xu, J. Y.; Xu, J. L.; Xu, J.; Xu, W.; Xu, Y.; Xue, T.; Yan, J.; Yang, C. G.; Yang, L.; Yang, M. S.; Yang, M. T.; Ye, M.; Yeh, M.; Yeh, Y. S.; Yip, K.; Young, B. L.; Yu, G. Y.; Yu, Z. Y.; Zeng, S.; Zhan, L.; Zhang, C.; Zhang, F. H.; Zhang, H. H.; Zhang, J. W.; Zhang, K.; Zhang, Q. X.; Zhang, Q. M.; Zhang, S. H.; Zhang, X. T.; Zhang, Y. C.; Zhang, Y. H.; Zhang, Y. M.; Zhang, Y. X.; Zhang, Y. M.; Zhang, Z. J.; Zhang, Z. Y.; Zhang, Z. P.; Zhao, J.; Zhao, Q. W.; Zhao, Y. F.; Zhao, Y. B.; Zheng, L.; Zhong, W. L.; Zhou, L.; Zhou, N.; Zhou, Z. Y.; Zhuang, H. L.; Zimmerman, S.; Zou, J. H.

    2016-03-01

    The Daya Bay experiment was the first to report simultaneous measurements of reactor antineutrinos at multiple baselines leading to the discovery of νbare oscillations over km-baselines. Subsequent data has provided the world's most precise measurement of sin2 2θ13 and the effective mass splitting Δ mee2. The experiment is located in Daya Bay, China where the cluster of six nuclear reactors is among the world's most prolific sources of electron antineutrinos. Multiple antineutrino detectors are deployed in three underground water pools at different distances from the reactor cores to search for deviations in the antineutrino rate and energy spectrum due to neutrino mixing. Instrumented with photomultiplier tubes, the water pools serve as shielding against natural radioactivity from the surrounding rock and provide efficient muon tagging. Arrays of resistive plate chambers over the top of each pool provide additional muon detection. The antineutrino detectors were specifically designed for measurements of the antineutrino flux with minimal systematic uncertainty. Relative detector efficiencies between the near and far detectors are known to better than 0.2%. With the unblinding of the final two detectors' baselines and target masses, a complete description and comparison of the eight antineutrino detectors can now be presented. This paper describes the Daya Bay detector systems, consisting of eight antineutrino detectors in three instrumented water pools in three underground halls, and their operation through the first year of eight detector data-taking.

  4. Reactor operation safety information document

    Energy Technology Data Exchange (ETDEWEB)

    1990-01-01

    The report contains a reactor facility description which includes K, P, and L reactor sites, structures, operating systems, engineered safety systems, support systems, and process and effluent monitoring systems; an accident analysis section which includes cooling system anomalies, radioactive materials releases, and anticipated transients without scram; a summary of onsite doses from design basis accidents; severe accident analysis (reactor core disruption); a description of operating contractor organization and emergency planning; and a summary of reactor safety evolution. (MB)

  5. 26 CFR 48.4216(b)-3 - Constructive sale price; special rule for arm's-length sales.

    Science.gov (United States)

    2010-04-01

    ... not maintain a sales force to resell the article whose constructive sale price was established under... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Constructive sale price; special rule for arm's-length sales. 48.4216(b)-3 Section 48.4216(b)-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF...

  6. Inhibition of PTEN gene expression by oncogenic miR-23b-3p in renal cancer.

    Directory of Open Access Journals (Sweden)

