WorldWideScience

Sample records for calder hall b-3 reactor

  1. Frequency spectrum of Calder Hall reactor noise

    International Nuclear Information System (INIS)

    Cummins, J.D.

    1960-01-01

    The frequency spectrum of the noise power of Calder Hall reactor No. 1 has been obtained by analysing a tape recording of the backed off power. The root mean square noise power due to all frequencies above 0.001 cycles per second was found to be 0.13%. The noise power for this reactor, is due mainly to modulations of the power level by reactivity variations caused in turn by gas temperature changes. These gas temperature changes are caused by a Cyclic variation in the feedwater regulator to the heat exchanger. The apparatus and method used to determine the noise power are described in this memorandum. It is shown that for frequencies in the range 0.001 to 0.030 cycles per second the noise spectrum falls at 60 decibels per decade of frequency. (author)

  2. Ultrasonic inspection of the Calder Hall and Chaplecross reactor pressure vessels

    International Nuclear Information System (INIS)

    Pennick, A.M.

    1993-01-01

    This paper describes the ultrasonic inspection surveys that have recently been carried out on the Calder Hall and Chapelcross Magnox steel reactor pressure vessels. The development of the inspection system, which is based on the Rediman manipulator and uses the Sonomatic Zipscan equipment and Time-of-Flight diffraction techniques is discussed. The inspection results are presented and compared with the original inspection findings and limiting crack sizes. (author)

  3. Operational aspects of the Calder Hall and Chapelcross pressure vessel ultrasonic inspections

    International Nuclear Information System (INIS)

    Bithell, S.J.; Howard, S.R.

    1993-01-01

    As a consequence of the NII's assessment of the Calder Hall and Chapelcross Long Term Safety Review, BNFplc were required to demonstrate the integrity of the Reactor Pressure Vessels through a programme of volumetric seam weld inspection. Existing equipment proved to be inadequate and necessitated the design and manufacture of a remote power manipulator and ultrasonic scanning package. Calder Hall Operations Department and Sellafield Technical Department, working closely with contract staff, completed the first stage of this technically demanding task within 14 months of the project's initiation, resulting in the first deployment of ''REDIMAN'' in March 1991. The design of the new equipment, and the technical and operational difficulties which were overcome by the Inspection Team are outlined. (author)

  4. Great day: H.M. Queen Elizabeth II at the Calder Hall opening

    International Nuclear Information System (INIS)

    1956-01-01

    The opening of the world's first nuclear power station, Calder Hall, was a major event in the history of post-war Britain. This film describes the construction and design of the station and its opening by the Queen. It is also an interesting historical document reflecting the beliefs and aspirations of the time. (author)

  5. Great day: H. M. Queen Elizabeth II at the Calder Hall opening

    Energy Technology Data Exchange (ETDEWEB)

    1956-01-01

    The opening of the world's first nuclear power station, Calder Hall, was a major event in the history of post-war Britain. This film describes the construction and design of the station and its opening by the Queen. It is also an interesting historical document reflecting the beliefs and aspirations of the time. (author).

  6. The Performance of Major Plant Items at Calder Hall; Fonctionnement des elements principaux de la centrale de Calder Hall; Kharakteristika osnovnykh uzlov ustanovki v Kolder-Kholle; Rendimiento de los principales elementos de la central de Calder Hall

    Energy Technology Data Exchange (ETDEWEB)

    Desbruslais, E. L. [United Kingdom Atomic Energy Authority, Seascale, Cumberland (United Kingdom)

    1963-10-15

    For over six years Calder Hall has been operated as a base-load power station and has sustained faults similar to those experienced by conventional power plants. All the faults have occurred in the conventional plant and none in the nuclear reactors themselves. Experience has demonstrated that from a reactor safety viewpoint, reactors and major plant items, together with the Grid connections, must be treated as a whole. No significant changes have been detected which suggest that the reactor pressure vessel or the graphite moderator will limit plant life. Asymmetric temperature distribution exists round the outlet gas ducts and now limits reactor power. The initial fitting of more thermocouples, strain gauges and provision for visual examination at high stress and temperature areas is recommended. The humidriers are no longer used during normal operation and consequently a small increase in reactor power has resulted. Recommendations are made for the frequency of surveys of heat exchangers, main gas ducts and bellow units. A small increase in steam generation has resulted from reducing gas bypassing. Only minor difficulties have been experienced with the centrifugal type of gas circulators. A small loss in production occurred initially because of commutator flash overs on the highly stressed blower drive motors and generators. The provision of duplicate stand-by auxiliaries, together with the interconnection of steam and water systems, has been amply justified. The BCDG equipment has proved extremely satisfactory. Because the channel group sensitivity is higher than necessary, modifications to achieve shorter cycle times at the expense of some sensitivity are being contemplated. The, re-arrangement made to the power supplies for reactor instrumentation and safety circuits is discussed. The grading of alarms and sequence of importance and a ''first up'' feature are recommended. The two-guard-line system has proved adequate and the need for three or more is

  7. The approach associated with the continued operation of the Calder Hall and Chapelcross nuclear power stations to 50 years

    International Nuclear Information System (INIS)

    Ayres, G.

    1996-01-01

    Calder Hall was the world's first commercial nuclear power station, commencing operation in 1956, and with its sister station at Chapelcross has operated successfully, with consistently high load factors, for approximately 40 years. The first part of this paper reviews the operating history of the stations. Secondly, the paper will briefly describe both the work carried out under the Long Term Safety Review which has supported operation to 40 years and the work being carried out as part of a Periodic Safety Review to support continued operation of both stations to 50 years. The commercial improvements, some of which, of course, do have some nuclear safety significance, will be briefly described in the context of operating within what is increasingly becoming a demanding privatized electricity market in the United Kingdom. Finally, potential life limiting features will be identified and the monitoring programmes described leading to the conclusion that there is no reason why the stations should not continue to operate to at least 50 years. (author). 4 refs

  8. In-pile inspections of the Calder and Chapelcross nuclear reactors

    International Nuclear Information System (INIS)

    Stewart, G.

    1984-01-01

    The subject is discussed under the headings: introduction (relevant data about the reactors); inspection policy; photographic inspection (equipment; inspection results (vessel seam welds and plates; top dome welds; top dome internals)); ultrasonic equipment; manipulator; television inspections; concluding remarks. (U.K.)

  9. Evaluation of Pressure Changes in HANARO Reactor Hall after a Reactor Shutdown

    International Nuclear Information System (INIS)

    Han, Geeyang; Han, Jaesam; Ahn, Gukhoon; Jung, Hoansung

    2013-01-01

    The major objective of this work is intended to evaluate the characteristics of the thermal behavior regarding how the decay heat will be affected by the reactor hall pressure change and the increase of pool water temperature induced in the primary coolant after a reactor shutdown. The particular reactor pool water temperature at the surface where it is evaporated owing to the decay heat resulting in the local heat transfer rate is related to the pressure change response in the reactor hall associated with the primary cooling system because of the reduction of the heat exchanger to remove the heat. The increase in the pool water temperature is proportional to the heat transfer rate in the reactor pool. Consequently, any limit on the reactor pool water temperature imposes a corresponding limit on the reactor hall pressure. At HANARO, the decay heat after a reactor shutdown is mainly removed by the natural circulation cooling in the reactor pool. This paper is written for the safety feature of the pressure change related leakage rate from the reactor hall. The calculation results show that the increase of pressure in the reactor hall will not cause any serious problems to the safety limits although the reactor hall pressure is slightly increased. Therefore, it was concluded that the pool water temperature increase is not so rapid as to cause the pressure to vary significantly in the reactor hall. Furthermore, the mathematical model developed in this work can be a useful analytical tool for scoping and parametric studies in the area of thermal transient analysis, with its proper representation of the interaction between the temperature and pressure in the reactor hall

  10. Air leakage test of reactor hall using tracer technique

    International Nuclear Information System (INIS)

    Yang Yanqiu; Yang Liang; Yang Tongzai

    2011-01-01

    The leakage ratios of three related reactor halls were tested by sulfur hexafluoride gaseous tracer technique. Moreover, the accumulation intensities of leak gas and its retention time in some important working rooms, the crossroads of corridors and anteroom of the building were detected. The results show that the air leakage ratios of the three reactor halls are (7.30±0.16) x 10 -4 , (1.88±0.12) x 10 -4 and (2.07±0.07) x 10 -4 h -1 . The leak gas accumulates in all the detected working rooms fast, and the retention time to various rooms is about 5 h. The heaviest intensities are in the clothes change rooms on the first floor. However, the retention time to the crossroads and the anteroom is about 10 h, and the accumulation intensities are much small. (authors)

  11. Tritium monitoring within the reactor hall of a DT fusion reactor

    International Nuclear Information System (INIS)

    Jalbert, R.A.

    1983-01-01

    Monitoring the reactor hall atmosphere of DT-fueled fusion reactors will probably be performed with conventional ion chamber and proportional counter instruments modified as necessry to deal with the background radiation. Background includes external neutron and gamma radiation and internal beta-gamma radiation from the activated atmosphere. Although locating instruments in remote areas of the reactor hall and adding local shielding and electronic compensation may be feasible, placing the instruments in accessible low-background areas outside of the reactor hall and doing remote sampling is preferable and solves most of the radiation problems. The remaining problem of the activated atmosphere may be solved by recently developed instruments in conjunction with the use of semi-permeable membranes currently under development and evaluation

  12. Monitoring of irradiation effects on the pressure vessel steels of Calder, Chapelcross and Windscale Advanced Gas Cooled Reactor (WAGR) nuclear reactors

    International Nuclear Information System (INIS)

    Turner, F.

    1980-01-01

    Tensile, Charpy and bend specimens of plate, forging and weld metal are exposed in the lower and upper zones of the reactors to neutron fluxes covering the range experienced by the vessels. The test conditions are described, the results presented and discussed. (author)

  13. Description of the magnox type of gas cooled reactor (MAGNOX)

    International Nuclear Information System (INIS)

    Jensen, S.E.; Nonboel, E.

    1999-05-01

    The present report comprises a technical description of the MAGNOX type of reactor as it has been build in Great Britain. The Magnox reactor is gas cooled (CO 2 ) with graphite moderators. The fuels is natural uranium in metallic form, canned with a magnesium alloy called 'Magnox'. The Calder Hall Magnox plant on the Lothian coastline of Scotland, 60 km east of Edinburgh, has been chosen as the reference plant and is described in some detail. Data on the other stations are given in tables with a summary of design data. Special design features are also shortly described. Where specific data for Calder Hall Magnox has not been available, corresponding data from other Magnox plants has been used. The information presented is based on the open literature. The report is written as a part of the NKS/RAK-2 sub-project 3: 'Reactors in Nordic Surroundings', which comprises a description of nuclear power plants neighbouring the Nordic countries. (au)

  14. A simulation Model of the Reactor Hall Ventilation and air Conditioning Systems of ETRR-2

    International Nuclear Information System (INIS)

    Abd El-Rahman, M.F.

    2004-01-01

    Although the conceptual design for any system differs from one designer to another. each of them aims to achieve the function of the system required. the ventilation and air conditioning system of reactors hall is one of those systems that really differs but always dose its function for which it is designed. thus, ventilation and air conditioning in some reactor hall constitute only one system whereas in some other ones, they are separate systems. the Egypt Research Reactor-2 (ETRR-2)represents the second type. most studies conducted on ventilation and air conditioning simulation models either in traditional building or for research rectors show that those models were not designed similarly to the model of the hall of ETRR-2 in which ventilation and air conditioning constitute two separate systems.besides, those studies experimented on ventilation and air conditioning simulation models of reactor building predict the temperature and humidity inside these buildings at certain outside condition and it is difficult to predict when the outside conditions are changed . also those studies do not discuss the influences of reactor power changes. therefore, the present work deals with a computational study backed by infield experimental measurements of the performance of the ventilation and air conditioning systems of reactor hall during normal operation at different outside conditions as well as at different levels of reactor power

  15. TRIPOLI calculation of the neutron field in the hall of the SILENE reactor

    International Nuclear Information System (INIS)

    Bourdet, L.

    1986-05-01

    This study concerns the utilization of the experimental reactor SILENE as radiation source. Its aim is to get a theoretical estimation of the neutron field characteristics in different points of the irradiation hall (spectra, fluences, equivalents of biological doses and reaction yields). These estimations are compared to results obtained by several experimental techniques; they allow to know better this neutron field with or without lead shield [fr

  16. Science Hall of Atomic Energy in Research Reactor Institute, Kyoto University

    International Nuclear Information System (INIS)

    Hayashi, Takeo

    1979-01-01

    The Science Hall of Atomic Energy was built as a subsidiary facility of the Research Reactor Institute, Kyoto University. The purpose of this facility is to accept outside demands concerning the application of the research reactor. The building is a two story building, and has the floor area of 901.47 m 2 . There are an exhibition room, a library, and a big lecture room. In the exhibition room, models of the Kyoto University Research Reactor and the Kyoto University Critical Assembly are placed. Various pictures concerning the application of the reactor are on the wall. In the library, people from outside of the Institute can use various books on science. Books for boys and girls are also stocked and used for public use. At the lecture room, various kinds of meeting can be held. (Kato, T.)

  17. Theoretical analysis of nuclear reactors (Phase III), I-V, Part III, Reactor poisoning; Razrada metoda teorijske analize nuklearnih reaktora (III faza) I-IV, III Deo, Zatrovanje reaktora

    Energy Technology Data Exchange (ETDEWEB)

    Pop-Jordanov, J [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1963-01-15

    Report on calculation of poisoning in experimental and power reactor includes four parts. Part one describes the influence of poisoning on the physical parameters of a reactor. part two includes transformation of differential equations for iodine and xenon. It was needed for easier solution of of differential equation using the analog computer. This calculation was done for RA reactor operating at 5 MW power. The RA reactor was used an example of calculation by the proposed method. Part four shows the application of the method for calculating the Calder Hall power reactor.

  18. Methods and instrumentation for investigating Hall sensors during their irradiation in nuclear research reactors

    International Nuclear Information System (INIS)

    Bolshakova, I.; Holyaka, R.; Makido, E.; Marusenkov, A.; Shurygin, F.; Yerashok, V.; Moreau, P. J.; Vayakis, G.; Duran, I.; Stockel, J.; Chekanov, V.; Konopleva, R.; Nazarkin, I.; Kulikov, S.; Leroy, C.

    2009-01-01

    Present work discusses the issues of creating the instrumentation for testing the semiconductor magnetic field sensors during their irradiation with neutrons in nuclear reactors up to fluences similar to neutron fluences in steady-state sensor locations in ITER. The novelty of the work consists in Hall sensor parameters being investigated: first, directly during the irradiation (in real time), and, second, at high irradiation levels (fast neutron fluence > 10 18 n/cm 2 ). Developed instrumentation has been successfully tested and applied in the research experiments on radiation stability of magnetic sensors in IBR-2 (JINR, Dubna) and VVR-M (PNPI, Saint-Petersburg) reactors. The 'Remote-Rad' bench consists of 2 heads (head 1 and head 2) bearing investigated sensors put in a ceramic setting, of electronic unit, of personal computer and of signal lines. Each head contains 6 Hall sensors and a coil for generating test magnetic field. Moreover head 1 contains thermocouples for temperature measurement while the temperature of head 2 is measured by thermo-resistive method. The heads are placed in the reactor channel

  19. Optimal Protection of Reactor Hall Under Nuclear Fuel Container Drop Using Simulation Methods

    Directory of Open Access Journals (Sweden)

    Králik Juraj

    2014-12-01

    Full Text Available This paper presents of the optimal design of the damping devices cover of reactor hall under impact of nuclear fuel container drop of type TK C30. The finite element idealization of nuclear power plant structure is used in software ANSYS. The steel pipe damper system is proposed for dissipation of the kinetic energy of the container free fall in comparison with the experimental results. The probabilistic and sensitivity analysis of the damping devices was considered on the base of the simulation methods in program AntHill using the Monte Carlo method.

  20. Metal Hall sensors for the new generation fusion reactors of DEMO scale

    Science.gov (United States)

    Bolshakova, I.; Bulavin, M.; Kargin, N.; Kost, Ya.; Kuech, T.; Kulikov, S.; Radishevskiy, M.; Shurygin, F.; Strikhanov, M.; Vasil'evskii, I.; Vasyliev, A.

    2017-11-01

    For the first time, the results of on-line testing of metal Hall sensors based on nano-thickness (50-70) nm gold films, which was conducted under irradiation by high-energy neutrons up to the high fluences of 1 · 1024 n · m-2, are presented. The testing has been carried out in the IBR-2 fast pulsed reactor in the neutron flux with the intensity of 1.5 · 1017 n · m-2 · s-1 at the Joint Institute for Nuclear Research. The energy spectrum of neutron flux was very close to that expected for the ex-vessel sensors locations in the ITER experimental reactor. The magnetic field sensitivity of the gold sensors was stable within the whole fluence range under research. Also, sensitivity values at the start and at the end of irradiation session were equal within the measurement error (<1%). The results obtained make it possible to recommend gold sensors for magnetic diagnostics in the new generation fusion reactors of DEMO scale.

  1. Nonthermal fusion reactor concept based on Hall-effect magnetohydrodynamics plasma theory

    International Nuclear Information System (INIS)

    Witalis, E.A.

    1988-01-01

    The failure of magnetic confinement controlled thermonuclear fusion research to achieve its goal is attributed to its foundation on the incomplete MHD plasma description instead of the more general HMHD (Hall-effect magnetohydrodynamics) theory. The latter allows for a certain magnetic plasma self-confinement under described stringent conditions. A reactor concept based on the formation, acceleration, and forced disintegration of magnetized whirl structures, plasmoids, is proposed. The four conventional MHD theory objections, i.e., absence of dynamo action, fast decay caused by resistivity, non-existence of magnetic self-confinement, and negligible non-thermal fusion yield, are shown not to apply. Support for the scheme from dense plasma focus research is pointed out. (orig.) [de

  2. First Calderón Prize

    Science.gov (United States)

    Rundell, William; Somersalo, Erkki

    2008-07-01

    The Inverse Problems International Association (IPIA) awarded the first Calderón Prize to Matti Lassas for his outstanding contributions to the field of inverse problems, especially in geometric inverse problems. The Calderón Prize is given to a researcher under the age of 40 who has made distinguished contributions to the field of inverse problems broadly defined. The first Calderón Prize Committee consisted of Professors Adrian Nachman, Lassi Päivärinta, William Rundell (chair), and Michael Vogelius. William Rundell For the Calderón Prize Committee Prize ceremony The ceremony awarding the Calderón Prize. Matti Lassas is on the left. He and William Rundell are on the right. Photos by P Stefanov. Brief Biography of Matti Lassas Matti Lassas was born in 1969 in Helsinki, Finland, and studied at the University of Helsinki. He finished his Master's studies in 1992 in three years and earned his PhD in 1996. His PhD thesis, written under the supervision of Professor Erkki Somersalo was entitled `Non-selfadjoint inverse spectral problems and their applications to random bodies'. Already in his thesis, Matti demonstrated a remarkable command of different fields of mathematics, bringing together the spectral theory of operators, geometry of Riemannian surfaces, Maxwell's equations and stochastic analysis. He has continued to develop all of these branches in the framework of inverse problems, the most remarkable results perhaps being in the field of differential geometry and inverse problems. Matti has always been a very generous researcher, sharing his ideas with his numerous collaborators. He has authored over sixty scientific articles, among which a monograph on inverse boundary spectral problems with Alexander Kachalov and Yaroslav Kurylev and over forty articles in peer reviewed journals of the highest standards. To get an idea of the wide range of Matti's interests, it is enough to say that he also has three US patents on medical imaging applications. Matti is

  3. CALDER: High-sensitivity cryogenic light detectors

    International Nuclear Information System (INIS)

    Casali, N.; Bellini, F.; Cardani, L.

    2017-01-01

    The current bolometric experiments searching for rare processes such as neutrinoless double-beta decay or dark matter interaction demand for cryogenic light detectors with high sensitivity, large active area and excellent scalability and radio-purity in order to reduce their background budget. The CALDER project aims to develop such kind of light detectors implementing phonon-mediated Kinetic Inductance Detectors (KIDs). The goal for this project is the realization of a 5 × 5 cm"2 light detector working between 10 and 100mK with a baseline resolution RMS below 20 eV. In this work the characteristics and the performances of the prototype detectors developed in the first project phase will be shown.

  4. Theoretical analysis of nuclear reactors (Phase III), I-V, Part IV, Influence of isotopic composition of nuclear fuel on the reactivity with constant flux; Razrada metoda teorijske analize nuklearnih reaktora (III faza) I-IV, IV Deo, Uticaj promene izotopnog sastava goriva na reaktivnost uz konstantan fluks

    Energy Technology Data Exchange (ETDEWEB)

    Pop-Jordanov, J [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1963-01-15

    Part one of this report presents a series of differential equations describing the nuclear fuel depletion during reactor operation. This series of differential equations is extended to describe the fission products. This part includes equations for effective multiplication factor k{sub eff} and reactivity {rho} as a function of irradiation {tau}. Part two includes results obtained on the analog computer PACE 231 R, and related to Calder Hall type reactor. Part three covers detailed preparation of the series of equations for solution by using the analog computer. Part four includes the list of references related to this task.

  5. The Calderón problem with corrupted data

    Science.gov (United States)

    Caro, Pedro; Garcia, Andoni

    2017-08-01

    We consider the inverse Calderón problem consisting of determining the conductivity inside a medium by electrical measurements on its surface. Ideally, these measurements determine the Dirichlet-to-Neumann map and, therefore, one usually assumes the data to be given by such a map. This situation corresponds to having access to infinite-precision measurements, which is totally unrealistic. In this paper, we study the Calderón problem assuming the data to contain measurement errors and provide formulas to reconstruct the conductivity and its normal derivative on the surface. Additionally, we state the rate convergence of the method. Our approach is theoretical and has a stochastic flavour.

  6. Interim dry fuel storage for magnox reactors

    Energy Technology Data Exchange (ETDEWEB)

    Bradley, N [National Nuclear Corporation, Risley, Warrington (United Kingdom); Ealing, C [GEC Energy Systems Ltd, Whetstone, Leicester (United Kingdom)

    1985-07-01

    In the UK the practice of short term buffer storage in water ponds prior to chemical reprocessing had already been established on the early gas cooled reactors in Calder Hall. Thus the choice of water pond buffer storage for MGR power plants logically followed the national policy decision to reprocess. The majority of the buffer storage period would take place at the reprocessing plant with only a nominal of 100 days targeted at the station. Since Magnox clad fuel is not suitable for long term pond storage, alternative methods of storage on future stations was considered desirable. In addition to safeguards considerations the economic aspects of the fuel cycle has influenced the conclusion that today the purchase of a MGR power plant with dry spent fuel storage and without commitment to reprocess would be a rational decision for a country initiating a nuclear programme. Dry storage requirements are discussed and two designs of dry storage facilities presented together with a fuel preparation facility.

  7. Interim dry fuel storage for magnox reactors

    International Nuclear Information System (INIS)

    Bradley, N.; Ealing, C.

    1985-01-01

    In the UK the practice of short term buffer storage in water ponds prior to chemical reprocessing had already been established on the early gas cooled reactors in Calder Hall. Thus the choice of water pond buffer storage for MGR power plants logically followed the national policy decision to reprocess. The majority of the buffer storage period would take place at the reprocessing plant with only a nominal of 100 days targeted at the station. Since Magnox clad fuel is not suitable for long term pond storage, alternative methods of storage on future stations was considered desirable. In addition to safeguards considerations the economic aspects of the fuel cycle has influenced the conclusion that today the purchase of a MGR power plant with dry spent fuel storage and without commitment to reprocess would be a rational decision for a country initiating a nuclear programme. Dry storage requirements are discussed and two designs of dry storage facilities presented together with a fuel preparation facility

  8. Performance of Hall sensor-based devices for magnetic field diagnosis at fusion reactors

    Czech Academy of Sciences Publication Activity Database

    Bolshakova, I.; Ďuran, Ivan; Holyaka, R.; Hristoforou, E.; Marusenkov, A.

    2007-01-01

    Roč. 5, č. 1 (2007), s. 283-288 ISSN 1546-198X R&D Projects: GA AV ČR KJB100430504 Institutional research plan: CEZ:AV0Z20430508 Keywords : Galvanomagnetic * Sensor * Fusion Reactor * Magnetic Diagnostics * Radiation Hardness Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.587, year: 2007

  9. Tasks related to increase of RA reactor exploitation and experimental potential, 01. Designing the protection chamber in the RA reactor hall for handling the radioactive experimental equipment (I-II) Part II, Vol. II

    International Nuclear Information System (INIS)

    Pavicevic, M.

    1963-07-01

    This second volume of the project for construction of the protection chamber in the RA reactor hall for handling the radioactive devices includes the technical description of the chamber, calculation of the shielding wall thickness, bottom lead plate, horizontal stability of the chamber, cost estimation, and the engineering drawings

  10. Lp-continuity for Calderón–Zygmund operator

    Indian Academy of Sciences (India)

    Given a Calderón–Zygmund (- for short) operator , which satisfies Hörmander condition, we prove that: if maps all the characteristic atoms to W L 1 , then is continuous from L p to L p ( 1 < p < ∞ ) . So the study of strong continuity on arbitrary function in L p has been changed into the study of weak continuity on ...

  11. Hall effect measurements of Frenkel defect clustering in aluminium during high-dose reactor irradiation at 4.6 K

    International Nuclear Information System (INIS)

    Boening, K.; Mauer, W.; Pfaendner, K.; Rosner, P.

    1976-01-01

    The low-field Hall coefficient R 0 of irradiated aluminium at 4.6 K is independent of the Frenkel defect (FD) concentration, however sensitively dependent of their configuration. Since measurement of R 0 is not too difficult, rather extensive investigations of FD clustering during irradiation can be performed, but only qualitative interpretations are possible. Several pure Al samples have been irradiated with reactor neutrons at 4.6 K up to very high doses phit resp. resistivity increments Δrho 0 (maximum 91% of extrapolated saturation value Δrho 0 sup(sat) approximately 980 nΩcm). The main results are 1.FD clustering within a single displacement cascade is not a very strong effect in Al, since the R 0 values are essentially the same after reactor and after electron irradiation. Rough cascade averages are: volume Vsub(c) approximately 2.1 x 10 5 at.vol. and FD concentration csub(c) approximately 1100 ppm. 2. There is practically no dose-dependent FD clustering up to Δrho 0 approximately 350 nΩcm, since R 0 remains essentially constant there. It follows that dose-dependent FD clustering can only occur for high-order overlap of cascade volumes. The differential dose curve dΔrho 0 /dphit is perfectly linear in Δrho 0 as long as R 0 = const. 3. For Δrho 0 > 350 nΩcm FD clustering becomes increasingly important and R 0 changes strongly. Surprisingly dR 0 /dphit approximately const whence there is a constant rate of cluster size increase in spite of the vanishing rate of FD production, evidence of the continuous regrouping of the lattice and its defects. (author)

  12. Theoretical analysis of nuclear reactors (Phase I), I-V, Part IV, Nuclear fuel depletion

    International Nuclear Information System (INIS)

    Pop-Jordanov, J.

    1962-07-01

    Nuclear fuel depletion is analyzed in order to estimate the qualitative and quantitative fuel property changes during irradiation and the influence of changes on the reactivity during long-term reactor operation. The changes of fuel properties are described by changes of neutron absorption and fission cross sections. Part one of this report covers the economic significance of fuel burnup and the review of fuel isotopic changes during depletion. Pat two contains the analysis of the U 235 chain, analytical expressions for the concentrations of U 235 , U 236 and Np 237 as a function of burnup. Part three contains the analysis of neutron spectrum influence on the Westcott method for calculating the cross sections. Part four contains the calculation method applied on Calder Hall type reactor. The results were obtained by applying ZUSE-22 R digital computer

  13. A calderón multiplicative preconditioner for the combined field integral equation

    KAUST Repository

    Bagci, Hakan; Andriulli, Francesco P.; Cools, Kristof; Olyslager, Femke; Michielssen, Eric

    2009-01-01

    A Calderón multiplicative preconditioner (CMP) for the combined field integral equation (CFIE) is developed. Just like with previously proposed Caldern-preconditioned CFIEs, a localization procedure is employed to ensure that the equation

  14. Chapter 10: Calculation of the temperature coefficient of reactivity of a graphite-moderated reactor

    International Nuclear Information System (INIS)

    Brown, G.; Richmond, R.; Stace, R.H.W.

    1963-01-01

    The temperature coefficients of reactivity of the BEPO, Windscale and Calder reactors are calculated, using the revised methods given by Lockey et al. (1956) and by Campbell and Symonds (1962). The results are compared with experimental values. (author)

  15. Magnetic Measuring Instrumentation with Radiation-Resistant Hall Sensors for Fusion Reactors: Experience of Testing at JET

    Czech Academy of Sciences Publication Activity Database

    Bolshakova, I.; Quercia, A.; Coccorese, V.; Murari, A.; Holyaka, R.; Ďuran, Ivan; Viererbl, L.; Konopleva, R.; Yerashok, V.

    2012-01-01

    Roč. 59, č. 4 (2012), s. 1224-1231 ISSN 0018-9499. [International Conference on Advancements in Nuclear Instrumentation, Measurement Methods and their Applications. Ghent, 06.06.2011-09.06.2011] R&D Projects: GA ČR GAP205/10/2055 Institutional research plan: CEZ:AV0Z20430508 Keywords : plasma * tokamak * JET * Hall probes * radiation resistance Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.219, year: 2012

  16. Theoretical analysis of nuclear reactors (Phase I), I-V, Part IV, Nuclear fuel depletion; Razrada metoda teorijske analize nuklearnih reaktora (I faza) I-V, IV Deo, Promena izotopnog sastava goriva

    Energy Technology Data Exchange (ETDEWEB)

    Pop-Jordanov, J [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1962-07-15

    Nuclear fuel depletion is analyzed in order to estimate the qualitative and quantitative fuel property changes during irradiation and the influence of changes on the reactivity during long-term reactor operation. The changes of fuel properties are described by changes of neutron absorption and fission cross sections. Part one of this report covers the economic significance of fuel burnup and the review of fuel isotopic changes during depletion. Pat two contains the analysis of the U{sup 235} chain, analytical expressions for the concentrations of U{sup 235}, U{sup 236} and Np{sup 237} as a function of burnup. Part three contains the analysis of neutron spectrum influence on the Westcott method for calculating the cross sections. Part four contains the calculation method applied on Calder Hall type reactor. The results were obtained by applying ZUSE-22 R digital computer.

  17. Hall A

    Data.gov (United States)

    Federal Laboratory Consortium — The instrumentation in Hall A at the Thomas Jefferson National Accelerator Facility was designed to study electroand photo-induced reactions at very high luminosity...

  18. Hall C

    Data.gov (United States)

    Federal Laboratory Consortium — Hall C's initial complement of equipment (shown in the figure), includes two general-purpose magnetic spectrometers. The High Momentum Spectrometer (HMS) has a large...

  19. The ins and outs of a list of plays by Calderón

    Directory of Open Access Journals (Sweden)

    Erik Coenen

    2009-06-01

    Full Text Available In 1682, Don Juan de Vera Tassis published two lists of plays circulating under Calderón’s name: one in which he listed those plays he considered really written by Calderón, and another one including those plays which he believed were not his. These lists are the longest of their sort which has come down to us from the 17th century. In this paper, the internal organization of these lists is examined, as well as the possible origin of the knowledge reflected in them, not only so as to determine their degree of authority, but also for what they tell us about the texts which this posthumous editor of 108 plays by Calderón had at his disposal.

  20. CALDER: Cryogenic light detectors for background-free searches

    Energy Technology Data Exchange (ETDEWEB)

    Cardani, L. [Dipartimento di Fisica - Sapienza Università di Roma, Roma - Italy and Physics Department, Princeton University, Princeton, NJ (United States); Bellini, F.; Casali, N.; Coppolecchia, A.; Cosmelli, C.; Cruciani, A.; Vignati, M. [Dipartimento di Fisica - Sapienza Università di Roma and INFN - Sezione di Roma, Roma - Italy (Italy); Castellano, M. G. [Istituto di Fotonica e Nanotecnologie - CNR, Roma - Italy (Italy); Colantoni, I. [Dipartimento di Fisica - Sapienza Università di Roma (Italy); Di Domizio, S. [Dipartimento di Fisica, Università di Genova, Genova - Italy and INFN Sezione di Genova, Genova - Italy (Italy); Tomei, C. [INFN - Sezione di Roma, Roma - Italy (Italy)

    2015-08-17

    The development of background-free detectors is essential for experiments searching for rare events. Bolometers, that are among the most competitive devices for the study of neutrino-less double beta decay (0νDBD) and Dark Matter interactions, suffer from the absence of techniques that allow to identify the nature of the interacting particles. This limit can be overcome by coupling the bolometer to an independent device for the measurement of the light emitted by interactions, as the combined read-out of the bolometric and light signals allows to identify and reject particles different from those of interest. CUORE, the most advanced bolometric experiment for 0νDBD searches, could disentangle the electrons produced by 0νDBD from the dangerous background due to α particles, by measuring the (tiny) Cherenkov light emitted by electrons and not by α’s. LUCIFER, a project based on ZnSe scintillating bolometers for the study of {sup 82}Se 0νDBD, would be competitive also in the search of Dark Matter interactions if equipped with light detectors that allow to distinguish and reject the background due to electrons and γ’s. These advances require cryogenic detectors characterized by noise lower than 20 eV, large active area, wide temperature range of operation, high radio-purity and ease in fabricating hundreds of channels. The CALDER collaboration aims to develop such detectors by exploiting the superb energy resolution and natural multiplexed read-out provided by Kinetic Inductance Detectors.

  1. High-Order Calderón Preconditioned Time Domain Integral Equation Solvers

    KAUST Repository

    Valdes, Felipe

    2013-05-01

    Two high-order accurate Calderón preconditioned time domain electric field integral equation (TDEFIE) solvers are presented. In contrast to existing Calderón preconditioned time domain solvers, the proposed preconditioner allows for high-order surface representations and current expansions by using a novel set of fully-localized high-order div-and quasi curl-conforming (DQCC) basis functions. Numerical results demonstrate that the linear systems of equations obtained using the proposed basis functions converge rapidly, regardless of the mesh density and of the order of the current expansion. © 1963-2012 IEEE.

  2. High-Order Calderón Preconditioned Time Domain Integral Equation Solvers

    KAUST Repository

    Valdes, Felipe; Ghaffari-Miab, Mohsen; Andriulli, Francesco P.; Cools, Kristof; Michielssen,

    2013-01-01

    Two high-order accurate Calderón preconditioned time domain electric field integral equation (TDEFIE) solvers are presented. In contrast to existing Calderón preconditioned time domain solvers, the proposed preconditioner allows for high-order surface representations and current expansions by using a novel set of fully-localized high-order div-and quasi curl-conforming (DQCC) basis functions. Numerical results demonstrate that the linear systems of equations obtained using the proposed basis functions converge rapidly, regardless of the mesh density and of the order of the current expansion. © 1963-2012 IEEE.

  3. Poder, autoridad y desautorización en el teatro de Calderón

    OpenAIRE

    Arellano, Ignacio

    2011-01-01

    Las comedias que exploran el tema del poder y la autoridad, con sus anejas constelaciones de motivos (la privanza, el modelo de rey, el tiranicidio, la voltaria fortuna o la libertad frente al sometimiento) abundan en el Siglo de Oro, y constituyen en Calderón un territorio amplio y complejo que despliega una problemática llena de matices. Su amplitud de enfoques y perspectivas permite a Calderón una variedad extraordinaria de conflictos y soluciones, manteniendo siempre la car...

  4. The boundedness of multilinear Calderón–Zygmund operators on ...

    Indian Academy of Sciences (India)

    In this paper, we study the boundedness of the multilinear Calderón–. Zygmund operators ... We first recall the definition of Hardy space H p(Rd). .... variable. Therefore, T is a linearly continuous functional. Then, for any atomic decom- position ...

  5. A Direct Numerical Reconstruction Algorithm for the 3D Calderón Problem

    DEFF Research Database (Denmark)

    Delbary, Fabrice; Hansen, Per Christian; Knudsen, Kim

    2011-01-01

    In three dimensions Calderón's problem was addressed and solved in theory in the 1980s in a series of papers, but only recently the numerical implementation of the algorithm was initiated. The main ingredients in the solution of the problem are complex geometrical optics solutions to the conducti...

  6. Mujer y travestismo en el teatro de Calderón

    Directory of Open Access Journals (Sweden)

    Escalonilla López, Rosa Ana

    2001-06-01

    Full Text Available After a brief exposition regarding the situation, Calderón's recourse to travestism appears as the symbol of this theatre, mechanism of ideological transmission and unifying element of the whole of this dramatic production (profane, sacramental and brief. The ideological aspect is analysed and therein its relationship with womanhood. Herewith Calderón appears as a forerunner of modernism, since femenine roles distort the restriction imposed by a baroque society. As a result of travestism. Calderón's women do not fit the epoch's stereotypes. They transgress the activities and spaces assigned to their sex, protecting their honour and facing male authority. Definitely, women behave as complete human beings in equal condition to men.Tras una breve exposición del estado de la cuestión, se contempla el recurso del travestismo en Calderón desde su consideración como símbolo de su teatro, mecanismo de transmisión ideológica y elemento unificador de toda su dramaturgia (profana, sacramental y breve. Se analiza el aspecto ideológico y, dentro de éste, la conexión con el tema de la mujer. Calderón se nos revela, así, como precursor de la modernidad, pues los papeles femeninos violentan las restricciones impuestas por la sociedad barroca. Gracias al travestismo, las mujeres calderonianas se sitúan fuera de los estereotipos de la época, transgreden las actividades y los espacios destinados a su sexo, defienden su propio honor y se enfrentan a la autoridad masculina. La mujer es presentada, en definitiva, como un ser humano completo en igualdad de condiciones con el hombre.

  7. Tasks related to increase of RA reactor exploitation and experimental potential, 01. Designing the protection chamber in the RA reactor hall for handling the radioactive experimental equipment (I-II) Part II, Vol. II; Radovi na povecanju eksploatacionih i eksperimentalnih mogucnosti reaktora RA, 01. Projektovanje zastitne komore u hali reaktora RA za rad sa aktivnim eksperimentalnim uredjajima (I-II), II Deo, Album II

    Energy Technology Data Exchange (ETDEWEB)

    Pavicevic, M [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1963-07-15

    This second volume of the project for construction of the protection chamber in the RA reactor hall for handling the radioactive devices includes the technical description of the chamber, calculation of the shielding wall thickness, bottom lead plate, horizontal stability of the chamber, cost estimation, and the engineering drawings.

  8. A calderón-preconditioned single source combined field integral equation for analyzing scattering from homogeneous penetrable objects

    KAUST Repository

    Valdé s, Felipe; Andriulli, Francesco P.; Bagci, Hakan; Michielssen, Eric

    2011-01-01

    A new regularized single source equation for analyzing scattering from homogeneous penetrable objects is presented. The proposed equation is a linear combination of a Calderón-preconditioned single source electric field integral equation and a

  9. A calderón multiplicative preconditioner for the combined field integral equation

    KAUST Repository

    Bagci, Hakan

    2009-10-01

    A Calderón multiplicative preconditioner (CMP) for the combined field integral equation (CFIE) is developed. Just like with previously proposed Caldern-preconditioned CFIEs, a localization procedure is employed to ensure that the equation is resonance-free. The iterative solution of the linear system of equations obtained via the CMP-based discretization of the CFIE converges rapidly regardless of the discretization density and the frequency of excitation. © 2009 IEEE.

  10. The Reproductive Morphology and Physiological Age Grading of the Female Salvinia Weevil, Calder and Sands

    OpenAIRE

    Lee Eisenberg; Seth Johnson; Michael J Grodowitz

    2018-01-01

    The morphology of the female Cyrtobagous salviniae Calder and Sands reproductive system is similar to other weevil species being meroistic and telotrophic. The reproductive system is composed of 2 ovaries each containing 2 ovarioles where the follicles mature. A physiological age grading system was developed where the continuum of ovarium development was divided into 2 nulliparous and 3 parous classes. This was based on the differentiation of the ovarioles, presence, and appearance of follicu...

  11. Experimental halls workshop summary

    International Nuclear Information System (INIS)

    Thorndike, A.

    1976-01-01

    A brief discussion is given of: (1) pros and cons of open areas as compared with enclosed halls; (2) experimental hall needs of ep, anti p p, and other options; (3) hall for the lepton detector; and, (4) hall for the hadron spectrometer

  12. Experimental halls workshop summary

    International Nuclear Information System (INIS)

    Thorndike, A.

    1976-01-01

    On May 26 and 27, 1976, approximately 50 people met for an informal workshop on plans for experimental halls for ISABELLE. Plans as they exist in the May 1976 version of the ISABELLE proposal were presented. Discussions were held on the following four general topics by separate working groups: (1) pros and cons of open areas as compared with enclosed halls; (2) experimental hall needs of ep, anti pp, and other options; (3) hall for the lepton detector; and (4) hall for the hadron spectrometer. The planning for experimental halls at PEP, the hall for the lepton detector, the hadron spectrometer, and open areas are discussed

  13. Experimental halls workshop summary

    International Nuclear Information System (INIS)

    Thorndike, A.

    1976-01-01

    At the experimental halls workshop, discussions were held on: (1) open areas as compared with enclosed halls; (2) the needs of ep, anti pp, and other options; (3) the hall for the lepton detector; and (4) the hall for the hadron spectrometer. The value of different possibilities for the future experimental program was explored. A number of suggestions emerged which will be used as the design of the experimental halls progresses

  14. A UKAEA review of gas-cooled reactors in the United Kingdom

    International Nuclear Information System (INIS)

    Heath, E.C.; Knowles, A.N.

    1983-01-01

    The commercial use of nuclear power for electrical generation commenced in the UK in the 1950s with the Calder Hall reactors. Based on this concept, eighteen commercial reactor units, with two further units outside the UK, were constructed and have been in operation for periods ranging from 10 to 19 years. The paper reviews this experience mainly from the aspects of safety and the achieved costs, which compare favourably with current figures for fossil fired generation. The further development of the gas-cooled system in the UK commenced with the construction of the Windscale AGR, which came into operation in 1962. This led to the ordering of 14 large commercial AGR units, 4 of which have been in service since 1976, 6 are at an advanced stage of construction and 4 are at an early stage of construction. The paper reviews the main safety features of the AGR and considers the costs, taking achieved costs for the units which are in service and a combination of historical costs and projected costs for the units under construction. Again a clear advantage over fossil fuelled stations is shown. The paper also includes a preliminary account of the use of the prototype AGR at Windscale for the series of experiments concerning plateout, over-temperature in the fuel and simulated fault transients in the core which were carried out earlier in 1981. (author)

  15. El laberinto, motivo sacramental en Tirso y Calderón

    OpenAIRE

    Escudero-Baztán, J.M. (Juan Manuel); Oteiza, B. (Blanca)

    2013-01-01

    Este trabajo estudia el motivo del laberinto en dos autos sacramentales del siglo XVII: “El laberinto de Creta” de Tirso de Molina y “El laberinto del mundo” de Calderón de la Barca. Se enmarca dentro de un estudio más ambicioso que pretende abarcar la utilización del concepto de laberinto en el teatro del siglo XVII. La lectura de ambos textos muestra profundas transformaciones en el diseño, la estructura, la métrica y la utilización de la alegoría. El estudio comparado arroja una mayor dest...

  16. El bestiario de Cristo en los Autos Sacramentales de Calderón

    OpenAIRE

    Alonso Rey, Maria Dolores

    2005-01-01

    communication en attente de publication. El maravilloso mundo de los autos sacramentales. Casa de Velázquez. Madrid. 2005; Del conjunto de figuras y símbolos con los que Calderón representa a Cristo nos interesa analizar los símbolos zoomórficos. Nos interrogaremos sobre su utilización, los contextos en los que aparecen, sus valores visuales y sus potencialidades expresivas. No se elige más que a cinco de ellos : ciervo, león, cordero, pelícano y serpiente.

  17. Embajadas y guerras: algunos paradigmas compositivos en el auto sacramental de Calderón

    OpenAIRE

    Sáez, Adrián J.

    2012-01-01

    Entre los diversos materiales que Calderón emplea para el diseño de sus autos sacramentales se encuentra una serie de paradigmas estrechamente vinculados a argumentos bélicos. Sus fuentes no son únicamente literarias, sino que también se asientan en la realidad del momento. La embajada, misión diplomática habitual, contribuye a la exaltación de la monarquía hispánica y legitima sus acciones bélicas, pues son solo el último camino posible tras las constantes ofertas de paz. A su vez, las diver...

  18. La crónica de Ventura García Calderón

    Directory of Open Access Journals (Sweden)

    Esther Espinoza E.