    Mohd Saif Zaman

    Full Text Available BACKGROUND: miR-23b is located on chromosome number 9 and plays different roles in different organs especially with regards to cancer development. However, the functional significance of miR-23b-3p in renal cell carcinoma (RCC has not been reported. METHODS AND RESULTS: We measured miR-23b-3p levels in 29 pairs of renal cell carcinoma and their normal matched tissues using real-time PCR. The expression level of miR-23b-3p was correlated with the 5 year survival rate of renal cancer patients. In 15 cases (52%, miR-23b-3p expression was found to be high. All patients with moderate to low miR-23b-3p expression survived 5 years, while those with high miR-23b-3p expression, only 50% survived. After knocking down miRNA-23b-3p expression in RCC cell lines, there was an induction of apoptosis and reduced invasive capabilities. MiR-23b-3p was shown to directly target PTEN gene through 3'UTR reporter assays. Inhibition of miR-23b-3p induces PTEN gene expression with a concomitant reduction in PI3-kinase, total Akt and IL-32. Immunohistochemistry showed the lack of PTEN protein expression in cancerous regions of tissue samples where the expression of miR-23b-3p was high. We studied the in vitro effects of the dietary chemo preventive agent genistein on miR-23b-3p expression and found that it inhibited expression of miR-23b-3p in RCC cell lines. CONCLUSIONS: The current study shows that miR-23b-3p is an oncogenic miRNA and inhibits PTEN tumor suppressor gene in RCC. Therefore, inhibition of miR-23b-3p may be a useful therapeutic target for the treatment of renal cell carcinoma.

  7. Fast reactor programme in India

    Indian Academy of Sciences (India)

    2015-09-04

    Sep 4, 2015 ... criteria; passive shutdown and decay heat removal systems; fast breeder reactors in India. PACS No. 28.41.−i. 1. ... water reactors, mainly pressurized heavy water reactors (PHWRs) to extract ∼10 GWe capacity for ..... commissioning phase and most of the supporting systems have been commissioned and.

  8. Engineering reactors for catalytic reactions

    Indian Academy of Sciences (India)

    Extensive studies have been conducted to establish sound basis for design and engineering of reactors for practising such catalytic reactions and for realizing improvements in reactor performance. In this article, application of recent (and not so recent) developments in engineering reactors for catalytic reactions is ...

  9. REACTOR FUEL ELEMENTS TESTING CONTAINER

    Science.gov (United States)

    Whitham, G.K.; Smith, R.R.

    1963-01-15

    This patent shows a method for detecting leaks in jacketed fuel elements. The element is placed in a sealed tank within a nuclear reactor, and, while the reactor operates, the element is sparged with gas. The gas is then led outside the reactor and monitored for radioactive Xe or Kr. (AEC)

  10. Fast reactor programme in India

    Indian Academy of Sciences (India)

    2015-09-04

    Sep 4, 2015 ... Home; Journals; Pramana – Journal of Physics; Volume 85; Issue 3. Fast reactor programme in India. P Chellapandi P R ... Keywords. Sodium fast reactor; design challenges; construction challenges; emerging safety criteria; passive shutdown and decay heat removal systems; fast breeder reactors in India.

  11. Stabilized Spheromak Fusion Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Fowler, T

    2007-04-03

    The U.S. fusion energy program is focused on research with the potential for studying plasmas at thermonuclear temperatures, currently epitomized by the tokamak-based International Thermonuclear Experimental Reactor (ITER) but also continuing exploratory work on other plasma confinement concepts. Among the latter is the spheromak pursued on the SSPX facility at LLNL. Experiments in SSPX using electrostatic current drive by coaxial guns have now demonstrated stable spheromaks with good heat confinement, if the plasma is maintained near a Taylor state, but the anticipated high current amplification by gun injection has not yet been achieved. In future experiments and reactors, creating and maintaining a stable spheromak configuration at high magnetic field strength may require auxiliary current drive using neutral beams or RF power. Here we show that neutral beam current drive soon to be explored on SSPX could yield a compact spheromak reactor with current drive efficiency comparable to that of steady state tokamaks. Thus, while more will be learned about electrostatic current drive in coming months, results already achieved in SSPX could point to a productive parallel development path pursuing auxiliary current drive, consistent with plans to install neutral beams on SSPX in the near future. Among possible outcomes, spheromak research could also yield pulsed fusion reactors at lower capital cost than any fusion concept yet proposed.

  12. Nuclear Reactors and Technology

    Energy Technology Data Exchange (ETDEWEB)

    Cason, D.L.; Hicks, S.C. [eds.