    2012-12-01

    Full Text Available Este estudio brinda una lectura del libro de crónicas Bajo el clamor delas sirenas de Ventura García Calderón, en el que ofrece su visión de labarbarie instalada en el centro de la civilización, mediante la guerra. Lamirada del autor logra extraer de esa experiencia la oportunidad parauniversalizar los valores franceses, capaces de convocar a todos los pueblos y culturas, en una nueva era de avance tecnológico.

  19. Pedro Calderón de la Barca, Autos sacramentales - Francisco de Quevedo, Prosa satírica

    OpenAIRE

    Plata, Fernando

    2011-01-01

    Reseñas de Pedro Calderón de la Barca, Autos sacramentales. El divino Jasón. El gran mercado del Mundo. El gran teatro del Mundo. La viña del Señor, ed. I. Arellano, Homo Legens (Bibliotheca Homolegens, 50), Madrid, 2010, 406 pp. ISBN: 978-84-92518-54-8 y Francisco de Quevedo, Prosa satírica, ed. I. Arellano, Homo Legens (Bibliotheca Homolegens, 58), Madrid, 2011, 206 pp. ISBN: 978-84-92518-69-2. Reviews of Pedro Calderón de la Barca, Autos sacramentales. El divino Jasón. El gran mercado d...

  20. The Cuatrocientos milagros de la cruz of Jaime Bleda: a bedside book for Calderón?

    Directory of Open Access Journals (Sweden)

    Adrián J. Sáez

    2013-04-01

    Full Text Available Abstract:This paper explores the possible knowledge that some authors of the Golden Age may have about certain treatises of historical, philosophical and political nature, besides the well-known relations with other literary works, like the critics frequently have pointed out. So, this investigation compares the series of miracles that appear in La devoción de la cruz of Calderón with the book Cuatrocientos milagros de la cruz of Jaime Bleda, a religious treaty that Calderón might recalled in order to write some passages of this comedy. Overall, this paper reveals data about the prodigious miscellany that may serve to other studies about this matter. Resumen:Este trabajo explora el posible conocimiento que algunos autores del Siglo de Oro pudieron tener de ciertos tratados de tema histórico, filosófico, político, etc., al margen de las relaciones con otras obras literarias, frecuentemente estudiadas por la crítica. Así, se pone en diálogo la serie de milagros que aparecen en La devoción de la cruz de Calderón con los Cuatrocientos milagros de la cruz de Jaime Bleda, un repertorio de milagros que Calderón pudo recordar a la hora de escribir algunos pasajes de esta comedia. Conjuntamente se da noticia de esta miscelánea de prodigios, que puede resultar de gran utilidad para otros estudios.

  1. 8 CFR 343b.3 - Interrogation.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Interrogation. 343b.3 Section 343b.3 Aliens... NATURALIZATION FOR RECOGNITION BY A FOREIGN STATE § 343b.3 Interrogation. When Form N-565 presents a prima facie... issuance of the certificate. Interrogation of the applicant shall be conducted before the application is...

  2. Para una teoría de la realidad virtual en Calderón

    OpenAIRE

    Suárez, J.L. (Juan Luis)

    2012-01-01

    Este artículo se vale del concepto de realidad virtual para analizar la obra de Calderón y enmarcarla en una concepción de la cultura entendida como espectáculo y entretenimiento. En esta concepción, la realidad virtual se entiende a partir de una clasificación que opone lo virtual a lo concreto, no a lo real, y que describe la cultura del Barroco como una época de creativos ensayos sobre la realidad virtual en la literatura y la cultura hispanas que va más allá de la representación y que tie...

  3. The Reproductive Morphology and Physiological Age Grading of the Female Salvinia Weevil, Calder and Sands

    Directory of Open Access Journals (Sweden)

    Lee Eisenberg

    2018-01-01

    Full Text Available The morphology of the female Cyrtobagous salviniae Calder and Sands reproductive system is similar to other weevil species being meroistic and telotrophic. The reproductive system is composed of 2 ovaries each containing 2 ovarioles where the follicles mature. A physiological age grading system was developed where the continuum of ovarium development was divided into 2 nulliparous and 3 parous classes. This was based on the differentiation of the ovarioles, presence, and appearance of follicular relics, cuticle hardness/coloration, and fat body quantity/appearance. High correlation occurred between the parous classes and number of eggs produced where the P3 class had over 9-fold higher number of eggs in comparison with the P1 class. Mean number of eggs produced for each parous class was significantly different, however, overlap occurred. Such a system enables a determination of the past, present, and future reproductive status of field populations and mass-rearing colonies.

  4. A Calderón multiplicative preconditioner for coupled surface-volume electric field integral equations

    KAUST Repository

    Bagci, Hakan

    2010-08-01

    A well-conditioned coupled set of surface (S) and volume (V) electric field integral equations (S-EFIE and V-EFIE) for analyzing wave interactions with densely discretized composite structures is presented. Whereas the V-EFIE operator is well-posed even when applied to densely discretized volumes, a classically formulated S-EFIE operator is ill-posed when applied to densely discretized surfaces. This renders the discretized coupled S-EFIE and V-EFIE system ill-conditioned, and its iterative solution inefficient or even impossible. The proposed scheme regularizes the coupled set of S-EFIE and V-EFIE using a Calderón multiplicative preconditioner (CMP)-based technique. The resulting scheme enables the efficient analysis of electromagnetic interactions with composite structures containing fine/subwavelength geometric features. Numerical examples demonstrate the efficiency of the proposed scheme. © 2006 IEEE.

  5. El camino de la mina, vehículo de emociones en Calderón

    Directory of Open Access Journals (Sweden)

    Rull, Enrique

    2002-12-01

    Full Text Available Calderón uses some scenic devices to stablish certain dramatic situations in the plays. The studied here is related to the function of the mine, which possessed important polisemic values. Not only it is used for stablishing a belie religious or a reat loving environement but also to use this motif with the metaphoric value of passion or as a true laberinto of love, includying trascendental mitological symbols. Everything together is aimed to create a very fast and mysterious activity mixing both comic and tragic effects in which the nonexpected becomes not only dramatical essence but also a personal experience about destinity and life.Calderón utiliza varios recursos escénicos para establecer determinadas situaciones dramáticas en sus obras. El que se estudia aquí se refiere a la función de la mina, que posee valores polisémicos muy notables, los cuales van desde los que le sirven para establecer un ámbito guerrero, religioso, amoroso de carácter real, hasta la utilización de este motivo con carácter metafórico de la pasión amorosa o como verdadero laberinto de amor que incluye incluso una mitologización trascendente de la misma. Todo ello le sirve para configurar en sus obras una acción trepidante, misteriosa, en la que se mezcla lo cómico con lo trágico, y en donde lo inesperado cobra un valor no sólo de esencia dramática sino también de vivencia existencial acerca del destino de la vida.

  6. Cryogenic microsize Hall sensors

    International Nuclear Information System (INIS)

    Kvitkovic, J.; Polak, M.

    1993-01-01

    Hall sensors have a variety of applications in magnetic field measurements. The active area of the Hall sensor does not play an important role in measuring of homogeneous magnetic field. Actually Hall sensors are widely used to measure profiles of magnetic fields produced by magnetization currents in samples of HTC superconductors, as well as of LTC ones. Similar techniques are used to measure magnetization of both HTC and LTC superconductors. In these cases Hall sensor operates in highly inhomogeneous magnetic fields. Because of that, Hall sensors with very small active area are required. We developed and tested Hall sensors with active area 100 μm x 100 μm - type M and 50 μm x 50 μm - type V. Here we report on the most imporant parameters of these units, as well as on their properties as differential magnetometer. (orig.)

  7. Study of radiation exposure rate on the measurement points in Kartini reactor hall as based to determine operation safety parameters (KBO)

    International Nuclear Information System (INIS)

    Mahrus Salam; Elisabeth Supriyatni; Fajar Panuntun

    2016-01-01

    In the operation of nuclear facility there are safety parameters, which is the value of the conservatively maximum limit to ensure that all of the uncertainty in the analysis of facility operations safety have been considered, such as uncertainty of measurement, response time and uncertainty calculation tool, and is get a long to others value of normal operating condition limits, in other words, there are still allowed or permitted. Calculation of the radiation exposure rate on five measurement points (50 cm above the water surface of reactor pool, above interim storage (bulk shielding), reactor deck, thermal column and sub critical facility) and to be compared to the operation safety parameters (KBO) of Kartini reactor. The exposure rate value is obtained by calculating the source term of radioactivity on the core, attenuation resulting from the radiation shielding and measurement distance. From the calculation obtained that the value of gamma exposure rate of 50 cm above the water surface of reactor pool is 96.91 mR/hr (KBO<100 mR/hr), on the deck of Bulk Shielding amounted to 1.70 mR/h (KBO<2.5 mR/hr), on the reactor deck amounted to 5.73 mR/hr (KBO<10 mR/hr), on the Thermal Column amounted to 2.73 mR/hr (KBO<10 mR/hr) and on the sub critical facility amounted to 1.148 mR/hr (KBO<2.5 mR/hr). The value of gamma exposure rate at 5 locations measurements are still less than the operation safety parameters (KBO), it means that the reactor is safe to be operated. (author)

  8. Skyrmions and Hall viscosity

    Science.gov (United States)

    Kim, Bom Soo

    2018-05-01

    We discuss the contribution of magnetic Skyrmions to the Hall viscosity and propose a simple way to identify it in experiments. The topological Skyrmion charge density has a distinct signature in the electric Hall conductivity that is identified in existing experimental data. In an electrically neutral system, the Skyrmion charge density is directly related to the thermal Hall conductivity. These results are direct consequences of the field theory Ward identities, which relate various physical quantities based on symmetries and have been previously applied to quantum Hall systems.

  9. El motivo del viaje en los autos sacramentales de Calderón, I: los viajes mitológicos

    Directory of Open Access Journals (Sweden)

    Arellano, Ignacio

    2011-06-01

    Full Text Available The article examines the aspects of the travel in five allegorical plays of Calderón with mythological argument, analyzing the main elements of travel narrative and allegorical use in relation with conventions of the sacramental plays. Especially important is the structure of travel in El divino Jasón and Los encantos de la Culpa organized on the story of the Argonauts and the Odyssey respectively.El artículo examina los aspectos del viaje en cinco autos de argumento mitológico de Calderón, analizando los principales elementos de relato de viaje y su utilización alegórica en el marco del género sacramental. Destaca por su importancia la estructura del viaje en los autos El divino Jasón y Los encantos de la Culpa, sobre la historia de los argonautas y la Odisea respectivamente.

  10. Sellafield

    International Nuclear Information System (INIS)

    1984-01-01

    This small, illustrated, booklet describes Sellafield under the headings: introduction (historical and general); organisation (Windscale Works; Calder Works); Magnox reprocessing (using nuclear fuel in a reactor; transport of fuel; used fuel stored in ponds; decanning of Magnox fuel; separation process; highly-active storage tanks; vitrification); waste disposal; health and safety; Calder Hall; future developments; training young people; community relations. (U.K.)

  11. The study of the irradiation-induced embrittlement of reactor pressure vessels. Analysis of surveillance test specimens of a commercial nuclear reactor pressure vessel studied by three-dimensional atom probe and positron annihilation

    International Nuclear Information System (INIS)

    Nagai, Yasuyoshi; Toyama, Takeshi; Hasegawa, Masayuki

    2007-01-01

    The study of embrittlement of nuclear power reactor pressure vessels (RPVs) is of critical importance for the safety assessment in the nuclear industry. Some origins of embrittlement are attributed to fine Cu precipitates, matrix defects, grain boundary segregation of P and late blooming phase. This review article described nanostructural observation by three-dimensional atom probe (3DAP) and positron annihilation spectroscopy (PAS). The density and sizes of Cu-rich nanoprecipitates and grain boundary segregation are sensitively detected by 3DAP, and vacancies are probed by PAS. Element analysis around vacancies and fine microstructural Cu precipitates not containing vacancies are successfully observed by a coincidence doppler broadening method. The nanostructural evolution of irradiation-induced Cu-rich nanoprecipitates (CRNPs) and vacancy clusters in surveillance test specimens of commercial nuclear reactor pressure vessel steel welds of Doel-2 in Belgium were revealed by combining 3DAP and PAS. In both medium (0.13 wt%) and high (0.30 wt%) Cu welds, the CRNPs were found to form readily at the very beginning of the reactor lifetime. On the other hand, small vacancy clusters start appearing after the initial Cu precipitates and accumulate steadily with increasing neutron dose. The CRNPs were also observed at very low dose rate of neutrons in the test specimen of Calder Hall Reactor of Japan Atomic Power Company. The significant enhancement of these Cu precipitates results in the embrittlement in practical RPVs. At very high dose of 2.2x10 18 n/cm 2 by JMTR, the Cu precipitates were scarcely observed, and the irradiation-induced embrittlement was primarily caused from vacancy-impurity complexes and dislocation loops. (author)

  12. Reactor

    International Nuclear Information System (INIS)

    Toyama, Masahiro; Kasai, Shigeo.

    1978-01-01

    Purpose: To provide a lmfbr type reactor wherein effusion of coolants through a loop contact portion is reduced even when fuel assemblies float up, and misloading of reactor core constituting elements is prevented thereby improving the reactor safety. Constitution: The reactor core constituents are secured in the reactor by utilizing the differential pressure between the high-pressure cooling chamber and low-pressure cooling chamber. A resistance port is formed at the upper part of a connecting pipe, and which is connect the low-pressure cooling chamber and the lower surface of the reactor core constituent. This resistance part is formed such that the internal sectional area of the connecting pipe is made larger stepwise toward the upper part, and the cylinder is formed larger so that it profiles the inner surface of the connecting pipe. (Aizawa, K.)

  13. Reactor

    International Nuclear Information System (INIS)

    Ikeda, Masaomi; Kashimura, Kazuo; Inoue, Kazuyuki; Nishioka, Kazuya.

    1979-01-01

    Purpose: To facilitate the construction of a reactor containment building, whereby the inspections of the outer wall of a reactor container after the completion of the construction of the reactor building can be easily carried out. Constitution: In a reactor accommodated in a container encircled by a building wall, a space is provided between the container and the building wall encircling the container, and a metal wall is provided in the space so that it is fitted in the building wall in an attachable or detatchable manner. (Aizawa, K.)

  14. Halls Lake 1990

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Salt marsh habitats along the shoreline of Halls Lake are threatened by wave erosion, but the reconstruction of barrier islands to reduce this erosion will modify or...

  15. The quantum hall effect

    International Nuclear Information System (INIS)

    El-Arabi, N. M.

    1993-01-01

    Transport phenomena in two dimensional semiconductors have revealed unusual properties. In this thesis these systems are considered and discussed. The theories explain the Integral Quantum Hall Effect (IQHE) and the Fractional Quantum Hall Effect (FQHE). The thesis is composed of five chapters. The first and the second chapters lay down the theory of the IQHE, the third and fourth consider the theory of the FQHE. Chapter five deals with the statistics of particles in two dimension. (author). Refs

  16. Hall viscosity of hierarchical quantum Hall states

    Science.gov (United States)

    Fremling, M.; Hansson, T. H.; Suorsa, J.

    2014-03-01

    Using methods based on conformal field theory, we construct model wave functions on a torus with arbitrary flat metric for all chiral states in the abelian quantum Hall hierarchy. These functions have no variational parameters, and they transform under the modular group in the same way as the multicomponent generalizations of the Laughlin wave functions. Assuming the absence of Berry phases upon adiabatic variations of the modular parameter τ, we calculate the quantum Hall viscosity and find it to be in agreement with the formula, given by Read, which relates the viscosity to the average orbital spin of the electrons. For the filling factor ν =2/5 Jain state, which is at the second level in the hierarchy, we compare our model wave function with the numerically obtained ground state of the Coulomb interaction Hamiltonian in the lowest Landau level, and find very good agreement in a large region of the complex τ plane. For the same example, we also numerically compute the Hall viscosity and find good agreement with the analytical result for both the model wave function and the numerically obtained Coulomb wave function. We argue that this supports the notion of a generalized plasma analogy that would ensure that wave functions obtained using the conformal field theory methods do not acquire Berry phases upon adiabatic evolution.

  17. Temperature dependence of collapse of quantized hall resistance

    International Nuclear Information System (INIS)

    Tanaka, Hiroyasu; Kawashima, Hironori; Iizuka, Hisamitsu; Fukuda, Hideaki; Kawaji, Shinji

    2006-01-01

    Similarity is observed in the deviation of Hall resistance from the quantized value with the increase in the source-drain current I SD in our butterfly-type Hall bars and in the Hall bars used by Jeanneret et al., while changes in the diagonal resistivity ρ xx with I SD are significantly different between these Hall bars. The temperature dependence of the critical Hall electric field F cr (T) for the collapse of R H (4) measured in these Hall bars is approximated using F cr (T) = F cr (0)(1 - (T/T cr ) 2 ). Here, the critical Hall electric field at zero temperature depends on the magnetic field B as F cr (0) ∝ B 3/2 . Theoretical considerations are given on F cr (T) on the basis of a temperature-dependent mobility edge model and a schema of temperature-dependent inter-Landau level tunneling probability arising from the Fermi distribution function. The former does not fit in with the I SD dependence of activation energy in ρ xx . (author)

  18. Representation of the Indian in Calderón’s «La Aurora en Copacabana»

    Directory of Open Access Journals (Sweden)

    José Elías Gutiérrez Meza

    2014-11-01

    Full Text Available The article analyzes the onomastics of the Indian characters, the portrayal of the Inca Empire of Huáscar and Atahualpa, and the Christianization of Guacolda and Yupangui in Calderón’s La Aurora en Copacabana. Rational and proactive, these two characters realize the illegitimacy of the Inca idolatry and embrace the true religion, long before the formal start of Perú’s christianization. Thus, it is argued that this specific representation of the Indian may have been influenced by the close circles indianos of Miguel de Aguirre, who allegedly patronized this comedy.

  19. Pedro Calderón de la Barca, Autos sacramentales - Francisco de Quevedo, Prosa satírica

    Directory of Open Access Journals (Sweden)

    Fernando Plata

    2012-12-01

    Full Text Available Reviews of Pedro Calderón de la Barca, Autos sacramentales. El divino Jasón. El gran mercado del Mundo. El gran teatro del Mundo. La viña del Señor, ed. I. Arellano, Homo Legens (Bibliotheca Homolegens, 50, Madrid, 2010, 406 pp. ISBN: 978-84-92518-54-8 y Francisco de Quevedo, Prosa satírica, ed. I. Arellano, Homo Legens (Bibliotheca Homolegens, 58, Madrid, 2011, 206 pp. ISBN: 978-84-92518-69-2.

  20. 216-B-3 expansion ponds closure plan

    Energy Technology Data Exchange (ETDEWEB)

    1994-10-01

    This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA.

  1. 216-B-3 expansion ponds closure plan

    International Nuclear Information System (INIS)

    1994-10-01

    This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA

  2. The quantized Hall effect

    International Nuclear Information System (INIS)

    Klitzing von, K.

    1989-01-01

    The quantized Hall effect is theoretically explained in detail as are its basic properties. The explanation is completed with the pertinent mathematical relations and illustrative figures. Experimental data are critically assessed obtained by quantum transport measurement in a magnetic field on two-dimensional systems. The results are reported for a MOSFET silicon transistor and for GaAs-Al x Ga 1-x As heterostructures. The application is discussed of the quantized Hall effect in determining the fine structure constant or in implementing the resistance standard. (M.D.). 27 figs., 57 refs

  3. Intrinsic superspin Hall current

    Science.gov (United States)

    Linder, Jacob; Amundsen, Morten; Risinggârd, Vetle

    2017-09-01

    We discover an intrinsic superspin Hall current: an injected charge supercurrent in a Josephson junction containing heavy normal metals and a ferromagnet generates a transverse spin supercurrent. There is no accompanying dissipation of energy, in contrast to the conventional spin Hall effect. The physical origin of the effect is an antisymmetric spin density induced among transverse modes ky near the interface of the superconductor arising due to the coexistence of p -wave and conventional s -wave superconducting correlations with a belonging phase mismatch. Our predictions can be tested in hybrid structures including thin heavy metal layers combined with strong ferromagnets and ordinary s -wave superconductors.

  4. Hall effect in hopping regime

    International Nuclear Information System (INIS)

    Avdonin, A.; Skupiński, P.; Grasza, K.

    2016-01-01

    A simple description of the Hall effect in the hopping regime of conductivity in semiconductors is presented. Expressions for the Hall coefficient and Hall mobility are derived by considering averaged equilibrium electron transport in a single triangle of localization sites in a magnetic field. Dependence of the Hall coefficient is analyzed in a wide range of temperature and magnetic field values. Our theoretical result is applied to our experimental data on temperature dependence of Hall effect and Hall mobility in ZnO. - Highlights: • Expressions for Hall coefficient and mobility for hopping conductivity are derived. • Theoretical result is compared with experimental curves measured on ZnO. • Simultaneous action of free and hopping conduction channels is considered. • Non-linearity of hopping Hall coefficient is predicted.

  5. Hall effect in hopping regime

    Energy Technology Data Exchange (ETDEWEB)

    Avdonin, A., E-mail: avdonin@ifpan.edu.pl [Institute of Physics, Polish Academy of Sciences, Al. Lotników 32/46, 02-668 Warszawa (Poland); Skupiński, P. [Institute of Physics, Polish Academy of Sciences, Al. Lotników 32/46, 02-668 Warszawa (Poland); Grasza, K. [Institute of Physics, Polish Academy of Sciences, Al. Lotników 32/46, 02-668 Warszawa (Poland); Institute of Electronic Materials Technology, ul. Wólczyńska 133, 01-919 Warszawa (Poland)

    2016-02-15

    A simple description of the Hall effect in the hopping regime of conductivity in semiconductors is presented. Expressions for the Hall coefficient and Hall mobility are derived by considering averaged equilibrium electron transport in a single triangle of localization sites in a magnetic field. Dependence of the Hall coefficient is analyzed in a wide range of temperature and magnetic field values. Our theoretical result is applied to our experimental data on temperature dependence of Hall effect and Hall mobility in ZnO. - Highlights: • Expressions for Hall coefficient and mobility for hopping conductivity are derived. • Theoretical result is compared with experimental curves measured on ZnO. • Simultaneous action of free and hopping conduction channels is considered. • Non-linearity of hopping Hall coefficient is predicted.

  6. The Monty Hall Dilemma.

    Science.gov (United States)

    Granberg, Donald; Brown, Thad A.

    1995-01-01

    Examines people's behavior in the Monty Hall Dilemma (MHD), in which a person must make two decisions to win a prize. In a series of five studies, found that people misapprehend probabilities in the MHD. Discusses the MHD's relation to illusion of control, belief perseverance, and the status quo bias. (RJM)

  7. The Isolde experimental hall

    CERN Multimedia

    Laurent Guiraud

    2000-01-01

    General view of the Isotope-Separator On-Line (ISOLDE) hall. ISOLDE is dedicated to the production of a large variety of radioactive ion beams for many different experiments. Rare isotopes can be produced allowing the study of spectra for neutrino beam production.

  8. Hall Sweet Home

    Science.gov (United States)

    Oguntoyinbo, Lekan

    2011-01-01

    Many urban and commuter universities have their sights set on students who are unlikely to connect with the college and likely to fail unless the right strategies are put in place to help them graduate. In efforts to improve retention rates, commuter colleges are looking to an unusual suspect: residence halls. The author discusses how these…

  9. Anomalous Hall effect

    Czech Academy of Sciences Publication Activity Database

    Nagaosa, N.; Sinova, Jairo; Onoda, S.; MacDonald, A. H.; Ong, N. P.

    2010-01-01

    Roč. 82, č. 2 (2010), s. 1539-1592 ISSN 0034-6861 Institutional research plan: CEZ:AV0Z10100521 Keywords : anomalous Hall effect * spintronics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 51.695, year: 2010

  10. Laurance David Hall.

    Science.gov (United States)

    Coxon, Bruce

    2011-01-01

    An account is given of the life, scientific contributions, and passing of Laurance David Hall (1938-2009), including his early history and education at the University of Bristol, UK, and the synthesis and NMR spectroscopy of carbohydrates and other natural products during ∼20 years of research and teaching at the University of British Columbia in Vancouver, Canada. Lists of graduate students, post-doctoral fellows, and sabbatical visitors are provided for this period. Following a generous endowment by Dr. Herchel Smith, Professor Hall built a new Department of Medicinal Chemistry at Cambridge University, UK, and greatly expanded his researches into the technology and applications of magnetic resonance imaging (MRI) and zero quantum NMR. MRI technology was applied both to medical problems such as the characterization of cartilage degeneration in knee joints, the measurement of ventricular function, lipid localization in animal models of atherosclerosis, paramagnetic metal complexes of polysaccharides as contrast agents, and studies of many other anatomical features, but also to several aspects of materials analysis, including food analyses, process control, and the elucidation of such physical phenomena as the flow of liquids through porous media, defects in concrete, and the visualization of fungal damage to wood. Professor Hall's many publications, patents, lectures, and honors and awards are described, and also his successful effort to keep the Asilomar facility in Pacific Grove, California as the alternating venue for the annual Experimental NMR Conference. Two memorial services for Professor Hall are remembered. Copyright © 2011 Elsevier Inc. All rights reserved.

  11. Reactors

    DEFF Research Database (Denmark)

    Shah, Vivek; Vaz Salles, Marcos António

    2018-01-01

    The requirements for OLTP database systems are becoming ever more demanding. Domains such as finance and computer games increasingly mandate that developers be able to encode complex application logic and control transaction latencies in in-memory databases. At the same time, infrastructure...... engineers in these domains need to experiment with and deploy OLTP database architectures that ensure application scalability and maximize resource utilization in modern machines. In this paper, we propose a relational actor programming model for in-memory databases as a novel, holistic approach towards......-level function calls. In contrast to classic transactional models, however, reactors allow developers to take advantage of intra-transaction parallelism and state encapsulation in their applications to reduce latency and improve locality. Moreover, reactors enable a new degree of flexibility in database...

  12. Spin Hall effects

    Science.gov (United States)

    Sinova, Jairo; Valenzuela, Sergio O.; Wunderlich, J.; Back, C. H.; Jungwirth, T.

    2015-10-01

    Spin Hall effects are a collection of relativistic spin-orbit coupling phenomena in which electrical currents can generate transverse spin currents and vice versa. Despite being observed only a decade ago, these effects are already ubiquitous within spintronics, as standard spin-current generators and detectors. Here the theoretical and experimental results that have established this subfield of spintronics are reviewed. The focus is on the results that have converged to give us the current understanding of the phenomena, which has evolved from a qualitative to a more quantitative measurement of spin currents and their associated spin accumulation. Within the experimental framework, optical-, transport-, and magnetization-dynamics-based measurements are reviewed and linked to both phenomenological and microscopic theories of the effect. Within the theoretical framework, the basic mechanisms in both the extrinsic and intrinsic regimes are reviewed, which are linked to the mechanisms present in their closely related phenomenon in ferromagnets, the anomalous Hall effect. Also reviewed is the connection to the phenomenological treatment based on spin-diffusion equations applicable to certain regimes, as well as the spin-pumping theory of spin generation used in many measurements of the spin Hall angle. A further connection to the spin-current-generating spin Hall effect to the inverse spin galvanic effect is given, in which an electrical current induces a nonequilibrium spin polarization. This effect often accompanies the spin Hall effect since they share common microscopic origins. Both can exhibit the same symmetries when present in structures comprising ferromagnetic and nonmagnetic layers through their induced current-driven spin torques or induced voltages. Although a short chronological overview of the evolution of the spin Hall effect field and the resolution of some early controversies is given, the main body of this review is structured from a pedagogical

  13. Paired Hall states

    International Nuclear Information System (INIS)

    Greiter, M.

    1992-01-01

    This dissertation contains a collection of individual articles on various topics. Their significance in the corresponding field as well as connections between them are emphasized in a general and comprehensive introduction. In the first article, the author explores the consequences for macroscopic effective Lagrangians of assuming that the momentum density is proportional to the flow of conserved current. The universal corrections obtained for the macroscopic Lagrangian of a superconductor describe the London Hall effect, and provide a fully consistent derivation of it. In the second article, a heuristic principle is proposed for quantized Hall states: the existence and incompressibility of fractionally quantized Hall states is explained by an argument based on an adiabatic localization of magnetic flux, the process of trading uniform flux for an equal amount of fictitious flux attached to the particles. This principle is exactly implemented in the third article. For a certain class of model Hamiltonians, the author obtains Laughlin's Jastrow type wave functions explicitly from a filled Landau level, by smooth extrapolation in quantum statistics. The generalization of this analysis to the torus geometry shows that theorems restricting the possibilities of quantum statistics on closed surfaces are circumvented in the presence of a magnetic field. In the last article, the existence is proposed of a novel incompressible quantum liquid, a paired Hall state, at a half filled Landau level. This state arises adiabatically from free fermions in zero magnetic field, and reduces to a state previously proposed by Halperin in the limit of tightly bound pairs. It supports unusual excitations, including neutral fermions and charge e/4 anyons with statistical parameter θ = π/8

  14. LWR containment thermal hydraulic codes benchmark demona B3 exercise

    International Nuclear Information System (INIS)

    Della Loggia, E.; Gauvain, J.

    1988-01-01

    Recent discussion about the aerosol codes currently used for the analysis of containment retention capabilities have revealed a number of questions concerning the reliabilities and verifications of the thermal-hydraulic modules of these codes with respect to the validity of implemented physical models and the stability and effectiveness of numerical schemes. Since these codes are used for the calculation of the Source Term for the assessment of radiological consequences of severe accidents, they are an important part of reactor safety evaluation. For this reason the Commission of European Communities (CEC), following the recommendation mode by experts from Member Stades, is promoting research in this field with the aim also of establishing and increasing collaboration among Research Organisations of member countries. In view of the results of the studies, the CEC has decided to carry out a Benchmark exercise for severe accident containment thermal hydraulics codes. This exercise is based on experiment B3 in the DEMONA programme. The main objective of the benchmark exercise has been to assess the ability of the participating codes to predict atmosphere saturation levels and bulk condensation rates under conditions similar to those predicted to follow a severe accident in a PWR. This exercise follows logically on from the LA-4 exercise, which, is related to an experiment with a simpler internal geometry. We present here the results obtained so far and from them preliminary conclusions are drawn, concerning condensation temperature, pressure, flow rates, in the reactor containment

  15. Guild Hall retrofit

    Energy Technology Data Exchange (ETDEWEB)

    1984-08-01

    This report demonstrates the economic viability of an exterior rewrap retrofit performed on a public community facility for the performing arts. This facility originally consisted of two mess halls built by the American army. The exterior retrofit consisted of constructing a super-insulated passageway to link the two halls as well as completely wrapping the facility with six millimetre polyethylene to provide an airtight barrier. The roofs and walls were reinsulated and insulation levels were increased to RSI 10.5 in the ceilings and RSI 7.7 in the walls. The installation of a propane fuelled furnace was also included in the retrofit package. Prior to the renovations and retrofitting, the Guild Hall facility was almost unusable. The demonstration project transformed the cold, drafty buildings into an attractive, comfortable and functional centre for the performing arts. Heating requirements have been reduced to 500 MJ/m {sup 2} of floor space annually compared to a predicted 1,760 MJ/m{sup 2} of floor space based on HOTCAN analysis of the heating requirements without the energy conservation measures. 9 figs., 10 tabs.

  16. Quantum critical Hall exponents

    CERN Document Server

    Lütken, C A

    2014-01-01

    We investigate a finite size "double scaling" hypothesis using data from an experiment on a quantum Hall system with short range disorder [1-3]. For Hall bars of width w at temperature T the scaling form is w(-mu)T(-kappa), where the critical exponent mu approximate to 0.23 we extract from the data is comparable to the multi-fractal exponent alpha(0) - 2 obtained from the Chalker-Coddington (CC) model [4]. We also use the data to find the approximate location (in the resistivity plane) of seven quantum critical points, all of which closely agree with the predictions derived long ago from the modular symmetry of a toroidal sigma-model with m matter fields [5]. The value nu(8) = 2.60513 ... of the localisation exponent obtained from the m = 8 model is in excellent agreement with the best available numerical value nu(num) = 2.607 +/- 0.004 derived from the CC-model [6]. Existing experimental data appear to favour the m = 9 model, suggesting that the quantum Hall system is not in the same universality class as th...

  17. Reactor

    International Nuclear Information System (INIS)

    Fujibayashi, Toru.

    1976-01-01

    Object: To provide a boiling water reactor which can enhance a quake resisting strength and flatten power distribution. Structure: At least more than four fuel bundles, in which a plurality of fuel rods are arranged in lattice fashion which upper and lower portions are supported by tie-plates, are bundled and then covered by a square channel box. The control rod is movably arranged within a space formed by adjoining channel boxes. A spacer of trapezoidal section is disposed in the central portion on the side of the channel box over substantially full length in height direction, and a neutron instrumented tube is disposed in the central portion inside the channel box. Thus, where a horizontal load is exerted due to earthquake or the like, the spacers come into contact with each other to support the channel box and prevent it from abnormal vibrations. (Furukawa, Y.)

  18. Topological Hall and Spin Hall Effects in Disordered Skyrmionic Textures

    OpenAIRE

    N'diaye, P. B.; Akosa, C. A.; Manchon, A.

    2016-01-01

    We carry out a throughout study of the topological Hall and topological spin Hall effects in disordered skyrmionic systems: the dimensionless (spin) Hall angles are evaluated across the energy band structure in the multiprobe Landauer-B\\"uttiker formalism and their link to the effective magnetic field emerging from the real space topology of the spin texture is highlighted. We discuss these results for an optimal skyrmion size and for various sizes of the sample and found that the adiabatic a...

  19. A calderón-preconditioned single source combined field integral equation for analyzing scattering from homogeneous penetrable objects

    KAUST Repository

    Valdés, Felipe

    2011-06-01

    A new regularized single source equation for analyzing scattering from homogeneous penetrable objects is presented. The proposed equation is a linear combination of a Calderón-preconditioned single source electric field integral equation and a single source magnetic field integral equation. The equation is immune to low-frequency and dense-mesh breakdown, and free from spurious resonances. Unlike dual source formulations, this equation involves operator products that cannot be discretized using standard procedures for discretizing standalone electric, magnetic, and combined field operators. Instead, the single source equation proposed here is discretized using a recently developed technique that achieves a well-conditioned mapping from div- to curl-conforming function spaces, thereby fully respecting the space mapping properties of the operators involved, and guaranteeing accuracy and stability. Numerical results show that the proposed equation and discretization technique give rise to rapidly convergent solutions. They also validate the equation\\'s resonant free character. © 2006 IEEE.

  20. Quantum hall effect. A perspective

    International Nuclear Information System (INIS)

    Aoki, Hideo

    2006-01-01

    Novel concepts and phenomena are emerging recently in the physics of quantum Hall effect. This article gives an overview, which starts from the fractional quantum Hall system viewed as an extremely strongly correlated system, and move on to present various phenomena involving internal degrees of freedom (spin and layer), non-equilibrium and optical properties, and finally the spinoff to anomalous Hall effect and the rotating Bose-Einstein condensate. (author)

  1. Pedro Calderón de la Barca, Judas Macabeo. Edición crítica de las dos versiones, ed. F. Rodríguez-Gallego

    Directory of Open Access Journals (Sweden)

    Fernando Plata

    2013-10-01

    Full Text Available Review of Pedro Calderón de la Barca, Judas Macabeo. Edición crítica de las dos versiones, ed. F. Rodríguez-Gallego, Universidad de Navarra / Iberoamericana / Vervuert (Biblioteca Áurea Hispánica, 80; Comedias Completas de Calderón, 8, Madrid / Frankfurt, 2012, 501 pp. ISBN: 978-84-8489-692-0.

  2. Magnesium Hall Thruster

    Science.gov (United States)

    Szabo, James J.

    2015-01-01

    This Phase II project is developing a magnesium (Mg) Hall effect thruster system that would open the door for in situ resource utilization (ISRU)-based solar system exploration. Magnesium is light and easy to ionize. For a Mars- Earth transfer, the propellant mass savings with respect to a xenon Hall effect thruster (HET) system are enormous. Magnesium also can be combusted in a rocket with carbon dioxide (CO2) or water (H2O), enabling a multimode propulsion system with propellant sharing and ISRU. In the near term, CO2 and H2O would be collected in situ on Mars or the moon. In the far term, Mg itself would be collected from Martian and lunar regolith. In Phase I, an integrated, medium-power (1- to 3-kW) Mg HET system was developed and tested. Controlled, steady operation at constant voltage and power was demonstrated. Preliminary measurements indicate a specific impulse (Isp) greater than 4,000 s was achieved at a discharge potential of 400 V. The feasibility of delivering fluidized Mg powder to a medium- or high-power thruster also was demonstrated. Phase II of the project evaluated the performance of an integrated, highpower Mg Hall thruster system in a relevant space environment. Researchers improved the medium power thruster system and characterized it in detail. Researchers also designed and built a high-power (8- to 20-kW) Mg HET. A fluidized powder feed system supporting the high-power thruster was built and delivered to Busek Company, Inc.

  3. Spin Hall effect transistor

    Czech Academy of Sciences Publication Activity Database

    Wunderlich, Joerg; Park, B.G.; Irvine, A.C.; Zarbo, Liviu; Rozkotová, E.; Němec, P.; Novák, Vít; Sinova, Jairo; Jungwirth, Tomáš

    2010-01-01

    Roč. 330, č. 6012 (2010), s. 1801-1804 ISSN 0036-8075 R&D Projects: GA AV ČR KAN400100652; GA MŠk LC510 EU Projects: European Commission(XE) 215368 - SemiSpinNet Grant - others:AV ČR(CZ) AP0801 Program:Akademická prémie - Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : spin Hall effect * spintronics * spin transistor Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 31.364, year: 2010

  4. Circular Cationic Compounds B3Rgn+ of Triangular Ion B3 Trapping Rare Gases

    Institute of Scientific and Technical Information of China (English)

    ZHANG Ruiwen; LI Anyong; LI Zhuozhe

    2017-01-01

    The circular cationic compounds B3Rgn+(n=1-3,Rg=He-Rn) formed by the electron-deficient aromatic ion B3+ trapping rare gases were studied theoretically.The formed B-Rg bond has large bonding energy in the range of 60--209 kJ/mol,its length is close to the stun of covalent radii of B and Rg,for Ar-Rn.The analyses based on the natural bond orbitals and electron density topology show that the B-Rg bonds for Ar-Rn have strong covalent character.The geometric structures,binding energy,bond nature and thermodynamic stability of the boron-rare gas compounds show that these species for Ar-Rn may be experimentally available.Several different theoretical studies have demonstrated that these triangular cations are aromatic.

  5. Quantum Hall Electron Nematics

    Science.gov (United States)

    MacDonald, Allan

    In 2D electron systems hosted by crystals with hexagonal symmetry, electron nematic phases with spontaneously broken C3 symmetry are expected to occur in the quantum Hall regime when triplets of Landau levels associated with three different Fermi surface pockets are partially filled. The broken symmetry state is driven by intravalley Coulombic exchange interactions that favor spontaneously polarized valley occupations. I will discuss three different examples of 2D electron systems in which this type of broken symmetry state is expected to occur: i) the SnTe (111) surface, ii) the Bi (111) surface. and iii) unbalanced bilayer graphene. This type of quantum Hall electron nematic state has so far been confirmed only in the Bi (111) case, in which the anisotropic quasiparticle wavefunctions of the broken symmetry state were directly imaged. In the SnTe case the nematic state phase boundary is controlled by a competition between intravalley Coulomb interactions and intervalley scattering processes that increase in relative strength with magnetic field. An in-plane Zeeman field alters the phase diagram by lifting the three-fold Landau level degeneracy, yielding a ground state energy with 2 π/3 periodicity as a function of Zeeman-field orientation angle. I will comment on the possibility of observing similar states in the absence of a magnetic field. Supported by DOE Division of Materials Sciences and Engineering Grant DE-FG03-02ER45958.

  6. The ISOLDE hall

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    Since 1992, after its move from the 600 MeV SC, ISOLDE is a customer of the Booster (then 1 GeV, now 1.4 GeV). The intense Booster beam (some 3E13 protons per pulse) is directed onto a target, from which a mixture of isotopes emanates. After ionization and electrostatic acceleration to 60 keV, they enter one of the 2 spectrometers (General Purpose Separator: GPS, and High Resolution Separator: HRS) from which the selected ions are directed to the experiments. The photos show: the REX-ISOLDE post accelerator; the mini-ball experiment; an overview of the ISOLDE hall. In the picture (_12) of the hall, the separators are behind the wall. From either of them, beams can be directed into any of the many beamlines towards the experiments, some of which are visible in the foreground. The elevated cubicle at the left is EBIS (Electron Beam Ion Source), which acts as a charge-state multiplier for the REX facility. The ions are further mass analzyzed and passed on to the linac which accelerates them to higher energies. T...

  7. G. Güntert, La comedia de Calderón: discurso social y sabiduría poética

    OpenAIRE

    Sáez, Adrián J.

    2013-01-01

    À partir de la premisa de que todo el universo tiene cabida en el arte dramático de Calderón, Georges Güntert se adentra por sus caminos para conocer qué mundo aparece realmente en su teatro. En el prólogo, sitúa a Calderón dentro de una concepción cosmológica enlazada con la teología cristiana, con una estética notablemente influida por el neoplatonismo. Pero, como hombre de teatro, se alejaba de la teoría para trasladar a las tablas «los conceptos abstractos que se debatían en los tratados»...

  8. How many versions does an autograph offer? The authorial interventions in the autograph of Calderón’s «El secreto a voces»

    Directory of Open Access Journals (Sweden)

    Simon Kroll

    2014-11-01

    Full Text Available Pedro Calderón de la Barca never ceases to work. His constant in­terest to improve or adapt his texts has produced two versions of the same play in several occasions. His autographs allow us to examine his writing process as well as the theatrical practice in Golden Age Spain. In the autograph of «El secreto a voces», Calderón himself seems to delete up to 200 verses, nevertheless it also presents interventions by other hands. In this article, I will therefore try to distinguish between the authentic and non-authentic interventions in the autograph of «El secreto a voces».

  9. Energy consumption of sport halls

    Energy Technology Data Exchange (ETDEWEB)

    1983-01-01

    The energy consumption of Finland's sports halls (ball games halls, ice hockey halls and swimming halls) represent approximately 1% of that of the country's whole building stock. In the light of the facts revealed by the energy study the potential energy saving rate in sports halls is 15-25%. The total savings would be something like FIM 30-40 million per annum, of which about a half would be achieved without energy-economic investments only by changing utilization habits and by automatic control measures. The energy-economic investments are for the most part connected with ventilation and their repayment period is from one to five years. On the basis of the energy study the following specific consumption are presented as target values: swimming halls: heat (kWh/m*H3/a)100, electricity (kWh/m*H3/a)35, water (l/m*H3/a)1000 icehockey halls (warm): heat (kWh/m*H3/a)25, electricity (kWh/m*H3/a)15, water (l/m*H3/a)200, ball games halls (multi-purpose halls): heat (kWh/m*H3/a)30, electricity (kWh/m*H3/a)25, water (l/m*H3/a)130. In the study the following points proved to be the central areas of energy saving in sports halls: 1. Flexible regulation of the temperature in sports spaces on the basis of the sport in question. 2. The ventilation of swimming halls should be adjusted in such a way that the humidity of the hall air would comply with the limit humidity curve determined by the quality of structures and the temperature of the outdoor air. 3. An ice skating hall is an establishment producing condensing energy from 8 to 9 months a year worth of approx. 100.000-150.000 Finnmarks. The development of the recovery of condensing energy has become more important. 4. The ventilation of ball games halls may account for over 50% of the energy consumption of the whole building. Therefore special attention should be paid to the optimatization of ventilation as a whole.

  10. Descripción y análisis de capas superpuestas en El castillo de Lindabridis de Calderón

    OpenAIRE

    Escudero Baztán, Juan Manuel

    2015-01-01

    This paper describes and analyzes the highlights of a play El castillo de Lindabridis of Calderón de la Barca: topics relating to the date of his writing and his performances in the seventeenth century, the management of chivalric sources, the unitary structure, the use of emblematic material through the medieval bestiaries, musical interludes, and the staging and the repetition of themes and motifs, along with some final considerations about gender. All these factors indicate the particular ...

  11. Scanning vector Hall probe microscopy

    International Nuclear Information System (INIS)

    Cambel, V.; Gregusova, D.; Fedor, J.; Kudela, R.; Bending, S.J.

    2004-01-01

    We have developed a scanning vector Hall probe microscope for mapping magnetic field vector over magnetic samples. The microscope is based on a micromachined Hall sensor and the cryostat with scanning system. The vector Hall sensor active area is ∼5x5 μm 2 . It is realized by patterning three Hall probes on the tilted faces of GaAs pyramids. Data from these 'tilted' Hall probes are used to reconstruct the full magnetic field vector. The scanning area of the microscope is 5x5 mm 2 , space resolution 2.5 μm, field resolution ∼1 μT Hz -1/2 at temperatures 10-300 K

  12. 45 CFR 73b.3 - Reports of violations.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Reports of violations. 73b.3 Section 73b.3 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION DEBARMENT OR SUSPENSION OF FORMER EMPLOYEES § 73b.3 Reports of violations. (a) If an officer or employee of the Department has reason to...

  13. On Hall current fluid

    International Nuclear Information System (INIS)

    Shen, M.C.; Ebel, D.

    1987-01-01

    In this paper some new results concerning magnetohydrodynamic (MHD) equations with the Hall current (HC) term in the Ohm's law are presented. For the cylindrical pinch of a compressible HC fluid, it is found that for large time and long wave length the solution to the governing equations exhibits the behavior of solitons as in the case of an ideal MHD model. In some special cases, the HC model appears to be better posed. An open question is whether a simple toroidal equilibrium of an HC fluid with resistivity and viscosity exists. The answer to this question is affirmative if the prescribed velocity on the boundary has a small norm. Furthermore, the equilibrium is also linearly and nonlinearly stable

  14. Farm Hall: The Play

    Science.gov (United States)

    Cassidy, David C.

    2013-03-01

    It's July 1945. Germany is in defeat and the atomic bombs are on their way to Japan. Under the direction of Samuel Goudsmit, the Allies are holding some of the top German nuclear scientists-among them Heisenberg, Hahn, and Gerlach-captive in Farm Hall, an English country manor near Cambridge, England. As secret microphones record their conversations, the scientists are unaware of why they are being held or for how long. Thinking themselves far ahead of the Allies, how will they react to the news of the atomic bombs? How will these famous scientists explain to themselves and to the world their failure to achieve even a chain reaction? How will they come to terms with the horror of the Third Reich, their work for such a regime, and their behavior during that period? This one-act play is based upon the transcripts of their conversations as well as the author's historical work on the subject.

  15. Quantum Hall effect

    International Nuclear Information System (INIS)

    Joynt, R.J.

    1982-01-01

    A general investigation of the electronic structure of two dimensional systems is undertaken with a view towards understanding the quantum Hall effect. The work is limited to the case of a strong perpendicular magnetic field, with a disordered potential and an externally applied electric field. The electrons are treated as noninteracting. First, the scattering theory of the system is worked out. The surprising result is found that a wavepacket will reform after scattering from an isolated potential. Also it will tend to be accelerated in the neighborhood of the scatterer if the potential has bound states. Fredholm theory can then be used to show that the extended states carry an additional current which compensates for the zero current of the bound states. Together, these give the quantized conductance. The complementary case of a smooth random potential is treated by a path-integral approach which exploits the analogies to the classical equations of motion. The Green's function can be calculated approximately, which gives the general character of both the bound and extended states. Also the ratio of these two types of states can be computed for a given potential. The charge density is uniform in first approximation, and the Hall conductance is quantized. Higher-order corrections for more rapidly fluctuating potential are calculated. The most general conditions under which the conductance is quantized are discussed. Because of the peculiar scattering properties of the system, numerical solution of the Schroedinger equation is of interest, both to confirm the analytical results, and for pedagogical reasons. The stability and convergence problems inherent in the computer solution of the problem are analyzed. Results for some model scattering potentials are presented

  16. Stability of the Hall sensors performance under neutron irradiation

    International Nuclear Information System (INIS)

    Duran, I.; Hron, M.; Stockel, J.; Viererbl, L.; Vsolak, R.; Cerva, V.; Bolshakova, I.; Holyaka, R.; Vayakis, G.

    2004-01-01

    A principally new diagnostic method must be developed for magnetic measurements in steady state regime of operation of fusion reactor. One of the options is the use of transducers based on Hall effect. The use of Hall sensors in ITER is presently limited by their questionable radiation and thermal stability. Issues of reliable operation in ITER like radiation and thermal environment are addressed in the paper. The results of irradiation tests of candidate Hall sensors in LVR-15 and IBR-2 experimental fission reactors are presented. Stable operation (deterioration of sensitivity below one percent) of the specially prepared sensors was demonstrated during irradiation by the total fluence of 3.10 16 n/cm 2 in IBR-2 reactor. Increasing the total neutron fluence up to 3.10 17 n/cm 2 resulted in deterioration of the best sensor's output still below 10% as demonstrated during irradiation in LVR-15 fission reactor. This level of neutron is already higher than the expected ITER life time neutron fluence for a sensor location just outside the ITER vessel. (authors)

  17. Hall Effect Gyrators and Circulators

    Science.gov (United States)

    Viola, Giovanni; DiVincenzo, David P.

    2014-04-01

    The electronic circulator and its close relative the gyrator are invaluable tools for noise management and signal routing in the current generation of low-temperature microwave systems for the implementation of new quantum technologies. The current implementation of these devices using the Faraday effect is satisfactory but requires a bulky structure whose physical dimension is close to the microwave wavelength employed. The Hall effect is an alternative nonreciprocal effect that can also be used to produce desired device functionality. We review earlier efforts to use an Ohmically contacted four-terminal Hall bar, explaining why this approach leads to unacceptably high device loss. We find that capacitive coupling to such a Hall conductor has much greater promise for achieving good circulator and gyrator functionality. We formulate a classical Ohm-Hall analysis for calculating the properties of such a device, and show how this classical theory simplifies remarkably in the limiting case of the Hall angle approaching 90°. In this limit, we find that either a four-terminal or a three-terminal capacitive device can give excellent circulator behavior, with device dimensions far smaller than the ac wavelength. An experiment is proposed to achieve GHz-band gyration in millimeter (and smaller) scale structures employing either semiconductor heterostructure or graphene Hall conductors. An inductively coupled scheme for realizing a Hall gyrator is also analyzed.

  18. Topological Hall and spin Hall effects in disordered skyrmionic textures

    KAUST Repository

    Ndiaye, Papa Birame; Akosa, Collins Ashu; Manchon, Aurelien

    2017-01-01

    We carry out a thorough study of the topological Hall and topological spin Hall effects in disordered skyrmionic systems: the dimensionless (spin) Hall angles are evaluated across the energy-band structure in the multiprobe Landauer-Büttiker formalism and their link to the effective magnetic field emerging from the real-space topology of the spin texture is highlighted. We discuss these results for an optimal skyrmion size and for various sizes of the sample and find that the adiabatic approximation still holds for large skyrmions as well as for nanoskyrmions. Finally, we test the robustness of the topological signals against disorder strength and show that the topological Hall effect is highly sensitive to momentum scattering.

  19. Topological Hall and spin Hall effects in disordered skyrmionic textures

    KAUST Repository

    Ndiaye, Papa Birame

    2017-02-24

    We carry out a thorough study of the topological Hall and topological spin Hall effects in disordered skyrmionic systems: the dimensionless (spin) Hall angles are evaluated across the energy-band structure in the multiprobe Landauer-Büttiker formalism and their link to the effective magnetic field emerging from the real-space topology of the spin texture is highlighted. We discuss these results for an optimal skyrmion size and for various sizes of the sample and find that the adiabatic approximation still holds for large skyrmions as well as for nanoskyrmions. Finally, we test the robustness of the topological signals against disorder strength and show that the topological Hall effect is highly sensitive to momentum scattering.

  20. Tuning giant anomalous Hall resistance ratio in perpendicular Hall balance

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, J. Y.; Yang, G. [Department of Materials Physics and Chemistry, University of Science and Technology Beijing, Beijing 100083 (China); State Key Laboratory of Magnetism, Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Wang, S. G., E-mail: sgwang@iphy.ac.cn, E-mail: ghyu@mater.ustb.edu.cn [State Key Laboratory of Magnetism, Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Liu, J. L. [State Key Laboratory of Magnetism, Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Department of Physics, Beijing University of Aeronautics and Astronautics, Beijing 100191 (China); Wang, R. M. [Department of Physics, Beijing University of Aeronautics and Astronautics, Beijing 100191 (China); Amsellem, E.; Kohn, A. [Department of Materials Engineering, Ilse Katz Institute for Nanoscale Science and Technology, Ben-Gurion University of the Negev, Beer-Sheva 84105 (Israel); Yu, G. H., E-mail: sgwang@iphy.ac.cn, E-mail: ghyu@mater.ustb.edu.cn [Department of Materials Physics and Chemistry, University of Science and Technology Beijing, Beijing 100083 (China)

    2015-04-13

    Anomalous Hall effect at room temperature in perpendicular Hall balance with a core structure of [Pt/Co]{sub 4}/NiO/[Co/Pt]{sub 4} has been tuned by functional CoO layers, where [Pt/Co]{sub 4} multilayers exhibit perpendicular magnetic anisotropy. A giant Hall resistance ratio up to 69 900% and saturation Hall resistance (R{sub S}{sup P}) up to 2590 mΩ were obtained in CoO/[Pt/Co]{sub 4}/NiO/[Co/Pt]{sub 4}/CoO system, which is 302% and 146% larger than that in the structure without CoO layers, respectively. Transmission electron microscopy shows highly textured [Co/Pt]{sub 4} multilayers and oxide layers with local epitaxial relations, indicating that the crystallographic structure has significant influence on spin dependent transport properties.

  1. Anomalous Hall effect

    Science.gov (United States)

    Nagaosa, Naoto; Sinova, Jairo; Onoda, Shigeki; MacDonald, A. H.; Ong, N. P.

    2010-04-01

    The anomalous Hall effect (AHE) occurs in solids with broken time-reversal symmetry, typically in a ferromagnetic phase, as a consequence of spin-orbit coupling. Experimental and theoretical studies of the AHE are reviewed, focusing on recent developments that have provided a more complete framework for understanding this subtle phenomenon and have, in many instances, replaced controversy by clarity. Synergy between experimental and theoretical works, both playing a crucial role, has been at the heart of these advances. On the theoretical front, the adoption of the Berry-phase concepts has established a link between the AHE and the topological nature of the Hall currents. On the experimental front, new experimental studies of the AHE in transition metals, transition-metal oxides, spinels, pyrochlores, and metallic dilute magnetic semiconductors have established systematic trends. These two developments, in concert with first-principles electronic structure calculations, strongly favor the dominance of an intrinsic Berry-phase-related AHE mechanism in metallic ferromagnets with moderate conductivity. The intrinsic AHE can be expressed in terms of the Berry-phase curvatures and it is therefore an intrinsic quantum-mechanical property of a perfect crystal. An extrinsic mechanism, skew scattering from disorder, tends to dominate the AHE in highly conductive ferromagnets. The full modern semiclassical treatment of the AHE is reviewed which incorporates an anomalous contribution to wave-packet group velocity due to momentum-space Berry curvatures and correctly combines the roles of intrinsic and extrinsic (skew-scattering and side-jump) scattering-related mechanisms. In addition, more rigorous quantum-mechanical treatments based on the Kubo and Keldysh formalisms are reviewed, taking into account multiband effects, and demonstrate the equivalence of all three linear response theories in the metallic regime. Building on results from recent experiment and theory, a

  2. Iniciativa de decreto sobre la propuesta de reforma política del presidente Felipe Calderón

    Directory of Open Access Journals (Sweden)

    Adrián Joaquín Miranda Camarena

    2010-01-01

    Full Text Available El presidente Felipe Calderón presenta un paquete de iniciativas, entre las que se encuentra la reforma política que tiene como fin dar más poder al ciudadano y fortalecer la democracia. Además, alienta al ciudadano para que participe y perciba que sus órganos de representación estén más atentos a sus demandas y necesidades. La iniciativa apunta a transformar los rasgos estructurales del régimen político autoritario en el ámbito del ejercicio del poder, no limitándose a lo electoral, por lo que además se pretende salir del estancamiento político y cambiar la dinámica viciosa de la representación legislativa y el conflicto frecuente entre Ejecutivo y Congreso. Por lo que consideró era urgente plantear una serie de cambios, a fin de que nuestro sistema político provenga del sufragio efectivo y pase a una democracia efectiva.

  3. A comparison of the predicted and observed reaction rates of various neutron detectors in a thermal reactor spectrum

    International Nuclear Information System (INIS)

    Hardiman, J.P.; Maunders, E.J.

    1963-08-01

    A number of the detectors commonly used in integral neutron spectrum measurements have been irradiated in the pitch moderator position of a Calder Hall lattice where the detailed energy spectrum is known from time of flight measurements. Predicted and observed reaction rates are generally in good agreement although they are brought into better agreement by a small modification to the spectrum. The predicted cadmium ratios are quite sensitive to the value adopted for the effective cadmium cut off energy, values of which were determined for various detectors using the Ferranti Mercury computer. The values varied over a wide range, although in every case only 40 mil. cadmium filters were used. (author)

  4. Planar Hall effect bridge magnetic field sensors

    DEFF Research Database (Denmark)

    Henriksen, A.D.; Dalslet, Bjarke Thomas; Skieller, D.H.

    2010-01-01

    Until now, the planar Hall effect has been studied in samples with cross-shaped Hall geometry. We demonstrate theoretically and experimentally that the planar Hall effect can be observed for an exchange-biased ferromagnetic material in a Wheatstone bridge topology and that the sensor signal can...... Hall effect bridge sensors....

  5. Gauge invariance and fractional quantized Hall effect

    International Nuclear Information System (INIS)

    Tao, R.; Wu, Y.S.

    1984-01-01

    It is shown that gauge invariance arguments imply the possibility of fractional quantized Hall effect; the Hall conductance is accurately quantized to a rational value. The ground state of a system showing the fractional quantized Hall effect must be degenerate; the non-degenerate ground state can only produce the integral quantized Hall effect. 12 references

  6. "Hall mees" Linnateatris / Triin Sinissaar

    Index Scriptorium Estoniae

    Sinissaar, Triin

    1999-01-01

    Tallinn Linnateatri ja Raadioteatri ühislavastus "Hall mees" Gill Adamsi näidendi järgi, lavastaja Eero Spriit, osades Helene Vannari ja Väino Laes, kunstnik Kustav - Agu Püüman. Esietendus 22. okt

  7. Sheldon-Hall syndrome

    Directory of Open Access Journals (Sweden)

    Bamshad Michael J

    2009-03-01

    Full Text Available Abstract Sheldon-Hall syndrome (SHS is a rare multiple congenital contracture syndrome characterized by contractures of the distal joints of the limbs, triangular face, downslanting palpebral fissures, small mouth, and high arched palate. Epidemiological data for the prevalence of SHS are not available, but less than 100 cases have been reported in the literature. Other common clinical features of SHS include prominent nasolabial folds, high arched palate, attached earlobes, mild cervical webbing, short stature, severe camptodactyly, ulnar deviation, and vertical talus and/or talipes equinovarus. Typically, the contractures are most severe at birth and non-progressive. SHS is inherited in an autosomal dominant pattern but about half the cases are sporadic. Mutations in either MYH3, TNNI2, or TNNT3 have been found in about 50% of cases. These genes encode proteins of the contractile apparatus of fast twitch skeletal muscle fibers. The diagnosis of SHS is based on clinical criteria. Mutation analysis is useful to distinguish SHS from arthrogryposis syndromes with similar features (e.g. distal arthrogryposis 1 and Freeman-Sheldon syndrome. Prenatal diagnosis by ultrasonography is feasible at 18–24 weeks of gestation. If the family history is positive and the mutation is known in the family, prenatal molecular genetic diagnosis is possible. There is no specific therapy for SHS. However, patients benefit from early intervention with occupational and physical therapy, serial casting, and/or surgery. Life expectancy and cognitive abilities are normal.

  8. Irradiation tests of ITER candidate Hall sensors using two types of neutron spectra

    International Nuclear Information System (INIS)

    Duran, I.; Bolshakova, I.; Holyaka, R.; Viererbl, L.; Lahodova, Z.; Sentkerestiova, J.; Bem, P.

    2010-01-01

    We report on irradiation tests of InSb based Hall sensors at two irradiation facilities with two distinct types of neutron spectra. One was a fission reactor neutron spectrum with a significant presence of thermal neutrons, while another one was purely fast neutron field. Total neutron fluence of the order of 10 16 cm -2 was accumulated in both cases, leading to significant drop of Hall sensor sensitivity in case of fission reactor spectrum, while stable performance was observed at purely fast neutron spectrum. This finding suggests that performance of this particular type of Hall sensors is governed dominantly by transmutation. Additionally, it further stresses the need to test ITER candidate Hall sensors under neutron flux with ITER relevant spectrum.

  9. Anode sheath in Hall thrusters

    International Nuclear Information System (INIS)

    Dorf, L.; Semenov, V.; Raitses, Y.

    2003-01-01

    A set of hydrodynamic equations is used to describe quasineutral plasma in ionization and acceleration regions of a Hall thruster. The electron distribution function and Poisson equation are invoked for description of a near-anode region. Numerical solutions suggest that steady-state operation of a Hall thruster can be achieved at different anode sheath regimes. It is shown that the anode sheath depends on the thruster operating conditions, namely the discharge voltage and the mass flow rate

  10. Theory of spin Hall effect

    OpenAIRE

    Chudnovsky, Eugene M.

    2007-01-01

    An extension of Drude model is proposed that accounts for spin and spin-orbit interaction of charge carriers. Spin currents appear due to combined action of the external electric field, crystal field and scattering of charge carriers. The expression for spin Hall conductivity is derived for metals and semiconductors that is independent of the scattering mechanism. In cubic metals, spin Hall conductivity $\\sigma_s$ and charge conductivity $\\sigma_c$ are related through $\\sigma_s = [2 \\pi \\hbar...

  11. Optimization of Cylindrical Hall Thrusters

    International Nuclear Information System (INIS)

    Raitses, Yevgeny; Smirnov, Artem; Granstedt, Erik; Fisch, Nathaniel J.

    2007-01-01

    The cylindrical Hall thruster features high ionization efficiency, quiet operation, and ion acceleration in a large volume-to-surface ratio channel with performance comparable with the state-of-the-art annular Hall thrusters. These characteristics were demonstrated in low and medium power ranges. Optimization of miniaturized cylindrical thrusters led to performance improvements in the 50-200W input power range, including plume narrowing, increased thruster efficiency, reliable discharge initiation, and stable operation.

  12. Optimization of Cylindrical Hall Thrusters

    International Nuclear Information System (INIS)

    Raitses, Yevgeny; Smirnov, Artem; Granstedt, Erik; Fi, Nathaniel J.

    2007-01-01

    The cylindrical Hall thruster features high ionization efficiency, quiet operation, and ion acceleration in a large volume-to-surface ratio channel with performance comparable with the state-of-the-art annular Hall thrusters. These characteristics were demonstrated in low and medium power ranges. Optimization of miniaturized cylindrical thrusters led to performance improvements in the 50-200W input power range, including plume narrowing, increased thruster efficiency, reliable discharge initiation, and stable operation

  13. Misexpression of cyclin B3 leads to aberrant spermatogenesis.

    Science.gov (United States)

    Refik-Rogers, Jale; Manova, Katia; Koff, Andrew

    2006-09-01

    Mus musculus cyclin B3 is an early meiotic cyclin that is expressed in leptotene and zygotene phases during gametogenesis. In order to determine whether downregulation of cyclin B3 at zygotene-pachytene transition was important for normal spermatogenesis, we investigated the consequences of expressing H. sapiens cyclin B3 after zygotene in mouse testes. Prolonging expression of cyclin B3 until the end of meiosis led to a reduction in sperm counts and disruption of spermatogenesis in four independent lines of transgenic mice. There were three distinct morphological defects associated with the ectopic expression of cyclin B3. Seminiferous tubules were either depleted of germ cells, had an abnormal cell mass in the lumen, or were characterized by the presence of abnormal round spermatids. These defects were associated with increased apoptosis in the testes. These results suggest that downregulation of cyclin B3 at the zygotene-pachytene transition is required to ensure normal spermatogenesis.

  14. Not your grandfather's concert hall

    Science.gov (United States)

    Cooper, Russell; Malenka, Richard; Griffith, Charles; Friedlander, Steven

    2004-05-01

    The opening of Judy and Arthur Zankel Hall on 12 September 2003, restores Andrew Carnegie's original 1891 concept of having three outstanding auditoriums of different sizes under one roof, and creates a 21st-century venue for music performance and education. With concerts ranging from early music to avant-garde multimedia productions, from jazz to world music, and from solo recitals to chamber music, Zankel Hall expands the breadth and depth of Carnegie Hall's offerings. It allows for the integration of programming across three halls with minifestivals tailored both to the size and strengths of each hall and to the artists and music to be performed. The new flexible space also provides Carnegie Hall with an education center equipped with advanced communications technology. This paper discusses the unique program planned for this facility and how the architects, theatre consultants, and acousticians developed a design that fulfilled the client's expectations and coordinated the construction of the facility under the floor of the main Isaac Stern Auditorium without having to cancel a single performance.

  15. Public relations activities of the Service Hall for Kashiwazaki-Kariwa Nuclear Power Station

    International Nuclear Information System (INIS)

    Kono, T.

    1998-01-01

    This article includes information of the Service Hall for Kashiwazaki-Kariwa Nuclear Power Station. About 30% of the total electricity production in Japan is due to 16 power stations and 52 reactors. The service hall is a kind of atomic power pavilion for public relations. In Japan, each nuclear power station has such a pavilion, which acts a a center of public relations activities for the atomic power. (S. Grainger)

  16. Preservation of the first research nuclear reactor in Korea

    International Nuclear Information System (INIS)

    2008-06-01

    This book describes preservation of the first research nuclear reactor in Korea and necessity of building memorial hall, sale of the Institute of Atomic Energy Research in Seoul and dismantlement of the first and the second nuclear reactor, preservation of the first research nuclear reactor and activity about memorial hall of the atomic energy reactor, assignment and leaving the report, and the list of related data.

  17. Iodine Hall Thruster

    Science.gov (United States)

    Szabo, James

    2015-01-01

    Iodine enables dramatic mass and cost savings for lunar and Mars cargo missions, including Earth escape and near-Earth space maneuvers. The demonstrated throttling ability of iodine is important for a singular thruster that might be called upon to propel a spacecraft from Earth to Mars or Venus. The ability to throttle efficiently is even more important for missions beyond Mars. In the Phase I project, Busek Company, Inc., tested an existing Hall thruster, the BHT-8000, on iodine propellant. The thruster was fed by a high-flow iodine feed system and supported by an existing Busek hollow cathode flowing xenon gas. The Phase I propellant feed system was evolved from a previously demonstrated laboratory feed system. Throttling of the thruster between 2 and 11 kW at 200 to 600 V was demonstrated. Testing showed that the efficiency of iodine fueled BHT-8000 is the same as with xenon, with iodine delivering a slightly higher thrust-to-power (T/P) ratio. In Phase II, a complete iodine-fueled system was developed, including the thruster, hollow cathode, and iodine propellant feed system. The nominal power of the Phase II system is 8 kW; however, it can be deeply throttled as well as clustered to much higher power levels. The technology also can be scaled to greater than 100 kW per thruster to support megawatt-class missions. The target thruster efficiency for the full-scale system is 65 percent at high specific impulse (Isp) (approximately 3,000 s) and 60 percent at high thrust (Isp approximately 2,000 s).

  18. 26 CFR 48.4161(b)-3 - Use considered sale.

    Science.gov (United States)

    2010-04-01

    ....4161(b)-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS EXCISE TAXES MANUFACTURERS AND RETAILERS EXCISE TAXES Sporting Goods § 48.4161(b)-3 Use considered sale. For provisions relating to the tax on use of taxable articles by the manufacturer, producer, or...

  19. La identidad nacional y Calderón en la polémica teatral de 1762-1764

    Directory of Open Access Journals (Sweden)

    Bezhanova, Olga

    2004-06-01

    Full Text Available Drawing on contemporary theories about national identity, legitimacy and intellectual authority this article explores identitarian issues at stake during the 1762-1764 controversy on Spanish theater. Re-reading texts by Clavijo y Fajardo (El Pensador, Nicolás Fernández de Moratín (Desengaños al teatro español and other writings, Mariano José Nipho (Diario Estrangero and La nación española defendida and José Romea y Tapia (El escritor sin título we contend that what these authors are debating indeed is not theater but the legitimacy and authority they are claiming for, and ultimately opposing conceptions of national identity. Calderón becoming a cultural icon of such identity. Particularly significant is the role of autos sacramentales in this context. In effect, acrimony and irritation are part of this polemics because orthodox Catholicism is, from a conservative point of view, an essential component of what they consider Spanish national identity. The prohibition of the autos is just a sign of a temporary change in the relationship of forces.A partir de teorías actuales sobre la identidad nacional, la legitimidad y la autoridad intelectual, este artículo explora los puntos clave identitarios que se ponen en juego durante la polémica sobre el teatro español de los años 1762-1764. Mediante una re-lectura de los textos de Clavijo y Fajardo (El Pensador, Nicolás Fernández de Moratín (Desengaños al teatro español y otros escritos, Mariano José Nipho (Diario Estrangero y La nación española defendida y José Romea y Tapia (El escritor sin título, sostenemos que lo que estos autores discuten realmente no es sobre el teatro, sino sobre la legitimidad y autoridad que reclaman, y en último término concepciones enfrentadas sobre la identidad nacional, de la que Calderón parece convertirse en icono cultural. De particular significación es el papel de los autos sacramentales en este contexto. En efecto, la acritud y la irritaci

  20. RB research reactor Safety Report

    International Nuclear Information System (INIS)

    Sotic, O.; Pesic, M.; Vranic, S.

    1979-04-01

    This RB reactor safety report is a revised and improved version of the Safety report written in 1962. It contains descriptions of: reactor building, reactor hall, control room, laboratories, reactor components, reactor control system, heavy water loop, neutron source, safety system, dosimetry system, alarm system, neutron converter, experimental channels. Safety aspects of the reactor operation include analyses of accident causes, errors during operation, measures for preventing uncontrolled activity changes, analysis of the maximum possible accident in case of different core configurations with natural uranium, slightly and highly enriched fuel; influence of possible seismic events

  1. La cueva de Salamanca de Cervantes y El dragoncillo de Calderón: algunos aspectos del teatro barroco español

    Directory of Open Access Journals (Sweden)

    Luigi Contadini

    2010-05-01

    Full Text Available This paper analyses two interludes that share a number of folk motifs in order to highlight Cervantes’ tendency to explore forbidden areas, beyond sacred and social ties, and his inclination to demystify institutions apparently untouchable. At the same time it is underlined how Calderón, despite his inflexible aesthetic and moral principles, manages to represent, by breaking down the essential conflicts of his time, the irresolvable ambivalence between a profound pessimism and a burlesque, playful vision of the world.

  2. Sobre sueños y visiones en el auto de Calderón Los encantos de la culpa (1645)

    OpenAIRE

    Gilbert , Françoise

    2005-01-01

    International audience; El auto de Calderón Los encantos de la culpa (1645) alegoriza el conocido episodio de la llegada de Ulises y sus compañeros a la isla de Circe, la transformación de los marineros en animales por la maga y su rescate por el astuto héroe. En la transposición calderoniana, el Hombre, acompañado de sus cinco Sentidos y de su Entendimiento, se enfrenta con la Culpa y sus seducciones, vencidas gracias a la ayuda del cielo y la intervención de Penitencia. La adecuación entre ...

  3. High-order Div- and Quasi Curl-Conforming Basis Functions for Calderón Multiplicative Preconditioning of the EFIE

    KAUST Repository

    Valdes, Felipe; Andriulli, Francesco P.; Cools, Kristof; Michielssen, Eric

    2011-01-01

    A new high-order Calderón multiplicative preconditioner (HO-CMP) for the electric field integral equation (EFIE) is presented. In contrast to previous CMPs, the proposed preconditioner allows for high-order surface representations and current expansions by using a novel set of high-order quasi curl-conforming basis functions. Like its predecessors, the HO-CMP can be seamlessly integrated into existing EFIE codes. Numerical results demonstrate that the linear systems of equations obtained using the proposed HO-CMP converge rapidly, regardless of the mesh density and of the order of the current expansion. © 2006 IEEE.

  4. High-order Div- and Quasi Curl-Conforming Basis Functions for Calderón Multiplicative Preconditioning of the EFIE

    KAUST Repository

    Valdes, Felipe

    2011-04-01

    A new high-order Calderón multiplicative preconditioner (HO-CMP) for the electric field integral equation (EFIE) is presented. In contrast to previous CMPs, the proposed preconditioner allows for high-order surface representations and current expansions by using a novel set of high-order quasi curl-conforming basis functions. Like its predecessors, the HO-CMP can be seamlessly integrated into existing EFIE codes. Numerical results demonstrate that the linear systems of equations obtained using the proposed HO-CMP converge rapidly, regardless of the mesh density and of the order of the current expansion. © 2006 IEEE.

  5. ac spin-Hall effect

    International Nuclear Information System (INIS)

    Entin-Wohlman, O.

    2005-01-01

    Full Text:The spin-Hall effect is described. The Rashba and Dresselhaus spin-orbit interactions are both shown to yield the low temperature spin-Hall effect for strongly localized electrons coupled to phonons. A frequency-dependent electric field E(ω) generates a spin-polarization current, normal to E, due to interference of hopping paths. At zero temperature the corresponding spin-Hall conductivity is real and is proportional to ω 2 . At non-zero temperatures the coupling to the phonons yields an imaginary term proportional to ω. The interference also yields persistent spin currents at thermal equilibrium, at E = 0. The contributions from the Dresselhaus and Rashba interactions to the interference oppose each other

  6. Rare bile duct anomaly: B3 duct draining to gallbladder

    Directory of Open Access Journals (Sweden)

    Seung Eun Lee

    2016-01-01

    Full Text Available A 10-year-old girl presented with recurrent right upper abdominal pain and dyspepsia. Magnetic resonance cholangiopancreatography revealed a dilated common channel of intrahepatic bile duct of segment 3 (B3 and segment 4 (B4 drained into the gallbladder directly. The patient underwent laparoscopic cholecystectomy and Roux-en Y hepaticojejunostomy (B3-jejunostomy. Among the anatomical variability of the biliary system, the cholecystohepatic ducts are controversial in existence and incidence. We report a very rare variant of a cholecystohepatic duct in which the B3 duct drained into gallbladder directly and to the best of our knowledge this is the first report.

  7. Descripción y análisis de capas superpuestas en El castillo de Lindabridis de Calderón

    Directory of Open Access Journals (Sweden)

    Escudero Baztán, Juan Manuel

    2015-06-01

    Full Text Available This paper describes and analyzes the highlights of a play El castillo de Lindabridis of Calderón de la Barca: topics relating to the date of his writing and his performances in the seventeenth century, the management of chivalric sources, the unitary structure, the use of emblematic material through the medieval bestiaries, musical interludes, and the staging and the repetition of themes and motifs, along with some final considerations about gender. All these factors indicate the particular importance of this comedy of Calderón.Este trabajo describe y analiza los puntos más relevantes de una obra caballeresca calderoniana poco conocida como El castillo de Lindabridis: cuestiones relativas a la fecha de su escritura y sus representaciones en el siglo XVII, al manejo de las fuentes caballerescas, a la estructura unitaria, al uso de la emblemática a través de los bestiarios medievales, a los interludios musicales, a la escenificación y la repetición de temas y motivos, junto a unas consideraciones finales sobre el género. Elementos en su conjunto que indican la particular relevancia de esta comedia de gran espectáculo calderoniana.

  8. ATLAS Assembly Hall Open Day

    CERN Multimedia

    Patrice Loiez

    2004-01-01

    To mark the 50th Anniversary of the founding of CERN, a day of tours, displays and presentations was held in October 2004. The assembly halls for the experiments that were waiting to be installed on the LHC, such as ATLAS shown here, were transformed into display areas and cafés.

  9. Universal intrinsic spin Hall effect

    Czech Academy of Sciences Publication Activity Database

    Sinova, J.; Culcer, D.; Sinitsyn, N. A.; Niu, Q.; Jungwirth, Tomáš; MacDonald, A. H.

    2004-01-01

    Roč. 92, č. 12 (2004), 126603/1-126603/4 ISSN 0031-9007 R&D Projects: GA ČR GA202/02/0912 Institutional research plan: CEZ:AV0Z1010914 Keywords : semiconductor quantum wells * spin-orbit interaction * spin Hall effect Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 7.218, year: 2004

  10. Spin Hall effect for anyons

    International Nuclear Information System (INIS)

    Dhar, S.; Basu, B.; Ghosh, Subir

    2007-01-01

    We explain the intrinsic spin Hall effect from generic anyon dynamics in the presence of external electromagnetic field. The free anyon is represented as a spinning particle with an underlying non-commutative configuration space. The Berry curvature plays a major role in the analysis

  11. The Other Hall Effect: College Board Physics

    Science.gov (United States)

    Sheppard, Keith; Gunning, Amanda M.

    2013-01-01

    Edwin Herbert Hall (1855-1938), discoverer of the Hall effect, was one of the first winners of the AAPT Oersted Medal for his contributions to the teaching of physics. While Hall's role in establishing laboratory work in high schools is widely acknowledged, his position as chair of the physics section of the Committee on College Entrance…

  12. Service hall in Number 1 Fukushima Nuclear Power Station, Tokyo Electric Power Company, Inc

    International Nuclear Information System (INIS)

    Tawara, Shigesuke

    1979-01-01

    There are six BWR type nuclear power plants in the Number 1 Fukushima Nuclear Power Station, Tokyo Electric Power Company, Inc. The service hall of the station is located near the entrance of the station. In the center of this service hall, there is the model of a nuclear reactor of full scale. This mock-up shows the core region in the reactor pressure vessel for the number one plant. The diameter and the thickness of the pressure vessel are about 5 m and 16 cm, respectively. The fuel assemblies and control rods are set just like the actual reactor, and the start-up operation of the reactor is shown colorfully and dynamically by pushing a button. When the control rods are pulled out, the boiling of water is demonstrated. The 1/50 scale model of the sixth plant with the power generating capacity of 1100 MWe is set, and this model is linked to the mock-up of reactor written above. The operations of a recirculating loop, a turbine and a condenser are shown by switching on and off lamps. The other exhibitions are shielding concrete wall, ECCS model, and many kinds of panels and models. This service hall is incorporated in the course of study and observation of civics. The good environmental effects to fishes and shells are explained in this service hall. Official buildings and schools are built near the service hall utilizing the tax and grant concerning power generation. This service hall contributes to give much freedom from anxiety to the public by the tour. (Nakai, Y.)

  13. The Influence Of Switching-Off The Big Lamps On The Humidity Operation Hall

    International Nuclear Information System (INIS)

    Wiranto, Slamet; Sriawan

    2001-01-01

    When there is no activity in the Operation Hall, the big lamps in this are switched off. Due to the water trap of ventilation system is not in good function, the humidity of the Operation Hall increases. In any point of time the humidity rise over the permitted limit value. To avoid this problem it is needed to investigate the characteristic by measuring the humidity of the Operation Hall at various condition and situation. From the characteristic, it can be determined that for normal condition, the Operation Hall big lamps should be switched off, and 2 days before start-up reactor, the all operation building lamps should be switched on for about 5 days as the operation building humidity back to normal value

  14. Electrification Beyond Light Duty: Class 2b-3 Commercial Vehicles

    Energy Technology Data Exchange (ETDEWEB)

    Birky, Alicia [Energetics Incorporated; Laughlin, Michael [Energetics Incorporated; Tartaglia, Katie [Energetics Incorporated; Price, Rebecca [Energetics Incorporated; Lim, Brandon [Energetics Incorporated; Lin, Zhenhong [ORNL

    2018-01-01

    The class 2b-3 truck market covers a wide range of commercial truck applications across a half-million vehicle sales annually. This report collected public information and stakeholder input to assess the opportunity for electrification in this market. Although class 2b-3 pickup truck and van bodies are very similar to personal light vehicles, their functional requirements are quite different due to the demands of the commercial market. These demands vary by application and often vary from day to day for a single application. Fleet customers purchase these vehicles to perform a particular job for their business and are concerned about the overall cost of doing that job. Therefore, the vehicles must meet the job requirements cost effectively. Customers also are sensitive to initial cost. Electrification offers the potential to reduce vehicle operating costs and possibly improve vehicle functionality. However, the current market for class 2b-3 electrified trucks is very small, and the trucks are costly. Increased production volumes are key to cost reductions and may be assisted by sharing components with larger or smaller truck classes. Expanding demand is also crucial and stakeholders identified several niche markets with duty cycles that are likely well-suited to electrified class 2b-3 trucks. To expand beyond these niches, class 2b-3 electric solutions must be robust, flexible, and adaptable in order to cover a wide range of vocations, applications, and duty cycles.

  15. Yield Stress Model for Molten Composition B-3

    Science.gov (United States)

    Davis, Stephen; Zerkle, David

    2017-06-01

    Composition B-3 (Comp B-3) is a melt-castable explosive composed of 60/40 wt% RDX/TNT (hexahydro-1,3,5-trinitro-1,3,5-triazine/2,4,6-trinitrotoluene). During casting operations thermal conditions are controlled which along with the low melting point of TNT and the insensitivity of the mixture to external stimuli leading to safe use. Outside these standard operating conditions a more rigorous model of Comp B-3 rheological properties is necessary to model thermal transport as Comp B-3 evolves from quiescent solid through vaporization/decomposition upon heating. One particular rheological phenomena of interest is Bingham plasticity, where a material behaves as a quiescent solid unless a sufficient load is applied, resulting in fluid flow. In this study falling ball viscometer data is used to model the change in Bingham plastic yield stresses as a function of RDX particle volume fraction; a function of temperature. Results show the yield stress of Comp B-3 (τy) follows the expression τy = B ϕ -ϕc N , where Φ and Φc are the volume fraction of RDX and a critical volume fraction, respectively and B and N are experimentally evaluated constants.

  16. Hall effect in noncommutative coordinates

    International Nuclear Information System (INIS)

    Dayi, Oemer F.; Jellal, Ahmed

    2002-01-01

    We consider electrons in uniform external magnetic and electric fields which move on a plane whose coordinates are noncommuting. Spectrum and eigenfunctions of the related Hamiltonian are obtained. We derive the electric current whose expectation value gives the Hall effect in terms of an effective magnetic field. We present a receipt to find the action which can be utilized in path integrals for noncommuting coordinates. In terms of this action we calculate the related Aharonov-Bohm phase and show that it also yields the same effective magnetic field. When magnetic field is strong enough this phase becomes independent of magnetic field. Measurement of it may give some hints on spatial noncommutativity. The noncommutativity parameter θ can be tuned such that electrons moving in noncommutative coordinates are interpreted as either leading to the fractional quantum Hall effect or composite fermions in the usual coordinates

  17. General vibration monitoring: Experimental hall

    International Nuclear Information System (INIS)

    Jendrzejczyk, J.A.; Wambsganss, M.W.; Smith, R.K.

    1993-01-01

    The reported vibration data were generated from measurements made on the experimental hall floor on December 2, 1992. At the time of the measurements, the ESRF hydrolevel was set-up in the Early Assembly Area (EAA) of the experimental hall and was being used to measure static displacement (settlement) of the floor. The vibration measurement area was on and adjacent to the EAA, in the vicinity of the ESRF hydrolevel test which was in progress. This report summarizes the objectives, instrumentation, measurement locations, observations, and conclusions, and provides selected results in the form of RMS vs. time plots, and power spectral densities from which frequency information can be derived. Measured response amplitudes were within the vibration criteria established for the APS

  18. Scanning vector Hall probe microscope

    Czech Academy of Sciences Publication Activity Database

    Fedor, J.; Cambel, V.; Gregušová, D.; Hanzelka, Pavel; Dérer, J.; Volko, J.

    2003-01-01

    Roč. 74, č. 12 (2003), s. 5105 - 5110 ISSN 0034-6748 Institutional research plan: CEZ:AV0Z2065902 Keywords : VHPM * Hall sensor * Helium cryostat Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.343, year: 2003 http://web. ebscohost .com/ehost/pdf?vid=8&hid=115&sid=a7c0555a-21f4-4932-b1c6-a308ac4dd50b%40sessionmgr2

  19. Effects of hypervitaminosis of vitamin B3 on silkworm biology

    Indian Academy of Sciences (India)

    Unknown

    [Etebari K and Matindoost L 2004 Effects of hypervitaminosis of vitamin B3 on silkworm biology; J. Biosci. 29 417–422]. 1. ... ate growth of larvae and the reproduction in many insects and also mites has been ... were dried in air for 10 min.

  20. L'effet Hall Quantique

    Science.gov (United States)

    Samson, Thomas

    Nous proposons une methode permettant d'obtenir une expression pour la conductivite de Hall de structures electroniques bidimensionnelles et nous examinons celle -ci a la limite d'une temperature nulle dans le but de verifier l'effet Hall quantique. Nous allons nous interesser essentiellement a l'effet Hall quantique entier et aux effets fractionnaires inferieurs a un. Le systeme considere est forme d'un gaz d'electrons en interaction faible avec les impuretes de l'echantillon. Le modele du gaz d'electrons consiste en un gaz bidimensionnel d'electrons sans spin expose perpendiculairement a un champ magnetique uniforme. Ce dernier est decrit par le potentiel vecteur vec{rm A} defini dans la jauge de Dingle ou jauge symetrique. Conformement au formalisme de la seconde quantification, l'hamiltonien de ce gaz est represente dans la base des etats a un-corps de Dingle |n,m> et exprime ainsi en terme des operateurs de creation et d'annihilation correspondants a_sp{ rm n m}{dag} et a _{rm n m}. Nous supposons de plus que les electrons du niveau fondamental de Dingle interagissent entre eux via le potentiel coulombien. La methode utilisee fait appel a une equation mai tresse a N-corps, de nature quantique et statistique, et verifiant le second principe de la thermodynamique. A partir de celle-ci, nous obtenons un systeme d'equations differentielles appele hierarchie d'equations quantique dont la resolution nous permet de determiner une equation a un-corps, dite de Boltzmann quantique, et dictant l'evolution de la moyenne statistique de l'operateur non-diagonal a _sp{rm n m}{dag } a_{rm n}, _{rm m}, sous l'action du champ electrique applique vec{rm E}(t). C'est sa solution Tr(p(t) a _sp{rm n m}{dag} a_{rm n},_ {rm m}), qui definit la relation de convolution entre la densite courant de Hall vec{rm J}_{rm H }(t) et le champ electrique vec {rm E}(t) dont la transformee de Laplace-Fourier du noyau nous fournit l'expression de la conductivite de Hall desiree. Pour une valeur de

  1. Spin Hall effect by surface roughness

    KAUST Repository

    Zhou, Lingjun

    2015-01-08

    The spin Hall and its inverse effects, driven by the spin orbit interaction, provide an interconversion mechanism between spin and charge currents. Since the spin Hall effect generates and manipulates spin current electrically, to achieve a large effect is becoming an important topic in both academia and industries. So far, materials with heavy elements carrying a strong spin orbit interaction, provide the only option. We propose here a new mechanism, using the surface roughness in ultrathin films, to enhance the spin Hall effect without heavy elements. Our analysis based on Cu and Al thin films suggests that surface roughness is capable of driving a spin Hall angle that is comparable to that in bulk Au. We also demonstrate that the spin Hall effect induced by surface roughness subscribes only to the side-jump contribution but not the skew scattering. The paradigm proposed in this paper provides the second, not if only, alternative to generate a sizable spin Hall effect.

  2. Tunneling Anomalous and Spin Hall Effects.

    Science.gov (United States)

    Matos-Abiague, A; Fabian, J

    2015-07-31

    We predict, theoretically, the existence of the anomalous Hall effect when a tunneling current flows through a tunnel junction in which only one of the electrodes is magnetic. The interfacial spin-orbit coupling present in the barrier region induces a spin-dependent momentum filtering in the directions perpendicular to the tunneling current, resulting in a skew tunneling even in the absence of impurities. This produces an anomalous Hall conductance and spin Hall currents in the nonmagnetic electrode when a bias voltage is applied across the tunneling heterojunction. If the barrier is composed of a noncentrosymmetric material, the anomalous Hall conductance and spin Hall currents become anisotropic with respect to both the magnetization and crystallographic directions, allowing us to separate this interfacial phenomenon from the bulk anomalous and spin Hall contributions. The proposed effect should be useful for proving and quantifying the interfacial spin-orbit fields in metallic and metal-semiconductor systems.

  3. RB Research nuclear reactor, Annual report for 2004

    International Nuclear Information System (INIS)

    Dasic, N.; Pesic, M.; Nikolic, D; Jevremovic, M.; Eskirovic, B.