    1992-01-01

    This publication Nuclear Reactors and Technology (NRT) announces on a monthly basis the current worldwide information available from the open literature on nuclear reactors and technology, including all aspects of power reactors, components and accessories, fuel elements, control systems, and materials. This publication contains the abstracts of DOE reports, journal articles, conference papers, patents, theses, and monographs added to the Energy Science and Technology Database during the past month. Also included are US information obtained through acquisition programs or interagency agreements and international information obtained through the International Energy Agency`s Energy Technology Data Exchange or government-to-government agreements. The digests in NRT and other citations to information on nuclear reactors back to 1948 are available for online searching and retrieval on the Energy Science and Technology Database and Nuclear Science Abstracts (NSA) database. Current information, added daily to the Energy Science and Technology Database, is available to DOE and its contractors through the DOE Integrated Technical Information System. Customized profiles can be developed to provide current information to meet each user`s needs.

  13. Nuclear reactor building

    Science.gov (United States)

    Gou, P.F.; Townsend, H.E.; Barbanti, G.

    1994-04-05

    A reactor building for enclosing a nuclear reactor includes a containment vessel having a wetwell disposed therein. The wetwell includes inner and outer walls, a floor, and a roof defining a wetwell pool and a suppression chamber disposed there above. The wetwell and containment vessel define a drywell surrounding the reactor. A plurality of vents are disposed in the wetwell pool in flow communication with the drywell for channeling into the wetwell pool steam released in the drywell from the reactor during a LOCA for example, for condensing the steam. A shell is disposed inside the wetwell and extends into the wetwell pool to define a dry gap devoid of wetwell water and disposed in flow communication with the suppression chamber. In a preferred embodiment, the wetwell roof is in the form of a slab disposed on spaced apart support beams which define there between an auxiliary chamber. The dry gap, and additionally the auxiliary chamber, provide increased volume to the suppression chamber for improving pressure margin. 4 figures.

  14. JACKETED REACTOR FUEL ELEMENT

    Science.gov (United States)

    Smith, K.F.; Van Thyne, R.J.

    1958-12-01

    A fuel element is described for fast reactors comprised of a core of uranium metal containing material and a jacket around the core, the jacket consisting of from 2.5 to 15 percent of titanium, from 1 to 5 percent of niobium, and from 80 to 96.5 percent of vanadium.

  15. Nuclear rocket engine reactor

    Energy Technology Data Exchange (ETDEWEB)

    Lanin, Anatoly

    2013-07-01

    Covers a new technology of nuclear reactors and the related materials aspects. Integrates physics, materials science and engineering Serves as a basic book for nuclear engineers and nuclear physicists. The development of a nuclear rocket engine reactor (NRER) is presented in this book. The working capacity of an active zone NRER under mechanical and thermal load, intensive neutron fluxes, high energy generation (up to 30 MBT/l) in a working medium (hydrogen) at temperatures up to 3100 K is displayed. Design principles and bearing capacity of reactors area discussed on the basis of simulation experiments and test data of a prototype reactor. Property data of dense constructional, porous thermal insulating and fuel materials like carbide and uranium carbide compounds in the temperatures interval 300 - 3000 K are presented. Technological aspects of strength and thermal strength resistance of materials are considered. The design procedure of possible emergency processes in the NRER is developed and risks for their origination are evaluated. Prospects of the NRER development for pilotless space devices and piloted interplanetary ships are viewed.

  16. WATER BOILER REACTOR

    Science.gov (United States)

    King, L.D.P.

    1960-11-22

    As its name implies, this reactor utilizes an aqueous solution of a fissionable element salt, and is also conventional in that it contains a heat exchanger cooling coil immersed in the fuel. Its novelty lies in the utilization of a cylindrical reactor vessel to provide a critical region having a large and constant interface with a supernatant vapor region, and the use of a hollow sleeve coolant member suspended from the cover assembly in coaxial relation with the reactor vessel. Cool water is circulated inside this hollow coolant member, and a gap between its outer wall and the reactor vessel is used to carry off radiolytic gases for recombination in an external catalyst chamber. The central passage of the coolant member defines a reflux condenser passage into which the externally recombined gases are returned and condensed. The large and constant interface between fuel solution and vapor region prevents the formation of large bubbles and minimizes the amount of fuel salt carried off by water vapor, thus making possible higher flux densities, specific powers and power densities.

  17. Fossil fuel furnace reactor

    Science.gov (United States)

    Parkinson, William J.

    1987-01-01

    A fossil fuel furnace reactor is provided for simulating a continuous processing plant with a batch reactor. An internal reaction vessel contains a batch of shale oil, with the vessel having a relatively thin wall thickness for a heat transfer rate effective to simulate a process temperature history in the selected continuous processing plant. A heater jacket is disposed about the reactor vessel and defines a number of independent controllable temperature zones axially spaced along the reaction vessel. Each temperature zone can be energized to simulate a time-temperature history of process material through the continuous plant. A pressure vessel contains both the heater jacket and the reaction vessel at an operating pressure functionally selected to simulate the continuous processing plant. The process yield from the oil shale may be used as feedback information to software simulating operation of the continuous plant to provide operating parameters, i.e., temperature profiles, ambient atmosphere, operating pressure, material feed rates, etc., for simulation in the batch reactor.

  18. NEUTRONIC REACTOR SHIELD

    Science.gov (United States)

    Fermi, E.; Zinn, W.H.

    1957-09-24

    The reactor radiation shield material is comprised of alternate layers of iron-containing material and compressed cellulosic material, such as masonite. The shielding material may be prefabricated in the form of blocks, which can be stacked together in ary desired fashion to form an effective shield.

  19. Neutronic Reactor Structure

    Science.gov (United States)

    Vernon, H. C.; Weinberg, A. M.

    1961-05-30

    The neutronic reactor is comprised of a core consisting of natural uranium and heavy water with a K-factor greater than unity. The core is surrounded by a reflector consisting of natural uranium and ordinary water with a Kfactor less than unity. (AEC)

  20. NEUTRONIC REACTOR CONTROL ELEMENT

    Science.gov (United States)

    Beaver, R.J.; Leitten, C.F. Jr.

    1962-04-17

    A boron-10 containing reactor control element wherein the boron-10 is dispersed in a matrix material is describeri. The concentration of boron-10 in the matrix varies transversely across the element from a minimum at the surface to a maximum at the center of the element, prior to exposure to neutrons. (AEC)

  1. Thermal Reactor Safety

    Energy Technology Data Exchange (ETDEWEB)

    1980-06-01

    Information is presented concerning fire risk and protection; transient thermal-hydraulic analysis and experiments; class 9 accidents and containment; diagnostics and in-service inspection; risk and cost comparison of alternative electric energy sources; fuel behavior and experiments on core cooling in LOCAs; reactor event reporting analysis; equipment qualification; post facts analysis of the TMI-2 accident; and computational methods.

  2. Research on the reactor physics and reactor safety of VVER reactors. AER Symposium 2016

    Energy Technology Data Exchange (ETDEWEB)

    Kliem, S.

    2017-09-15

    The selected paperscan be attributed to the following main subjects: Reactor start-up tests and use of corresponding data for code validation, code development and application, approaches for safety analyses, closure of nuclear fuel cycle, prospective reactor concepts.

  3. Mutation of SH2B3 (LNK), a GWAS candidate for hypertension, attenuates Dahl SS hypertension via inflammatory modulation

    Science.gov (United States)

    Rudemiller, Nathan P.; Lund, Hayley; Priestley, Jessica R. C.; Endres, Bradley T.; Prokop, Jeremy W.; Jacob, Howard J.; Geurts, Aron M.; Cohen, Eric P.; Mattson, David L.

    2015-01-01

    Human genome wide association studies (GWAS) have linked SH2B3 (LNK) to hypertension and renal disease, though little experimental investigation has been done to verify a role for SH2B3 in these pathologies. SH2B3, a member of the SH2B adaptor protein family, is an intracellular adaptor protein that functions as a negative regulator in many signaling pathways, including inflammatory signaling processes. To explore a mechanistic link between SH2B3 and hypertension, we targeted the SH2B3 gene for mutation on the Dahl salt-sensitive (SS) rat genetic background with zinc-finger nucleases (ZFN). The resulting mutation was a 6 base-pair, in-frame deletion within a highly-conserved region of the Src Homology 2 (SH2) domain of SH2B3. This mutation significantly attenuated Dahl salt-sensitive (SS) hypertension and renal disease. Also, infiltration of leukocytes into the kidneys, a key mediator of Dahl SS pathology, was significantly blunted in the Sh2b3em1Mcwi mutant rats. To determine if this was due to differences in immune signaling, bone marrow transplant studies were performed in which Dahl SS and Sh2b3em1Mcwi mutants underwent total body irradiation and were then transplanted with Dahl SS or Sh2b3em1Mcwi mutant bone marrow. Rats that received Sh2b3em1Mcwi mutant bone marrow had a significant reduction in mean arterial pressure and kidney injury when placed on a high salt diet (4% NaCl). These data further support a role for the immune system as a modulator of disease severity in the pathogenesis of hypertension and provide insight into inflammatory mechanisms at play in human hypertension and renal disease. PMID:25776069