    2005-02-01

    Report on RB reactor operation during 2004 contains 3 parts. Part one contains a brief description of the reactor, reactor operation and operational capabilities, reactor components, relevant dosimetry and radiation protection issues, personnel and financial data. It contains data about reactor operation during previous 8 years. Part two is devoted to maintenance of the reactor components, namely, fuel, heavy water, reactor vessel, heavy water circulation system, absorption rods and heavy water level meters, maintenance of electronic, mechanical, electrical and auxiliary equipment. Part three contains data concerned with reactor operation, Annex 1. contains data about heavy water degradation, and Annex 2 is the certificate about the crane bridge in the reactor hall

  4. Observation of the Zero Hall Plateau in a Quantum Anomalous Hall Insulator

    Energy Technology Data Exchange (ETDEWEB)

    Feng, Yang; Feng, Xiao; Ou, Yunbo; Wang, Jing; Liu, Chang; Zhang, Liguo; Zhao, Dongyang; Jiang, Gaoyuan; Zhang, Shou-Cheng; He, Ke; Ma, Xucun; Xue, Qi-Kun; Wang, Yayu

    2015-09-16

    We report experimental investigations on the quantum phase transition between the two opposite Hall plateaus of a quantum anomalous Hall insulator. We observe a well-defined plateau with zero Hall conductivity over a range of magnetic field around coercivity when the magnetization reverses. The features of the zero Hall plateau are shown to be closely related to that of the quantum anomalous Hall effect, but its temperature evolution exhibits a significant difference from the network model for a conventional quantum Hall plateau transition. We propose that the chiral edge states residing at the magnetic domain boundaries, which are unique to a quantum anomalous Hall insulator, are responsible for the novel features of the zero Hall plateau.

  5. Backfitting of the FRG reactors

    International Nuclear Information System (INIS)

    Krull, W.

    1990-01-01

    The FRG-research reactors The GKSS-research centre is operating two research reactors of the pool type fueled with MTR-type type fuel elements. The research reactors FRG-1 and FRG-2 having power levels of 5 MW and 15 MW are in operation for 31 year and 27 years respectively. They are comparably old like other research reactors. The reactors are operating at present at approximately 180 days (FRG-1) and between 210 and 250 days (FRG-2) per year. Both reactors are located in the same reactor hall in a connecting pool system. Backfitting measures are needed for our and other research reactors to ensure a high level of safety and availability. The main backfitting activities during last ten years were concerned with: comparison of the existing design with today demands (criteria, guidelines, standards etc.); and probability approach for events from outside like aeroplane crashes and earthquakes; the main accidents were rediscussed like startup from low and full power, loss of coolant flow, loss of heat sink, loss of coolant and fuel plate melting; a new reactor protection system had to be installed, following today's demands; a new crane has been installed in the reactor hall. A cold neutron source has been installed to increase the flux of cold neutrons by a factor of 14. The FRG-l is being converted from 93% enriched U with Alx fuel to 20% enriched U with U 3 Si 2 fuel. Both cooling towers were repaired. Replacement of instrumentation is planned

  6. Anomalous Hall effect in polycrystalline Ni films

    KAUST Repository

    Guo, Zaibing

    2012-02-01

    We systematically studied the anomalous Hall effect in a series of polycrystalline Ni films with thickness ranging from 4 to 200 nm. It is found that both the longitudinal and anomalous Hall resistivity increased greatly as film thickness decreased. This enhancement should be related to the surface scattering. In the ultrathin films (46 nm thick), weak localization corrections to anomalous Hall conductivity were studied. The granular model, taking into account the dominated intergranular tunneling, has been employed to explain this phenomenon, which can explain the weak dependence of anomalous Hall resistivity on longitudinal resistivity as well. © 2011 Elsevier Ltd. All rights reserved.

  7. Temperature Gradient in Hall Thrusters

    International Nuclear Information System (INIS)

    Staack, D.; Raitses, Y.; Fisch, N.J.

    2003-01-01

    Plasma potentials and electron temperatures were deduced from emissive and cold floating probe measurements in a 2 kW Hall thruster, operated in the discharge voltage range of 200-400 V. An almost linear dependence of the electron temperature on the plasma potential was observed in the acceleration region of the thruster both inside and outside the thruster. This result calls into question whether secondary electron emission from the ceramic channel walls plays a significant role in electron energy balance. The proportionality factor between the axial electron temperature gradient and the electric field is significantly smaller than might be expected by models employing Ohmic heating of electrons

  8. Radioprotective action of pantothenic acid (vitamin B3)

    International Nuclear Information System (INIS)

    Perepelkin, S.P.; Egorova, N.D.; Kovalenko, V.A.; Demin, V.I.

    1976-01-01

    A protective action of pantothenic acid (vitamin B 3 ) administered orally with food in doses of 150, 750 and 1500 μg per animal has been studied in albino male rats exposed to a total-body X-irradiation of 600 R. Applied in the doses of 150 and 750 μg, the vitamin increases the animals radioresistance, while the dose of 1500 μg aggravates the course of radiation sickness

  9. 75 FR 7467 - Gary E. Hall and Rita C. Hall; Notice of Application Accepted for Filing With the Commision...

    Science.gov (United States)

    2010-02-19

    ... Rita C. Hall; Notice of Application Accepted for Filing With the Commision, Soliciting Motions To.... Project No.: 13652-000. c. Date filed: January 11, 2010. d. Applicant: Gary E. Hall and Rita C. Hall. e... Policies Act of 1978, 16 U.S.C. 2705, 2708. h. Applicant Contact: Mr. Gary E. Hall and Ms. Rita C. Hall, P...

  10. Nondestructive hall coefficient measurements using ACPD techniques

    Science.gov (United States)

    Velicheti, Dheeraj; Nagy, Peter B.; Hassan, Waled

    2018-04-01

    Hall coefficient measurements offer great opportunities as well as major challenges for nondestructive materials characterization. The Hall effect is produced by the magnetic Lorentz force acting on moving charge carriers in the presence of an applied magnetic field. The magnetic perturbation gives rise to a Hall current that is normal to the conduction current but does not directly perturb the electric potential distribution. Therefore, Hall coefficient measurements usually exploit the so-called transverse galvanomagnetic potential drop effect that arises when the Hall current is intercepted by the boundaries of the specimen and thereby produce a measurable potential drop. In contrast, no Hall potential is produced in a large plate in the presence of a uniform normal field at quasi-static low frequencies. In other words, conventional Hall coefficient measurements are inherently destructive since they require cutting the material under tests. This study investigated the feasibility of using alternating current potential drop (ACPD) techniques for nondestructive Hall coefficient measurements in plates. Specifically, the directional four-point square-electrode configuration is investigated with superimposed external magnetic field. Two methods are suggested to make Hall coefficient measurements in large plates without destructive machining. At low frequencies, constraining the bias magnetic field can replace constraining the dimensions of the specimen, which is inherently destructive. For example, when a cylindrical permanent magnet is used to provide the bias magnetic field, the peak Hall voltage is produced when the diameter of the magnet is equal to the diagonal of the square ACPD probe. Although this method is less effective than cutting the specimen to a finite size, the loss of sensitivity is less than one order of magnitude even at very low frequencies. In contrast, at sufficiently high inspection frequencies the magnetic field of the Hall current induces a

  11. Hall magnetohydrodynamics of neutral layers

    International Nuclear Information System (INIS)

    Huba, J.D.; Rudakov, L.I.

    2003-01-01

    New analytical and numerical results of the dynamics of inhomogeneous, reversed field current layers in the Hall limit (i.e., characteristic length scales < or approx. the ion inertial length) are presented. Specifically, the two- and three-dimensional evolution of a current layer that supports a reversed field plasma configuration and has a density gradient along the current direction is studied. The two-dimensional study demonstrates that a density inhomogeneity along the current direction can dramatically redistribute the magnetic field and plasma via magnetic shock-like or rarefaction waves. The relative direction between the density gradient and current flow plays a critical role in the evolution of the current sheet. One important result is that the current sheet can become very thin rapidly when the density gradient is directed opposite to the current. The three-dimensional study uses the same plasma and field configuration as the two-dimensional study but is also initialized with a magnetic field perturbation localized along the current channel upstream of the plasma inhomogeneity. The perturbation induces a magnetic wave structure that propagates in the direction of the electron drift (i.e., opposite to the current). The propagating wave structure is a Hall phenomenon associated with magnetic field curvature. The interaction between the propagating wave structure and the evolving current layer can lead to rapid magnetic field line reconnection. The results are applied to laboratory and space plasma processes

  12. Enterocin B3A-B3B produced by LAB collected from infant faeces: potential utilization in the food industry for Listeria monocytogenes biofilm management.

    Science.gov (United States)

    Al-Seraih, Alaa; Belguesmia, Yanath; Baah, John; Szunerits, Sabine; Boukherroub, Rabah; Drider, Djamel

    2017-02-01

    Enterococcus faecalis B3A-B3B produces the bacteriocin B3A-B3B with activity against Listeria monocytogenes, Staphylococcus aureus, methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, but apparently not against fungi or Gram-negative bacteria, except for Salmonella Newport. B3A-B3B enterocin has two different nucleotides but similar amino acid composition to the class IIb MR10A-MR10B enterocin. B3A-B3B consists of two peptides of predicted molecular mass of 5176.31 Da (B3A) and 5182.21 Da (B3B). Importantly, B3A-B3B impeded biofilm formation of the foodborne pathogen L. monocytogenes 162 grown on stainless steel. The antimicrobial treatment of stainless steel with nisin (1 or 16 mg ml -1 ) decreased the cell numbers by about 2 log CFU ml -1 , thereby impeding the biofilm formation by L. monocytogenes 162 or its nisin-resistant derivative strain L. monocytogenes 162R. Furthermore, the combination of nisin and B3A-B3B enterocin reduced the MIC required to inhibit this pathogen grown in planktonic or biofilm cultures.

  13. Quantum Hall effect in quantum electrodynamics

    International Nuclear Information System (INIS)

    Penin, Alexander A.

    2009-01-01

    We consider the quantum Hall effect in quantum electrodynamics and find a deviation from the quantum-mechanical prediction for the Hall conductivity due to radiative antiscreening of electric charge in an external magnetic field. A weak dependence of the universal von Klitzing constant on the magnetic field strength, which can possibly be observed in a dedicated experiment, is predicted

  14. Hall devices improve electric motor efficiency

    Science.gov (United States)

    Haeussermann, W.

    1979-01-01

    Efficiency of electric motors and generators is reduced by radial magnetic forces created by symmetric fields within device. Forces are sensed and counteracted by Hall devices on excitation or control windings. Hall generators directly measure and provide compensating control of anu asymmetry, eliminating additional measurements needed for calibration feedback control loop.

  15. Higher fractions theory of fractional hall effect

    International Nuclear Information System (INIS)

    Kostadinov, I.Z.; Popov, V.N.

    1985-07-01

    A theory of fractional quantum Hall effect is generalized to higher fractions. N-particle model interaction is used and the gap is expressed through n-particles wave function. The excitation spectrum in general and the mean field critical behaviour are determined. The Hall conductivity is calculated from first principles. (author)

  16. Espectáculo y construcción espacial en los autos de Pedro Calderón de la Barca: «La cena del rey Baltasar»

    Directory of Open Access Journals (Sweden)

    Antonio Sánchez Jiménez

    2013-11-01

    Full Text Available Este artículo analiza la construcción espectacular y espacial de un auto temprano de Calderón de la Barca, «La cena del rey Baltasar». Para ello, examina cómo funcionaban en este auto los elementos escénicos (carros, tramoya y atrezzo, así como la música, el vestuario y los espacios escénico y dramático. This article analyzes the spectacular and spacial construction of an early auto sacramental by Calderón de la Barca, «La cena del rey Baltasar». In order to do so, we examine the meaning of the different scenic elements (carros, theatrical machinery, and atrezzo, as well as the music, clothing, and scenic and dramatic spaces.

  17. Classical and quantum electrodynamics and the B(3) field

    CERN Document Server

    Evans, Myron W

    2001-01-01

    It is well known that classical electrodynamics is riddled with internal inconsistencies springing from the fact that it is a linear, Abelian theory in which the potentials are unphysical. This volume offers a self-consistent hypothesis which removes some of these problems, as well as builds a framework on which linear and nonlinear optics are treated as a non-Abelian gauge field theory based on the emergence of the fundamental magnetizing field of radiation, the B(3) field. Contents: Interaction of Electromagnetic Radiation with One Fermion; The Field Equations of Classical O (3) b Electrodyn

  18. Report of experimental hall subworking group

    International Nuclear Information System (INIS)

    Miyake, K.; Ohama, T.; Takahashi, K.

    1982-01-01

    The general plan of constructing the TRISTAN e + e - colliding beam experimental halls may be divided into two parts. The first step is to construct two test-experimental halls associated with the 6.5 GeV x 6.5 GeV e + e - accumulator ring, and the second step is to build four experimental halls at the 30 GeV x 30 GeV e + e - TRISTAN main ring. At this workshop, extensive discussions on the detailed design of the four main ring experimental halls have been made. Four experimental areas will be built at the main ring, and two test-experimental halls at the accumulating ring. Among the four areas at the main ring, two will be used for electron-proton possible as well as electron-positron colliding beam experiment. The other two will be used exclusively for e + e - colliding experiments. Only a preliminary design has been made for these four experimental areas. A tentative plan of a larger experimental hall includes a counting and data processing room, a utility room, and a radiation safety control room. Two smaller halls have simpler structure. The figures of the experimental halls are presented. The two test-experimental halls at the accumulator ring will be used to test the detectors for e + e - colliding experiments before the final installation. The utility rooms designed for the halls are used to supply coolant and electric power of superconducting magnets. At the workshop, various ideas concerning the preliminary plan are presented. (Kato, T.)

  19. The quantum Hall effect helicity

    Energy Technology Data Exchange (ETDEWEB)

    Shrivastava, Keshav N., E-mail: keshav1001@yahoo.com [Department of Physics, University of Malaya, Kuala Lumpur 50603 (Malaysia); School of Physics, University of Hyderabad, Hyderabad 500046 (India)

    2015-04-16

    The quantum Hall effect in semiconductor heterostructures is explained by two signs in the angular momentum j=l±s and g=(2j+1)/(2l+1) along with the Landau factor (n+1/2). These modifications in the existing theories explain all of the fractional charges. The helicity which is the sign of the product of the linear momentum with the spin p.s plays an important role for the understanding of the data at high magnetic fields. In particular it is found that particles with positive sign in the spin move in one direction and those with negative sign move in another direction which explains the up and down stream motion of the particles.

  20. Stuart Hall: An Organic Intellectual

    Directory of Open Access Journals (Sweden)

    Johanna Fernández Castro

    2017-01-01

    Full Text Available Stuart Hall (3 February 1932 – 10 February 2014 is acknowledged as one of the founding figures of British Cultural Studies. His extensive academic work on topics such as race, ethnicity and identity reflects his own position as a diasporic intellectual. His contribution to the study of popular culture is determined by the importance of his political character in every social act, his non-deterministic view of Marxism, and is especially determined by his insistence on playing an active role beyond academia in order to contribute to the transformation of hegemonic structures. The following biography aims to give a focused view of his personal history and its direct influence on his key theoretical reflections.

  1. The fractional quantum Hall effect

    International Nuclear Information System (INIS)

    Stormer, H.L.

    1988-01-01

    The fractional quantum Hall effect (FQHE), is the manifestation of a new, highly correlated, many-particle ground state that forms in a two-dimensional electron system at low temperatures and in high magnetic fields. It is an example of the new physics that has grown out of the tremendous recent advances in semiconductor material science, which has provided us with high-quality, lower-dimensional carrier systems. The novel electronic state exposes itself in transport experiments through quantization of the Hall resistance to an exact rational fraction of h/e, and concomitantly vanishing longitudinal resistivity. Its relevant energy scale is only a few degrees kelvin. The quantization is a consequence of the spontaneous formation of an energy gap separating the condensed ground state from its rather elusive quasiparticle excitations. The theoretical understanding of the novel quantum liquids which underlie the FQHE has predominantly emerged from an ingenious many-particle wave function strongly supported by numerous few-particle simulations. Theory has now constructed a complex model for ideal two-dimensional electron systems in the presence of high magnetic fields and makes definitive, often fascinating predictions. Experiments have successively uncovered odd-denominator fractional states reaching presently to 7/13. The application of new experimental tools to the FQHE, such as optics, microwaves, and phonon techniques promises the direct observation of such parameters as the gap energy and possibly even some of the more elusive quantities in the future. While theory and experiment in the FQHE appear to be converging, there remains considerable room for challenging surprises. This paper provides a concise overview of the FQHE. It focuses on the experimental aspects and states, but does not expand on the theoretical advances. 70 refs., 11 figs

  2. La sublevación de Cataluña de 1640 en Los agravios satisfechos, apócrifo de Calderón de la Barca

    Directory of Open Access Journals (Sweden)

    Deias, Antonia

    2016-06-01

    Full Text Available This essay analyses Los agravios satisfechos y vísperas sicilianas, an apocryphal comedy by Calderón de la Barca, whose subject is the anti-French rebellion that took place at Palermo in 1282. The comparison between the literary text and some historical studies has allowed the identification of possible sources used by the author. On the other hand, the manipulation of History, in addition to the anachronisms related to some events of the third and fourth decade of the XVII century (France’s declaration of war on Spain in 1635, 1640 Catalan revolt and the Pact of Ceret, 1641 conspiracy in Andalusia, led us to establish the date of the Golden Age comedy and to identify the goals pursued by the playwright: to turn the Sicilian Vespers into a foundation myth of the Monarchy in Spain, using them as an anti-French symbol and, at the same time, to criticize the «restoring reformism» that the Count-Duke Olivares undertook.El trabajo analiza Los agravios satisfechos y vísperas cicilianas, comedia apócrifa de Calderón que trata del levantamiento antifrancés acontecido en Palermo en 1282. El cotejo del texto con algunas obras historiográficas ha permitido identificar las posibles fuentes utilizadas por el autor. Por otro lado, la manipulación de los hechos históricos, junto con los anacronismos que remiten a acontecimientos de los años treinta y cuarenta del siglo XVII (la declaración de guerra de Francia a España de 1635, la rebelión de Cataluña y el Pacto de Ceret de 1640, la conspiración de 1641 para levantar a Andalucía, han permitido establecer la datación de la obra e identificar los objetivos perseguidos por el autor: hacer de las Vísperas sicilianas un mito fundador de la monarquía española, utilizándolas en clave anti-francesa y, al mismo tiempo, criticar el «reformismo restaurador» del conde-duque de Olivares.

  3. The quantum Hall effects: Philosophical approach

    Science.gov (United States)

    Lederer, P.

    2015-05-01

    The Quantum Hall Effects offer a rich variety of theoretical and experimental advances. They provide interesting insights on such topics as gauge invariance, strong interactions in Condensed Matter physics, emergence of new paradigms. This paper focuses on some related philosophical questions. Various brands of positivism or agnosticism are confronted with the physics of the Quantum Hall Effects. Hacking's views on Scientific Realism, Chalmers' on Non-Figurative Realism are discussed. It is argued that the difficulties with those versions of realism may be resolved within a dialectical materialist approach. The latter is argued to provide a rational approach to the phenomena, theory and ontology of the Quantum Hall Effects.

  4. Quantized Hall conductance as a topological invariant

    International Nuclear Information System (INIS)

    Niu, Q.; Thouless, Ds.J.; Wu, Y.S.

    1984-10-01

    Whenever the Fermi level lies in a gap (or mobility gap) the bulk Hall conductance can be expressed in a topologically invariant form showing the quantization explicitly. The new formulation generalizes the earlier result by TKNN to the situation where many body interaction and substrate disorder are also present. When applying to the fractional quantized Hall effect we draw the conclusion that there must be a symmetry breaking in the many body ground state. The possibility of writing the fractionally quantized Hall conductance as a topological invariant is also carefully discussed. 19 references

  5. Piezo Voltage Controlled Planar Hall Effect Devices.

    Science.gov (United States)

    Zhang, Bao; Meng, Kang-Kang; Yang, Mei-Yin; Edmonds, K W; Zhang, Hao; Cai, Kai-Ming; Sheng, Yu; Zhang, Nan; Ji, Yang; Zhao, Jian-Hua; Zheng, Hou-Zhi; Wang, Kai-You

    2016-06-22

    The electrical control of the magnetization switching in ferromagnets is highly desired for future spintronic applications. Here we report on hybrid piezoelectric (PZT)/ferromagnetic (Co2FeAl) devices in which the planar Hall voltage in the ferromagnetic layer is tuned solely by piezo voltages. The change of planar Hall voltage is associated with magnetization switching through 90° in the plane under piezo voltages. Room temperature magnetic NOT and NOR gates are demonstrated based on the piezo voltage controlled Co2FeAl planar Hall effect devices without the external magnetic field. Our demonstration may lead to the realization of both information storage and processing using ferromagnetic materials.

  6. Annual report on JEN-1 reactor

    International Nuclear Information System (INIS)

    Montes, J.

    1972-01-01

    In the annual report on the JEN-1 reactor the main features of the reactor operations and maintenance are described. The reactor has been critical for 1831 hours, what means 65,8% of the total working time. Maintenance and pool water contamination have occupied the rest of the time. The maintenance schedule is shown in detail according to three subjects. The main failures and reactor scrams are also described. The daily maximum values of the water activity are given so as the activity of the air in the reactor hall. (Author)

  7. Contribution of the study of the Hall Effect. Hall Effect of powder products

    International Nuclear Information System (INIS)

    Cherville, Jean

    1961-01-01

    This research thesis reports the development of an apparatus aimed at measuring the Hall Effect and the magneto-resistance of powders at room temperature and at the liquid nitrogen temperature. The author also proposes a theoretical contribution to the Hall Effect and reports the calculation of conditions to be met to obtain a correct value for the Hall constant. Results are experimentally verified. The method is then applied to the study of a set of powdered pre-graphitic graphites. The author shows that their Hall coefficient confirms the model already proposed by Mrozowski. The study of the Hall Effect of any kind of powders can thus be performed, and the Hall Effect can therefore be a mean to study mineral and organic compounds, and notably powdered biological molecules [fr

  8. The infrared Hall effect in YBCO: Temperature and frequency dependence of Hall scattering

    International Nuclear Information System (INIS)

    Grayson, M.; Cerne, J.; Drew, H.D.; Schmadel, D.C.; Hughes, R.; Preston, J.S.; Kung, P.J.; Vale, L.

    1999-01-01

    The authors measure the Hall angle, θ H , in YBCO films in the far- and mid-infrared to determine the temperature and frequency dependence of the Hall scattering. Using novel modulation techniques they measure both the Faraday rotation and ellipticity induced by these films in high magnetic fields to deduce the complex conductivity tensor. They observe a strong temperature dependence of the mid-infrared Hall conductivity in sharp contrast to the weak dependence of the longitudinal conductivity. By fitting the frequency dependent normal state Hall angle to a Lorentzian θ H (ω) = ω H /(γ H minus iω) they find the Hall frequency, ω H , is nearly independent of temperature. The Hall scattering rate, γ H , is consistent with γ H ∼ T 2 up to 200 K and is remarkably independent of IR frequency suggesting non-Fermi liquid behavior

  9. Topologically induced fractional Hall steps in the integer quantum Hall regime of MoS 2

    Science.gov (United States)

    Firoz Islam, SK; Benjamin, Colin

    2016-09-01

    The quantum magnetotransport properties of a monolayer of molybdenum disulfide are derived using linear response theory. In particular, the effect of topological terms on longitudinal and Hall conductivity is analyzed. The Hall conductivity exhibits fractional steps in the integer quantum Hall regime. Further complete spin and valley polarization of the longitudinal conductivitity is seen in presence of these topological terms. Finally, the Shubnikov-de Hass oscillations are suppressed or enhanced contingent on the sign of these topological terms.

  10. Alí Calderón: La reconstrucción lírica de la historia de la cultura mexicana

    Directory of Open Access Journals (Sweden)

    Nieves García Prados

    2017-01-01

    Full Text Available La poesía de los últimos años se ha caracterizado por una conexión entre los autores de Hispanoamérica y España, entre los que destaca una polifonía de voces. No obstante, existen actualmente dos tendencias entre los poetas de hoy: una conocida como la poética del fragmento o el neobarroco y otra de un corte más realista y que tiene como prioridad la comunicación y la búsqueda de la emoción. En este último grupo se enmarca el llamado movimiento de Poesía ante la Incertidumbre, cuyos precursores apuestan por una poesía que se entienda y que se enfrente a las incertezas actuales. El más joven del grupo es el mexicano Alí Calderón, en el que encontramos una preocupación por la historia y la necesidad de reconstruir de forma lírica la cultura y la tradición de su país.

  11. Wendelstein 7-X Torus Hall Layout and System Integration

    International Nuclear Information System (INIS)

    Hartmann, D.; Damiani, C.; Hartfuss, H.-J.; Krampitz, R.; Neuner, U.

    2006-01-01

    Wendelstein 7-X is an experimental fusion device presently under construction in Greifswald, Germany, to study the stellarator concept at reactor relevant parameters und steady-state conditions. The heart of the machine consists of the torus that houses the superconducting coils and the plasma vacuum vessel. It is located nearly in the center of a 30 m x 30 m x 20 m hall. A large number of components need to be placed in close proximity of the torus to provide the system with the required means, e.g. cryogenic gases, cooling water, electricity, and to integrate it with the peripheral diagnostic and heating components. The arrangement of these components has to be supported by suitable structures, and has to be optimized to allow for installation, maintenance, and repair. In addition, space has to be provided for escape routes and for sufficient distance between components that could negatively influence each other's performance, etc. The layout of the components has been done over many years using 3D CAD software. It was based on simple geometric models of the components and of the additionally required space. Presently the layout design is being detailed and updated by replacing the original coarse models with more refined estimates or - in some cases - with as-built models. All interface requirements are carefully taken into account. Detailed routing was specified for the cryo and cooling water supply lines whose design and installation is outsourced. Due to the limited space available and severely restricted access during experimental campaigns, the requirement to put auxiliary components like electronic racks into the torus hall is being queried. The paper summarizes the present state of the component layout in the torus hall, and how the peripheral supply, diagnostics, and heating systems are integrated into the machine. (author)

  12. Spin Hall effect by surface roughness

    KAUST Repository

    Zhou, Lingjun; Grigoryan, Vahram L.; Maekawa, Sadamichi; Wang, Xuhui; Xiao, Jiang

    2015-01-01

    induced by surface roughness subscribes only to the side-jump contribution but not the skew scattering. The paradigm proposed in this paper provides the second, not if only, alternative to generate a sizable spin Hall effect.

  13. Mesoscopic effects in the quantum Hall regime

    Indian Academy of Sciences (India)

    . When band mixing between multiple Landau levels is present, mesoscopic effects cause a crossover from a sequence of quantum Hall transitions for weak disorder to classical behavior for strong disorder. This behavior may be of relevance ...

  14. Plasmon Geometric Phase and Plasmon Hall Shift

    Science.gov (United States)

    Shi, Li-kun; Song, Justin C. W.

    2018-04-01

    The collective plasmonic modes of a metal comprise a simple pattern of oscillating charge density that yields enhanced light-matter interaction. Here we unveil that beneath this familiar facade plasmons possess a hidden internal structure that fundamentally alters its dynamics. In particular, we find that metals with nonzero Hall conductivity host plasmons with an intricate current density configuration that sharply departs from that of ordinary zero Hall conductivity metals. This nontrivial internal structure dramatically enriches the dynamics of plasmon propagation, enabling plasmon wave packets to acquire geometric phases as they scatter. At boundaries, these phases accumulate allowing plasmon waves that reflect off to experience a nonreciprocal parallel shift. This plasmon Hall shift, tunable by Hall conductivity as well as plasmon wavelength, displaces the incident and reflected plasmon trajectories and can be readily probed by near-field photonics techniques. Anomalous plasmon geometric phases dramatically enrich the nanophotonics toolbox, and yield radical new means for directing plasmonic beams.

  15. A system for pulse Hall effect measurements

    International Nuclear Information System (INIS)

    Orzechowski, T.; Kupczak, R.

    1975-01-01

    Measuring system for fast Hall-voltage changes in an n-type germanium sample irradiated at liquid nitrogen temperature with a high-energy electron-beam from the Van de Graaff accelerator is described. (author)

  16. Novel optical probe for quantum Hall system

    Indian Academy of Sciences (India)

    to explore Landau levels of a two-dimensional electron gas (2DEG) in modulation doped ... Keywords. Surface photovoltage spectroscopy; quantum Hall effect; Landau levels; edge states. ... An optical fibre carries light from tunable diode laser.

  17. AA under construction in its hall

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The Antiproton Accumulator was installed in a specially built hall. Here we see it at an "early" stage of installation, just a few magnets on the floor, no vacuum chamber at all, but: 3 months later there was circulating beam !

  18. Elementary theory of quantum Hall effect

    Directory of Open Access Journals (Sweden)

    Keshav N. Shrivastava

    2008-04-01

    Full Text Available The Hall effect is the generation of a current perpendicular to both the direction of the applied electric as well as magnetic field in a metal or in a semiconductor. It is used to determine the concentration of electrons. The quantum Hall effect with integer quantization was discovered by von Klitzing and fractionally charged states were found by Tsui, Stormer and Gossard. Robert Laughlin explained the quantization of Hall current by using “flux quantization” and introduced incompressibility to obtain the fractional charge. We have developed the theory of the quantum Hall effect by using the theory of angular momentum. Our predicted fractions are in accord with those measured. We emphasize our explanation of the observed phenomena. We use spin to explain the fractional charge and hence we discover spin-charge locking.

  19. The fluctuation Hall conductivity and the Hall angle in type-II superconductor under magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Tinh, Bui Duc, E-mail: tinhbd@hnue.edu.vn [Institute of Research and Development, Duy Tan University, K7/25 Quang Trung, Danang (Viet Nam); Department of Physics, Hanoi National University of Education, 136 Xuan Thuy, Cau Giay, Hanoi (Viet Nam); Hoc, Nguyen Quang; Thu, Le Minh [Department of Physics, Hanoi National University of Education, 136 Xuan Thuy, Cau Giay, Hanoi (Viet Nam)

    2016-02-15

    Highlights: • The time-dependent Ginzburg–Landau was used to calculate fluctuation Hall conductivity and Hall angle in type-II superconductor in 2D and 3D. • We obtain analytical expressions for the fluctuation Hall conductivity and the Hall angle summing all Landau levels without need to cutoff higher Landau levels to treat arbitrary magnetic field. • The results were compared to the experimental data on YBCO. - Abstract: The fluctuation Hall conductivity and the Hall angle, describing the Hall effect, are calculated for arbitrary value of the imaginary part of the relaxation time in the frame of the time-dependent Ginzburg–Landau theory in type II-superconductor with thermal noise describing strong thermal fluctuations. The self-consistent Gaussian approximation is used to treat the nonlinear interaction term in dynamics. We obtain analytical expressions for the fluctuation Hall conductivity and the Hall angle summing all Landau levels without need to cutoff higher Landau levels to treat arbitrary magnetic field. The results are compared with experimental data on high-T{sub c} superconductor.

  20. NAS Decadal Review Town Hall

    Science.gov (United States)

    The National Academies of Sciences, Engineering and Medicine is seeking community input for a study on the future of materials research (MR). Frontiers of Materials Research: A Decadal Survey will look at defining the frontiers of materials research ranging from traditional materials science and engineering to condensed matter physics. Please join members of the study committee for a town hall to discuss future directions for materials research in the United States in the context of worldwide efforts. In particular, input on the following topics will be of great value: progress, achievements, and principal changes in the R&D landscape over the past decade; identification of key MR areas that have major scientific gaps or offer promising investment opportunities from 2020-2030; and the challenges that MR may face over the next decade and how those challenges might be addressed. This study was requested by the Department of Energy and the National Science Foundation. The National Academies will issue a report in 2018 that will offer guidance to federal agencies that support materials research, science policymakers, and researchers in materials research and other adjoining fields. Learn more about the study at http://nas.edu/materials.

  1. Resistive Instabilities in Hall Current Plasma Discharge

    International Nuclear Information System (INIS)

    Litvak, Andrei A.; Fisch, Nathaniel J.

    2000-01-01

    Plasma perturbations in the acceleration channel of a Hall thruster are found to be unstable in the presence of collisions. Both electrostatic lower-hybrid waves and electromagnetic Alfven waves transverse to the applied electric and magnetic field are found to be unstable due to collisions in the E X B electron flow. These results are obtained assuming a two-fluid hydrodynamic model in slab geometry. The characteristic frequencies of these modes are consistent with experimental observations in Hall current plasma thrusters

  2. Are tent halls subject to property tax?

    Directory of Open Access Journals (Sweden)

    Mariusz Macudziński

    2016-12-01

    Full Text Available The presented publication is a response to currently asked questions and interpretative doubts of taxpayers and tax authorities, namely whether tent halls are subject to property tax. General issues connected with an entity and a subject of taxation of this tax are presented herein. The answer to the question asked is then provided through the qualification of constructions works and the allocation of tent halls in the proper category of the works, with the use of the current law.

  3. Fractional statistics and fractional quantized Hall effect

    International Nuclear Information System (INIS)

    Tao, R.; Wu, Y.S.

    1985-01-01

    The authors suggest that the origin of the odd-denominator rule observed in the fractional quantized Hall effect (FQHE) may lie in fractional statistics which govern quasiparticles in FQHE. A theorem concerning statistics of clusters of quasiparticles implies that fractional statistics do not allow coexistence of a large number of quasiparticles at fillings with an even denominator. Thus, no Hall plateau can be formed at these fillings, regardless of the presence of an energy gap. 15 references

  4. Hall effect in organic layered conductors

    Directory of Open Access Journals (Sweden)

    R.A.Hasan

    2006-01-01

    Full Text Available The Hall effect in organic layered conductors with a multisheeted Fermi surfaces was considered. It is shown that the experimental study of Hall effect and magnetoresistance anisotropy at different orientations of current and a quantizing magnetic field relative to the layers makes it possible to determine the contribution of various charge carriers groups to the conductivity, and to find out the character of Fermi surface anisotropy in the plane of layers.

  5. Excess hall effect in epitaxial YBCO film under moderate magnetic fields, approached by renormalized superconducting fluctuations model

    International Nuclear Information System (INIS)

    Puica, I.; Lang, W.; Goeb, W.; Sobolewski, R.

    2002-01-01

    Full text: Measurements of the Hall effect and the resistivity on precisely-patterned YBCO thin film in moderate magnetic fields B from 0.5 to 6 T oriented parallel to the crystallographic c axis reveal a sign reversal of the Hall coefficient for B < 3 T. The data are confronted with the full quantitative expressions given by the renormalized fluctuation model for the excess Hall conductivity. The model offers a satisfactory quantitative approach to the experimental results, for moderate fields and temperatures near the critical region, provided the inhomogeneity of the critical temperature distribution is also taken into account. For lower fields and temperatures, the adequacy of the model is altered by vortex pinning. (author)

  6. Decommissioning of Salaspils nuclear reactor

    International Nuclear Information System (INIS)

    Abramenkovs, A.; Malnachs, J.; Popelis, A.

    2002-01-01

    In May 1995, the Latvian Government decided to shut down the Research Reactor Salaspils (SRR) and to dispense with nuclear energy in future. The reactor has been out of operation since July 1998. A conceptual study for the decommissioning of SRR has been carried out by Noell-KRC-Energie- und Umwelttechnik GmbH from 1998-1999. he Latvian Government decided on 26 October 1999 to start the direct dismantling to 'green field' in 2001. The results of decommissioning and dismantling performed in 1999-2001 are presented and discussed. The main efforts were devoted to collecting and conditioning 'historical' radioactive waste from different storages outside and inside the reactor hall. All radioactive material more than 20 tons were conditioned in concrete containers for disposal in the radioactive waste depository 'Radons' in the Baldone site. Personal protective and radiation measurement equipment was upgraded significantly. All non-radioactive equipment and material outside the reactor buildings were free-released and dismantled for reuse or conventional disposal. Weakly contaminated material from the reactor hall was collected and removed for free-release measurements. The technology of dismantling of the reactor's systems, i.e. second cooling circuit, zero power reactors and equipment, is discussed in the paper. (author)

  7. Crystal growth of Li10B3O5

    International Nuclear Information System (INIS)

    Sugiyama, Akira; Gallagher, Hugh G.; Han, Thomas P.J.

    1999-09-01

    The growth of boron 10 isotope enriched L 10 BO (Li 10 B 3 O 5 ) optical crystal has been developed from Top-Seeded-Solution-Growth using a resistance furnace. In the preparation for growth materials, we have made further improvement on a charge loading technique to a crucible and succeeded in forming suitable high temperature flux for producing crystals. Adequate temperature gradient of 1K/cm inside the crucible was achieved from searching for a combination of setting temperatures in the vertical three-zone furnace and installing a ceramic ring under the crucible. We have also optimized seed holder configuration and established growth conditions by several attempts. As a result, two good quality L 10 BO crystals were produced with sizes of 14 x 25 x 22 mm and 13 x 10 x 12 mm from oriented seed crystals. Although these sizes were limited by the size of the crucible used, appropriate oriented samples were extracted for detailed studies in optical measurements. (author)

  8. Coxsackievirus B3 2A protease promotes encephalomyocarditis virus replication.

    Science.gov (United States)

    Song, Qin-Qin; Lu, Ming-Zhi; Song, Juan; Chi, Miao-Miao; Sheng, Lin-Jun; Yu, Jie; Luo, Xiao-Nuan; Zhang, Lu; Yao, Hai-Lan; Han, Jun

    2015-10-02

    To determine whether 2A protease of the enterovirus genus with type I internal ribosome entry site (IRES) effect on the viral replication of type II IRES, coxsackievirus B3(CVB3)-encoded protease 2A and encephalomyocarditis virus (EMCV) IRES (Type II)-dependent or cap-dependent report gene were transiently co-expressed in eukaryotic cells. We found that CVB3 2A protease not only inhibited translation of cap-dependent reporter genes through the cleavage of eIF4GI, but also conferred high EMCV IRES-dependent translation ability and promoted EMCV replication. Moreover, deletions of short motif (aa13-18 RVVNRH, aa65-70 KNKHYP, or aa88-93 PRRYQSH) resembling the nuclear localization signals (NLS) or COOH-terminal acidic amino acid motif (aa133-147 DIRDLLWLEDDAMEQ) of CVB3 2A protease decreased both its EMCV IRES-dependent translation efficiency and destroy its cleavage on eukaryotic initiation factor 4G (eIF4G) I. Our results may provide better understanding into more effective interventions and treatments for co-infection of viral diseases. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. Backfitting swimming pool reactors

    International Nuclear Information System (INIS)

    Roebert, G.A.

    1978-01-01

    Calculations based on measurements in a critical assembly, and experiments to disclose fuel element surface temperatures in case of accidents like stopping of primary coolant flow during full power operation, have shown that the power of the swimming pool type research reactor FRG-2 (15 MW, operating since 1967) might be raised to 21 MW within the present rules of science and technology, without major alterations of the pool buildings and the cooling systems. A backfitting program is carried through to adjust the reactor control systems of FRG-2 and FRG-1 (5 MW, housed in the same reactor hall) to the present safety rules and recommendations, to ensure FRG-2 operation at 21 MW for the next decade. (author)

  10. 75 FR 22770 - Gary E. Hall and Rita Hall; Notice of Availability of Environmental Assessment

    Science.gov (United States)

    2010-04-30

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 13652-000-Montana] Gary E. Hall and Rita Hall; Notice of Availability of Environmental Assessment April 22, 2010. In accordance with the National Environmental Policy Act of 1969, as amended, and the Federal Energy Regulatory...

  11. Annual report on JEN-1 reactor; Informe periodico del Reactor JEN-1 correspondiente al ano 1971

    Energy Technology Data Exchange (ETDEWEB)

    Montes, J

    1972-07-01

    In the annual report on the JEN-1 reactor the main features of the reactor operations and maintenance are described. The reactor has been critical for 1831 hours, what means 65,8% of the total working time. Maintenance and pool water contamination have occupied the rest of the time. The maintenance schedule is shown in detail according to three subjects. The main failures and reactor scrams are also described. The daily maximum values of the water activity are given so as the activity of the air in the reactor hall. (Author)

  12. Charge carrier coherence and Hall effect in organic semiconductors

    Science.gov (United States)

    Yi, H. T.; Gartstein, Y. N.; Podzorov, V.

    2016-01-01

    Hall effect measurements are important for elucidating the fundamental charge transport mechanisms and intrinsic mobility in organic semiconductors. However, Hall effect studies frequently reveal an unconventional behavior that cannot be readily explained with the simple band-semiconductor Hall effect model. Here, we develop an analytical model of Hall effect in organic field-effect transistors in a regime of coexisting band and hopping carriers. The model, which is supported by the experiments, is based on a partial Hall voltage compensation effect, occurring because hopping carriers respond to the transverse Hall electric field and drift in the direction opposite to the Lorentz force acting on band carriers. We show that this can lead in particular to an underdeveloped Hall effect observed in organic semiconductors with substantial off-diagonal thermal disorder. Our model captures the main features of Hall effect in a variety of organic semiconductors and provides an analytical description of Hall mobility, carrier density and carrier coherence factor. PMID:27025354

  13. Charge carrier coherence and Hall effect in organic semiconductors.

    Science.gov (United States)

    Yi, H T; Gartstein, Y N; Podzorov, V

    2016-03-30

    Hall effect measurements are important for elucidating the fundamental charge transport mechanisms and intrinsic mobility in organic semiconductors. However, Hall effect studies frequently reveal an unconventional behavior that cannot be readily explained with the simple band-semiconductor Hall effect model. Here, we develop an analytical model of Hall effect in organic field-effect transistors in a regime of coexisting band and hopping carriers. The model, which is supported by the experiments, is based on a partial Hall voltage compensation effect, occurring because hopping carriers respond to the transverse Hall electric field and drift in the direction opposite to the Lorentz force acting on band carriers. We show that this can lead in particular to an underdeveloped Hall effect observed in organic semiconductors with substantial off-diagonal thermal disorder. Our model captures the main features of Hall effect in a variety of organic semiconductors and provides an analytical description of Hall mobility, carrier density and carrier coherence factor.

  14. High temperature hall effect measurement system design, measurement and analysis

    Science.gov (United States)

    Berkun, Isil

    A reliable knowledge of the transport properties of semiconductor materials is essential for the development and understanding of a number of electronic devices. In this thesis, the work on developing a Hall Effect measurement system with software based data acqui- sition and control for a temperature range of 300K-700K will be described. A system was developed for high temperature measurements of materials including single crystal diamond, poly-crystalline diamond, and thermoelectric compounds. An added capability for monitor- ing the current versus voltage behavior of the contacts was used for studying the influence of ohmic and non-ohmic contacts on Hall Effect measurements. The system has been primar- ily used for testing the transport properties of boron-doped single crystal diamond (SCD) deposited in a microwave plasma-assisted chemical vapor deposition (MPCVD) reactor [1]. Diamond has several outstanding properties that are of high interest for its development as an electronic material. These include a relatively wide band gap of 5.5 (eV), high thermal conductivity, high mobility, high saturation velocity, and a high breakdown voltage. For a temperature range of 300K-700K, IV curves, Hall mobilities and carrier concentrations are shown. Temperature dependent Hall effect measurements have shown carrier concentrations from below 1017cm --3 to approximately 1021 cm--3 with mobilities ranging from 763( cm2/V s) to 0.15(cm 2/V s) respectively. Simulation results have shown the effects of single and mixed carrier models, activation energies, effective mass and doping concentrations. These studies have been helpful in the development of single crystal diamond for diode applications. Reference materials of Ge and GaAs were used to test the Hall Effect system. The system was also used to characterize polycrystalline diamond deposited on glass for electrochemical applications, and Mg2(Si,Sn) compounds which are promising candidates of low-cost, light weight and non

  15. Dr. Hall and the work cure.

    Science.gov (United States)

    Reed, Kathlyn L

    2005-01-01

    Herbert James Hall, MD (1870-1923), was a pioneer in the systematic and organized study of occupation as therapy for persons with nervous and mental disorders that he called the "work cure." He began his work in 1904 during the early years of the Arts and Crafts Movement in the United States. His primary interest was the disorder neurasthenia, a condition with many symptoms including chronic fatigue, stress, and inability to work or perform everyday tasks. The prevailing treatment of the day was absolute bed rest known as the "rest cure." Hall believed that neurasthenia was not caused by overwork but by faulty living habits that could be corrected through an ordered life schedule and selected occupations. He identified several principles of therapy that are still used today including graded activity and energy conservation. Dr. Adolph Meyer credits Hall for organizing the ideas on the therapeutic use of occupation (Meyer, 1922). Hall also provided the name American Occupational Therapy Association for the professional organization and served as the fourth president. For his many contributions to the profession Hall deserves to be recognized as a major contributor to the development and organization of occupational therapy.