  4. On the low-field Hall coefficient of graphite

    Directory of Open Access Journals (Sweden)

    P. Esquinazi

    2014-11-01

    Full Text Available We have measured the temperature and magnetic field dependence of the Hall coefficient (RH in three, several micrometer long multigraphene samples of thickness between ∼9 to ∼30 nm in the temperature range 0.1 to 200 K and up to 0.2 T field. The temperature dependence of the longitudinal resistance of two of the samples indicates the contribution from embedded interfaces running parallel to the graphene layers. At low enough temperatures and fields RH is positive in all samples, showing a crossover to negative values at high enough fields and/or temperatures in samples with interfaces contribution. The overall results are compatible with the reported superconducting behavior of embedded interfaces in the graphite structure and indicate that the negative low magnetic field Hall coefficient is not intrinsic of the ideal graphite structure.

  5. The Hall Technique for managing carious primary molars.

    Science.gov (United States)

    Innes, Nicola; Evans, Dafydd; Hall, Norna

    2009-10-01

    The Hall Technique, a method of managing carious primary molars effectively with preformed metal crowns, without the use of local anaesthesia, caries removal or tooth preparation of any kind, is described.The technique is illustrated with a case report.The evidence underpinning the technique is discussed, along with indications and contra-indications for its use, and details of where clinicians can obtain further information on the technique if they are considering using it. Research evidence has indicated that the Hall Technique is effective in managing dental caries in primary molar teeth when used by General Dental Practitioners, and is preferred by them, their child patients and the children's parents to conventional restorative methods for these teeth.

  6. Chiral Exact Relations for Helicities in Hall Magnetohydrodynamic Turbulence

    CERN Document Server

    Banerjee, Supratik

    2016-01-01

    Besides total energy, three-dimensional incompressible Hall magnetohydrodynamics (MHD) possesses two inviscid invariants which are the magnetic helicity and the generalized helicity. New exact relations are derived for homogeneous (non-isotropic) stationary Hall MHD turbulence (and also for its inertialess electron MHD limit) with non-zero helicities and in the asymptotic limit of large Reynolds numbers. The universal laws are written only in terms of mixed second-order structure functions, i.e. the scalar product of two different increments. It provides, therefore, a direct measurement of the dissipation rates for the corresponding invariant flux. This study shows that the generalized helicity cascade is strongly linked to the left polarized fluctuations while the magnetic helicity cascade is linked to the right polarized fluctuations.

  7. Multi-region relaxed Hall magnetohydrodynamics with flow

    CERN Document Server

    Lingam, Manasvi; Hudson, Stuart R

    2016-01-01

    The recent formulations of multi-region relaxed magnetohydrodynamics (MRxMHD) have generalized the famous Woltjer-Taylor states by incorporating a collection of "ideal barriers" that prevent global relaxation, and flow. In this paper, we generalize MRxMHD with flow to include Hall effects (MRxHMHD), and thereby obtain the partially relaxed counterparts of the famous double Beltrami states as a special subset. The physical and mathematical consequences arising from the introduction of the Hall term are also presented. We demonstrate that our results (in the ideal MHD limit) constitute an important subset of ideal MHD equilibria, and we compare our approach against other variational principles proposed for deriving the relaxed states.

  8. Recent advances in the spin Hall effect of light

    Science.gov (United States)

    Ling, Xiaohui; Zhou, Xinxing; Huang, Kun; Liu, Yachao; Qiu, Cheng-Wei; Luo, Hailu; Wen, Shuangchun

    2017-06-01

    The spin Hall effect (SHE) of light, as an analogue of the SHE in electronic systems, is a promising candidate for investigating the SHE in semiconductor spintronics/valleytronics, high-energy physics and condensed matter physics, owing to their similar topological nature in the spin-orbit interaction. The SHE of light exhibits unique potential for exploring the physical properties of nanostructures, such as determining the optical thickness, and the material properties of metallic and magnetic thin films and even atomically thin two-dimensional materials. More importantly, it opens a possible pathway for controlling the spin states of photons and developing next-generation photonic spin Hall devices as a fundamental constituent of the emerging spinoptics. In this review, based on the viewpoint of the geometric phase gradient, we give a detailed presentation of the recent advances in the SHE of light and its applications in precision metrology and future spin-based photonics.