  16. A new CMOS Hall angular position sensor

    Energy Technology Data Exchange (ETDEWEB)

    Popovic, R.S.; Drljaca, P. [Swiss Federal Inst. of Tech., Lausanne (Switzerland); Schott, C.; Racz, R. [SENTRON AG, Zug (Switzerland)

    2001-06-01

    The new angular position sensor consists of a combination of a permanent magnet attached to a shaft and of a two-axis magnetic sensor. The permanent magnet produces a magnetic field parallel with the magnetic sensor plane. As the shaft rotates, the magnetic field also rotates. The magnetic sensor is an integrated combination of a CMOS Hall integrated circuit and a thin ferromagnetic disk. The CMOS part of the system contains two or more conventional Hall devices positioned under the periphery of the disk. The ferromagnetic disk converts locally a magnetic field parallel with the chip surface into a field perpendicular to the chip surface. Therefore, a conventional Hall element can detect an external magnetic field parallel with the chip surface. As the direction of the external magnetic field rotates in the chip plane, the output voltage of the Hall element varies as the cosine of the rotation angle. By placing the Hall elements at the appropriate places under the disk periphery, we may obtain the cosine signals shifted by 90 , 120 , or by any other angle. (orig.)

  17. Composite fermions in the quantum Hall effect

    International Nuclear Information System (INIS)

    Johnson, B.L.; Kirczenow, G.

    1997-01-01

    The quantum Hall effect and associated quantum transport phenomena in low-dimensional systems have been the focus of much attention for more than a decade. Recent theoretical development of interesting quasiparticles - 'composite fermions' - has led to significant advances in understanding and predicting the behaviour of two-dimensional electron systems under high transverse magnetic fields. Composite fermions may be viewed as fermions carrying attached (fictitious) magnetic flux. Here we review models of the integer and fractional quantum Hall effects, including the development of a unified picture of the integer and fractional effects based upon composite fermions. The composite fermion picture predicts remarkable new physics: the formation of a Fermi surface at high magnetic fields, and anomalous ballistic transport, thermopower, and surface acoustic wave behaviour. The specific theoretical predictions of the model, as well as the body of experimental evidence for these phenomena are reviewed. We also review recent edge-state models for magnetotransport in low-dimensional devices based on the composite fermion picture. These models explain the fractional quantum Hall effect and transport phenomena in nanoscale devices in a unified framework that also includes edge state models of the integer quantum Hall effect. The features of the composite fermion edge-state model are compared and contrasted with those of other recent edge-state models of the fractional quantum Hall effect. (author)

  18. Air temperature gradient in large industrial hall

    Science.gov (United States)

    Karpuk, Michał; Pełech, Aleksander; Przydróżny, Edward; Walaszczyk, Juliusz; Szczęśniak, Sylwia

    2017-11-01

    In the rooms with dominant sensible heat load, volume airflow depends on many factors incl. pre-established temperature difference between exhaust and supply airflow. As the temperature difference is getting higher, airflow volume drops down, consequently, the cost of AHU is reduced. In high industrial halls with air exhaust grids located under the ceiling additional temperature gradient above working zone should be taken into consideration. In this regard, experimental research of the vertical air temperature gradient in high industrial halls were carried out for the case of mixing ventilation system The paper presents the results of air temperature distribution measurements in high technological hall (mechanically ventilated) under significant sensible heat load conditions. The supply airflow was delivered to the hall with the help of the swirl diffusers while exhaust grids were located under the hall ceiling. Basing on the air temperature distribution measurements performed on the seven pre-established levels, air temperature gradient in the area between 2.0 and 7.0 m above the floor was calculated and analysed.

  19. Field theory approach to quantum hall effect

    International Nuclear Information System (INIS)

    Cabo, A.; Chaichian, M.

    1990-07-01

    The Fradkin's formulation of statistical field theory is applied to the Coulomb interacting electron gas in a magnetic field. The electrons are confined to a plane in normal 3D-space and also interact with the physical 3D-electromagnetic field. The magnetic translation group (MTG) Ward identities are derived. Using them it is shown that the exact electron propagator is diagonalized in the basis of the wave functions of the free electron in a magnetic field whenever the MTG is unbroken. The general tensor structure of the polarization operator is obtained and used to show that the Chern-Simons action always describes the Hall effect properties of the system. A general proof of the Streda formula for the Hall conductivity is presented. It follows that the coefficient of the Chern-Simons terms in the long-wavelength approximation is exactly given by this relation. Such a formula, expressing the Hall conductivity as a simple derivative, in combination with diagonal form of the full propagator allows to obtain a simple expressions for the filling factor and the Hall conductivity. Indeed, these results, after assuming that the chemical potential lies in a gap of the density of states, lead to the conclusion that the Hall conductivity is given without corrections by σ xy = νe 2 /h where ν is the filling factor. In addition it follows that the filling factor is independent of the magnetic field if the chemical potential remains in the gap. (author). 21 ref, 1 fig

  20. Extrinsic spin Hall effect in graphene

    Science.gov (United States)

    Rappoport, Tatiana

    The intrinsic spin-orbit coupling in graphene is extremely weak, making it a promising spin conductor for spintronic devices. In addition, many applications also require the generation of spin currents in graphene. Theoretical predictions and recent experimental results suggest one can engineer the spin Hall effect in graphene by greatly enhancing the spin-orbit coupling in the vicinity of an impurity. The extrinsic spin Hall effect then results from the spin-dependent skew scattering of electrons by impurities in the presence of spin-orbit interaction. This effect can be used to efficiently convert charge currents into spin-polarized currents. I will discuss recent experimental results on spin Hall effect in graphene decorated with adatoms and metallic cluster and show that a large spin Hall effect can appear due to skew scattering. While this spin-orbit coupling is small if compared with what it is found in metals, the effect is strongly enhanced in the presence of resonant scattering, giving rise to robust spin Hall angles. I will present our single impurity scattering calculations done with exact partial-wave expansions and complement the analysis with numerical results from a novel real-space implementation of the Kubo formalism for tight-binding Hamiltonians. The author acknowledges the Brazilian agencies CNPq, CAPES, FAPERJ and INCT de Nanoestruturas de Carbono for financial support.

  1. Backfitting of the FRG reactors

    Energy Technology Data Exchange (ETDEWEB)

    Krull, W [GKSS-Forschungszentrum Geesthacht GmbH, Geesthacht (Germany)

    1990-05-01

    The FRG-research reactors The GKSS-research centre is operating two research reactors of the pool type fueled with MTR-type type fuel elements. The research reactors FRG-1 and FRG-2 having power levels of 5 MW and 15 MW are in operation for 31 year and 27 years respectively. They are comparably old like other research reactors. The reactors are operating at present at approximately 180 days (FRG-1) and between 210 and 250 days (FRG-2) per year. Both reactors are located in the same reactor hall in a connecting pool system. Backfitting measures are needed for our and other research reactors to ensure a high level of safety and availability. The main backfitting activities during last ten years were concerned with: comparison of the existing design with today demands (criteria, guidelines, standards etc.); and probability approach for events from outside like aeroplane crashes and earthquakes; the main accidents were rediscussed like startup from low and full power, loss of coolant flow, loss of heat sink, loss of coolant and fuel plate melting; a new reactor protection system had to be installed, following today's demands; a new crane has been installed in the reactor hall. A cold neutron source has been installed to increase the flux of cold neutrons by a factor of 14. The FRG-l is being converted from 93% enriched U with Alx fuel to 20% enriched U with U{sub 3}Si{sub 2} fuel. Both cooling towers were repaired. Replacement of instrumentation is planned.

  2. Proyecto de factibilidad para la implantación de un sistema de recolección de residuos sólidos en la ciudad de Quito parroquia calderón

    OpenAIRE

    Jaramillo Narváez, Sandy Viviana; Vinueza Bracero, Diana Carolina

    2013-01-01

    Actualmente el sistema de Recolección de Desechos Sólidos presenta deficiencias en su manejo, ocasionando, así, problemas directos sobre la población, por este motivo el presente documento se ha elaborado con el objetivo de analizar la factibilidad de implantación de un servicio de soporte para el actual sistema de recolección de desechos sólidos en el cantón de Quito, parroquia Calderón, el cual consiste en la propuesta de un servicio de contenedore...

  3. Sociolinguistics of power in the Spanish Golden Age. Of reverences, highnesses, mercies, lordships and other forms of treatment in the theatre of Calderón de la Barca

    Directory of Open Access Journals (Sweden)

    Carmela Pérez-Salazar

    2018-01-01

    Full Text Available This work reviews the resources that are used in dramatic works of Calderón de la Barca for the treatment of the representatives of the authority; that is, the presence on stage of what Gonzalo Correas calls «names of honor», for which the protocol of the sixteenth and seventeenth centuries imposes very strict guidelines, is analyzed. The study is based on a selection of works in which representatives of political, military and ecclesiastical power, and characters of different rank, sex and age participate.

  4. ORPHEE reactor. Upgrade of the installation

    International Nuclear Information System (INIS)

    Farnoux, B.; Maziere, M.

    1995-01-01

    Designed by the end of the seventies, the ORPHEE Reactor is equipped with two hydrogen cold sources, one hot source and six cold neutron guides. The neutron beams are extracted by nine beam ports and used in two experimental halls, the reactor hall and the neutron guide hall. After fourteen years of use, a modernisation programme is in progress. One step concerns the neutron guides, another one the cold sources with the modification of the cell geometry in order to increase the cold neutron flux. This operation requires the use a new cryogenerator to ensure liquefaction capabilities for the new cells. It is also scheduled to replace the Zircaloy core housing in order to avoid difficulties linked to the expansion under irradiation. (author)

  5. Localization in a quantum spin Hall system.

    Science.gov (United States)

    Onoda, Masaru; Avishai, Yshai; Nagaosa, Naoto

    2007-02-16

    The localization problem of electronic states in a two-dimensional quantum spin Hall system (that is, a symplectic ensemble with topological term) is studied by the transfer matrix method. The phase diagram in the plane of energy and disorder strength is exposed, and demonstrates "levitation" and "pair annihilation" of the domains of extended states analogous to that of the integer quantum Hall system. The critical exponent nu for the divergence of the localization length is estimated as nu congruent with 1.6, which is distinct from both exponents pertaining to the conventional symplectic and the unitary quantum Hall systems. Our analysis strongly suggests a different universality class related to the topology of the pertinent system.

  6. Hall probe magnetometer for SSC magnet cables

    International Nuclear Information System (INIS)

    Cross, R.W.; Goldfarb, R.B.

    1991-01-01

    The authors of this paper constructed a Hall probe magnetometer to measure the magnetization hysteresis loops of Superconducting Super Collider magnet cables. The instrument uses two Hall-effect field sensors to measure the applied field H and the magnetic induction B. Magnetization M is calculated from the difference of the two quantities. The Hall probes are centered coaxially in the bore of a superconducting solenoid with the B probe against the sample's broad surface. An alternative probe arrangement, in which M is measured directly, aligns the sample probe parallel to the field. The authors measured M as a function of H and field cycle rate both with and without a dc transport current. Flux creep as a function of current was measured from the dependence of ac loss on the cycling rate and from the decay of magnetization with time. Transport currents up to 20% of the critical current have minimal effect on magnetization and flux creep

  7. Spin Hall Effect in Doped Semiconductor Structures

    Science.gov (United States)

    Tse, Wang-Kong; Das Sarma, Sankar

    2006-03-01

    We present a microscopic theory of the extrinsic spin Hall effect based on the diagrammatic perturbation theory. Side-jump (SJ) and skew-scattering (SS) contributions are explicitly taken into account to calculate the spin Hall conductivity, and we show their effects scale as σxy^SJ/σxy^SS ˜(/τ)/ɛF, where τ being the transport relaxation time. Motivated by recent experimental work we apply our theory to n-doped and p-doped 3D and 2D GaAs structures, obtaining analytical formulas for the SJ and SS contributions. Moreover, the ratio of the spin Hall conductivity to longitudinal conductivity is found as σs/σc˜10-3-10-4, in reasonable agreement with the recent experimental results of Kato et al. [Science 306, 1910 (2004)] in n-doped 3D GaAs system.

  8. Shielding consideration for the SSCL experimental halls

    International Nuclear Information System (INIS)

    Bull, J.; Coyne, J.; Mokhov, N.; Stapleton, G.

    1994-03-01

    The Superconducting Super Collider which is being designed and built in Waxahachie, Texas consists Of series of proton accelerators, culminating in a 20 Te proton on proton collider. The collider will be in a tunnel which will be 87 km in circumference and. on average about 30 meters underground. The present design calls for two large interaction halls on the east side of the ring. The shielding for these halls is being designed for an interaction rate of 10 9 Hz or 10 16 interactions per year, based on 10 7 seconds per operational year. SSC guidelines require that the shielding be designed to meet the criterion of 1mSv per year for open areas off site 2mSv per year for open areas on site, and 2mSv per year for controlled areas. Only radiation workers will be routinely allowed to work in controlled areas. It should be pointed that there is a potential for an accidental full beam loss in either of the experimental halls, and this event would consist of the loss of the full circulating beam up to 4 x 10 14 protons. With the present design. the calculated dose equivalent for this event is about 10% of the annual dose equivalent for the normal p-p interactions, so that die accident condition does not control the shielding. If, for instance, local shielding within the experimental hall is introduced into the calculations, this could change. The shielding requirements presented here are controlled by the normal p-p interactions. Three important questions were addressed in the present calculations. They are (1) the thickness of the roof over the experimental halls, (2) the configuration of the shafts and adits which give access to the halls, and (3) the problem of ground water and air activation

  9. Up-regulated ephrinB3/EphB3 expression in intractable temporal lobe epilepsy patients and pilocarpine induced experimental epilepsy rat model.

    Science.gov (United States)

    Huang, Hao; Li, Ruohan; Yuan, Jinxian; Zhou, Xin; Liu, Xi; Ou, Shu; Xu, Tao; Chen, Yangmei

    2016-05-15

    EphB family receptor tyrosine kinases, in cooperation with cell surface-bound ephrinB ligands, play a critical role in maintenance of dendritic spine morphogenesis, axons guidance, synaptogenesis, synaptic reorganization and plasticity in the central nervous system (CNS). However, the expression pattern of ephrinB/EphB in intractable temporal lobe epilepsy (TLE) and the underlying molecular mechanisms during epileptogenesis remain poorly understood. Here we investigated the expression pattern and cellular distribution of ephrinB/EphB in intractable TLE patients and lithium chloride-pilocarpine induced TLE rats using real-time quantitative polymerase chain reaction (RT-qPCR), immunohistochemistry, double-labeled immunofluorescence and Western blot analysis. Compared to control groups, ephrinB3 and EphB3 mRNA expression were significantly up-regulated in intractable TLE patients and TLE rats, while the mRNA expression trend of ephrinB1/2 and EphB1/2/4/6 in intractable TLE patients and TLE rats were inconsistent. Western blot analysis and semi-quantitative immunohistochemistry confirmed that ephrinB3 and EphB3 protein level were up-regulated in intractable TLE patients and TLE rats. At the same time, double-labeled immunofluorescence indicate that ephrinB3 was expressed mainly in the cytoplasm and protrusions of glia and neurons, while EphB3 was expressed mainly in the cytoplasm of neurons. Taken together, up-regulated expression of ephrinB3/EphB3 in intractable TLE patients and experimental TLE rats suggested that ephrinB3/EphB3 might be involved in the pathogenesis of TLE. Copyright © 2016 Elsevier B.V. All rights reserved.

  10. Developments in Scanning Hall Probe Microscopy

    Science.gov (United States)

    Chouinard, Taras; Chu, Ricky; David, Nigel; Broun, David

    2009-05-01

    Low temperature scanning Hall probe microscopy is a sensitive means of imaging magnetic structures with high spatial resolution and magnetic flux sensitivity approaching that of a Superconducting Quantum Interference Device. We have developed a scanning Hall probe microscope with novel features, including highly reliable coarse positioning, in situ optimization of sensor-sample alignment and capacitive transducers for linear, long range positioning measurement. This has been motivated by the need to reposition accurately above fabricated nanostructures such as small superconducting rings. Details of the design and performance will be presented as well as recent progress towards time-resolved measurements with sub nanosecond resolution.

  11. Enhanced Performance of Cylindrical Hall Thrusters

    International Nuclear Information System (INIS)

    Raitses, Y.; Smirnov, A.; Fisch, N.J.

    2007-01-01

    The cylindrical thruster differs significantly in its underlying physical mechanisms from the conventional annular Hall thruster. It features high ionization efficiency, quiet operation, ion acceleration in a large volume-to-surface ratio channel, and performance comparable with the state-of-the-art conventional Hall thrusters. Very significant plume narrowing, accompanied by the increase of the energetic ion fraction and improvement of ion focusing, led to 50-60% increase of the thruster anode efficiency. These improvements were achieved by overrunning the discharge current in the magnetized thruster plasma

  12. Inverse spin Hall effect by spin injection

    Science.gov (United States)

    Liu, S. Y.; Horing, Norman J. M.; Lei, X. L.

    2007-09-01

    Motivated by a recent experiment [S. O. Valenzuela and M. Tinkham, Nature (London) 442, 176 (2006)], the authors present a quantitative microscopic theory to investigate the inverse spin-Hall effect with spin injection into aluminum considering both intrinsic and extrinsic spin-orbit couplings using the orthogonalized-plane-wave method. Their theoretical results are in good agreement with the experimental data. It is also clear that the magnitude of the anomalous Hall resistivity is mainly due to contributions from extrinsic skew scattering.

  13. Prototype dining hall energy efficiency study

    Energy Technology Data Exchange (ETDEWEB)

    Mazzucchi, R.P.; Bailey, S.A.; Zimmerman, P.W.

    1988-06-01

    The energy consumption of food service facilities is among the highest of any commercial building type, owing to the special requirements for food preparation, sanitation, and ventilation. Consequently, the US Air Force Engineering and Services Center (AFESC) contracted with Pacific Northwest Laboratory (PNL) to collect and analyze end-use energy consumption data for a prototypical dining hall and make specific recommendations on cost-effective energy conservation options. This information will be used to establish or update criteria for dining hall designs and retrofits as appropriate. 6 refs., 21 figs., 23 tabs.

  14. Acoustics in rock and pop music halls

    DEFF Research Database (Denmark)

    Larsen, Niels Werner; Thompson, Eric Robert; Gade, Anders Christian

    2007-01-01

    The existing body of literature regarding the acoustic design of concert halls has focused almost exclusively on classical music, although there are many more performances of rhythmic music, including rock and pop. Objective measurements were made of the acoustics of twenty rock music venues...... in Denmark and a questionnaire was used in a subjective assessment of those venues with professional rock musicians and sound engineers. Correlations between the objective and subjective results lead, among others, to a recommendation for reverberation time as a function of hall volume. Since the bass...

  15. Proton knock-out in Hall A

    International Nuclear Information System (INIS)

    Jager, K. de

    2003-01-01

    Proton knock-out is studied in a broad program in Hall A at Jefferson Lab. The first experiment performed in Hall A studied the 16 O(e,e'p) reaction. Since then proton knock-out experiments have studied a variety of aspects of that reaction, from single-nucleon properties to its mechanism, such as final-state interactions and two-body currents, in nuclei from 2 H to 16 O. In this review the accomplishments of this program will be summarized and an outlook given of expected future results. (orig.)

  16. Theory of fractional quantum Hall effect

    International Nuclear Information System (INIS)

    Kostadinov, I.Z.

    1984-09-01

    A theory of the fractional quantum Hall effect is constructed by introducing 3-particle interactions breaking the symmetry for ν=1/3 according to a degeneracy theorem proved here. An order parameter is introduced and a gap in the single particle spectrum is found. The critical temperature, critical filling number and critical behaviour are determined as well as the Ginzburg-Landau equation coefficients. A first principle calculation of the Hall current is given. 3, 5, 7 electron tunneling and Josephson interference effects are predicted. (author)

  17. Bound values for Hall conductivity of heterogeneous medium under ...

    Indian Academy of Sciences (India)

    - ditions in inhomogeneous medium has been studied. It is shown that bound values for. Hall conductivity differ from bound values for metallic conductivity. This is due to the unusual character of current percolation under quantum Hall effect ...

  18. A Small Modular Laboratory Hall Effect Thruster

    Science.gov (United States)

    Lee, Ty Davis

    Electric propulsion technologies promise to revolutionize access to space, opening the door for mission concepts unfeasible by traditional propulsion methods alone. The Hall effect thruster is a relatively high thrust, moderate specific impulse electric propulsion device that belongs to the class of electrostatic thrusters. Hall effect thrusters benefit from an extensive flight history, and offer significant performance and cost advantages when compared to other forms of electric propulsion. Ongoing research on these devices includes the investigation of mechanisms that tend to decrease overall thruster efficiency, as well as the development of new techniques to extend operational lifetimes. This thesis is primarily concerned with the design and construction of a Small Modular Laboratory Hall Effect Thruster (SMLHET), and its operation on argon propellant gas. Particular attention was addressed at low-cost, modular design principles, that would facilitate simple replacement and modification of key thruster parts such as the magnetic circuit and discharge channel. This capability is intended to facilitate future studies of device physics such as anomalous electron transport and magnetic shielding of the channel walls, that have an impact on thruster performance and life. Preliminary results demonstrate SMLHET running on argon in a manner characteristic of Hall effect thrusters, additionally a power balance method was utilized to estimate thruster performance. It is expected that future thruster studies utilizing heavier though more expensive gases like xenon or krypton, will observe increased efficiency and stability.

  19. June 1992 Hall B collaboation meeting

    International Nuclear Information System (INIS)

    Dennis, L.

    1992-01-01

    The Hall B collaboration meeting at the CEBAF 1992 Summer Workshop consisted of technical and physics working group meetings, a special beam line devices working group meeting the first meeting of the membership committee, a technical representatives meeting and a full collaboration meeting. Highlights of these meetings are presented in this report

  20. Chapin Hall Projects and Publications. Autumn 1999.

    Science.gov (United States)

    Chicago Univ., IL. Chapin Hall Center for Children.

    This guide chronicles the ongoing work and writings of the Chapin Hall Center for Children at the University of Chicago, a policy research center dedicated to bringing sound information, rigorous analyses, innovative ideas, and an independent, multidisciplinary perspective to bear on policies and programs affecting children. This guide, organized…

  1. Quantum Hall Conductivity and Topological Invariants

    Science.gov (United States)

    Reyes, Andres

    2001-04-01

    A short survey of the theory of the Quantum Hall effect is given emphasizing topological aspects of the quantization of the conductivity and showing how topological invariants can be derived from the hamiltonian. We express these invariants in terms of Chern numbers and show in precise mathematical terms how this relates to the Kubo formula.

  2. Room acoustic properties of concert halls

    DEFF Research Database (Denmark)

    Gade, Anders Christian

    1996-01-01

    A large database of values of various room acoustic parameters has provided the basis for statistical analyses of how and how much the acoustic properties of concert halls are influenced by their size, shape, and absorption area (as deduced from measured reverberation time). The data have been...

  3. Pseudospin anisotropy classification of quantum Hall ferromagnets

    Czech Academy of Sciences Publication Activity Database

    Jungwirth, Tomáš; MacDonald, A. H.

    2000-01-01

    Roč. 63, č. 3 (2000), s. 035305-1 - 035305-9 ISSN 0163-1829 R&D Projects: GA ČR GA202/98/0085 Institutional research plan: CEZ:AV0Z1010914 Keywords : quantum Hall ferromagnets * anisotropy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.065, year: 2000

  4. Anomalous Hall effect in disordered multiband metals

    Czech Academy of Sciences Publication Activity Database

    Kovalev, A.A.; Sinova, Jairo; Tserkovnyak, Y.

    2010-01-01

    Roč. 105, č. 3 (2010), 036601/1-036601/4 ISSN 0031-9007 Institutional research plan: CEZ:AV0Z10100521 Keywords : anomalous Hall effect * spintronics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 7.621, year: 2010

  5. Anomalous Hall conductivity: Local orbitals approach

    Czech Academy of Sciences Publication Activity Database

    Středa, Pavel

    2010-01-01

    Roč. 82, č. 4 (2010), 045115/1-045115/9 ISSN 1098-0121 Institutional research plan: CEZ:AV0Z10100521 Keywords : anomalous Hall effect * Berry phase correction * orbital polarization momentum Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.772, year: 2010

  6. Quantization and hall effect: necessities and difficulties

    International Nuclear Information System (INIS)

    Ahmed Bouketir; Hishamuddin Zainuddin

    1999-01-01

    The quantization procedure is a necessary tool for a proper understanding of many interesting quantum phenomena in modern physics. In this note, we focus on geometrical framework for such procedures, particularly the group-theoretic approach and their difficulties. Finally we look through the example of Hall effect as a quantized macroscopic phenomenon with group-theoretic quantization approach. (author)

  7. Spin Hall effect on a noncommutative space

    International Nuclear Information System (INIS)

    Ma Kai; Dulat, Sayipjamal

    2011-01-01

    We study the spin-orbital interaction and the spin Hall effect of an electron moving on a noncommutative space under the influence of a vector potential A(vector sign). On a noncommutative space, we find that the commutator between the vector potential A(vector sign) and the electric potential V 1 (r(vector sign)) of the lattice induces a new term, which can be treated as an effective electric field, and the spin Hall conductivity obtains some correction. On a noncommutative space, the spin current and spin Hall conductivity have distinct values in different directions, and depend explicitly on the noncommutative parameter. Once this spin Hall conductivity in different directions can be measured experimentally with a high level of accuracy, the data can then be used to impose bounds on the value of the space noncommutativity parameter. We have also defined a new parameter, σ=ρθ (ρ is the electron concentration, θ is the noncommutativity parameter), which can be measured experimentally. Our approach is based on the Foldy-Wouthuysen transformation, which gives a general Hamiltonian of a nonrelativistic electron moving on a noncommutative space.

  8. Prospect of quantum anomalous Hall and quantum spin Hall effect in doped kagome lattice Mott insulators.

    Science.gov (United States)

    Guterding, Daniel; Jeschke, Harald O; Valentí, Roser

    2016-05-17

    Electronic states with non-trivial topology host a number of novel phenomena with potential for revolutionizing information technology. The quantum anomalous Hall effect provides spin-polarized dissipation-free transport of electrons, while the quantum spin Hall effect in combination with superconductivity has been proposed as the basis for realizing decoherence-free quantum computing. We introduce a new strategy for realizing these effects, namely by hole and electron doping kagome lattice Mott insulators through, for instance, chemical substitution. As an example, we apply this new approach to the natural mineral herbertsmithite. We prove the feasibility of the proposed modifications by performing ab-initio density functional theory calculations and demonstrate the occurrence of the predicted effects using realistic models. Our results herald a new family of quantum anomalous Hall and quantum spin Hall insulators at affordable energy/temperature scales based on kagome lattices of transition metal ions.

  9. Digital technology impacts on the Arnhem transfer hall structural design

    NARCIS (Netherlands)

    Van de Straat, R.; Hofman, S.; Coenders, J.L.; Paul, J.C.

    2015-01-01

    The new Transfer Hall in Arnhem is one of the key projects to prepare the Dutch railways for the increased future demands for capacity. UNStudio developed a master plan in 1996 for the station area of which the completion of the Transfer Hall in 2015 will be a final milestone. The Transfer Hall is a

  10. Magnetoresistance in quantum Hall metals due to Pancharatnam ...

    Indian Academy of Sciences (India)

    Abstract. We derive the trial Hall resistance formula for the quantum Hall metals to address both the integer and fractional quantum Hall effects. Within the degenerate (and crossed) Landau levels, and in the presence of changing magnetic field strength, one can invoke two physical processes responsible for the electron ...

  11. Destruction of the fractional quantum Hall effect by disorder

    International Nuclear Information System (INIS)

    Laughlin, R.B.

    1985-07-01

    It is suggested that Hall steps in the fractional quantum Hall effect are physically similar to those in the ordinary quantum Hall effect. This proposition leads to a simple scaling diagram containing a new type of fixed point, which is identified with the destruction of the fractional states by disorder. 15 refs., 3 figs

  12. A Hall probe technique for characterizing high-temperature superconductors

    International Nuclear Information System (INIS)

    Zhang, J.; Sheldon, P.; Ahrenkiel, R.K.

    1992-01-01

    Thin-film GaAs Hall probes were fabricated by molecular beam epitaxy technology. A contactless technique was developed to characterize thin-film, high-temperature superconducting (HTSC) materials. The Hall probes detected the ac magnetic flux penetration through the high-temperature superconducting materials. The Hall detector has advantages over the mutual inductance magnetic flux detector

  13. Spin-singlet hierarchy in the fractional quantum Hall effect

    OpenAIRE

    Ino, Kazusumi

    1999-01-01

    We show that the so-called permanent quantum Hall states are formed by the integer quantum Hall effects on the Haldane-Rezayi quantum Hall state. Novel conformal field theory description along with this picture is deduced. The odd denominator plateaux observed around $\

  14. Overview of fusion reactor safety

    International Nuclear Information System (INIS)

    Cohen, S.; Crocker, J.G.

    1981-01-01

    Use of deuterium-tritium burning fusion reactors requires examination of several major safety and environmental issues: (1) tritium inventory control, (2) neutron activation of structural materials, fluid streams and reactor hall environment, (3) release of radioactivity from energy sources including lithium spill reactions, superconducting magnet stored energy release, and plasma disruptions, (4) high magnetic and electromagnetic fields associated with fusion reactor superconducting magnets and radio frequency heating devices, and (5) handling and disposal of radioactive waste. Early recognition of potential safety problems with fusion reactors provides the opportunity for improvement in design and materials to eliminate or greatly reduce these problems. With an early start in this endeavor, fusion should be among the lower risk technologies for generation of commercial electrical power

  15. Topological honeycomb magnon Hall effect: A calculation of thermal Hall conductivity of magnetic spin excitations

    Energy Technology Data Exchange (ETDEWEB)

    Owerre, S. A., E-mail: solomon@aims.ac.za [African Institute for Mathematical Sciences, 6 Melrose Road, Muizenberg, Cape Town 7945, South Africa and Perimeter Institute for Theoretical Physics, 31 Caroline St. N., Waterloo, Ontario N2L 2Y5 (Canada)

    2016-07-28

    Quite recently, the magnon Hall effect of spin excitations has been observed experimentally on the kagome and pyrochlore lattices. The thermal Hall conductivity κ{sup xy} changes sign as a function of magnetic field or temperature on the kagome lattice, and κ{sup xy} changes sign upon reversing the sign of the magnetic field on the pyrochlore lattice. Motivated by these recent exciting experimental observations, we theoretically propose a simple realization of the magnon Hall effect in a two-band model on the honeycomb lattice. The magnon Hall effect of spin excitations arises in the usual way via the breaking of inversion symmetry of the lattice, however, by a next-nearest-neighbour Dzyaloshinsky-Moriya interaction. We find that κ{sup xy} has a fixed sign for all parameter regimes considered. These results are in contrast to the Lieb, kagome, and pyrochlore lattices. We further show that the low-temperature dependence on the magnon Hall conductivity follows a T{sup 2} law, as opposed to the kagome and pyrochlore lattices. These results suggest an experimental procedure to measure thermal Hall conductivity within a class of 2D honeycomb quantum magnets and ultracold atoms trapped in a honeycomb optical lattice.

  16. The evaluation of research reactor TRIGA MARK II safety

    International Nuclear Information System (INIS)

    Jordan, R.; Kozuh, M.; Mavko, B.

    1994-01-01

    In the paper the Probabilistic Safety Analysis (PSA) of a research reactor is described. Five different initiating events were selected and analyzed with the use of event trees. Seven reactor systems were modeled with fault trees. Three groups of radiation releases were introduced - Success, Reactor-Hall, Environment - and their frequencies were estimated. The importance factors of initiating events, human errors and basic events were calculated regarding the consequence groups. (author)

  17. [Epidemiological profile of traumatic brain injury at the Dr. Rafael A. Calderón Guardia Hospital, Neurosurgery Department, during the period from 2007 to 2012].

    Science.gov (United States)

    Petgrave-Pérez, Alexander; Padilla, Juan I; Díaz, José; Chacón, Rosarito; Chaves, Carlos; Torres, Héctor; Fernández, Jorge

    2016-01-01

    To determine the epidemiological profile of the patients who suffered traumatic brain injury (TBI) and were treated at the Dr. Rafael A. Calderón Guardia Hospital (HCG) Neurosurgery department, during the period from 2007 to 2012. An observational, descriptive, retrospective and cross section study was performed on all the patients with TBI and who were admitted to the emergency room of the HCG during the period 2007 to 2012. There were a total of 721 cases, of which 566 records were obtained of patients who had the variables established in this study, excluding those with incomplete or inconsistent information. The present study established the epidemiological profile of the TBI in the population seen during the period 2007 to 2012 at the HCG. It was determined that the male sex made up the majority of the cases were male, with mean age of 46 years. The mortality rate was 12.69% (n=69). Car accidents were the most frequent cause of TBI (n=259 persons) in the age group of 25 to 44 years, followed by falls (n=174). It was observed that the majority were farmers, followed by students, and then construction workers. No chronic illnesses were recorded in 71.6% of the medical charts. No alcohol or other drugs were reported in 74.9% of the cases, while there was evidence of the presence of alcohol recorded in 22.8%. The clinical and laboratory parameters that had statistical significance (Paccidents being the main cause of these lesions (45.8%) in combination with alcohol consumption. Also, the consequences of such are aggravated when the victims present with chronic diseases such as, systemic arterial hypertension and mellitus diabetes. As regards the post-traumatic indicators directly related to a poor outcome, it was determined that a GCS score equal to or less than 8, a mean blood pressure less than 60, the prolongation of the coagulation times, the presence of mydriasis, and skull fractures, have a direct association with the negative or fatal outcome for the

  18. Interaction with epsin 1 regulates the constitutive clathrin-dependent internalization of ErbB3.

    Science.gov (United States)

    Szymanska, Monika; Fosdahl, Anne Marthe; Raiborg, Camilla; Dietrich, Markus; Liestøl, Knut; Stang, Espen; Bertelsen, Vibeke

    2016-06-01

    In contrast to other members of the EGF receptor family, ErbB3 is constitutively internalized in a clathrin-dependent manner. Previous studies have shown that ErbB3 does not interact with the coated pit localized adaptor complex 2 (AP-2), and that ErbB3 lacks two AP-2 interacting internalization signals identified in the EGF receptor. Several other clathrin-associated sorting proteins which may recruit cargo into coated pits have, however, been identified, and the study was performed to identify adaptors needed for constitutive internalization of ErbB3. A high-throughput siRNA screen was used to identify adaptor proteins needed for internalization of ErbB3. Upon knock-down of candidate proteins internalization of ErbB3 was identified using an antibody-based internalization assay combined with automatic fluorescence microscopy. Among 29 candidates only knock-down of epsin 1 turned out to inhibit ErbB3. Epsin 1 has ubiquitin interacting motifs (UIMs) and we show that ErbB3 interacts with an epsin 1 deletion mutant containing these UIMs. In support of an ErbB3-epsin 1 UIM dependent interaction, we show that ErbB3 is constitutively ubiquitinated, but that both ubiquitination and the ErbB3-epsin 1 interaction increase upon ligand binding. Altogether the results are consistent with a model whereby both constitutive and ligand-induced internalization of ErbB3 are regulated through interaction with epsin 1. Internalization is an important regulator of growth factor receptor mediated signaling and the current study identify mechanisms regulating plasma membrane turnover of ErbB3. Copyright © 2016 Elsevier B.V. All rights reserved.

  19. Diagnostics Systems for Permanent Hall Thrusters Development

    Science.gov (United States)

    Ferreira, Jose Leonardo; Soares Ferreira, Ivan; Santos, Jean; Miranda, Rodrigo; Possa, M. Gabriela

    This work describes the development of Permanent Magnet Hall Effect Plasma Thruster (PHALL) and its diagnostic systems at The Plasma Physics Laboratory of University of Brasilia. The project consists on the construction and characterization of plasma propulsion engines based on the Hall Effect. Electric thrusters have been employed in over 220 successful space missions. Two types stand out: the Hall-Effect Thruster (HET) and the Gridded Ion Engine (GIE). The first, which we deal with in this project, has the advantage of greater simplicity of operation, a smaller weight for the propulsion subsystem and a longer shelf life. It can operate in two configurations: magnetic layer and anode layer, the difference between the two lying in the positioning of the anode inside the plasma channel. A Hall-Effect Thruster-HET is a type of plasma thruster in which the propellant gas is ionized and accelerated by a magneto hydrodynamic effect combined with electrostatic ion acceleration. So the essential operating principle of the HET is that it uses a J x B force and an electrostatic potential to accelerate ions up to high speeds. In a HET, the attractive negative charge is provided by electrons at the open end of the Thruster instead of a grid, as in the case of the electrostatic ion thrusters. A strong radial magnetic field is used to hold the electrons in place, with the combination of the magnetic field and the electrostatic potential force generating a fast circulating electron current, the Hall current, around the axis of the Thruster, mainly composed by drifting electrons in an ion plasma background. Only a slow axial drift towards the anode occurs. The main attractive features of the Hall-Effect Thruster are its simple design and operating principles. Most of the Hall-Effect Thrusters use electromagnet coils to produce the main magnetic field responsible for plasma generation and acceleration. In this paper we present a different new concept, a Permanent Magnet Hall

  20. Valley-chiral quantum Hall state in graphene superlattice structure

    Science.gov (United States)

    Tian, H. Y.; Tao, W. W.; Wang, J.; Cui, Y. H.; Xu, N.; Huang, B. B.; Luo, G. X.; Hao, Y. H.

    2016-05-01

    We theoretically investigate the quantum Hall effect in a graphene superlattice (GS) system, in which the two valleys of graphene are coupled together. In the presence of a perpendicular magnetic field, an ordinary quantum Hall effect is found with the sequence σxy=ν e^2/h(ν=0,+/-1,+/-2,\\cdots) . At the zeroth Hall platform, a valley-chiral Hall state stemming from the single K or K' valley is found and it is localized only on one sample boundary contributing to the longitudinal conductance but not to the Hall conductivity. Our findings may shed light on the graphene-based valleytronics applications.

  1. Accurate micro Hall effect measurements on scribe line pads

    DEFF Research Database (Denmark)

    Østerberg, Frederik Westergaard; Petersen, Dirch Hjorth; Wang, Fei

    2009-01-01

    Hall mobility and sheet carrier density are important parameters to monitor in advanced semiconductor production. If micro Hall effect measurements are done on small pads in scribe lines, these parameters may be measured without using valuable test wafers. We report how Hall mobility can...... be extracted from micro four-point measurements performed on a rectangular pad. The dimension of the investigated pad is 400 × 430 ¿m2, and the probe pitches range from 20 ¿m to 50 ¿m. The Monte Carlo method is used to find the optimal way to perform the Hall measurement and extract Hall mobility most...

  2. Revisión crítica de la construcción de un mito en sacramentales El gran teatro del mundo y La vida es sueño, de Pedro Calderón de la Barca

    OpenAIRE

    Irene González Muñoz

    2012-01-01

    En este artículo se realiza una lectura de dos de los autos sacramentales de Pedro Calderón de la Barca, a partir de una revisión crítica que evidencia los presupuestos ideológicos que fundamentan estas producciones literarias.

  3. Revisión crítica de la construcción de un mito en sacramentales El gran teatro del mundo y La vida es sueño, de Pedro Calderón de la Barca

    Directory of Open Access Journals (Sweden)

    Irene González Muñoz

    2012-11-01

    Full Text Available En este artículo se realiza una lectura de dos de los autos sacramentales de Pedro Calderón de la Barca, a partir de una revisión crítica que evidencia los presupuestos ideológicos que fundamentan estas producciones literarias.

  4. Dosimetry and radiation shielding at the RA reactor, Annual report 1975, Annex 5

    International Nuclear Information System (INIS)

    Ninkovic, M.

    1976-01-01

    In the working environment at the RA reactor, the level of gamma radiation is measured continuously by the built-in stationary system. According to the needs, measurement are done in the reactor hall every day. The level of gamma radiation is measured separately in typical points when the reactor is operated at nominal power and during intervals between two operating campaigns. The level of neutron radiation is measured according to the needs by means of a mobile spherical neutron detector. These measurements are done in the reactor hall around the horizontal experimental channels. Measured values of neutron radiation are three times lower than the relevant levels of gamma radiation [sr

  5. Program of RA reactor start-up to nominal power

    International Nuclear Information System (INIS)

    1959-01-01

    The zero start-up program is followed by the program of RA reactor start-up to nominal power. This program is described in detail and includes the following measurements: radiation characteristics at the exit of the channels; gamma and fast neutron dose distribution in the reactor; influence of absorbers on the reactivity; temperature effect; absolute flux and calibration of ionization chambers; xenon effect; thermal and hydraulics; dosimetry around the reactor; neutron flux in the reactor core and in the reactor hall; heavy water level; thermal characteristics after shutdown. A list of measuring devices and instrumentation is included with the detailed action plan and list of responsible staff members

  6. Giant photonic Hall effect in magnetophotonic crystals.

    Science.gov (United States)

    Merzlikin, A M; Vinogradov, A P; Inoue, M; Granovsky, A B

    2005-10-01

    We have considered a simple, square, two-dimensional (2D) PC built of a magneto-optic matrix with square holes. It is shown that using such a magnetophotonic crystal it is possible to deflect a light beam at very large angles by applying a nonzero external magnetic field. The effect is called the giant photonic Hall effect (GPHE) or the magnetic superprism effect. The GPHE is based on magneto-optical properties, as is the photonic Hall effect [B. A. van Tiggelen and G. L. J. A. Rikken, in, edited by V. M. Shalaev (Springer-Verlag, Berlin, 2002), p. 275]; however GPHE is not caused by asymmetrical light scattering but rather by the influence of an external magnetic field on the photonic band structure.

  7. Assessment of elevator rope using Hall Sensor

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jong O; Yoon, Woon Ha; Son, Young Ho; Kim, Jung Woo [Korea Institute of Machinery and Materials, Daejeon (Korea, Republic of); Lee, Jong Ku [Pukyung National University, Pusan (Korea, Republic of)

    2003-07-01

    Defect detection of wire rope for an elevator was investigated through the measurement of magnetic flux leakage. The types of defect usually found in wire rope categorized such as inner and outer wire breakage and wear. The specimens that has artificial defects were magnetized via permanent magnet, and measurement of magnetic flux leakage on the defects was performed with Hall sensor. In wire broken model, a defect smaller than 0.4 mm and 1 mm in depth on outer and inner wire rope, respectively, could be detected well. In wear model, smaller defect could not be detected clearly, however, appearance of changing of total magnetic flux during magnetic pole of the sensor passing through a defect 0.2 mm in depth at 4 mm or above width could make possible to detect it. From the results, the measurement via Hall sensor might be useful tool for defect detection of wire rope.

  8. Assesment of elevator rope using hall sensor

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jong O; Yoon, Woon Ha; Son, Young Ho [Korea Institute of Machinery and Materials, Daejeon (Korea, Republic of); Kim, Jung Woo; Lee, Jong Ku [Pukyong National University, Pusan (Korea, Republic of)

    2003-05-15

    Defect detection of wire rope for an elevator was investigated through the measurement of magnetic flux leakage. The types of defect usually found in wire rope categorized such as inner and outer wire breakage and wear. The specimens that has artificial defects were magnetized via permanent magnet, and measurement of magnetic flux leakage on the defects was performed with Hall sensor. In wire broken model, a defect smaller than 0.4mm and 1mm in depth on outer and inner wire rope, respectively, could be detected well. In wear model, smaller defect could not be detected clearly, however, appearance of changing of total magnetic flux during magnetic pole of the sensor passing through a defect 0.2mm in depth at 4mm or above width could make possible to detect it. From the results, the measurement via Hall sensor might be useful tool for defect detection of wire rope.

  9. Infinite symmetry in the quantum Hall effect

    Directory of Open Access Journals (Sweden)

    Lütken C.A.

    2014-04-01

    Full Text Available The new states of matter and concomitant quantum critical phenomena revealed by the quantum Hall effect appear to be accompanied by an emergent modular symmetry. The extreme rigidity of this infinite symmetry makes it easy to falsify, but two decades of experiments have failed to do so, and the location of quantum critical points predicted by the symmetry is in increasingly accurate agreement with scaling experiments. The symmetry severely constrains the structure of the effective quantum field theory that encodes the low energy limit of quantum electrodynamics of 1010 charges in two dirty dimensions. If this is a non-linear σ-model the target space is a torus, rather than the more familiar sphere. One of the simplest toroidal models gives a critical (correlation length exponent that agrees with the value obtained from numerical simulations of the quantum Hall effect.

  10. Stuart Hall and Cultural Studies, circa 1983

    Directory of Open Access Journals (Sweden)

    Ann Curthoys

    2017-11-01

    Full Text Available Stuart Hall sought to internationalise theoretical debates and to create Cultural Studies as interdisciplinary. We chart his theoretical journey through a detailed examination of a series of lectures delivered in 1983 and now published for the first time. In these lectures, he discusses theorists such as E.P. Thompson, Raymond Williams, Louis Althusser, Levi Strauss and Antonio Gramsci, and explores the relationship between ideas and social structure, the specificities of class and race, and the legacies of slavery. We note his turn towards metaphors of divergence and dispersal and highlight how autobiographical and deeply personal Hall is in these lectures, especially in his ego histoire moment of traumatic memory recovery.