  9. Creating a bosonic fractional quantum Hall state by pairing fermions

    Science.gov (United States)

    Repellin, Cécile; Yefsah, Tarik; Sterdyniak, Antoine

    2017-10-01

    We numerically study the behavior of spin-1 /2 fermions on a two-dimensional square lattice subject to a uniform magnetic field, where opposite spins interact via an on-site attractive interaction. Starting from the noninteracting case where each spin population is prepared in a quantum Hall state with unity filling, we follow the evolution of the system as the interaction strength is increased. Above a critical value and for sufficiently low flux density, we observe the emergence of a twofold quasidegeneracy accompanied by the opening of an energy gap to the third level. Analysis of the entanglement spectra shows that the gapped ground state is the bosonic 1 /2 Laughlin state. Our work therefore provides compelling evidence of a topological phase transition from the fermionic quantum Hall state at unity filling to the bosonic Laughlin state at a critical attraction strength of the order of the one-body spectrum linewidth.

  10. Precise quantization of anomalous Hall effect near zero magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Bestwick, A. J. [Stanford Univ., Stanford, CA (United States); SLAC National Accelerator Lab., Menlo Park, CA (United States); Fox, E. J. [Stanford Univ., Stanford, CA (United States); SLAC National Accelerator Lab., Menlo Park, CA (United States); Kou, Xufeng [Univ. of California, Los Angeles, CA (United States); Pan, Lei [Univ. of California, Los Angeles, CA (United States); Wang, Kang L. [Univ. of California, Los Angeles, CA (United States); Goldhaber-Gordon, D. [Stanford Univ., Stanford, CA (United States); SLAC National Accelerator Lab., Menlo Park, CA (United States)

    2015-05-04

    In this study, we report a nearly ideal quantum anomalous Hall effect in a three-dimensional topological insulator thin film with ferromagnetic doping. Near zero applied magnetic field we measure exact quantization in the Hall resistance to within a part per 10,000 and a longitudinal resistivity under 1 Ω per square, with chiral edge transport explicitly confirmed by nonlocal measurements. Deviations from this behavior are found to be caused by thermally activated carriers, as indicated by an Arrhenius law temperature dependence. Using the deviations as a thermometer, we demonstrate an unexpected magnetocaloric effect and use it to reach near-perfect quantization by cooling the sample below the dilution refrigerator base temperature in a process approximating adiabatic demagnetization refrigeration.

  11. Tearing mode dynamics and sawtooth oscillation in Hall-MHD

    Science.gov (United States)

    Ma, Zhiwei; Zhang, Wei; Wang, Sheng

    2017-10-01

    Tearing mode instability is one of the most important dynamic processes in space and laboratory plasmas. Hall effects, resulted from the decoupling of electron and ion motions, could cause the fast development and perturbation structure rotation of the tearing mode and become non-negligible. We independently developed high accuracy nonlinear MHD code (CLT) to study Hall effects on the dynamic evolution of tearing modes with Tokamak geometries. It is found that the rotation frequency of the mode in the electron diamagnetic direction is in a good agreement with analytical prediction. The linear growth rate increases with increase of the ion inertial length, which is contradictory to analytical solution in the slab geometry. We further find that the self-consistently generated rotation largely alters the dynamic behavior of the double tearing mode and the sawtooth oscillation. National Magnetic Confinement Fusion Science Program of China under Grant No. 2013GB104004 and 2013GB111004.