  11. Hall magnetohydrodynamics: Conservation laws and Lyapunov stability

    International Nuclear Information System (INIS)

    Holm, D.D.

    1987-01-01

    Hall electric fields produce circulating mass flow in confined ideal-fluid plasmas. The conservation laws, Hamiltonian structure, equilibrium state relations, and Lyapunov stability conditions are presented here for ideal Hall magnetohydrodynamics (HMHD) in two and three dimensions. The approach here is to use the remarkable array of nonlinear conservation laws for HMHD that follow from its Hamiltonian structure in order to construct explicit Lyapunov functionals for the HMHD equilibrium states. In this way, the Lyapunov stability analysis provides classes of HMHD equilibria that are stable and whose linearized initial-value problems are well posed (in the sense of possessing continuous dependence on initial conditions). Several examples are discussed in both two and three dimensions

  12. Music hall Markneukirchen; Musikhalle in Markneukirchen

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1996-01-01

    The article presents the new building of the music hall Markneukirchen. From the planned use of the building result very high demands on the ventilation system in order to keep to a sound power level of less than 30 dB(A) in the hall. The building services are dealt with using numerous flowsheets and diagrams: Heat supply, ventilation system, sanitary system, building management, instrumentation and control, electric and lighting systems. (BWI) [Deutsch] Der vorliegende Beitrag stellt den Neubau der Musikhalle Markneukirchen vor. Durch das Nutzungskonzept ergeben sich fuer die Einhaltung eines Schalleistungspegels von weniger als 30 dB(A) im Saalbereich an die Lueftungsanlage sehr hohe Ansprueche. Es werden die raumlufttechnischen Anlagen anhand zahlreicher Flussbilder und Abbildungen vorgestellt: Waermeversorgung, Lueftungstechnik, Sanitaertechnik, Gebaeudeleit- und MSR-Technik, Elektro- und Lichttechnik. (BWI)

  13. Theory of fractional quantum hall effect

    International Nuclear Information System (INIS)

    Kostadinov, I.Z.

    1985-08-01

    A theory of the Fractional Quantum Hall Effect is constructed based on magnetic flux fractionization, which lead to instability of the system against selfcompression. A theorem is proved stating that arbitrary potentials fail to lift a specific degeneracy of the Landau level. For the case of 1/3 fractional filling a model 3-particles interaction is constructed breaking the symmetry. The rigid 3-particles wave function plays the role of order parameter. In a BCS type of theory the gap in the single particles spectrum is produced by the 3-particles interaction. The mean field critical behaviour and critical parameters are determined as well as the Ginsburg-Landau equation coefficients. The Hall conductivity is calculated from the first principles and its temperature dependence is found. The simultaneous tunnelling of 3,5,7 etc. electrons and quantum interference effects are predicted. (author)

  14. Coulomb blockade in hierarchical quantum Hall droplets

    International Nuclear Information System (INIS)

    Cappelli, Andrea; Georgiev, Lachezar S; Zemba, Guillermo R

    2009-01-01

    The degeneracy of energy levels in a quantum dot of Hall fluid, leading to conductance peaks, can be readily derived from the partition functions of conformal field theory. Their complete expressions can be found for Hall states with both Abelian and non-Abelian statistics, upon adapting known results for the annulus geometry. We analyze the Abelian states with hierarchical filling fractions, ν = m/(mp ± 1), and find a non-trivial pattern of conductance peaks. In particular, each one of them occurs with a characteristic multiplicity, which is due to the extended symmetry of the m-folded edge. Experimental tests of the multiplicity can shed more light on the dynamics of this composite edge. (fast track communication)

  15. Assessment of elevator rope using Hall Sensor

    International Nuclear Information System (INIS)

    Lee, Jong O; Yoon, Woon Ha; Son, Young Ho; Kim, Jung Woo; Lee, Jong Ku

    2003-01-01

    Defect detection of wire rope for an elevator was investigated through the measurement of magnetic flux leakage. The types of defect usually found in wire rope categorized such as inner and outer wire breakage and wear. The specimens that has artificial defects were magnetized via permanent magnet, and measurement of magnetic flux leakage on the defects was performed with Hall sensor. In wire broken model, a defect smaller than 0.4 mm and 1 mm in depth on outer and inner wire rope, respectively, could be detected well. In wear model, smaller defect could not be detected clearly, however, appearance of changing of total magnetic flux during magnetic pole of the sensor passing through a defect 0.2 mm in depth at 4 mm or above width could make possible to detect it. From the results, the measurement via Hall sensor might be useful tool for defect detection of wire rope.

  16. Assesment of elevator rope using hall sensor

    International Nuclear Information System (INIS)

    Lee, Jong O; Yoon, Woon Ha; Son, Young Ho; Kim, Jung Woo; Lee, Jong Ku

    2003-01-01

    Defect detection of wire rope for an elevator was investigated through the measurement of magnetic flux leakage. The types of defect usually found in wire rope categorized such as inner and outer wire breakage and wear. The specimens that has artificial defects were magnetized via permanent magnet, and measurement of magnetic flux leakage on the defects was performed with Hall sensor. In wire broken model, a defect smaller than 0.4mm and 1mm in depth on outer and inner wire rope, respectively, could be detected well. In wear model, smaller defect could not be detected clearly, however, appearance of changing of total magnetic flux during magnetic pole of the sensor passing through a defect 0.2mm in depth at 4mm or above width could make possible to detect it. From the results, the measurement via Hall sensor might be useful tool for defect detection of wire rope.

  17. Judy Estes Hall (1940-2015).

    Science.gov (United States)

    Sammons, Morgan T; Boucher, Andrew

    2016-01-01

    Presents an obituary for Judy Estes Hall, who passed away on November 24, 2015. Hall served as the Executive Officer of the National Register of Health Service Psychologists until her retirement in 2013. She is a recognized expert in the development of education and training standards for the profession of psychology, she also made significant contributions in the field of international psychology, where she was a renowned expert in cross-national credentialing and an advocate for commonality in licensing standards. She was the coauthor of one edited volume and author of more than 60 journal articles, book chapters, and professional publications. A passionate advocate for the advancement of women in psychology, a devoted mother and grandmother, a connoisseur of wine and international traveler extraordinaire, she touched the personal and professional lives of many. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

  18. Homotopy arguments for quantized Hall conductivity

    CERN Document Server

    Richter, T

    2002-01-01

    Using the strong localization bounds obtained by the Aizenman-Molcanov method for a particle in a magnetic field and a disordered potential, we show that the zero-temperature Hall conductivity of a gas of such particles is quantized and constant as long as both Fermi energy and disorder coupling parameter vary in a region of strong localization of the corresponding two-dimensional phase diagram.

  19. SPS beam to the West Hall

    CERN Multimedia

    CERN PhotoLab

    1976-01-01

    One of the two target stations feeding the West Hall (see Annual Report 1976). After the proton beam was split into three branches, the outer two were directed on to targets in the cast iron shielding box, the centre one passing through the box to another target station downstream. Five different targets could be put in each beam, controlled by the mechanism seen on top.

  20. Anomalous hall effect in ferromagnetic semiconductors

    Czech Academy of Sciences Publication Activity Database

    Jungwirth, Tomáš; Niu, Q.; MacDonald, A. H.

    2002-01-01

    Roč. 88, č. 20 (2002), s. 207208-1-207208-4 ISSN 0031-9007 R&D Projects: GA ČR GA202/02/0912; GA MŠk OC P5.10 Institutional research plan: CEZ:AV0Z1010914 Keywords : ferromagnetic semiconductors * anomalous Hall effect Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 7.323, year: 2002

  1. A hall for assembly and cryogenic tests

    International Nuclear Information System (INIS)

    Beaunier, J.; Buhler, S.; Caruette, A.; Chevrollier, R.; Junquera, T.; Le Scornet, J.C.

    1999-01-01

    Cryodrome, an assembly hall and the testing ground for cryogenic equipment and R and D experiments for the superconducting cavities is going to be transformed for its future missions. The cryogenic utilities, especially the He low pressure pumping capacity, was rearranged and extended to a new area. Space was provided to install CRYHOLAB, a new horizontal cryostat for cavity testing. Automatic control and supervision of the utilities and the experimental area are rebuilt and updated. (authors)

  2. Generic superweak chaos induced by Hall effect

    Science.gov (United States)

    Ben-Harush, Moti; Dana, Itzhack

    2016-05-01

    We introduce and study the "kicked Hall system" (KHS), i.e., charged particles periodically kicked in the presence of uniform magnetic (B ) and electric (E ) fields that are perpendicular to each other and to the kicking direction. We show that for resonant values of B and E and in the weak-chaos regime of sufficiently small nonintegrability parameter κ (the kicking strength), there exists a generic family of periodic kicking potentials for which the Hall effect from B and E significantly suppresses the weak chaos, replacing it by "superweak" chaos (SWC). This means that the system behaves as if the kicking strength were κ2 rather than κ . For E =0 , SWC is known to be a classical fingerprint of quantum antiresonance, but it occurs under much less generic conditions, in particular only for very special kicking potentials. Manifestations of SWC are a decrease in the instability of periodic orbits and a narrowing of the chaotic layers, relative to the ordinary weak-chaos case. Also, for global SWC, taking place on an infinite "stochastic web" in phase space, the chaotic diffusion on the web is much slower than the weak-chaos one. Thus, the Hall effect can be relatively stabilizing for small κ . In some special cases, the effect is shown to cause ballistic motion for almost all parameter values. The generic global SWC on stochastic webs in the KHS appears to be the two-dimensional closest analog to the Arnol'd web in higher dimensional systems.

  3. Anode Fall Formation in a Hall Thruster

    International Nuclear Information System (INIS)

    Dorf, Leonid A.; Raitses, Yevgeny F.; Smirnov, Artem N.; Fisch, Nathaniel J.

    2004-01-01

    As was reported in our previous work, accurate, nondisturbing near-anode measurements of the plasma density, electron temperature, and plasma potential performed with biased and emissive probes allowed the first experimental identification of both electron-repelling (negative anode fall) and electron-attracting (positive anode fall) anode sheaths in Hall thrusters. An interesting new phenomenon revealed by the probe measurements is that the anode fall changes from positive to negative upon removal of the dielectric coating, which appears on the anode surface during the course of Hall thruster operation. As reported in the present work, energy dispersion spectroscopy analysis of the chemical composition of the anode dielectric coating indicates that the coating layer consists essentially of an oxide of the anode material (stainless steel). However, it is still unclear how oxygen gets into the thruster channel. Most importantly, possible mechanisms of anode fall formation in a Hall thruster with a clean and a coated anodes are analyzed in this work; practical implication of understanding the general structure of the electron-attracting anode sheath in the case of a coated anode is also discussed

  4. Josephson tunneling in bilayer quantum Hall system

    International Nuclear Information System (INIS)

    Ezawa, Z.F.; Tsitsishvili, G.; Sawada, A.

    2012-01-01

    A Bose–Einstein condensation is formed by composite bosons in the quantum Hall state. A composite boson carries the fundamental charge (−e). We investigate Josephson tunneling of such charges in the bilayer quantum Hall system at the total filling ν=1. We show the existence of the critical current for the tunneling current to be coherent and dissipationless. Our results explain recent experiments due to [L. Tiemann, Y. Yoon, W. Dietsche, K. von Klitzing, W. Wegscheider, Phys. Rev. B 80 (2009) 165120] and due to [Y. Yoon, L. Tiemann, S. Schmult, W. Dietsche, K. von Klitzing, Phys. Rev. Lett. 104 (2010) 116802]. We predict also how the critical current changes as the sample is tilted in the magnetic field. -- Highlights: ► Composite bosons undergo Bose–Einstein condensation to form the bilayer quantum Hall state. ► A composite boson is a single electron bound to a flux quantum and carries one unit charge. ► Quantum coherence develops due to the condensation. ► Quantum coherence drives the supercurrent in each layer and the tunneling current. ► There exists the critical input current so that the tunneling current is coherent and dissipationless.

  5. Familial Pallister-Hall in adulthood.

    Science.gov (United States)

    Talsania, Mitali; Sharma, Rohan; Sughrue, Michael E; Scofield, R Hal; Lim, Jonea

    2017-10-01

    Pallister Hall syndrome is autosomal dominant disorder usually diagnosed in infants and children. Current diagnostic criteria include presence of hypothalamic hamartoma, post axial polydactyly and positive family history, but the disease has variable manifestations. Herein we report Pallister Hall syndrome diagnosed in a family where both patients were adults. A 59 year old man developed seizures 4 years prior to our evaluation of him, at which time imaging showed a hypothalamic hamartoma. The seizures were controlled medically. He did well until he had visual changes after a traumatic head injury. Repeat MRI showed slight expansion of the mass with formal visual field testing demonstrating bitemporal hemianopsia. There was no evidence of pituitary dysfunction except for large urine volume. He underwent surgery to debulk the hamartoma and the visual field defects improved. There was no hypopituitarism post-operatively, and the polydyspia resolved. His 29 year old daughter also had seizures and hypothalamic hamartoma. Both patients had had polydactyly with prior surgical correction in childhood. The daughter underwent genetic testing, which revealed a previously undescribed heterozygous single base pair deletion in exon 13 of the GLI3 gene causing a frameshift mutation. Further investigation into family history revealed multiple members in previous generations with polydactyly and/or seizures. Pallister-Hall syndrome is caused by an inherited autosomal dominant or de novo mutation in GLI3 gene. This rare syndrome has not had prevalence defined, however. Generally, diagnoses are made in the pediatric population. Our report adds to the few cases detected in adulthood.

  6. Safety of research reactors (Design and Operation)

    International Nuclear Information System (INIS)

    Dirar, H. M.

    2012-06-01

    The primary objective of this thesis is to conduct a comprehensive up-to-date literature review on the current status of safety of research reactor both in design and operation providing the future trends in safety of research reactors. Data and technical information of variety selected historical research reactors were thoroughly reviewed and evaluated, furthermore illustrations of the material of fuel, control rods, shielding, moderators and coolants used were discussed. Insight study of some historical research reactors was carried with considering sample cases such as Chicago Pile-1, F-1 reactor, Chalk River Laboratories,. The National Research Experimental Reactor and others. The current status of research reactors and their geographical distribution, reactor category and utilization is also covered. Examples of some recent advanced reactors were studied like safety barriers of HANARO of Korea including safety doors of the hall and building entrance and finger print identification which prevent the reactor from sabotage. On the basis of the results of this research, it is apparent that a high quality of safety of nuclear reactors can be attained by achieving enough robust construction, designing components of high levels of efficiency, replacing the compounds of the reactor in order to avoid corrosion and degradation with age, coupled with experienced scientists and technical staffs to operate nuclear research facilities.(Author)

  7. Nuclear reactors

    International Nuclear Information System (INIS)

    Barre, Bertrand

    2015-10-01

    After some remarks on the nuclear fuel, on the chain reaction control, on fuel loading and unloading, this article proposes descriptions of the design, principles and operations of different types of nuclear reactors as well as comments on their presence and use in different countries: pressurized water reactors (design of the primary and secondary circuits, volume and chemistry control, backup injection circuits), boiling water reactors, heavy water reactors, graphite and boiling water reactors, graphite-gas reactors, fast breeder reactors, and fourth generation reactors (definition, fast breeding). For these last ones, six concepts are presented: sodium-cooled fast reactor, lead-cooled fast reactor, gas-cooled fast reactor, high temperature gas-cooled reactor, supercritical water-cooled reactor, and molten salt reactor

  8. Tritium release during inspection of reactor 'RA' at 'Vinca' institute

    International Nuclear Information System (INIS)

    Sipka, V.; Miljevic, N.; Grsic, Z.; Todorovic, D.; Radenkovic, M.

    1997-01-01

    Tritium content in daily precipitation, atmospheric water vapor inside of the reactor hall and around 'Vinca' Institute as well as in soil up to 800 m distance was monitoring during the regular inspection of the fuel channels. Tritium activity in the reactor hall air moisture was in the range from 0.022 to 6.7 MBq/m 3 . Tritium content in soil moisture between 12.7 and 530.9 Bq/l indicate a certain contamination due to tritium release in the environment, depending on the depth and distance from the place of release (author) [sr

  9. Investigation of impact of neutron irradiation on properties of InSb-based hall plates

    Czech Academy of Sciences Publication Activity Database

    Ďuran, Ivan; Oszwaldowski, M.; Kovařík, Karel; Jankowski, J.; El-Ahmar, S.; Viererbl, L.; Lahodová, Z.

    2011-01-01

    Roč. 417, 1-3 (2011), s. 846-849 ISSN 0022-3115. [International Conference on Fusion Reactor Materials (ICFRM)/14./. Sapporo, 07.09.2009-12.09.2009] R&D Projects: GA MPO 2A-1TP1/101 Institutional research plan: CEZ:AV0Z20430508 Keywords : tokamak * Hall sensors * magnetic measurements * neutron irradiation Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.052, year: 2011 http://www.sciencedirect.com/science/article/pii/S0022311510009712

  10. A structure and second-harmonic generation of crystals Li B3O5

    International Nuclear Information System (INIS)

    Burak, Ya.V.

    1997-01-01

    Projections of atoms of nonlinear optical crystals Li B 3 O 5 onto planes perpendicular to directions of the phase matching of type-1 and type-2 for second-harmonic generation (SHG) in a YAG:Nd laser are constructed. Analyses of the interdependence of orientations of (B 3 O 7 ) 5 -complexes and of the effectiveness of SHG are conducted

  11. 26 CFR 48.6416(b)(3)-2 - Further manufacture included.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Further manufacture included. 48.6416(b)(3)-2... of Special Application to Retailers and Manufacturers Taxes § 48.6416(b)(3)-2 Further manufacture... overpayment by reason of any use in further manufacture, or sale as part of a second manufactured article...

  12. Roger Calder (1934 – 2014)

    CERN Multimedia

    2014-01-01

    Roger joined CERN’s Accelerator-Research Division in May 1963, at the beginning of the Intersecting Storage Rings (ISR) project. The challenge was to evacuate the two beam pipes of about 1 km each to 10-7 Pa and to obtain a beam lifetime of 20 hours. An ultra-high vacuum system of this size and complexity required the most advanced technologies available.   Among the outstanding contributions by Roger were: the choice of turbomolecular- and ion-pumps, low outgassing rates and an all-metal system bakeable to 300°C. Still today, Roger’s name is linked to "900°C vacuum degassed stainless steel" for very low hydrogen outgassing. The unexpected dynamic pressure run-away during the ISR start-up, at only a few A of beam, was quickly identified as the "ion-induced pressure bump instability". Among Roger’s efforts to mitigate this effect, the pumping system was supplemented with titanium sublimation pumps. In a second s...

  13. Genetic loss of SH2B3 in acute lymphoblastic leukemia.

    Science.gov (United States)

    Perez-Garcia, Arianne; Ambesi-Impiombato, Alberto; Hadler, Michael; Rigo, Isaura; LeDuc, Charles A; Kelly, Kara; Jalas, Chaim; Paietta, Elisabeth; Racevskis, Janis; Rowe, Jacob M; Tallman, Martin S; Paganin, Maddalena; Basso, Giuseppe; Tong, Wei; Chung, Wendy K; Ferrando, Adolfo A

    2013-10-03

    The SH2B adaptor protein 3 (SH2B3) gene encodes a negative regulator of cytokine signaling with a critical role in the homeostasis of hematopoietic stem cells and lymphoid progenitors. Here, we report the identification of germline homozygous SH2B3 mutations in 2 siblings affected with developmental delay and autoimmunity, one in whom B-precursor acute lymphoblastic leukemia (ALL) developed. Mechanistically, loss of SH2B3 increases Janus kinase-signal transducer and activator of transcription signaling, promotes lymphoid cell proliferation, and accelerates leukemia development in a mouse model of NOTCH1-induced ALL. Moreover, extended mutation analysis showed homozygous somatic mutations in SH2B3 in 2 of 167 ALLs analyzed. Overall, these results demonstrate a Knudson tumor suppressor role for SH2B3 in the pathogenesis of ALL and highlight a possible link between genetic predisposition factors in the pathogenesis of autoimmunity and leukemogenesis.

  14. Commemorative Symposium on the Hall Effect and its Applications

    CERN Document Server

    Westgate, C

    1980-01-01

    In 1879, while a graduate student under Henry Rowland at the Physics Department of The Johns Hopkins University, Edwin Herbert Hall discovered what is now universally known as the Hall effect. A symposium was held at The Johns Hopkins University on November 13, 1979 to commemorate the lOOth anniversary of the discovery. Over 170 participants attended the symposium which included eleven in­ vited lectures and three speeches during the luncheon. During the past one hundred years, we have witnessed ever ex­ panding activities in the field of the Hall effect. The Hall effect is now an indispensable tool in the studies of many branches of condensed matter physics, especially in metals, semiconductors, and magnetic solids. Various components (over 200 million!) that utilize the Hall effect have been successfully incorporated into such devices as keyboards, automobile ignitions, gaussmeters, and satellites. This volume attempts to capture the important aspects of the Hall effect and its applications. It includes t...

  15. Experimental test of 200 W Hall thruster with titanium wall

    Science.gov (United States)

    Ding, Yongjie; Sun, Hezhi; Peng, Wuji; Xu, Yu; Wei, Liqiu; Li, Hong; Li, Peng; Su, Hongbo; Yu, Daren

    2017-05-01

    We designed a 200 W Hall thruster based on the technology of pushing down a magnetic field with two permanent magnetic rings. Boron nitride (BN) is an important insulating wall material for Hall thrusters. The discharge characteristics of the designed Hall thruster were studied by replacing BN with titanium (Ti). Experimental results show that the designed Hall thruster can discharge stably for a long time under a Ti channel. Experiments were performed to determine whether the channel and cathode are electrically connected. When the channel wall and cathode are insulated, the divergence angle of the plume increases, but the performance of the Hall thruster is improved in terms of thrust, specific impulse, anode efficiency, and thrust-to-power ratio. Ti exhibits a powerful antisputtering capability, a low emanation rate of gas, and a large structural strength, making it a potential candidate wall material in the design of low-power Hall thrusters.

  16. Performance of Diesel Engine Using Diesel B3 Mixed with Crude Palm Oil

    Science.gov (United States)

    Namliwan, Nattapong; Wongwuttanasatian, Tanakorn

    2014-01-01

    The objective of this study was to test the performance of diesel engine using diesel B3 mixed with crude palm oil in ratios of 95 : 5, 90 : 10, and 85 : 15, respectively, and to compare the results with diesel B3. According to the tests, they showed that the physical properties of the mixed fuel in the ratio of 95 : 5 were closest to those of diesel B3. The performance of the diesel engine that used mixed fuels had 5–17% lower torque and power than that of diesel B3. The specific fuel consumption of mixed fuels was 7–33% higher than using diesel B3. The components of gas emissions by using mixed fuel had 1.6–52% fewer amount of carbon monoxide (CO), carbon dioxide (CO2), sulfur dioxide (SO2), and oxygen (O2) than those of diesel B3. On the other hand, nitric oxide (NO) and nitrogen oxides (NOX) emissions when using mixed fuels were 10–39% higher than diesel B3. By comparing the physical properties, the performance of the engine, and the amount of gas emissions of mixed fuel, we found out that the 95 : 5 ratio by volume was a suitable ratio for agricultural diesel engine (low-speed diesel engine). PMID:24688402

  17. Performance of diesel engine using diesel B3 mixed with crude palm oil.

    Science.gov (United States)

    Namliwan, Nattapong; Wongwuttanasatian, Tanakorn

    2014-01-01

    The objective of this study was to test the performance of diesel engine using diesel B3 mixed with crude palm oil in ratios of 95 : 5, 90 : 10, and 85 : 15, respectively, and to compare the results with diesel B3. According to the tests, they showed that the physical properties of the mixed fuel in the ratio of 95 : 5 were closest to those of diesel B3. The performance of the diesel engine that used mixed fuels had 5-17% lower torque and power than that of diesel B3. The specific fuel consumption of mixed fuels was 7-33% higher than using diesel B3. The components of gas emissions by using mixed fuel had 1.6-52% fewer amount of carbon monoxide (CO), carbon dioxide (CO2), sulfur dioxide (SO2), and oxygen (O2) than those of diesel B3. On the other hand, nitric oxide (NO) and nitrogen oxides (NO X ) emissions when using mixed fuels were 10-39% higher than diesel B3. By comparing the physical properties, the performance of the engine, and the amount of gas emissions of mixed fuel, we found out that the 95 : 5 ratio by volume was a suitable ratio for agricultural diesel engine (low-speed diesel engine).

  18. Hall Sensor Output Signal Fault-Detection & Safety Implementation Logic

    Directory of Open Access Journals (Sweden)

    Lee SangHun

    2016-01-01

    Full Text Available Recently BLDC motors have been popular in various industrial applications and electric mobility. Recently BLDC motors have been popular in various industrial applications and electric mobility. In most brushless direct current (BLDC motor drives, there are three hall sensors as a position reference. Low resolution hall effect sensor is popularly used to estimate the rotor position because of its good comprehensive performance such as low cost, high reliability and sufficient precision. Various possible faults may happen in a hall effect sensor. This paper presents a fault-tolerant operation method that allows the control of a BLDC motor with one faulty hall sensor and presents the hall sensor output fault-tolerant control strategy. The situations considered are when the output from a hall sensor stays continuously at low or high levels, or a short-time pulse appears on a hall sensor signal. For fault detection, identification of a faulty signal and generating a substitute signal, this method only needs the information from the hall sensors. There are a few research work on hall effect sensor failure of BLDC motor. The conventional fault diagnosis methods are signal analysis, model based analysis and knowledge based analysis. The proposed method is signal based analysis using a compensation signal for reconfiguration and therefore fault diagnosis can be fast. The proposed method is validated to execute the simulation using PSIM.

  19. The Hall module of an exact category with duality

    OpenAIRE

    Young, Matthew B.

    2012-01-01

    We construct from a finitary exact category with duality a module over its Hall algebra, called the Hall module, encoding the first order self-dual extension structure of the category. We study in detail Hall modules arising from the representation theory of a quiver with involution. In this case we show that the Hall module is naturally a module over the specialized reduced sigma-analogue of the quantum Kac-Moody algebra attached to the quiver. For finite type quivers, we explicitly determin...

  20. DESIGN OF SUBSOIL IMPROVEMENT BELOW HALL FLOORS

    Directory of Open Access Journals (Sweden)

    Peter Turček

    2017-10-01

    Full Text Available The construction of an industrial park is now being prepared near the town of Nitra. The investor fixed very strict conditions for the bearing capacity and, above all, the settlement of halls and their floors. The geological conditions at the construction site are difficult: there are soft clay soils with high compressibility and low bearing capacity. A detailed analysis of soil improvement was made. Stone columns were prepared to be fitted into an approximately 5 m thick layer of soft clay. The paper shows the main steps used in the design of the stone columns.

  1. Optically induced Hall effect in semiconductors

    Energy Technology Data Exchange (ETDEWEB)

    Idrish Miah, M; Gray, E Mac A, E-mail: m.miah@griffith.edu.a [Nanoscale Science and Technology Centre, Griffith University, Nathan, Brisbane, QLD 4111 (Australia)

    2009-03-01

    We describe an experiment which investigates the effect of a longitudinal electric field on the spin-polarized carriers generated by a circularly polarized light in semiconductors. Our experiment observes the effect as a Hall voltage resulting from nonequilibrium magnetization induced by the spin-carrier electrons accumulating at the transverse boundaries of the sample as a result of asymmetries in scattering for spin-up and spin-down electrons in the presence of spin-orbit interaction. It is found that the effect depends on the longitudinal electric field and doping density as well as on temperature. The results are presented by discussing the dominant spin relaxation mechanisms in semiconductors.

  2. Fractional quantization and the quantum hall effect

    International Nuclear Information System (INIS)

    Guerrero, J.; Calixto, M.; Aldaya, V.

    1998-01-01

    Quantization with constrains is considered in a group-theoretical framework, providing a precise characterization of the set of good operators, i.e., those preserving the constrained Hilbert space, in terms of the representation of the subgroup of constraints. This machinery is applied to the quantization of the torus as symplectic manifold, obtaining that fractional quantum numbers are permitted, provided that we allow for vector valued representations. The good operators turn out to be the Wilson loops and, for certain representations of the subgroup of constraints, the modular transformations. These results are applied to the Fractional Quantum Hall Effect, where interesting implications are derived

  3. Excitons in the Fractional Quantum Hall Effect

    Science.gov (United States)

    Laughlin, R. B.

    1984-09-01

    Quasiparticles of charge 1/m in the Fractional Quantum Hall Effect form excitons, which are collective excitations physically similar to the transverse magnetoplasma oscillations of a Wigner crystal. A variational exciton wavefunction which shows explicitly that the magnetic length is effectively longer for quasiparticles than for electrons is proposed. This wavefunction is used to estimate the dispersion relation of these excitons and the matrix elements to generate them optically out of the ground state. These quantities are then used to describe a type of nonlinear conductivity which may occur in these systems when they are relatively clean.

  4. The fractional quantum Hall effect goes organic

    International Nuclear Information System (INIS)

    Smet, Jurgen

    2000-01-01

    Physicists have been fascinated by the behaviour of two-dimensional electron gases for the past two decades. All of these experiments were performed on inorganic semiconductor devices, most of them based on gallium arsenide. Indeed, until recently it was thought that the subtle effects that arise due to electron-electron interactions in these devices required levels of purity that could not be achieved in other material systems. However, Hendrik Schoen, Christian Kloc and Bertram Batlogg of Bell Laboratories in the US have now observed the fractional quantum Hall effect - the most dramatic signature of electron-electron interactions - in two organic semiconductors. (U.K.)

  5. A Compton polarimeter for CEBAF Hall A

    Energy Technology Data Exchange (ETDEWEB)

    Bardin, G; Cavata, C; Frois, B; Juillard, M; Kerhoas, S; Languillat, J C; Legoff, J M; Mangeot, P; Martino, J; Platchkov, S; Rebourgeard, P; Vernin, P; Veyssiere, C; CEBAF Hall A Collaboration

    1994-09-01

    The physic program at CEBAF Hall A includes several experiments using 4 GeV polarized electron beam: parity violation in electron elastic scattering from proton and {sup 4}He, electric form factor of the proton by recoil polarization, neutron spin structure function at low Q{sup 2}. Some of these experiments will need beam polarization measurement and monitoring with an accuracy close to 4%, for beam currents ranging from 100 nA to 100 microA. A project of a Compton Polarimeter that will meet these requirements is presented. It will comprise four dipoles and a symmetric cavity consisting of two identical mirrors. 1 fig., 10 refs.

  6. Hall conductivity for two dimensional magnetic systems

    International Nuclear Information System (INIS)

    Desbois, J.; Ouvry, S.; Texier, C.

    1996-01-01

    A Kubo inspired formalism is proposed to compute the longitudinal and transverse dynamical conductivities of an electron in a plane (or a gas of electrons at zero temperature) coupled to the potential vector of an external local magnetic field, with the additional coupling of the spin degree of freedom of the electron to the local magnetic field (Pauli Hamiltonian). As an example, the homogeneous magnetic field Hall conductivity is rederived. The case of the vortex at the origin is worked out in detail. A perturbative analysis is proposed for the conductivity in the random magnetic impurity problem (Poissonian vortices in the plane). (author)

  7. H Reactor

    Data.gov (United States)

    Federal Laboratory Consortium — The H Reactor was the first reactor to be built at Hanford after World War II.It became operational in October of 1949, and represented the fourth nuclear reactor on...

  8. Calculation of photon dose for Dalat research reactor in case of loss of reactor tank water

    International Nuclear Information System (INIS)

    Le Vinh Vinh; Huynh Ton Nghiem; Nguyen Kien Cuong

    2007-01-01

    Photon sources of actinides and fission products were estimated by ORIGEN2 code with the modified cross-section library for Dalat research reactor (DRR) using new cross-section generated by WIMS-ANL code. Photon sources of reactor tank water calculated from the experimental data. MCNP4C2 with available non-analog Monte Carlo model and ANSI/ANL-6.1.1-1977 flux-to-dose factors were used for dose estimation. The agreement between calculation results and those of measurements showed that the methods and models used to get photon sources and dose were acceptable. In case the reactor water totally leaks out from the reactor tank, the calculated dose is very high at the top of reactor tank while still low in control room. In the reactor hall, the operation staffs can access for emergency works but with time limits. (author)

  9. 17 CFR 275.203(b)(3)-2 - Methods for counting clients in certain private funds.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Methods for counting clients....203(b)(3)-2 Methods for counting clients in certain private funds. (a) For purposes of section 203(b)(3) of the Act (15 U.S.C. 80b-3(b)(3)), you must count as clients the shareholders, limited partners...

  10. Decommissioning of the Salaspils Research Reactor

    Directory of Open Access Journals (Sweden)

    Abramenkovs Andris

    2011-01-01

    Full Text Available In May 1995, the Latvian government decided to shut down the Salaspils Research Reactor and to dispense with nuclear energy in the future. The reactor has been out of operation since July 1998. A conceptual study on the decommissioning of the Salaspils Research Reactor was drawn up by Noell-KRC-Energie- und Umwelttechnik GmbH in 1998-1999. On October 26th, 1999, the Latvian government decided to start the direct dismantling to “green-field” in 2001. The upgrading of the decommissioning and dismantling plan was carried out from 2003-2004, resulting in a change of the primary goal of decommissioning. Collecting and conditioning of “historical” radioactive wastes from different storages outside and inside the reactor hall became the primary goal. All radioactive materials (more than 96 tons were conditioned for disposal in concrete containers at the radioactive wastes depository “Radons” at the Baldone site. Protective and radiation measurement equipment of the personnel was upgraded significantly. All non-radioactive equipment and materials outside the reactor buildings were released for clearance and dismantled for reuse or conventional disposal. Contaminated materials from the reactor hall were collected and removed for clearance measurements on a weekly basis.

  11. Transit-time instability in Hall thrusters

    International Nuclear Information System (INIS)

    Barral, Serge; Makowski, Karol; Peradzynski, Zbigniew; Dudeck, Michel

    2005-01-01

    Longitudinal waves characterized by a phase velocity of the order of the velocity of ions have been recurrently observed in Hall thruster experiments and simulations. The origin of this so-called ion transit-time instability is investigated with a simple one-dimensional fluid model of a Hall thruster discharge in which cold ions are accelerated between two electrodes within a quasineutral plasma. A short-wave asymptotics applied to linearized equations shows that plasma perturbations in such a device consist of quasineutral ion acoustic waves superimposed on a background standing wave generated by discharge current oscillations. Under adequate circumstances and, in particular, at high ionization levels, acoustic waves are amplified as they propagate, inducing strong perturbation of the ion density and velocity. Responding to the subsequent perturbation of the column resistivity, the discharge current generates a standing wave, the reflection of which sustains the generation of acoustic waves at the inlet boundary. A calculation of the frequency and growth rate of this resonance mechanism for a supersonic ion flow is proposed, which illustrates the influence of the ionization degree on their onset and the approximate scaling of the frequency with the ion transit time. Consistent with experimental reports, the traveling wave can be observed on plasma density and velocity perturbations, while the plasma potential ostensibly oscillates in phase along the discharge

  12. Cylindrical Hall Thrusters with Permanent Magnets

    International Nuclear Information System (INIS)

    Raitses, Yevgeny; Merino, Enrique; Fisch, Nathaniel J.

    2010-01-01

    The use of permanent magnets instead of electromagnet coils for low power Hall thrusters can offer a significant reduction of both the total electric power consumption and the thruster mass. Two permanent magnet versions of the miniaturized cylindrical Hall thruster (CHT) of different overall dimensions were operated in the power range of 50W-300 W. The discharge and plasma plume measurements revealed that the CHT thrusters with permanent magnets and electromagnet coils operate rather differently. In particular, the angular ion current density distribution from the permanent magnet thrusters has an unusual halo shape, with a majority of high energy ions flowing at large angles with respect to the thruster centerline. Differences in the magnetic field topology outside the thruster channel and in the vicinity of the channel exit are likely responsible for the differences in the plume characteristics measured for the CHTs with electromagnets and permanent magnets. It is shown that the presence of the reversing-direction or cusp-type magnetic field configuration inside the thruster channel without a strong axial magnetic field outside the thruster channel does not lead to the halo plasma plume from the CHT.

  13. Bimetric Theory of Fractional Quantum Hall States

    Directory of Open Access Journals (Sweden)

    Andrey Gromov

    2017-11-01

    Full Text Available We present a bimetric low-energy effective theory of fractional quantum Hall (FQH states that describes the topological properties and a gapped collective excitation, known as the Girvin-Macdonald-Platzman (GMP mode. The theory consists of a topological Chern-Simons action, coupled to a symmetric rank-2 tensor, and an action à la bimetric gravity, describing the gapped dynamics of a spin-2 mode. The theory is formulated in curved ambient space and is spatially covariant, which allows us to restrict the form of the effective action and the values of phenomenological coefficients. Using bimetric theory, we calculate the projected static structure factor up to the k^{6} order in the momentum expansion. To provide further support for the theory, we derive the long-wave limit of the GMP algebra, the dispersion relation of the GMP mode, and the Hall viscosity of FQH states. The particle-hole (PH transformation of the theory takes a very simple form, making the duality between FQH states and their PH conjugates manifest. We also comment on the possible applications to fractional Chern insulators, where closely related structures arise. It is shown that the familiar FQH observables acquire a curious geometric interpretation within the bimetric formalism.

  14. Hypernuclear Spectroscopy at JLab Hall C

    International Nuclear Information System (INIS)

    Hashimoto, Osamu; Chiba, Atsushi; Doi, Daisuke; Fujii, Yu; Toshiyuki, Gogami; Kanda, Hiroki; Kaneta, M.; Kawama, Daisuke; Maeda, Kazushige; Maruta, Tomofumi; Matsumura, Akihiko; Nagao, Sho; Nakamura, Satoshi; Shichijo, Ayako; Tamura, Hirokazu; Taniya, Naotaka; Yamamoto, Taku; Yokota, Kosuke; Kato, S.; Sato, Yoshinori; Takahashi, Toshiyuki; Noumi, Hiroyuki; Motoba, T.; Hiyama, E.; Albayrak, Ibrahim; Ates, Ozgur; Chen, Chunhua; Christy, Michael; Keppel, Cynthia; Kohl, Karl; Li, Ya; Liyanage, Anusha Habarakada; Tang, Liguang; Walton, T.; Ye, Zhihong; Yuan, Lulin; Zhu, Lingyan; Baturin, Pavlo; Boeglin, Werner; Dhamija, Seema; Markowitz, Pete; Raue, Brian; Reinhold, Joerg; Hungerford, Ed; Ent, Rolf; Fenker, Howard; Gaskell, David; Horn, Tanja; Jones, Mark; Smith, Gregory; Vulcan, William; Wood, Stephen; Johnston, C.; Simicevic, Neven; Wells, Stephen; Samanta, Chhanda; Hu, Bitao; Shen, Ji; Wang, W.; Zhang, Xiaozhuo; Zhang, Yi; Feng, Jing; Fu, Y.; Zhou, Jian; Zhou, S.; Jiang, Yi; Lu, H.; Yan, Xinhu; Ye, Yunxiu; Gan, Liping; Ahmidouch, Abdellah; Danagoulian, Samuel; Gasparian, Ashot; Elaasar, Mostafa; Wesselmann, Frank; Asaturyan, Arshak; Margaryan, Amur; Mkrtchyan, Arthur; Mkrtchyan, Hamlet; Tadevosyan, Vardan; Androic, Darko; Furic, Miroslav; Petkovic, Tomislav; Seva, Tomislav; Niculescu, Gabriel; Niculescu, Maria-Ioana; Rodriguez, Victor; Cisbani, Evaristo; Cusanno, Francesco; Garibaldi, Franco; Urciuoli, Guido; De Leo, Raffaele; Maronne, S.; Achenbach, Carsten; Pochodzalla, J.

    2010-01-01

    Since the 1st generation experiment, E89-009, which was successfully carried out as a pilot experiment of (e,e(prime)K + ) hypernuclear spectroscopy at JLab Hall C in 2000, precision hypernuclear spectroscopy by the (e,e(prime)K + ) reactions made considerable progress. It has evolved to the 2nd generation experiment, E01-011, in which a newly constructed high resolution kaon spectrometer (HKS) was installed and the 'Tilt method' was adopted in order to suppress large electromagnetic background and to run with high luminosity. Preliminary high-resolution spectra of 7 ΛHe and 28 ΛAl together with that of 12 ΛB that achieved resolution better than 500 keV(FWHM) were obtained. The third generation experiment, E05-115, has completed data taking with an experimental setup combining a new splitter magnet, high resolution electron spectrometer (HES) and the HKS used in the 2nd generation experiment. The data were accumulated with targets of 7 Li, 9 Be, 10 B, 12 C and 52 Cr as well as with those of CH 2 and H 2 O for calibration. The analysis is under way with particular emphasis of determining precision absolute hypernuclear masses. In this article, hypernuclear spectroscopy program in the wide mass range at JLab Hall C that has undergone three generation is described.

  15. Bimetric Theory of Fractional Quantum Hall States

    Science.gov (United States)

    Gromov, Andrey; Son, Dam Thanh

    2017-10-01

    We present a bimetric low-energy effective theory of fractional quantum Hall (FQH) states that describes the topological properties and a gapped collective excitation, known as the Girvin-Macdonald-Platzman (GMP) mode. The theory consists of a topological Chern-Simons action, coupled to a symmetric rank-2 tensor, and an action à la bimetric gravity, describing the gapped dynamics of a spin-2 mode. The theory is formulated in curved ambient space and is spatially covariant, which allows us to restrict the form of the effective action and the values of phenomenological coefficients. Using bimetric theory, we calculate the projected static structure factor up to the k6 order in the momentum expansion. To provide further support for the theory, we derive the long-wave limit of the GMP algebra, the dispersion relation of the GMP mode, and the Hall viscosity of FQH states. The particle-hole (PH) transformation of the theory takes a very simple form, making the duality between FQH states and their PH conjugates manifest. We also comment on the possible applications to fractional Chern insulators, where closely related structures arise. It is shown that the familiar FQH observables acquire a curious geometric interpretation within the bimetric formalism.

  16. Repurposing the Caltech Robinson Hall Coelostat

    Science.gov (United States)

    Treffers, Richard R.; Loisos, G.; Ubbelohde, M.; Douglas, S.; Martinez, M.

    2013-01-01

    We describe the repurposing of the historic coelostat atop Caltech’s Robinson Hall for building lighting, public education and scientific research. The coelostat was originally part of George Ellery Hale’s vision of the Astrophysical Laboratory on the Caltech campus in 1932. The coelostat, designed by Russell Porter, has a 36 inch diameter primary mirror a 30 inch diameter secondary mirror and provides a 24 inch un-vignetted beam of sunlight into the building. Although constructed in the 1930s, due to wartime pressures and other projects, it was used only briefly in the 1970s and never fully realized. Recently Robinson Hall has been fully renovated to house the Ronald and Maxine Linde Center for Global Environmental Science. The coelostat operation was modernized replacing the old motors and automating all the motions. Each morning, if the weather cooperates, the dome slit opens, the mirrors configured and sunlight pours into the building. The beam of sunlight is divided into three parts. One part goes into a refracting telescope which projects a ten inch diameter of the sun onto a ground glass screen visible to the public. A second fraction is distributed to fiber optic fixtures that illuminate some of the basement rooms. The final fraction goes into two laboratories where it is used in experiments monitoring trace constituents of our atmosphere and for solar catalysis experiments. The instrument as originally conceived required at least two human operators. Now it is fully automatic and doing real science

  17. Undulator Hall Air Temperature Fault Scenarios

    International Nuclear Information System (INIS)

    Sevilla, J.

    2010-01-01

    Recent experience indicates that the LCLS undulator segments must not, at any time following tuning, be allowed to change temperature by more than about ±2.5 C or the magnetic center will irreversibly shift outside of acceptable tolerances. This vulnerability raises a concern that under fault conditions the ambient temperature in the Undulator Hall might go outside of the safe range and potentially could require removal and retuning of all the segments. In this note we estimate changes that can be expected in the Undulator Hall air temperature for three fault scenarios: (1) System-wide power failure; (2) Heating Ventilation and Air Conditioning (HVAC) system shutdown; and (3) HVAC system temperature regulation fault. We find that for either a system-wide power failure or an HVAC system shutdown (with the technical equipment left on), the short-term temperature changes of the air would be modest due to the ability of the walls and floor to act as a heat ballast. No action would be needed to protect the undulator system in the event of a system-wide power failure. Some action to adjust the heat balance, in the case of the HVAC power failure with the equipment left on, might be desirable but is not required. On the other hand, a temperature regulation failure of the HVAC system can quickly cause large excursions in air temperature and prompt action would be required to avoid damage to the undulator system.

  18. Data of evolutionary structure change: 1B04B-3BAAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B04B-3BAAA 1B04 3BAA B A MDRQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDR...NLKTIRSLPLRLKEPVSLEARGEAFMPKASFLRLNEERKAR--ELFANPRNAAAGSLRQLDPKVAASRQLDLFVYGLADAEALGIASHSEALDYLQALGFKVNPERRR...DGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTV... 353 TYR CA 427 3BAA A 3BAAA...hain>A 3BAAA EREENGQDIFAN

  19. Random walks on the braid group B3 and magnetic translations in hyperbolic geometry

    International Nuclear Information System (INIS)

    Voituriez, Raphaeel

    2002-01-01

    We study random walks on the three-strand braid group B 3 , and in particular compute the drift, or average topological complexity of a random braid, as well as the probability of trivial entanglement. These results involve the study of magnetic random walks on hyperbolic graphs (hyperbolic Harper-Hofstadter problem), what enables to build a faithful representation of B 3 as generalized magnetic translation operators for the problem of a quantum particle on the hyperbolic plane

  20. 17 CFR 275.203(b)(3)-1 - Definition of “client” of an investment adviser.

    Science.gov (United States)

    2010-04-01

    ... Definition of “client” of an investment adviser. Preliminary Note to § 275.203(b)(3)-1. This section is a... single client for purposes of section 203(b)(3) of the Act. Under paragraph (b)(6) of this section, the... be a single client for purposes of section 203(b)(3) of the Act (15 U.S.C. 80b-3(b)(3)): (1) A...

  1. State Environmental Policy Act (SEPA) Environmental Checklist Form 216-B-3 Expansion Ponds Closure Plan

    International Nuclear Information System (INIS)

    1993-12-01

    The 216-B-3 Expansion Ponds Closure Plan (Revision 1) consists of a Part A Dangerous Waste Permit Application and a Resource Conservation and Recovery Act Closure Plan. An explanation of the Part A submitted with this document is provided at the beginning of the Part A Section. The closure plan consists of nine chapters and five appendices. The 216-B-3 Pond System consists of a series of four earthen, unlined, interconnected ponds and the 216-B-3-3 Ditch that receive waste water from various 200 East Area operating facilities. These four ponds, collectively. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the 216-B-3-3 Ditch. Water discharged to the 216-8-3-3 Ditch flows directly into the 216-B-3 Pond. In the past, waste water discharges to B Pond and the 216-B-3-3 Ditch contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the nonradioactive dangerous portion of mixed waste is regulated under RCRA. Mixed waste also may be considered a hazardous substance under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) when considering remediation of waste sites

  2. Economies of scale in electricity generation and transmission since 1945

    International Nuclear Information System (INIS)

    Tombs, F.

    1978-01-01

    Progress in the electricity supply industry since 1945 is reviewed with particular reference to increased ratings of plant and transmission. The contribution of nuclear energy is emphasised. Developments which have taken place, and policy within the nuclear industry since the construction of Calder Hall, are examined. The performance of the Magnox stations, difficulties with AGRs, and the debate on the choice of reactors are discussed. (U.K.)

  3. Mary E. Hall: Dawn of the Professional School Librarian

    Science.gov (United States)

    Alto, Teresa

    2012-01-01

    A century ago, a woman named Mary E. Hall convinced school leaders of the need for the professional school librarian--a librarian who cultivated a love of reading, academic achievement, and independent learning skills. After graduating from New York City's Pratt Institute Library School in 1895, Hall developed her vision for the high school…

  4. What is the Hallé? | Smith | Philosophical Papers

    African Journals Online (AJOL)

    The bulk of the paper examines the difficulty of reconciling the view that the Hallé is several individuals with two prima facie plausible theses about the manner of its persistence through time. The paper is structured around some remarks made by Peter Simons about groups, and the Hallé in particular, in his Parts.

  5. Spin hall effect associated with SU(2) gauge field

    Science.gov (United States)

    Tao, Y.

    2010-01-01

    In this paper, we focus on the connection between spin Hall effect and spin force. Here we investigate that the spin force due to spin-orbit coupling, which, in two-dimensional system, is equivalent to forces of Hirsch and Chudnovsky besides constant factors 3 and frac{3}{2} respectively, is a part of classic Anandan force, and that the spin Hall effect is an anomalous Hall effect. Furthermore, we develop the method of AC phase to derive the expression for the spin force, and note that the most basic spin Hall effect indeed originate from the AC phase and is therefore an intrinsic quantum mechanical property of spin. This method differs from approach of Berry phase in the study of anomalous Hall effect , which is the intrinsic property of the perfect crystal. On the other hand, we use an elegant skill to show that the Chudnovsky-Drude model is reasonable. Here we have improved the theoretical values of spin Hall conductivity of Chudnovsky. Compared to the theoretical values of spin Hall conductivity in the Chudnovsky-Drude model, ours are in better agreement with experimentation. Finally, we discuss the relation between spin Hall effect and fractional statistics.

  6. Energy spectrum, dissipation, and spatial structures in reduced Hall magnetohydrodynamic

    Energy Technology Data Exchange (ETDEWEB)

    Martin, L. N.; Dmitruk, P. [Departamento de Fisica, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires and IFIBA, CONICET, Ciudad Universitaria, 1428 Buenos Aires (Argentina); Gomez, D. O. [Departamento de Fisica, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires and IFIBA, CONICET, Ciudad Universitaria, 1428 Buenos Aires (Argentina); Instituto de Astronomia y Fisica del Espacio, CONICET, Buenos Aires (Argentina)

    2012-05-15

    We analyze the effect of the Hall term in the magnetohydrodynamic turbulence under a strong externally supported magnetic field, seeing how this changes the energy cascade, the characteristic scales of the flow, and the dynamics of global magnitudes, with particular interest in the dissipation. Numerical simulations of freely evolving three-dimensional reduced magnetohydrodynamics are performed, for different values of the Hall parameter (the ratio of the ion skin depth to the macroscopic scale of the turbulence) controlling the impact of the Hall term. The Hall effect modifies the transfer of energy across scales, slowing down the transfer of energy from the large scales up to the Hall scale (ion skin depth) and carrying faster the energy from the Hall scale to smaller scales. The final outcome is an effective shift of the dissipation scale to larger scales but also a development of smaller scales. Current sheets (fundamental structures for energy dissipation) are affected in two ways by increasing the Hall effect, with a widening but at the same time generating an internal structure within them. In the case where the Hall term is sufficiently intense, the current sheet is fully delocalized. The effect appears to reduce impulsive effects in the flow, making it less intermittent.

  7. Quantifying Spin Hall Angles from Spin Pumping : Experiments and Theory

    NARCIS (Netherlands)

    Mosendz, O.; Pearson, J.E.; Fradin, F.Y.; Bauer, G.E.W.; Bader, S.D.; Hoffmann, A.

    2010-01-01

    Spin Hall effects intermix spin and charge currents even in nonmagnetic materials and, therefore, ultimately may allow the use of spin transport without the need for ferromagnets. We show how spin Hall effects can be quantified by integrating Ni80Fe20|normal metal (N) bilayers into a coplanar

  8. Stuart Hall on Racism and the Importance of Diasporic Thinking

    Science.gov (United States)

    Rizvi, Fazal

    2015-01-01

    In this article, I want to show how my initial encounter with the work of Stuart Hall was grounded in my reading of the later philosophy of Ludwig Wittgenstein, and was shaped by my interest in understanding the nature of racism across the three countries in which I had lived. Over the years, Hall's various writings have helped me to make sense of…

  9. Theory of the quantum hall effects in lattice systems

    International Nuclear Information System (INIS)

    Kliros, G.S.

    1990-06-01

    The Fractional Quantum Hall Effect is identified as an Integral Quantum Hall Effect of electrons on a lattice with an even number of statistical flux quanta. A variational wavefunction in terms of the Hofstadter lattice eigenstates is proposed. (author). 21 refs

  10. A Residential Paradox?: Residence Hall Attributes and College Student Outcomes

    Science.gov (United States)

    Bronkema, Ryan; Bowman, Nicholas A.

    2017-01-01

    The researchers of this brief observed that few environments have the potential to shape the outcomes of college students as much as residence halls. As a result, residence halls have the capacity to foster a strong sense of community as well as other important outcomes such as college satisfaction and academic achievement. However, given the high…

  11. Bulk Versus Edge in the Quantum Hall Effect

    OpenAIRE

    Kao, Y. -C.; Lee, D. -H.

    1996-01-01

    The manifestation of the bulk quantum Hall effect on edge is the chiral anomaly. The chiral anomaly {\\it is} the underlying principle of the ``edge approach'' of quantum Hall effect. In that approach, $\\sxy$ should not be taken as the conductance derived from the space-local current-current correlation function of the pure one-dimensional edge problem.

  12. Critical current in the Integral Quantum Hall Effect

    International Nuclear Information System (INIS)

    Kostadinov, I.Z.

    1985-11-01

    A multiparticle theory of the Integral Quantum Hall Effect (IQHE) was constructed operating with pairs wave function as an order parameter. The IQHE is described with bosonic macroscopic states while the fractional QHE with fermionic ones. The calculation of the critical current and Hall conductivity temperature dependence is presented. (author)

  13. Useful Pedagogical Applications of the Classical Hall Effect

    Science.gov (United States)

    Houari, Ahmed

    2007-01-01

    One of the most known phenomena in physics is the Hall effect. This is mainly due to its simplicity and to the wide range of its theoretical and practical applications. To complete the pedagogical utility of the Hall effect in physics teaching, I will apply it here to determine the Faraday constant as a fundamental physical number and the number…

  14. A Novel Hall Effect Sensor Using Elaborate Offset Cancellation Method

    Directory of Open Access Journals (Sweden)

    Vlassis N. Petoussis

    2009-01-01

    Full Text Available The Hall effect is caused by a traverse force that is formed in the electrons or holes of metal element or semiconductor when are polarized by current source and simultaneously all the system it is found vertical in external magnetic field. Result is finally the production of difference of potential (Hall voltage in address vertical in that of current and magnetic field directions. In the present work is presented a new Hall sensor exploiting the former operation. In combination with his pioneering form and using dynamic spinning current technique with an elaborate sequence, it leads to satisfactory results of produced Hall voltage with small noise in a presence of external magnetic field. Anyone can see both the spinning current and anti-Hall technique in the same sensor simultaneously.

  15. Migrants and Their Experiences of Time: Edward T. Hall Revisited

    Directory of Open Access Journals (Sweden)

    Elisabeth Schilling

    2009-01-01

    Full Text Available In this paper we reassess the scientific heritage of Edward T. HALL and his contribution to the area of intercultural communication. The key objectives of our study are to demonstrate the applicability of HALL's theory of culture to empirical research and to establish its compatibility with other methods. Specifically, we propose that Alfred SCHÜTZ's phenomenology of sociality be taken as an extension to HALL. The connection between HALL and SCHÜTZ is made possible by the mutual emphases on the temporal dimension of culture and the temporal aspects of migration. With these foci we analyze six narratives by two groups of migrants: German and Russian. By combining HALL's theory of the cultural time with SCHÜTZ's phenomenological perspective on time and the Other and then applying them to empirical data, we show the terms in which different cultures experience time. URN: urn:nbn:de:0114-fqs0901357

  16. Unconventional quantum Hall effect in Floquet topological insulators

    KAUST Repository

    Tahir, M.

    2016-07-27

    We study an unconventional quantum Hall effect for the surface states of ultrathin Floquet topological insulators in a perpendicular magnetic field. The resulting band structure is modified by photon dressing and the topological property is governed by the low-energy dynamics of a single surface. An exchange of symmetric and antisymmetric surface states occurs by reversing the lights polarization. We find a novel quantum Hall state in which the zeroth Landau level undergoes a phase transition from a trivial insulator state, with Hall conductivity αyx = 0 at zero Fermi energy, to a Hall insulator state with αyx = e2/2h. These findings open new possibilities for experimentally realizing nontrivial quantum states and unusual quantum Hall plateaus at (±1/2,±3/2,±5/2, ...)e2/h. © 2016 IOP Publishing Ltd Printed in the UK.

  17. Magnetic Measurements of the Background Field in the Undulator Hall

    International Nuclear Information System (INIS)

    Fisher, Andrew

    2010-01-01

    The steel present in the construction of the undulator hall facility has the potential for changing the ambient fields present in the undulator hall. This note describes a measurement done to make a comparison between the fields in the hall and in the Magnetic Measurement Facility. In order for the undulators to have the proper tuning, the background magnetic field in the Undulator Hall should agree with the background field in the Magnetic Measurements Facility within .5 gauss. In order to verify that this was the case measurements were taken along the length of the undulator hall, and the point measurements were compared to the mean field which was measured on the MMF test bench.

  18. Unconventional quantum Hall effect in Floquet topological insulators

    KAUST Repository

    Tahir, M.; Vasilopoulos, P.; Schwingenschlö gl, Udo

    2016-01-01

    We study an unconventional quantum Hall effect for the surface states of ultrathin Floquet topological insulators in a perpendicular magnetic field. The resulting band structure is modified by photon dressing and the topological property is governed by the low-energy dynamics of a single surface. An exchange of symmetric and antisymmetric surface states occurs by reversing the lights polarization. We find a novel quantum Hall state in which the zeroth Landau level undergoes a phase transition from a trivial insulator state, with Hall conductivity αyx = 0 at zero Fermi energy, to a Hall insulator state with αyx = e2/2h. These findings open new possibilities for experimentally realizing nontrivial quantum states and unusual quantum Hall plateaus at (±1/2,±3/2,±5/2, ...)e2/h. © 2016 IOP Publishing Ltd Printed in the UK.

  19. ErbB3 mRNA leukocyte levels as a biomarker for major depressive disorder

    Directory of Open Access Journals (Sweden)

    Milanesi Elena

    2012-09-01

    Full Text Available Abstract Background In recent years, the identification of peripheral biomarkers that are associated with psychiatric diseases, such as Major Depressive Disorder (MDD, has become relevant because these biomarkers may improve the efficiency of the differential diagnosis process and indicate targets for new antidepressant drugs. Two recent candidate genes, ErbB3 and Fgfr1, are growth factors whose mRNA levels have been found to be altered in the leukocytes of patients that are affected by bipolar disorder in a depressive state. On this basis, the aim of the study was to determine if ErbB3 and Fgfr1 mRNA levels could be a biomarkers of MDD. Methods We measured by Real Time PCR ErbB3 and Fgfr1 mRNA expression levels in leukocytes of MDD patients compared with controls. Successively, to assess whether ErbB3 mRNA levels were influenced by previous antidepressant treatment we stratified our patients sample in two cohorts, comparing drug-naive versus drug-free patients. Moreover, we evaluated the levels of the transcript in MDD patients after 12 weeks of antidepressant treatment, and in prefrontal cortex of rats stressed and treated with an antidepressant drug of the same class. Results These results showed that ErbB3 but not Fgfr1 mRNA levels were reduced in leukocytes of MDD patients compared to healthy subjects. Furthermore, ErbB3 levels were not affected by antidepressant treatment in either human or animal models Conclusions Our data suggest that ErbB3 might be considered as a biomarker for MDD and that its deficit may underlie the pathopsysiology of the disease and is not a consequence of treatment. Moreover the study supports the usefulness of leukocytes as a peripheral system for identifying biomarkers in psychiatric diseases.

  20. Effect of Glu-B3 Allelic Variation on Sodium Dodecyl Sulfate Sedimentation Volume in Common Wheat (Triticum aestivum L.

    Directory of Open Access Journals (Sweden)

    Hongqi Si

    2013-01-01

    Full Text Available Sodium dodecyl sulfate (SDS sedimentation volume has long been used to characterize wheat flours and meals with the aim of predicting processing and end-product qualities. In order to survey the influence of low-molecular-weight glutenin subunits (LMW-GSs at Glu-B3 locus on wheat SDS sedimentation volume, a total of 283 wheat (Triticum aestivum L. varieties including landraces and improved and introduced cultivars were analyzed using 10 allele-specific PCR markers at the Glu-B3 locus. The highest allele frequency observed in the tested varieties was Glu-B3i with 21.9% in all varieties, 21.1% in landraces, 25.5% in improved cultivars, and 12% in introduced cultivars. Glu-B3 locus represented 8.6% of the variance in wheat SDS sedimentation volume, and Glu-B3b, Glu-B3g, and Glu-B3h significantly heightened the SDS sedimentation volume, but Glu-B3a, Glu-B3c, and Glu-B3j significantly lowered the SDS sedimentation volume. For the bread-making quality, the most desirable alleles Glu-B3b and Glu-B3g become more and more popular and the least desirable alleles Glu-B3a and Glu-B3c got less and less in modern improved cultivars, suggesting that wheat grain quality in China has been significantly improved through breeding effort.

  1. Planar Hall Effect Sensors for Biodetection

    DEFF Research Database (Denmark)

    Rizzi, Giovanni

    . In the second geometry (dPHEB) half of the sensor is used as a local negative reference to subtract the background signal from magnetic beads in suspension. In all applications below, the magnetic beads are magnetised using the magnetic field due to the bias current passed through the sensor, i.e., no external...... as labels and planar Hall effect bridge (PHEB) magnetic field sensor as readout for the beads. The choice of magnetic beads as label is motivated by the lack of virtually any magnetic background from biological samples. Moreover, magnetic beads can be manipulated via an external magnetic field...... hybridisation in real-time, in a background of suspended magnetic beads. This characteristic is employed in single nucleotide polymorphism (SNP) genotyping, where the denaturation of DNA is monitored in real-time upon washing with a stringency buffer. The sensor setup includes temperature control and a fluidic...

  2. Numerical investigation of a Hall thruster plasma

    International Nuclear Information System (INIS)

    Roy, Subrata; Pandey, B.P.

    2002-01-01

    The dynamics of the Hall thruster is investigated numerically in the framework of a one-dimensional, multifluid macroscopic description of a partially ionized xenon plasma using finite element formulation. The model includes neutral dynamics, inelastic processes, and plasma-wall interaction. Owing to disparate temporal scales, ions and neutrals have been described by set of time-dependent equations, while electrons are considered in steady state. Based on the experimental observations, a third order polynomial in electron temperature is used to calculate ionization rate. The results show that in the acceleration channel the increase in the ion number density is related to the decrease in the neutral number density. The electron and ion velocity profiles are consistent with the imposed electric field. The electron temperature remains uniform for nearly two-thirds of the channel; then sharply increases to a peak before dropping slightly at the exit. This is consistent with the predicted electron gyration velocity distribution

  3. Quantum Hall effect on Riemann surfaces

    Science.gov (United States)

    Tejero Prieto, Carlos

    2009-06-01

    We study the family of Landau Hamiltonians compatible with a magnetic field on a Riemann surface S by means of Fourier-Mukai and Nahm transforms. Starting from the geometric formulation of adiabatic charge transport on Riemann surfaces, we prove that Hall conductivity is proportional to the intersection product on the first homology group of S and therefore it is quantized. Finally, by using the theory of determinant bundles developed by Bismut, Gillet and Soul, we compute the adiabatic curvature of the spectral bundles defined by the holomorphic Landau levels. We prove that it is given by the polarization of the jacobian variety of the Riemann surface, plus a term depending on the relative analytic torsion.

  4. Quantum Hall effect on Riemann surfaces

    International Nuclear Information System (INIS)

    Tejero Prieto, Carlos

    2009-01-01

    We study the family of Landau Hamiltonians compatible with a magnetic field on a Riemann surface S by means of Fourier-Mukai and Nahm transforms. Starting from the geometric formulation of adiabatic charge transport on Riemann surfaces, we prove that Hall conductivity is proportional to the intersection product on the first homology group of S and therefore it is quantized. Finally, by using the theory of determinant bundles developed by Bismut, Gillet and Soul, we compute the adiabatic curvature of the spectral bundles defined by the holomorphic Landau levels. We prove that it is given by the polarization of the jacobian variety of the Riemann surface, plus a term depending on the relative analytic torsion.

  5. OPTICS. Quantum spin Hall effect of light.

    Science.gov (United States)

    Bliokh, Konstantin Y; Smirnova, Daria; Nori, Franco

    2015-06-26

    Maxwell's equations, formulated 150 years ago, ultimately describe properties of light, from classical electromagnetism to quantum and relativistic aspects. The latter ones result in remarkable geometric and topological phenomena related to the spin-1 massless nature of photons. By analyzing fundamental spin properties of Maxwell waves, we show that free-space light exhibits an intrinsic quantum spin Hall effect—surface modes with strong spin-momentum locking. These modes are evanescent waves that form, for example, surface plasmon-polaritons at vacuum-metal interfaces. Our findings illuminate the unusual transverse spin in evanescent waves and explain recent experiments that have demonstrated the transverse spin-direction locking in the excitation of surface optical modes. This deepens our understanding of Maxwell's theory, reveals analogies with topological insulators for electrons, and offers applications for robust spin-directional optical interfaces. Copyright © 2015, American Association for the Advancement of Science.

  6. Determination of the Hall Thruster Operating Regimes

    International Nuclear Information System (INIS)

    L. Dorf; V. Semenov; Y. Raitses; N.J. Fisch

    2002-04-01

    A quasi one-dimensional (1-D) steady-state model of the Hall thruster is presented. For the same discharge voltage two operating regimes are possible -- with and without the anode sheath. For given mass flow rate, magnetic field profile and discharge voltage a unique solution can be constructed, assuming that the thruster operates in one of the regimes. However, we show that for a given temperature profile the applied discharge voltage uniquely determines the operating regime: for discharge voltages greater than a certain value, the sheath disappears. That result is obtained over a wide range of incoming neutral velocities, channel lengths and widths, and cathode plane locations. It is also shown that a good correlation between the quasi 1-D model and experimental results can be achieved by selecting an appropriate electron mobility and temperature profile

  7. Chaotic waves in Hall thruster plasma

    International Nuclear Information System (INIS)

    Peradzynski, Zbigniew; Barral, S.; Kurzyna, J.; Makowski, K.; Dudeck, M.

    2006-01-01

    The set of hyperbolic equations of the fluid model describing the acceleration of plasma in a Hall thruster is analyzed. The characteristic feature of the flow is the existence of a trapped characteristic; i.e. there exists a characteristic line, which never intersects the boundary of the flow region in the thruster. To study the propagation of short wave perturbations, the approach of geometrical optics (like WKB) can be applied. This can be done in a linear as well as in a nonlinear version. The nonlinear version describes the waves of small but finite amplitude. As a result of such an approach one obtains so called transport equation, which are governing the wave amplitude. Due to the existence of trapped characteristics this transport equation appears to have chaotic (turbulent) solutions in both, linear and nonlinear versions

  8. Spin Hall magnetoresistance at high temperatures

    International Nuclear Information System (INIS)

    Uchida, Ken-ichi; Qiu, Zhiyong; Kikkawa, Takashi; Iguchi, Ryo; Saitoh, Eiji

    2015-01-01

    The temperature dependence of spin Hall magnetoresistance (SMR) in Pt/Y 3 Fe 5 O 12 (YIG) bilayer films has been investigated in a high temperature range from room temperature to near the Curie temperature of YIG. The experimental results show that the magnitude of the magnetoresistance ratio induced by the SMR monotonically decreases with increasing the temperature and almost disappears near the Curie temperature. We found that, near the Curie temperature, the temperature dependence of the SMR in the Pt/YIG film is steeper than that of a magnetization curve of the YIG; the critical exponent of the magnetoresistance ratio is estimated to be 0.9. This critical behavior of the SMR is attributed mainly to the temperature dependence of the spin-mixing conductance at the Pt/YIG interface

  9. Concept of Operating Indoor Skiing Halls with

    DEFF Research Database (Denmark)

    Paul, Joachim

    2003-01-01

    Indoor skiing halls are conventionally operated at low temperatures and with either crushed ice as snow substitute or snow made from freezing water in cold air. Both systems have a high energy demand for air cooling, floor freezing and consequently snow harvest. At the same time the snow at the top...... floor cooling/freezing and insulation become obsolete, significant savings in piping and building costs can be achieved. Due to the much higher evaporating temperature for the refrigeration system, the energy demand is kept low. Since the same equipment is used for both snowmaking and air cooling......, the running time of the equipment is high, resulting in a better economy. Using Binary Snow, with its unique qualities such as fluffy, crisp, white and ¿ since made daily ¿ "fresh and hygienic", offers great advantages in operating costs, investment costs and quality....

  10. Geometrical Description of fractional quantum Hall quasiparticles

    Science.gov (United States)

    Park, Yeje; Yang, Bo; Haldane, F. D. M.

    2012-02-01

    We examine a description of fractional quantum Hall quasiparticles and quasiholes suggested by a recent geometrical approach (F. D. M. Haldane, Phys. Rev. Lett. 108, 116801 (2011)) to FQH systems, where the local excess electric charge density in the incompressible state is given by a topologically-quantized ``guiding-center spin'' times the Gaussian curvature of a ``guiding-center metric tensor'' that characterizes the local shape of the correlation hole around electrons in the fluid. We use a phenomenological energy function with two ingredients: the shear distortion energy of area-preserving distortions of the fluid, and a local (short-range) approximation to the Coulomb energy of the fluctuation of charge density associated with the Gaussian curvature. Quasiparticles and quasiholes of the 1/3 Laughlin state are modeled as ``punctures'' in the incompressible fluid which then relax by geometric distortion which generates Gaussian curvature, giving rise to the charge-density profile around the topological excitation.

  11. Cathode Effects in Cylindrical Hall Thrusters

    Energy Technology Data Exchange (ETDEWEB)

    Granstedt, E.M.; Raitses, Y.; Fisch, N. J.

    2008-09-12

    Stable operation of a cylindrical Hall thruster (CHT) has been achieved using a hot wire cathode, which functions as a controllable electron emission source. It is shown that as the electron emission from the cathode increases with wire heating, the discharge current increases, the plasma plume angle reduces, and the ion energy distribution function shifts toward higher energies. The observed effect of cathode electron emission on thruster parameters extends and clarifies performance improvements previously obtained for the overrun discharge current regime of the same type of thruster, but using a hollow cathode-neutralizer. Once thruster discharge current saturates with wire heating, further filament heating does not affect other discharge parameters. The saturated values of thruster discharge parameters can be further enhanced by optimal placement of the cathode wire with respect to the magnetic field.

  12. On-Chip Microwave Quantum Hall Circulator

    Directory of Open Access Journals (Sweden)

    A. C. Mahoney

    2017-01-01

    Full Text Available Circulators are nonreciprocal circuit elements that are integral to technologies including radar systems, microwave communication transceivers, and the readout of quantum information devices. Their nonreciprocity arises from the interference of microwaves over the centimeter scale of the signal wavelength, in the presence of bulky magnetic media that breaks time-reversal symmetry. Here, we realize a completely passive on-chip microwave circulator with size 1/1000th the wavelength by exploiting the chiral, “slow-light” response of a two-dimensional electron gas in the quantum Hall regime. For an integrated GaAs device with 330  μm diameter and about 1-GHz center frequency, a nonreciprocity of 25 dB is observed over a 50-MHz bandwidth. Furthermore, the nonreciprocity can be dynamically tuned by varying the voltage at the port, an aspect that may enable reconfigurable passive routing of microwave signals on chip.

  13. Mesoscopic spin Hall effect in semiconductor nanostructures

    Science.gov (United States)

    Zarbo, Liviu

    The spin Hall effect (SHE) is a name given to a collection of diverse phenomena which share two principal features: (i) longitudinal electric current flowing through a paramagnetic semiconductor or metallic sample leads to transverse spin current and spin accumulation of opposite sign at opposing lateral edges; (ii) SHE does not require externally applied magnetic field or magnetic ordering in the equilibrium state of the sample, instead it relies on the presence of spin-orbit (SO) couplings within the sample. This thesis elaborates on a new type of phenomenon within the SHE family, predicted in our recent studies [Phys. Rev. B 72, 075361 (2005); Phys. Rev. Lett. 95, 046601 (2005); Phys. Rev. B 72, 075335 (2005); Phys. Rev. B 73 , 075303 (2006); and Europhys. Lett. 77, 47004 (2007)], where pure spin current flows through the transverse electrodes attached to a clean finitesize two-dimensional electron gas (2DEG) due to unpolarized charge current injected through its longitudinal leads. If transverse leads are removed, the effect manifests as nonequilibrium spin Hall accumulation at the lateral edges of 2DEG wires. The SO coupling driving this SHE effect is of the Rashba type, which arises due to structural inversion asymmetry of semiconductor heterostructure hosting the 2DEG. We term the effect "mesoscopic" because the spin Hall currents and accumulations reach optimal value in samples of the size of the spin precession length---the distance over which the spin of an electron precesses by an angle pi. In strongly SO-coupled structures this scale is of the order of ˜100 nm, and, therefore, mesoscopic in the sense of being much larger than the characteristic microscopic scales (such as the Fermi wavelength, screening length, or the mean free path in disordered systems), but still much smaller than the macroscopic ones. Although the first theoretical proposal for SHE, driven by asymmetry in SO-dependent scattering of spin-up and spin-down electrons off impurities

  14. 50 KW Class Krypton Hall Thruster Performance

    Science.gov (United States)

    Jacobson, David T.; Manzella, David H.

    2003-01-01

    The performance of a 50-kilowatt-class Hall thruster designed for operation on xenon propellant was measured using kryton propellant. The thruster was operated at discharge power levels ranging from 6.4 to 72.5 kilowatts. The device produced thrust ranging from 0.3 to 2.5 newtons. The thruster was operated at discharge voltages between 250 and 1000 volts. At the highest anode mass flow rate and discharge voltage and assuming a 100 percent singly charged condition, the discharge specific impulse approached the theoretical value. Discharge specific impulse of 4500 seconds was demonstrated at a discharge voltage of 1000 volts. The peak discharge efficiency was 64 percent at 650 volts.

  15. Magnon Hall effect on the Lieb lattice.

    Science.gov (United States)

    Cao, Xiaodong; Chen, Kai; He, Dahai

    2015-04-29

    Ferromagnetic insulators without inversion symmetry may show magnon Hall effect (MHE) in the presence of a temperature gradient due to the existence of Dzyaloshinskii-Moriya interaction (DMI). In this theoretical study, we investigate MHE on a lattice with inversion symmetry, namely the Lieb lattice, where the DMI is introduced by adding an external electric field. We show the nontrivial topology of this model by examining the existence of edge states and computing the topological phase diagram characterized by the Chern numbers of different bands. Together with the topological phase diagram, we can further determine the sign and magnitude of the transverse thermal conductivity. The impact of the flat band possessed by this model on the thermal conductivity is discussed by computing the Berry curvature analytically.

  16. Photonic spin Hall effect at metasurfaces.

    Science.gov (United States)

    Yin, Xiaobo; Ye, Ziliang; Rho, Junsuk; Wang, Yuan; Zhang, Xiang

    2013-03-22

    The spin Hall effect (SHE) of light is very weak because of the extremely small photon momentum and spin-orbit interaction. Here, we report a strong photonic SHE resulting in a measured large splitting of polarized light at metasurfaces. The rapidly varying phase discontinuities along a metasurface, breaking the axial symmetry of the system, enable the direct observation of large transverse motion of circularly polarized light, even at normal incidence. The strong spin-orbit interaction deviates the polarized light from the trajectory prescribed by the ordinary Fermat principle. Such a strong and broadband photonic SHE may provide a route for exploiting the spin and orbit angular momentum of light for information processing and communication.

  17. Residencia hall del Obispado, en Gescher, Alemania

    Directory of Open Access Journals (Sweden)

    Deilmann, Harald

    1969-02-01

    Full Text Available This Hall has four lecture rooms, each with a capacity for twenty students. They all face north, have lateral and cenithal illumination and cross ventilation. The workshop training halls face south, and there is a gymnasium. Each classroom is also connected with a protected open air space, so that in suitable weather, teaching can be practised out of doors. As the school is devoted to mentally retarded boys and youths, over 2 m2 of floor area has been allowed for each student in the classrooms, since it was estimated that many students would be of the nervous type and would need more room to work freely. Most of the construction is made with unfaced brick and concrete, which are long lasting materials, requiring little maintenance.Comprende cuatro clases propiamente dichas, con una capacidad total de 80 alumnos, a razón de 20 por cada clase, y orientadas al norte, con iluminación cenital y lateral y ventilación cruzada. Los locales donde se imparten las enseñanzas de taller tienen orientación sur. Se ha previsto, además, un gimnasio. Cada clase dispone de un recinto protegido para que, cuando las condiciones atmosféricas lo permitan, se pueda desarrollar en él la enseñanza al aire libre. Como la escuela está destinada a niños y adolescentes retrasados mentales, se partió de un espacio superior a los 2 m2 por alumno, pensando en que parte de ellos iban a ser niños nerviosos y, como consecuencia, la necesidad que tendrían de amplitud suficiente para desenvolverse adecuadamente. La construcción se ha desarrollado, en general, a base de fábrica de ladrillo a cara vista y hormigón visto, materiales de gran duración y prácticamente exentos de entretenimiento.

  18. Nonadiabatic effects in the Quantum Hall regime

    International Nuclear Information System (INIS)

    Page, D.A.; Brown, E.

    1993-01-01

    The authors consider the effect of a finite electric field on the states of a Bloch electron in two dimensions, with a uniform magnetic field present. They make use of the concept of electric time translation symmetry and treat the electric and magnetic fields symmetrically in a time dependent formalism. In addition to a wave vector k, the states are characterized by a frequency specifying the behavior under electric time translations. An effective Hamiltonian is employed to obtain the splitting of an isolated Bloch band into open-quotes frequencyclose quotes subbands. The time-averaged velocity and energy of the states are expressed in terms of the frequency dispersion. The relationship to the Stark ladder eigenstates in a scalar potential representation of the electric field is examined. This is seen to justify the use of the averaged energy in determining occupation of the states. In the weak electric field (adiabatic) limit, an expression is recovered for the quantized Hall conductivity of a magnetic subband as a topological invariant. A numerical procedure is outlined and results obtained over a range of electric field strengths. A transition between strong and weak field regimes is seen, with level repulsions between the frequencies playing an important role. The numerical results show how the magnetic subband structure and quantized Hall conductivity emerge as the electric field becomes weaker. In this regime, the behavior can be understood by comparison to the predictions of the adiabatic approximation. The latter predicts crossings in the frequencies at certain locations in wave vector space. Nonadiabatic effects are seen to produce gaps in the frequency spectrum at these locations. 35 refs., 14 figs

  19. Effect of Bifidobacterium breve B-3 on skin photoaging induced by chronic UV irradiation in mice.

    Science.gov (United States)

    Satoh, T; Murata, M; Iwabuchi, N; Odamaki, T; Wakabayashi, H; Yamauchi, K; Abe, F; Xiao, J Z

    2015-01-01

    Probiotics have been shown to have a preventative effect on skin photoaging induced by short term UV irradiation, however, the underlying mechanisms and the effect of probiotics on skin photoaging induced by chronic UV irradiation remain unclear. In this study, we investigated the effect of Bifidobacterium breve B-3 on skin photoaging induced by chronic UV irradiation in hairless mice. Mice were irradiated with UVB three times weekly and orally administered B. breve B-3 (2×10(9) cfu/mouse /day) for 7 weeks. Nonirradiated mice and UVB-irradiated mice without probiotic treatment were used as controls. B. breve B-3 significantly suppressed the changes of transepidermal water loss, skin hydration, epidermal thickening and attenuated the damage to the tight junction structure and basement membrane induced by chronic UVB irradiation. Administration of B. breve B-3 tended to suppress the UV-induced interleukin-1β production in skin (P=0.09). These results suggest that B. breve B-3 could potentially be used to prevent photoaging induced by chronic UV irradiation.

  20. Reactor Physics

    International Nuclear Information System (INIS)

    Ait Abderrahim, A.

    2002-01-01

    SCK-CEN's Reactor Physics and MYRRHA Department offers expertise in various areas of reactor physics, in particular in neutron and gamma calculations, reactor dosimetry, reactor operation and control, reactor code benchmarking and reactor safety calculations. This expertise is applied in the Department's own research projects in the VENUS critical facility, in the BR1 reactor and in the MYRRHA project (this project aims at designing a prototype Accelerator Driven System). Available expertise is also used in programmes external to the Department such as the reactor pressure steel vessel programme, the BR2 materials testing reactor dosimetry, and the preparation and interpretation of irradiation experiments by means of neutron and gamma calculations. The activities of the Fuzzy Logic and Intelligent Technologies in Nuclear Science programme cover several domains outside the department. Progress and achievements in these topical areas in 2001 are summarised

  1. Reactor Physics

    Energy Technology Data Exchange (ETDEWEB)

    Ait Abderrahim, A

    2001-04-01

    The Reactor Physics and MYRRHA Department of SCK-CEN offers expertise in various areas of reactor physics, in particular in neutronics calculations, reactor dosimetry, reactor operation, reactor safety and control and non-destructive analysis of reactor fuel. This expertise is applied in the Department's own research projects in the VENUS critical facility, in the BR1 reactor and in the MYRRHA project (this project aims at designing a prototype Accelerator Driven System). Available expertise is also used in programmes external to the Department such as the reactor pressure steel vessel programme, the BR2 reactor dosimetry, and the preparation and interpretation of irradiation experiments by means of neutron and gamma calculations. The activities of the Fuzzy Logic and Intelligent Technologies in Nuclear Science programme cover several domains outside the department. Progress and achievements in these topical areas in 2000 are summarised.

  2. Reactor Physics

    Energy Technology Data Exchange (ETDEWEB)

    Ait Abderrahim, A

    2002-04-01

    SCK-CEN's Reactor Physics and MYRRHA Department offers expertise in various areas of reactor physics, in particular in neutron and gamma calculations, reactor dosimetry, reactor operation and control, reactor code benchmarking and reactor safety calculations. This expertise is applied in the Department's own research projects in the VENUS critical facility, in the BR1 reactor and in the MYRRHA project (this project aims at designing a prototype Accelerator Driven System). Available expertise is also used in programmes external to the Department such as the reactor pressure steel vessel programme, the BR2 materials testing reactor dosimetry, and the preparation and interpretation of irradiation experiments by means of neutron and gamma calculations. The activities of the Fuzzy Logic and Intelligent Technologies in Nuclear Science programme cover several domains outside the department. Progress and achievements in these topical areas in 2001 are summarised.

  3. Reactor Physics

    International Nuclear Information System (INIS)

    Ait Abderrahim, A.

    2001-01-01

    The Reactor Physics and MYRRHA Department of SCK-CEN offers expertise in various areas of reactor physics, in particular in neutronics calculations, reactor dosimetry, reactor operation, reactor safety and control and non-destructive analysis of reactor fuel. This expertise is applied in the Department's own research projects in the VENUS critical facility, in the BR1 reactor and in the MYRRHA project (this project aims at designing a prototype Accelerator Driven System). Available expertise is also used in programmes external to the Department such as the reactor pressure steel vessel programme, the BR2 reactor dosimetry, and the preparation and interpretation of irradiation experiments by means of neutron and gamma calculations. The activities of the Fuzzy Logic and Intelligent Technologies in Nuclear Science programme cover several domains outside the department. Progress and achievements in these topical areas in 2000 are summarised

  4. Spontaneous Hall effect in a chiral p-wave superconductor

    Science.gov (United States)

    Furusaki, Akira; Matsumoto, Masashige; Sigrist, Manfred

    2001-08-01

    In a chiral superconductor with broken time-reversal symmetry a ``spontaneous Hall effect'' may be observed. We analyze this phenomenon by taking into account the surface properties of a chiral superconductor. We identify two main contributions to the spontaneous Hall effect. One contribution originates from the Bernoulli (or Lorentz) force due to spontaneous currents running along the surfaces of the superconductor. The other contribution has a topological origin and is related to the intrinsic angular momentum of Cooper pairs. The latter can be described in terms of a Chern-Simons-like term in the low-energy field theory of the superconductor and has some similarities with the quantum Hall effect. The spontaneous Hall effect in a chiral superconductor is, however, nonuniversal. Our analysis is based on three approaches to the problem: a self-consistent solution of the Bogoliubov-de Gennes equation, a generalized Ginzburg-Landau theory, and a hydrodynamic formulation. All three methods consistently lead to the same conclusion that the spontaneous Hall resistance of a two-dimensional superconducting Hall bar is of order h/(ekFλ)2, where kF is the Fermi wave vector and λ is the London penetration depth; the Hall resistance is substantially suppressed from a quantum unit of resistance. Experimental issues in measuring this effect are briefly discussed.

  5. Hall current effects in dynamic magnetic reconnection solutions

    International Nuclear Information System (INIS)

    Craig, I.J.D.; Heerikhuisen, J.; Watson, P.G.

    2003-01-01

    The impact of Hall current contributions on flow driven planar magnetic merging solutions is discussed. The Hall current is important if the dimensionless Hall parameter (or normalized ion skin depth) satisfies c H >η, where η is the inverse Lundquist number for the plasma. A dynamic analysis of the problem shows, however, that the Hall current initially manifests itself, not by modifying the planar reconnection field, but by inducing a non-reconnecting perpendicular 'separator' component in the magnetic field. Only if the stronger condition c H 2 >η is satisfied can Hall currents be expected to affect the planar merging. These analytic predictions are then tested by performing a series of numerical experiments in periodic geometry, using the full system of planar magnetohydrodynamic (MHD) equations. The numerical results confirm that the nature of the merging changes dramatically when the Hall coupling satisfies c H 2 >η. In line with the analytic treatment of sheared reconnection, the coupling provided by the Hall term leads to the emergence of multiple current layers that can enhance the global Ohmic dissipation at the expense of the reconnection rate. However, the details of the dissipation depend critically on the symmetries of the simulation, and when the merging is 'head-on' (i.e., comprises fourfold symmetry) the reconnection rate can be enhanced

  6. Graphene and the universality of the quantum Hall effect

    DEFF Research Database (Denmark)

    Tzalenchuk, A.; Janssen, T. J.B.M.; Kazakova, O.

    2013-01-01

    The quantum Hall effect allows the standard for resistance to be defined in terms of the elementary charge and Planck's constant alone. The effect comprises the quantization of the Hall resistance in two-dimensional electron systems in rational fractions of RK=h/e2=25812.8074434(84) Ω (Mohr P. J....... the unconventional quantum Hall effect and then present in detail the route, which led to the most precise quantum Hall resistance universality test ever performed.......The quantum Hall effect allows the standard for resistance to be defined in terms of the elementary charge and Planck's constant alone. The effect comprises the quantization of the Hall resistance in two-dimensional electron systems in rational fractions of RK=h/e2=25812.8074434(84) Ω (Mohr P. J....... et al., Rev. Mod. Phys., 84 (2012) 1527), the resistance quantum. Despite 30 years of research into the quantum Hall effect, the level of precision necessary for metrology, a few parts per billion, has been achieved only in silicon and III-V heterostructure devices. In this lecture we show...