  12. Planar Hall effect sensor with magnetostatic compensation layer

    DEFF Research Database (Denmark)

    Dalslet, Bjarke Thomas; Donolato, Marco; Hansen, Mikkel Fougt

    2012-01-01

    Demagnetization effects in cross-shaped planar Hall effect sensors cause inhomogeneous film magnetization and a hysteretic sensor response. Furthermore, when using sensors for detection of magnetic beads, the magnetostatic field from the sensor edges attracts and holds magnetic beads near the sen...... flow 60 times smaller than a flow that failed to remove beads from an uncompensated sensor.......Demagnetization effects in cross-shaped planar Hall effect sensors cause inhomogeneous film magnetization and a hysteretic sensor response. Furthermore, when using sensors for detection of magnetic beads, the magnetostatic field from the sensor edges attracts and holds magnetic beads near...... the sensor edges causing inhomogeneous and non-specific binding of the beads. We show theoretically that adding a compensation magnetic stack beneath the sensor stack and exchange-biasing it antiparallel to the sensor stack, the magnetostatic field is minimized. We show experimentally that the compensation...

  13. Simulating Smoke Filling in Big Halls by Computational Fluid Dynamics

    Directory of Open Access Journals (Sweden)

    W. K. Chow

    2011-01-01

    Full Text Available Many tall halls of big space volume were built and, to be built in many construction projects in the Far East, particularly Mainland China, Hong Kong, and Taiwan. Smoke is identified to be the key hazard to handle. Consequently, smoke exhaust systems are specified in the fire code in those areas. An update on applying Computational Fluid Dynamics (CFD in smoke exhaust design will be presented in this paper. Key points to note in CFD simulations on smoke filling due to a fire in a big hall will be discussed. Mathematical aspects concerning of discretization of partial differential equations and algorithms for solving the velocity-pressure linked equations are briefly outlined. Results predicted by CFD with different free boundary conditions are compared with those on room fire tests. Standards on grid size, relaxation factors, convergence criteria, and false diffusion should be set up for numerical experiments with CFD.

  14. Quantum anomalous Hall effect in 2D organic topological insulators.

    Science.gov (United States)

    Wang, Z F; Liu, Zheng; Liu, Feng

    2013-05-10

    The quantum anomalous Hall effect (QAHE) is a fundamental transport phenomenon in the field of condensed-matter physics. Without an external magnetic field, spontaneous magnetization combined with spin-orbit coupling gives rise to a quantized Hall conductivity. So far, a number of theoretical proposals have been made to realize the QAHE, but all based on inorganic materials. Here, using first-principles calculations, we predict a family of 2D organic topological insulators for realizing the QAHE. Designed by assembling molecular building blocks of triphenyl-transition-metal compounds into a hexagonal lattice, this new class of organic materials is shown to have a nonzero Chern number and exhibits a gapless chiral edge state within the Dirac gap.

  15. Can ensemble condition in a hall be improved and measured?

    DEFF Research Database (Denmark)

    Gade, Anders Christian

    1988-01-01

    of the ceiling reflectors; and (c) changing the position of the orchestra on the platform. These variables were then tested in full scale experiments in the hall including subjective evaluation by the orchestra in order to verify their effects under practical conditions. New objective parameters, which showed......In collaboration with the Danish Broadcasting Corporation an extensive series of experiments has been carried out in The Danish Radio Concert Hall with the practical purpose of trying to improve the ensemble conditions on the platform for the resident symphony orchestra. First, a series...... of experiments in a 1:20 scale model indicated that among several suggested means the following would be the most effective and acceptable: (a) changing the shape of the sidewalls in the platform area in order to make them reflect sound back to the musicians more effectively; (b) lowering and redesigning...

  16. Quantum Hall effect in epitaxial graphene with permanent magnets.

    Science.gov (United States)

    Parmentier, F D; Cazimajou, T; Sekine, Y; Hibino, H; Irie, H; Glattli, D C; Kumada, N; Roulleau, P

    2016-12-06

    We have observed the well-kown quantum Hall effect (QHE) in epitaxial graphene grown on silicon carbide (SiC) by using, for the first time, only commercial NdFeB permanent magnets at low temperature. The relatively large and homogeneous magnetic field generated by the magnets, together with the high quality of the epitaxial graphene films, enables the formation of well-developed quantum Hall states at Landau level filling factors v = ±2, commonly observed with superconducting electro-magnets. Furthermore, the chirality of the QHE edge channels can be changed by a top gate. These results demonstrate that basic QHE physics are experimentally accessible in graphene for a fraction of the price of conventional setups using superconducting magnets, which greatly increases the potential of the QHE in graphene for research and applications.

  17. Spin Hall effect-driven spin torque in magnetic textures

    KAUST Repository

    Manchon, Aurelien

    2011-07-13

    Current-induced spin torque and magnetization dynamics in the presence of spin Hall effect in magnetic textures is studied theoretically. The local deviation of the charge current gives rise to a current-induced spin torque of the form (1 - ΒM) × [(u 0 + αH u 0 M) ∇] M, where u0 is the direction of the injected current, H is the Hall angle and is the non-adiabaticity parameter due to spin relaxation. Since αH and ×can have a comparable order of magnitude, we show that this torque can significantly modify the current-induced dynamics of both transverse and vortex walls. © 2011 American Institute of Physics.

  18. Admittance measurements in the quantum Hall effect regime

    Energy Technology Data Exchange (ETDEWEB)

    Hernández, C., E-mail: carlos.hernandezr@unimilitar.edu.co [Departamento de Física, Universidad Militar Nueva Granada, Carrera 11 # 101-80, Bogotá D.C. (Colombia); Laboratorio de Magnetismo, Departamento de Física, Universidad de los Andes, A.A. 4976, Bogotá D.C. (Colombia); Consejo, C.; Chaubet, C. [Laboratoire Charles Coulomb L2C, Université Montpellier II, Pl. E. Bataillon, 34095 Montpellier Cedex 5 (France)

    2014-11-15

    In this work we present an admittance study of a two-dimensional electron gas (2DEG) in the quantum Hall effect (QHE) regime. We have studied several Hall bars in different contacts configurations in the frequency range 100 Hz–1 MHz. Our interpretation is based on the Landauer–Büttiker theory and takes into account both the capacitance and the topology of the coaxial cables which are connected to the sample holder. We show that we always observe losses through the capacitive impedance of the coaxial cables, except in the two contacts configuration in which the cable capacitance does not influence the admittance measurement of the sample. In this case, we measure the electrochemical capacitance of the 2DEG and show its dependence with the filling factor ν.

  19. Hall hole mobility in boron-doped homoepitaxial diamond

    Science.gov (United States)

    Pernot, J.; Volpe, P. N.; Omnès, F.; Muret, P.; Mortet, V.; Haenen, K.; Teraji, T.

    2010-05-01

    Hall hole mobility of boron-doped homoepitaxial (100) diamond samples has been investigated in the temperature range of 100-900 K, both experimentally and theoretically. The temperature dependence of the mobility measured in high-quality and low boron-doped materials was compared with theoretical calculations to determine the phonon-hole coupling constants (deformation potential for acoustic phonons and coupling constant for optical phonons). The maximum hole mobility is found to be close to 2000cm2/Vs at room temperature. For boron-doped material, the hole scattering by neutral boron atoms is shown to be important in diamond due to the high ionization energy of the boron acceptor. The doping dependence of the Hall hole mobility is established for boron-doping levels ranging between 1014 and 1020cm-3 at 300 and 500 K. The physical reasons which make diamond a semiconductor with a higher mobility than other semiconductors of column IV are discussed.

  20. Anomalous Hall effect scaling in ferromagnetic thin films

    KAUST Repository

    Grigoryan, Vahram L.

    2017-10-23

    We propose a scaling law for anomalous Hall effect in ferromagnetic thin films. Our approach distinguishes multiple scattering sources, namely, bulk impurity, phonon for Hall resistivity, and most importantly the rough surface contribution to longitudinal resistivity. In stark contrast to earlier laws that rely on temperature- and thickness-dependent fitting coefficients, this scaling law fits the recent experimental data excellently with constant parameters that are independent of temperature and film thickness, strongly indicating that this law captures the underlying physical processes. Based on a few data points, this scaling law can even fit all experimental data in full temperature and thickness range. We apply this law to interpret the experimental data for Fe, Co, and Ni and conclude that (i) the phonon-induced skew scattering is unimportant as expected; (ii) contribution from the impurity-induced skew scattering is negative; (iii) the intrinsic (extrinsic) mechanism dominates in Fe (Co), and both the extrinsic and intrinsic contributions are important in Ni.