  7. Decommissioning of Salaspils Research Reactor

    International Nuclear Information System (INIS)

    Abramenkovs, A.; Popelis, A.; Abramenkova, G

    2008-01-01

    The Salaspils Research Reactor (SRR) is out of operation since July 1998 and the decommissioning of SRR was started in 1999 according to the decision of the Government of Latvia. The main decommissioning activities up to 2006 were connected with collecting and conditioning of historical radioactive wastes from different storages outside and inside of reactor hall. The total amount of dismantled materials was about 700 tons, more than 77 tons were conditioned in concrete containers for disposal in repository. The radioactive wastes management technology is discussed in the paper. It was found, that additional efforts must be spent for immobilization of radionuclides in cemented matrix to be comply with the wastes acceptance criteria. The investigations of mechanical stability of water-cement matrix are described and discussed in the paper

  8. Gas-flow detector for uranium contamination on finned-can surface of a reactor fuel; Detecteur a courant gazeux pour deceler la contamination en uranium des nervures des gaines de combustible nucleaire; Gazopotochnyj detektor zagryazneniya uranom rebristoj poverkhnosti obolochki reaktornykh teplovydelyayushchikh ehlementov; Detector de flujo gaseoso para medir la contaminacion de uranio en la superficie de la vaina de aletas de los elementos combustibles para reactores

    Energy Technology Data Exchange (ETDEWEB)

    Miwa, H; Shiojiri, T; Maeda, Y [Kobe Kogyo Corporation, Okubo, Akashi, Hyogo (Japan)

    1962-04-15

    Calder Hall-type reactor-fuel and all JRR-3 fuels are to be inspected by this counter. (author) [French] Le detecteur a courant gazeux presente par les auteurs est un compteur proportionnel a grille, specialement concu pour deceler la contamination en uranium des nervures des gaines de combustible nucleaire. Un compteur proportionnel classique, compose seulement d'une cathode et d'un collecteur, n'est guere capable de deceler les particules alpha emises par l'uranium contaminant une surface rugueuse telle que les nervures d'une gaine de combustible nucleaire, par suite du manque d'uniformite du champ electrique pres de la surface. C'est pourquoi les auteurs ont construit un compteur proportionnel a grille. Cet appareil, de forme cylindrique, comprend le combustible, une grille, des collecteurs et une cathode, tous les elements etant disposes suivant le meme axe. Le combustible est place au centre de la grille a laquelle on applique une tension negative. L'espace entre le combustible et la grille sert de collecteur d'ions. La grille, faite de fils paralleles minces en tungstene, disposes suivant un cylindre autour du combustible, est reliee a la terre. Les collecteurs sont constitues de 16 minces fils de tungstene disposes de la meme maniere que la grille, mais chaque fil est isole electriquement des autres. Tous les collecteurs sont interconnectes par des resistances de 5 x 10{sup 4} ohms et relies au positif de la haute tension par une resistance. L'espace entre la grille, les collecteurs et la cathode sert a la multiplication du gaz, tout comme dans un compteur proportionnel classique. Chaque resistance de 5 x 10{sup 4} ohms isole la capacite parasite de chaque collecteur. La sortie du detecteur est couplee a un amplificateur a faible impedance d'entree. La faible impedance d'entree diminue aussi l'influence facheuse de la capacite parasite du circuit d'entree. Il en resulte un rapport favorable signal/bruit de fond, ce qui permet une bonne detection des particules

  9. Reactor operation

    CERN Document Server

    Shaw, J

    2013-01-01

    Reactor Operation covers the theoretical aspects and design information of nuclear reactors. This book is composed of nine chapters that also consider their control, calibration, and experimentation.The opening chapters present the general problems of reactor operation and the principles of reactor control and operation. The succeeding chapters deal with the instrumentation, start-up, pre-commissioning, and physical experiments of nuclear reactors. The remaining chapters are devoted to the control rod calibrations and temperature coefficient measurements in the reactor. These chapters also exp

  10. Reactor safeguards

    CERN Document Server

    Russell, Charles R

    1962-01-01

    Reactor Safeguards provides information for all who are interested in the subject of reactor safeguards. Much of the material is descriptive although some sections are written for the engineer or physicist directly concerned with hazards analysis or site selection problems. The book opens with an introductory chapter on radiation hazards, the construction of nuclear reactors, safety issues, and the operation of nuclear reactors. This is followed by separate chapters that discuss radioactive materials, reactor kinetics, control and safety systems, containment, safety features for water reactor

  11. Lesions of uncertain malignant potential in the breast (B3): what do we know?

    International Nuclear Information System (INIS)

    Purushothaman, H.N.; Lekanidi, K.; Shousha, S.; Wilson, R.

    2016-01-01

    Breast lesions classified as of uncertain malignant potential (B3) on biopsy form a diverse group of abnormalities, which pose a diagnostic and management challenge. In this paper, we discuss the imaging and pathology features as well as the management of the most controversial B3 lesions, consisting of papillary lesions, complex sclerosing lesions/radial scars, lobular intraepithelial neoplasia, and atypical epithelial proliferation of ductal type. As there is an association with malignancy at the time of diagnosis, as well as an increase in the risk of subsequent development of cancer, a multidisciplinary discussion is almost always required to tailor treatment.

  12. Lithium tri borate (LiB3O5) embedded polymer electret for mechanical sensing application

    Science.gov (United States)

    Murugan, S.; Praveen, E.; Prasad, M. V. N.; Jayakumar, K.

    2017-05-01

    Lithium tri borate (LiB3O5) particles were synthesized by precipitation assisted high temperature solid state reaction. The particles were embedded in chitosan polymer and used as an electret. This electret was characterized for the suitability as a sensing element in vibration accelerometer. It is observed that LiB3O5 embedded electret exhibiting piezoelectric property. The electret is also giving an isolation of > 999 MΩ at 100 Vdc, 250 Vdc, 500 Vdc and 1kVdc confirms compatible for intrinsically safe sensing alternative in vibration accelerometer.

  13. Short syntheses of enantiopure calystegine B-2, B-3, and B-4

    DEFF Research Database (Denmark)

    Skaanderup, Philip Robert; Madsen, Robert

    2001-01-01

    Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps.......Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps....

  14. MOLECULAR DYNAMICS STUDY OF INTERACTIONS OF POLYMYXIN B3 AND ITS ALA-MUTANTS WITH LIPOPOLYSACCHARIDE

    Directory of Open Access Journals (Sweden)

    Lisnyak Yu. V.

    2015-12-01

    Full Text Available Introduction. Emergence of nosocomial bacterial pathogens (especially Gram-negative bacteria with multiple resistance against almost all available antibiotics is a growing medical problem. No novel drugs targeting multidrug-resistant Gram-negative bacteria have been developed in recent years. In this context, there has been greatly renewed interest to cyclic lipodecapeptides polymyxins. Polymyxins exhibit rapid bactericidal activity, they are specific and highly potent against Gramnegative bacteria, but have potential nephrotoxic side effects. So polymyxins are attractive lead compounds to develop analogues with improved microbiological, pharmacological and toxicological properties. A detailed knowledge of the molecular mechanisms of polymyxin interactions with its cell targets is a prerequisite for the purposeful improvement of its therapeutic properties. The primary cell target of a polymyxin is a lipopolysaccharide (LPS in the outer membrane of Gram-negative bacteria. The binding site of polymyxin on LPS has been supposed to be Kdo2-lipid A fragment. Methods. For all molecular modeling and molecular dynamics simulation experiments the YASARA suite of programs was used. Complex of antimicrobial peptide polymyxin В3 (PmB3 with Kdo2-lipid A portion of E. coli lipopolysaccharide was constructed by rigid docking with flexible side chains of the peptide. By alanine scanning of polymyxin В3 bound to LPS followed by simulated annealing minimization of the complexes in explicit water environment, the molecular aspects of PmB3-LPS binding have been studied by 20 ns molecular dynamics simulations at 298 K and pH 7.0. The AMBER03 force field was used with a 1.05 nm force cutoff. To treat long range electrostatic interactions the Particle Mesh Ewald algorithm was used. Results. Ala-mutations of polymyxin’s residues Dab1, Dab3, Dab5, Dab8 and Dab9 in the PmB3-LPS complex caused sustained structural changes resulting in the notable loss in stability of

  15. Signal conditioning and processing for metallic Hall sensors.

    Czech Academy of Sciences Publication Activity Database

    Entler, Slavomír; Ďuran, Ivan; Sládek, P.; Vayakis, G.; Kočan, M.

    2017-01-01

    Roč. 123, November (2017), s. 783-786 ISSN 0920-3796. [SOFT 2016: Symposium on Fusion Technology /29./. Prague, 05.09.2016-09.09.2016] R&D Projects: GA MŠk LG14002 Institutional support: RVO:61389021 Keywords : Hall sensor * Lock-in * Synchronous detection * Current spinning * Hall effect * Planar hall effect suppression Subject RIV: JF - Nuclear Energetics OBOR OECD: Nuclear related engineering Impact factor: 1.319, year: 2016 http://www.sciencedirect.com/science/article/pii/S0920379617305070

  16. Anomalous Hall effect in Fe/Gd bilayers

    KAUST Repository

    Xu, W. J.; Zhang, Bei; Liu, Z. X.; Wang, Z.; Li, W.; Wu, Z. B.; Yu, R. H.; Zhang, Xixiang

    2010-01-01

    Non-monotonic dependence of anomalous Hall resistivity on temperature and magnetization, including a sign change, was observed in Fe/Gd bilayers. To understand the intriguing observations, we fabricated the Fe/Gd bilayers and single layers of Fe and Gd simultaneously. The temperature and field dependences of longitudinal resistivity, Hall resistivity and magnetization in these films have also been carefully measured. The analysis of these data reveals that these intriguing features are due to the opposite signs of Hall resistivity/or spin polarization and different Curie temperatures of Fe and Gd single-layer films. Copyright (C) EPLA, 2010

  17. Hall conductance and topological invariant for open systems.

    Science.gov (United States)

    Shen, H Z; Wang, W; Yi, X X

    2014-09-24

    The Hall conductivity given by the Kubo formula is a linear response of quantum transverse transport to a weak electric field. It has been intensively studied for quantum systems without decoherence, but it is barely explored for systems subject to decoherence. In this paper, we develop a formulism to deal with this issue for topological insulators. The Hall conductance of a topological insulator coupled to an environment is derived, the derivation is based on a linear response theory developed for open systems in this paper. As an application, the Hall conductance of a two-band topological insulator and a two-dimensional lattice is presented and discussed.

  18. Acoustic investigations of concert halls for rock music

    DEFF Research Database (Denmark)

    Adelman-Larsen, Niels Werner; Thompson, Eric Robert; Gade, Anders Christian

    2007-01-01

    Objective measurement data and subjective evaluations have been collected from 20 small-/medium-sized halls in Denmark used for amplified rhythmic music concerts (pop, rock, jazz). The purpose of the study was to obtain knowledge about optimum acoustic conditions for this type of hall. The study...... is motivated by the fact that most concert tickets sold in Denmark relate to concerts within these genres in this kind of venue. The subjective evaluations were carried out by professional musicians and sound engineers who responded on the basis of their experiences working in these (and other) halls. From...

  19. Anomalous Hall effect in Fe/Gd bilayers

    KAUST Repository

    Xu, W. J.

    2010-04-01

    Non-monotonic dependence of anomalous Hall resistivity on temperature and magnetization, including a sign change, was observed in Fe/Gd bilayers. To understand the intriguing observations, we fabricated the Fe/Gd bilayers and single layers of Fe and Gd simultaneously. The temperature and field dependences of longitudinal resistivity, Hall resistivity and magnetization in these films have also been carefully measured. The analysis of these data reveals that these intriguing features are due to the opposite signs of Hall resistivity/or spin polarization and different Curie temperatures of Fe and Gd single-layer films. Copyright (C) EPLA, 2010

  20. All Optical Measurement Proposed for the Photovoltaic Hall Effect

    International Nuclear Information System (INIS)

    Oka, Takashi; Aoki, Hideo

    2011-01-01

    We propose an all optical way to measure the recently proposed p hotovoltaic Hall effect , i.e., a Hall effect induced by a circularly polarized light in the absence of static magnetic fields. This is done in a pump-probe experiment with the Faraday rotation angle being the probe. The Floquet extended Kubo formula for photo-induced optical response is formulated and the ac-Hall conductivity is calculated. We also point out the possibility of observing the effect in two layered graphene, three-dimensional graphite, and more generally in multi-band systems such as materials described by the dp-model.

  1. Determination of intrinsic spin Hall angle in Pt

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yi; Deorani, Praveen; Qiu, Xuepeng; Kwon, Jae Hyun; Yang, Hyunsoo, E-mail: eleyang@nus.edu.sg [Department of Electrical and Computer Engineering, National University of Singapore, 117576 (Singapore)

    2014-10-13

    The spin Hall angle in Pt is evaluated in Pt/NiFe bilayers by spin torque ferromagnetic resonance measurements and is found to increase with increasing the NiFe thickness. To extract the intrinsic spin Hall angle in Pt by estimating the total spin current injected into NiFe from Pt, the NiFe thickness dependent measurements are performed and the spin diffusion in the NiFe layer is taken into account. The intrinsic spin Hall angle of Pt is determined to be 0.068 at room temperature and is found to be almost constant in the temperature range of 13–300 K.

  2. Determination of intrinsic spin Hall angle in Pt

    International Nuclear Information System (INIS)

    Wang, Yi; Deorani, Praveen; Qiu, Xuepeng; Kwon, Jae Hyun; Yang, Hyunsoo

    2014-01-01

    The spin Hall angle in Pt is evaluated in Pt/NiFe bilayers by spin torque ferromagnetic resonance measurements and is found to increase with increasing the NiFe thickness. To extract the intrinsic spin Hall angle in Pt by estimating the total spin current injected into NiFe from Pt, the NiFe thickness dependent measurements are performed and the spin diffusion in the NiFe layer is taken into account. The intrinsic spin Hall angle of Pt is determined to be 0.068 at room temperature and is found to be almost constant in the temperature range of 13–300 K.

  3. RMB: the new Brazilian Multipurpose Research Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Perrotta, Jose Augusto, E-mail: perrotta@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2016-07-01

    Full text: The Brazilian research reactors have a limited capacity for radioisotopes production, leading to a high dependence on external supply for radioisotopes used in nuclear medicine. In order to overcome this condition and due to the old age of these research reactors, the Brazilian Nuclear Energy Commission decided, in 2008, to construct a new research reactor. The new reactor named RMB (Brazilian Multipurpose Reactor) will be part of a new nuclear research center, to be built on a site about 100 kilometers from São Paulo city, in the southern part of Brazil. The new nuclear research center will have a 30 MW open pool type research reactor using low enriched uranium fuel, and several associated laboratories in order to produce radioisotopes for medical and industrial use, to use neutron beams in scientific and technological research; to perform neutron activation analysis; and to perform materials and fuels irradiation tests. Regarding the neutron beams use, the RMB design provides thermal and cold neutron beams. From one side of the reactor, the neutron guides will extend to an experimental hall of instruments named Neutron Guide Hall where it will be installed the scattering instruments. In the initial stage of the reactor operation, the intent is to implement two neutron guides for thermal neutrons and another two for cold neutrons. The 2015 SBPMAT symposium has presented the technical overview of the RMB project and its main buildings, structures and components. At this year symposium, the RMB presentation updates some technical information and the development status of the project, discussing the negative results of the Brazilian political and economic crisis to the project development and its future perspectives. (author)

  4. Nuclear reactors

    International Nuclear Information System (INIS)

    Middleton, J.E.

    1977-01-01

    Reference is made to water cooled reactors and in particular to the cooling system of steam generating heavy water reactors (SGHWR). A two-coolant circuit is described for the latter. Full constructural details are given. (U.K.)

  5. Reactor decommissioning

    International Nuclear Information System (INIS)

    Lawton, H.

    1984-01-01

    A pioneering project on the decommissioning of the Windscale Advanced Gas-cooled Reactor, by the UKAEA, is described. Reactor data; policy; waste management; remote handling equipment; development; and recording and timescales, are all briefly discussed. (U.K.)

  6. Properties of Nonabelian Quantum Hall States

    Science.gov (United States)

    Simon, Steven H.

    2004-03-01

    The quantum statistics of particles refers to the behavior of a multiparticle wavefunction under adiabatic interchange of two identical particles. While a three dimensional world affords the possibilities of Bosons or Fermions, the two dimensional world has more exotic possibilities such as Fractional and Nonabelian statistics (J. Frölich, in ``Nonperturbative Quantum Field Theory", ed, G. t'Hooft. 1988). The latter is perhaps the most interesting where the wavefunction obeys a ``nonabelian'' representation of the braid group - meaning that braiding A around B then B around C is not the same as braiding B around C then A around B. This property enables one to think about using these exotic systems for robust topological quantum computation (M. Freedman, A. Kitaev, et al, Bull Am Math Soc 40, 31 (2003)). Surprisingly, it is thought that quasiparticles excitations with such nonabelian statistics may actually exist in certain quantum Hall states that have already been observed. The most likely such candidate is the quantum Hall ν=5/2 state(R. L. Willett et al, Phys. Rev. Lett. 59, 1776-1779 (1987)), thought to be a so-called Moore-Read Pfaffian state(G. Moore and N. Read, Nucl Phys. B360 362 (1991)), which can be thought of as a p-wave paired superconducting state of composite fermions(M. Greiter, X. G. Wen, and F. Wilczek, PRL 66, 3205 (1991)). Using this superconducting analogy, we use a Chern-Simons field theory approach to make a number of predictions as to what experimental signatures one should expect for this state if it really is this Moore-Read state(K. Foster, N. Bonesteel, and S. H. Simon, PRL 91 046804 (2003)). We will then discuss how the nonabelian statistics can be explored in detail using a quantum monte-carlo approach (Y. Tserkovnyak and S. H. Simon, PRL 90 106802 (2003)), (I. Finkler, Y. Tserkovnyak, and S. H. Simon, work in progress.) that allows one to explicitly drag one particle around another and observe the change in the wavefunctions

  7. 17 CFR 240.10b-3 - Employment of manipulative and deceptive devices by brokers or dealers.

    Science.gov (United States)

    2010-04-01

    ... deceptive devices by brokers or dealers. 240.10b-3 Section 240.10b-3 Commodity and Securities Exchanges... Contrivances § 240.10b-3 Employment of manipulative and deceptive devices by brokers or dealers. (a) It shall be unlawful for any broker or dealer, directly or indirectly, by the use of any means or...

  8. RA Reactor

    International Nuclear Information System (INIS)

    1978-02-01

    In addition to basic characteristics of the RA reactor, organizational scheme and financial incentives, this document covers describes the state of the reactor components after 18 years of operation, problems concerned with obtaining the licence for operation with 80% fuel, problems of spent fuel storage in the storage pool of the reactor building and the need for renewal of reactor equipment, first of all instrumentation [sr

  9. Multiregion reactors

    International Nuclear Information System (INIS)

    Moura Neto, C. de; Nair, R.P.K.

    1979-08-01

    The study of reflected reactors can be done employing the multigroup diffusion method. The neutron conservation equations, inside the intervals, can be written by fluxes and group constants. A reflected reactor (one and two groups) for a slab geometry is studied, aplying the continuity of flux and current in the interface. At the end, the appropriated solutions for a infinite cylindrical reactor and for a spherical reactor are presented. (Author) [pt

  10. First International Consensus Conference on lesions of uncertain malignant potential in the breast (B3 lesions).

    Science.gov (United States)

    Rageth, Christoph J; O'Flynn, Elizabeth Am; Comstock, Christopher; Kurtz, Claudia; Kubik, Rahel; Madjar, Helmut; Lepori, Domenico; Kampmann, Gert; Mundinger, Alexander; Baege, Astrid; Decker, Thomas; Hosch, Stefanie; Tausch, Christoph; Delaloye, Jean-François; Morris, Elisabeth; Varga, Zsuzsanna

    2016-09-01

    The purpose of this study is to obtain a consensus for the therapy of B3 lesions. The first International Consensus Conference on lesions of uncertain malignant potential in the breast (B3 lesions) including atypical ductal hyperplasia (ADH), flat epithelial atypia (FEA), classical lobular neoplasia (LN), papillary lesions (PL), benign phyllodes tumors (PT), and radial scars (RS) took place in January 2016 in Zurich, Switzerland organized by the International Breast Ultrasound School and the Swiss Minimally Invasive Breast Biopsy group-a subgroup of the Swiss Society of Senology. Consensus recommendations for the management and follow-up surveillance of these B3 lesions were developed and areas of research priorities were identified. The consensus recommendation for FEA, LN, PL, and RS diagnosed on core needle biopsy or vacuum-assisted biopsy (VAB) is to therapeutically excise the lesion seen on imaging by VAB and no longer by open surgery, with follow-up surveillance imaging for 5 years. The consensus recommendation for ADH and PT is, with some exceptions, therapeutic first-line open surgical excision. Minimally invasive management of selected B3 lesions with therapeutic VAB is acceptable as an alternative to first-line surgical excision.

  11. Probable transmission of coxsackie B3 virus from human to chimpanzee, Denmark

    DEFF Research Database (Denmark)

    Nielsen, Sandra Cathrine Abel; Mourier, Tobias; Baandrup, Ulrik

    2012-01-01

    In 2010, a chimpanzee died at Copenhagen Zoo following an outbreak of respiratory disease among chimpanzees in the zoo. Identification of coxsackie B3 virus, a common human pathogen, as the causative agent, and its severe manifestation, raise questions about pathogenicity and transmissibility among...

  12. New patient pathway using vacuum-assisted biopsy reduces diagnostic surgery for B3 lesions

    International Nuclear Information System (INIS)

    Rajan, S.; Shaaban, A.M.; Dall, B.J.G.; Sharma, N.

    2012-01-01

    Aim: To assess the clinical impact of a new patient management pathway incorporating vacuum-assisted biopsy for lesions of uncertain malignant potential (B3). Materials and methods: A retrospective analysis was undertaken of all B3 lesions on core biopsy in the pathology database from April 2008 to April 2010. Outcome measures assessed included final histological diagnosis, frequency of diagnostic surgical biopsy, and impact on management. Results: In the old pathway, there were 95 B3 lesions, of which 14% (13/95) were planned for vacuum-assisted biopsy and 86% (82/95) for surgical biopsy. In the new pathway, there were 94 B3 lesions, of which 68% (64/94) were planned for vacuum-assisted biopsy and 32% (30/94) for surgical biopsy. Following further sampling with vacuum-assisted biopsy, only 13% of patients required diagnostic surgical biopsy and in 25% of cases, a preoperative diagnosis of carcinoma was reached allowing patients to proceed to therapeutic surgery. Conclusion: The new pathway has reduced the number of benign diagnostic surgical biopsies performed and increased the preoperative diagnosis of breast cancer.

  13. 17 CFR 270.24b-3 - Sales literature deemed filed.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales literature deemed filed... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.24b-3 Sales literature deemed filed. Any advertisement, pamphlet, circular, form letter or other sales literature addressed to or intended...

  14. KCC isoforms in a human lens epithelial cell line (B3) and lens tissue extracts.

    Science.gov (United States)

    Misri, Sandeep; Chimote, Ameet A; Adragna, Norma C; Warwar, Ronald; Brown, Thomas L; Lauf, Peter K

    2006-11-01

    We recently reported potassium-chloride cotransporter activity in human lens epithelial B3 (HLE-B3) cells. The purpose of the present study was to demonstrate in these cells as well as in human lens tissue the potassium-chloride cotransport (KCC) isoforms by reverse transcriptase-polymerase chain reaction (RT-PCR), Western blotting and immunofluorescence microscopy. Of the four KCC genes known to encode the respective proteins and their spliced variants, RT-PCR with both rat and human primers revealed the predicted cDNA fragments of KCC1, KCC3a, KCC3b, and KCC4 but not KCC2 in both HLE-B3 cells and in human lens tissue extracts from cataractous patients. Polyclonal rabbit (rb) anti-rat (rt) and anti-human (hm) antibodies against rtKCC1 and hmKCC3, respectively, and a commercially available rb-anti-mouse (ms) KCC4 antibody were used. Rb anti-rtKCC1-ECL3 [against epitopes within the large extracellular loop 3 (ECL3)] revealed a 150kDa band in HLE-B3 cells consistent with the known molecular weight of KCC1. Rb anti-hmKCC3-ECL3 yielded three bands of 150, 122 and 105kDa, evidence for the presence of KCC3a, KCC3b and possibly KCC3c isoforms. The 122 and 112kDa bands were also demonstrated by rb anti-hmKCC3-CTD [the C-terminal domain (CTD)]. Rb anti-msKCC4 antibody only showed a 100kDa band in HLE-B3 cells. In the human lens tissues, a 115kDa protein was detected with rb anti-rtKCC1-ECL3 and a 100kDa band with rb anti-msKCC4, however, no bands with rb anti-hmKCC3-ECL3 or rb anti-hmKCC3-CTD. Fluorescence microscopy revealed immunocytochemical cytoplasmic and membrane labeling of HLE-B3 cells with anti-KCC1, -KCC3 (laser confocal microscopy) and -KCC4 antibodies and a Cy3-tagged secondary antibody. Hence HLE-B3 cells expressed proteins of the KCC1, KCC3a, b, and KCC4 isoforms, whereas surgically removed cataractous lens tissue expressed only those of KCC1 and KCC4.

  15. Nuclear reactor

    International Nuclear Information System (INIS)

    Hattori, Sadao; Sato, Morihiko.

    1994-01-01

    Liquid metals such as liquid metal sodium are filled in a reactor container as primary coolants. A plurality of reactor core containers are disposed in a row in the circumferential direction along with the inner circumferential wall of the reactor container. One or a plurality of intermediate coolers are disposed at the inside of an annular row of the reactor core containers. A reactor core constituted with fuel rods and control rods (module reactor core) is contained at the inside of each of the reactor core containers. Each of the intermediate coolers comprises a cylindrical intermediate cooling vessels. The intermediate cooling vessel comprises an intermediate heat exchanger for heat exchange of primary coolants and secondary coolants and recycling pumps for compulsorily recycling primary coolants at the inside thereof. Since a plurality of reactor core containers are thus assembled, a great reactor power can be attained. Further, the module reactor core contained in one reactor core vessel may be small sized, to facilitate the control for the reactor core operation. (I.N.)

  16. Quantum Theory of Conducting Matter Superconductivity and Quantum Hall Effect

    CERN Document Server

    Fujita, Shigeji; Godoy, Salvador

    2009-01-01

    Explains major superconducting properties including zero resistance, Meissner effect, sharp phase change, flux quantization, excitation energy gap, and Josephson effects using quantum statistical mechanical calculations. This book covers the 2D superconductivity and the quantum Hall effects

  17. Magnesium Hall Thruster for Solar System Exploration, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — The innovation being developed in this program is a Mg Hall Effect Thruster system that would open the door for In-Situ Resource Utilization based solar system...

  18. W∞ gauge theory and the quantum Hall effect

    International Nuclear Information System (INIS)

    Shizuya, K.

    1994-05-01

    It is shown that a planar system of Hall electrons coupled to an applied electromagnetic field is written in the form of a W ∞ gauge theory. The associated W ∞ gauge field is expressed nonlinearly in terms of an infinite set of multipoles of the electromagnetic field. The W ∞ transformations generate mixing among the Landau levels. They provide a systematic way to classify the electromagnetic characteristics of the Hall system according to the resolution of external probes. In particular, an exact long-wavelength connection is derived between the carrier density and the Hall conductance in the presence of electron-electron interactions. Our approach is complementary to an earlier one and reveals a dual role the W ∞ gauge symmetry plays in the Hall dynamics. (author)

  19. Magnetohydrodynamic simulations of Gamble I POS with Hall effect

    International Nuclear Information System (INIS)

    Roderick, N.F.; Frese, M.H.; Peterkin, R.E.; Payne, S.S.

    1989-01-01

    Two dimensional single fluid magnetohydrodynamic simulations have been conducted to investigate the effects of the Hall electric field on magnetic field transport in plasma opening switches of the type used on Gamble I. The Hall terms were included in the magnetic field transport equation in the two dimensional simulation code MACH2 through the use of a generalized Ohm's law. Calculations show the Hall terms augment the field transport previously observed to occur through ion fluid motion and diffusion. For modest values of microturbulent collision frequency, board current channels were observed . Results also show the magnetic field transport to be affected by the cathode boundary conditions with the Hall terms included. In all cases center of mass motion was slight

  20. The Dream Comes True in the Golden Hall

    Institute of Scientific and Technical Information of China (English)

    JianZhong; ChenJianguo

    2004-01-01

    Nanjing Traditional Music Ensemble has long dreamed of performing in Vienna's Golden Hall.Now the dream has come true.the whole troupe felt so exciting that they did not even sleep well during the flight.

  1. Observation of the anomalous Hall effect in GaAs

    International Nuclear Information System (INIS)

    Miah, M Idrish

    2007-01-01

    Devices for the direct detection of the spin current, based on the anomalous Hall effect (AHE), are fabricated on n-type GaAs bulk semiconductor materials. The AHE is observed in the device when the photoinduced spin-polarized electrons are injected into it, and it is found that the effect depends on the applied electric field. The origin of the field-dependent observed Hall effect is discussed based on the D'yakonov-Perel' (DP) spin relaxation mechanism. The spin-dependent Hall effect is also found to be enhanced with increasing doping concentration. The present experimental results might have potential applications in semiconductor spintronic devices since the effect is closely related to the spin Hall effect

  2. Observation of the anomalous Hall effect in GaAs

    Energy Technology Data Exchange (ETDEWEB)

    Miah, M Idrish [Nanoscale Science and Technology Centre, School of Science, Griffith University, Nathan, Brisbane, QLD 4111 (Australia); Department of Physics, University of Chittagong, Chittagong, Chittagong - 4331 (Bangladesh)

    2007-03-21

    Devices for the direct detection of the spin current, based on the anomalous Hall effect (AHE), are fabricated on n-type GaAs bulk semiconductor materials. The AHE is observed in the device when the photoinduced spin-polarized electrons are injected into it, and it is found that the effect depends on the applied electric field. The origin of the field-dependent observed Hall effect is discussed based on the D'yakonov-Perel' (DP) spin relaxation mechanism. The spin-dependent Hall effect is also found to be enhanced with increasing doping concentration. The present experimental results might have potential applications in semiconductor spintronic devices since the effect is closely related to the spin Hall effect.

  3. Nobel Prize in physics 1985: Quantum Hall effect

    International Nuclear Information System (INIS)

    Herrmann, R.

    1986-01-01

    The conditions (like very strong magnetic fields, ultralow temperatures, and occurrence of a two-dimensional electron gas in microelectronic structures) for the measurement of the quantum Hall effect are explained. Two possible measuring methods are described. Measuring results for p-Si-MOSFET, GaAs/AlGaAs heterojuntions and grain boundaries in InSb crystals are reported. Differences between normal (integer) and fractional quantum Hall effect are discussed. One of the important consequences is that by means of the quantum Hall effect the value h/e 2 can be determined with very high accuracy. In 1985 Klaus von Klitzing was awarded the Nobel Prize for his work on the quantum Hall effect

  4. Quantum Computing With Quasiparticles of the Fractional Quantum Hall Effect

    National Research Council Canada - National Science Library

    Averin, Dmitri

    2001-01-01

    The focus of this project was the theoretical study of quantum computation based on controlled transfer of individual quasiparticles in systems of quantum antidots in the regime of the Fractional Quantum Hall Effect (FQHE...

  5. Quantum Hall Ferroelectrics and Nematics in Multivalley Systems

    Science.gov (United States)

    Sodemann, Inti; Zhu, Zheng; Fu, Liang

    2017-10-01

    We study broken symmetry states at integer Landau-level fillings in multivalley quantum Hall systems whose low-energy dispersions are anisotropic. When the Fermi surface of individual pockets lacks twofold rotational symmetry, like in bismuth (111) [Feldman et al. , Observation of a Nematic Quantum Hall Liquid on the Surface of Bismuth, Science 354, 316 (2016), 10.1126/science.aag1715] and in Sn1 -xPbxSe (001) [Dziawa et al., Topological Crystalline Insulator States in Pb1 -xSnxSe , Nat. Mater. 11, 1023 (2012), 10.1038/nmat3449] surfaces, interactions tend to drive the formation of quantum Hall ferroelectric states. We demonstrate that the dipole moment in these states has an intimate relation to the Fermi surface geometry of the parent metal. In quantum Hall nematic states, like those arising in AlAs quantum wells, we demonstrate the existence of unusually robust Skyrmion quasiparticles.

  6. Hall effects and related phenomena in disordered Rashba 2DEG

    International Nuclear Information System (INIS)

    Inoue, Jun-ichiro; Kato, Takashi; Bauer, Gerrit E W; Molenkamp, Laurens W

    2009-01-01

    We review our recent work on the spin and anomalous Hall effects and other related phenomena caused by the intrinsic spin–orbit interaction. We focus our attention on disorder effects on these transport properties by adopting a model of a two-dimensional electron gas with a Rashba-type spin–orbit interaction. A spin-polarized model is adopted to calculate the anomalous Hall effect and anisotropic magnetoresistance. It is shown that the spin Hall conductivity in the ballistic transport regime is cancelled by the so-called vertex corrections for the disorder scattering, and that the anomalous Hall conductivity and anisotropic magnetoresistance vanish unless the lifetime is spin dependent. We further present results on spin accumulation under an electric field

  7. Dual Mode Low Power Hall Thruster, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Sample and return missions desire and missions like Saturn Observer require a low power Hall thruster that can operate at high thrust to power as well as high...

  8. Suitable reverberation time for halls for rock and pop music

    DEFF Research Database (Denmark)

    Adelman-Larsen, Niels Werner; Thompson, Eric Robert; Gade, Anders Christian

    2010-01-01

    The existing body of literature regarding the acoustic design of concert halls has focused almost exclusively on classical music, although there are many more performances of popular music, including rock and pop. Objective measurements were made of the acoustics of 20 rock music venues in Denmark....... The best-rated halls in the study have reverberation times that are approximately frequency independent from 0.6 to 1.2 s for hall volumes from 1000 to 6000 m3. The worst rated halls in the study had significantly higher reverberation times in the 63 and 125 Hz bands. Since most audiences at rock concerts...... are standing, absorption coefficients were measured with a standing audience from 63 Hz to 4 kHz. These measurements showed that a standing audience absorbs about five times as much energy in mid-/high-frequency bands as in low-frequency bands....

  9. Analysis of Hall Probe Precise Positioning with Cylindrical Permanent Magnet

    International Nuclear Information System (INIS)

    Belicev, P.; Vorozhtsov, A.S.; Vorozhtsov, S.B.

    2007-01-01

    Precise positioning of a Hall probe for cyclotron magnetic field mapping, using cylindrical permanent magnets, was analyzed. The necessary permanent magnet parameters in order to achieve ±20 μm position precision, were determined. (author)

  10. High Input Voltage Hall Thruster Discharge Converter, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — The overall scope of this Phase I/II effort is the development of a high efficiency 15kW (nominal) Hall thruster discharge converter. In Phase I, Busek Co. Inc. will...

  11. Pragmatic data fusion uncertainty concerns: Tribute to Dave L. Hall

    CSIR Research Space (South Africa)

    Blasch, E

    2016-07-01

    Full Text Available Over the course of Dave Hall's career, he highlighted various concerns associated with the implementation of data fusion methods. Many of the issues included the role of uncertainty in data fusion, practical implementation of sensor fusion systems...

  12. 2D Electrostatic Potential Solver for Hall Thruster Simulation

    National Research Council Canada - National Science Library

    Koo, Justin W

    2006-01-01

    ...) for Hall thruster simulation. It is based on a finite volume discretization of a current conservation equation where the electron current density is described by a Generalized Ohm's law description...

  13. Precision of single-engage micro Hall effect measurements

    DEFF Research Database (Denmark)

    Henrichsen, Henrik Hartmann; Hansen, Ole; Kjær, Daniel

    2014-01-01

    Recently a novel microscale Hall effect measurement technique has been developed to extract sheet resistance (RS), Hall sheet carrier density (NHS) and Hall mobility (μH) from collinear micro 4-point probe measurements in the vicinity of an insulating boundary [1]. The technique measures in less...... than a minute directly the local transport properties, which enables in-line production monitoring on scribe line test pads [2]. To increase measurement speed and reliability, a method in which 4-point measurements are performed using two different electrode pitches has been developed [3......]. In this study we calculate the measurement error on RS, NHS and μH resulting from electrode position errors, probe placement, sample size and Hall signal magnitude. We show the relationship between measurement precision and electrode pitch, which is important when down-scaling the micro 4-point probe to fit...

  14. Evaluasi Fungsi Insinerator Dalam Memusnahkan Limbah B3 Di Rumah Sakit NI Dr.Ramelan Surabaya

    Directory of Open Access Journals (Sweden)

    Jahn Leonard Saragih

    2013-09-01

    Full Text Available Pengelolaan limbah padat B3 di Rumah Sakit TNI Angkatan Laut Dr. Ramelan sangat penting diperhatikan karena dapat berdampak buruk apabila tidak dikelola dengan baik. Oleh sebab itu diperlukan adanya penelitian untuk mengidentifikasi jumlah timbulan dan penanganan limbah padat B3, mengevaluasi manajemen, penyimpanan sementara serta mengevaluasi proses insinerasi. Evaluasi fungsi incinerator di Rumah Sakit TNI Angkatan Laut Dr. Ramelan dilakukan dengan meneliti jumlah timbulan limbah B3, kapasitas pembakaran insinerator, suhu pembakaran insinerator, densitas limbah dan abu pembakaran, dan tes TCLP residu pembakaran incinerator Rumah Sakit TNI Angkatan Laut Dr. Ramelan. Dalam penelitian ini, Rumkital Dr. Ramelan memusnahkan limbah dengan incinerator. Limbah B3 yang dihasilkan Rumkital Dr. Ramelan dimusnakan dengan satu incinerator dengan type KAMINE TYPE BDR-INC 10. Limbah yang dimusnahkan di Rumkital Dr. Ramelan berasal dari Rumkital Dr. Ramelan dan Lantamal Perak. Setelah dilakukan penelitian langsung selama 14 hari berturut-turut, didapatkan bahwa rata-rata timbulan limbah B3 di Rumkital Dr. Ramelan adalah 89.98 Kg/hari dan dengan densitas rata-rata limbah ialah 166,67 kg/m3. Tinggat removal dari pembakaran limbah dengan incinerator di Rumah Sakit TNI Angkatan Laut Dr. Ramelan ialah 82,63%. Pengelolaan abu sisa incinerator Rumkital Dr. Ramelan belum sesuai dengan peraturan yang berlaku dan dari penelitian yang dilakukan yaitu pengujian kandungan abu incinerator, solidifikasi abu incinerator dengan perbandingan semen:abu adalah 1:3 dan uji TCLP, didapatkan bahwa limbah abu sisa insinerator Rumah Sakit TNI Angkatan Laut Dr. Ramelan Surabaya, dapat ditimbun pada landfill kategori I sesuai dengan Keputusan Kepala Bapedal No.4 Tahun 1995.

  15. Las primeras muestras del romancero de tradición oral moderna: Serafín Estébanez Calderón (The first signs of ballads from modern oral tradition: Serafin Estébanez Calderon

    Directory of Open Access Journals (Sweden)

    Carmen de la Vega de la Muela

    2010-12-01

    Full Text Available Resumen: Las primeras muestras del Romancero de la tradición oral moderna vinieron de la mano de románticos viajeros que, como Washington Irving, dejaron testimonios de romances que se cantaban en Andalucía; y más tarde, los pioneros del folklorismo español daban a conocer en sus escritos costumbristas algunos romances recogidos directamente en estas tierras meridionales, siendo Serafín Estébanez Calderón quien más datos nos ofrece sobre los ambientes en los que se desenvolvía el Romancero en la primera mitad del siglo XIX.Abstract: The first signs of ballads from modern oral tradition came from the hand of romantic travelers who, like Washington Irving, left testimonies of ballads that were sung in Andalusia, and later, the pioneers of Spanish folklore were to reveal in his writings some manners romances collected directly in these southern lands, where Serafin Estébanez Calderon who gives us more data about the environments in which unfolded the Ballads in the first half of the nineteenth century.

  16. The integer quantum hall effect revisited

    Energy Technology Data Exchange (ETDEWEB)

    Michalakis, Spyridon [Los Alamos National Laboratory; Hastings, Matthew [Q STATION, CALIFORNIA

    2009-01-01

    For T - L x L a finite subset of Z{sup 2}, let H{sub o} denote a Hamiltonian on T with periodic boundary conditions and finite range, finite strength intetactions and a unique ground state with a nonvanishing spectral gap. For S {element_of} T, let q{sub s} denote the charge at site s and assume that the total charge Q = {Sigma}{sub s {element_of} T} q{sub s} is conserved. Using the local charge operators q{sub s}, we introduce a boundary magnetic flux in the horizontal and vertical direction and allow the ground state to evolve quasiadiabatically around a square of size one magnetic flux, in flux space. At the end of the evolution we obtain a trivial Berry phase, which we compare, via a method reminiscent of Stokes Theorem. to the Berry phase obtained from an evolution around an exponentially small loop near the origin. As a result, we show, without any averaging assumption, that the Hall conductance is quantized in integer multiples of e{sup 2}/h up to exponentially small corrections of order e{sup -L/{zeta}}, where {zeta}, is a correlation length that depends only on the gap and the range and strength of the interactions.

  17. Brand new hall in the main building

    CERN Multimedia

    Corinne Pralavorio

    2014-01-01

    The renovation of the UNIQA and post office premises is getting under way, with their reopening scheduled for the spring.   The renovation of the large hall in the main building (Building 500) has finally reached the home straight. As of this week, building contractors will get to work on the last part – the offices of UNIQA and La Poste. In the last week of November, the two concessions moved their offices across Route Scherrer to the same part of Building 510 where UBS was temporarily housed during the bank’s refurbishment. Their services were therefore unavailable for one day. The renovation work will last until the spring, with the new offices expected to open in May 2015. Between now and then, the windows and insulation will be completely refitted, with a view to reducing heat loss considerably, and, above all, the premises will be modernised to improve customer reception and service. For example, UNIQA’s new premises will feature a confidential area, guarantee...

  18. Acoustics in Halls for Speech and Music

    Science.gov (United States)

    Gade, Anders C.

    This chapter deals specifically with concepts, tools, and architectural variables of importance when designing auditoria for speech and music. The focus will be on cultivating the useful components of the sound in the room rather than on avoiding noise from outside or from installations, which is dealt with in Chap. 11. The chapter starts by presenting the subjective aspects of the room acoustic experience according to consensus at the time of writing. Then follows a description of their objective counterparts, the objective room acoustic parameters, among which the classical reverberation time measure is only one of many, but still of fundamental value. After explanations on how these parameters can be measured and predicted during the design phase, the remainder of the chapter deals with how the acoustic properties can be controlled by the architectural design of auditoria. This is done by presenting the influence of individual design elements as well as brief descriptions of halls designed for specific purposes, such as drama, opera, and symphonic concerts. Finally, some important aspects of loudspeaker installations in auditoria are briefly touched upon.

  19. Hall MHD reconnection in cometary magnetotail

    International Nuclear Information System (INIS)

    Jovanovic, Dusan; Shukla, Padma Kant; Morfill, Gregor

    2005-01-01

    The fine structure of cometary tails (swirls, loops and blobs) is studied in the framework of resistive magnetic reconnection without a guide field in a dusty plasma. For a high-beta plasma (β ∼ 1) consisting of electrons, ions, and immobile dust grains, a two-fluid description is used to study electromagnetic perturbations with the frequency below Ωi, propagating at an arbitrary angle, and including the effects of Hall current. A zero-order current associated with the anti-parallel magnetic configuration may exist even in the limit of zero plasma temperature in a dusty plasma due to a symmetry breaking between electrons and ions by dust grains that yields an E-vector x B-vector current. In the perturbed state, a new linear electromagnetic mode is found in dusty plasma which is evanescent below the Rao cut-off frequency and has the characteristic wavelength comparable to the ion skin depth, which enables the reconnection at short spatial scales. The role of the dust is found to be twofold, yielding a new mode outside of the current sheet and altering the continuity conditions at its edge by an inhomogeneous Doppler shift associated with the E-vector x B-vector current

  20. Linear waves in a resistive plasma with Hall current

    International Nuclear Information System (INIS)

    Almaguer, J.A.

    1992-01-01

    Dispersion relations for the case of a magnetized plasma are determined taking into account the Hall current and a constant resistivity, η, in Ohm's law. It is found that the Hall effect is relevant only for parallel (to the equilibrium magnetic field) wave numbers in the case of uniform plasmas, giving place to a dispersive behavior. In particular, the cases of η→0 and small (nonzero) resistivity are discussed

  1. Hall effect in the two-dimensional Luttinger liquid

    International Nuclear Information System (INIS)

    Anderson, P.W.

    1991-01-01

    The temperature dependence of the Hall effect in the normal state is a commom theme of all the cuprate superconductors and has been one of the more puzzling observations on these puzzling materials. We describe a general scheme within the Luttinger liquid theory of these two-dimensional quantum fluids which corrrelates the anomalous Hall and resistivity observations on a wide variety of both pure and doped single crystals, especially the data in the accompanying Letter of Chien, Wang, and Ong

  2. Thermoelectric and Hall-effect studies in hydrogenerated nickel foils

    International Nuclear Information System (INIS)

    Rani, R.; Nigam, A.N.

    1978-01-01

    Thermo e.m.f. and Hall constant of hydrogenerated nickel foils have been measured. Termo e.m.f. shows a sign reversal which is not due to the change in sign of the charge carriers, as indicated by the Hall-effect measurements. To account for the sign reversal of thermo e.m.f., it is found necessary to take into account the surface states of chemisorbed hydrogen on nickel

  3. Fractional statistics and fractional quantized Hall effect. Revision

    International Nuclear Information System (INIS)

    Tao, R.; Wu, Y.S.

    1984-01-01

    We suggest that the origin of the odd denominator rule observed in the fractional quantized Hall effect (FQHE) may lie in fractional statistics which governs quasiparticles in FQHE. A theorem concerning statistics of clusters of quasiparticles implies that fractional statistics does not allow coexistence of a large number of quasiparticles at fillings with an even denominator. Thus no Hall plateau can be formed at these fillings, regardless of the presence of an energy gap. 15 references

  4. Hall probe for measuring high currents in superconducting coils

    International Nuclear Information System (INIS)

    Ferendeci, A.M.

    1986-01-01

    Constructional details of a compact Hall probe for measuring high currents in superconducting coils are given. The Hall probe is easy to assemble and can be inserted or removed from the system without breaking the superconducting loop. Upper current limit of the probe can be increased by using larger magnetic core material. Shielding becomes necessary if the probe holder is to be placed near large current dependent magnetic fields

  5. Low-Cost, High-Performance Hall Thruster Support System

    Science.gov (United States)

    Hesterman, Bryce

    2015-01-01

    Colorado Power Electronics (CPE) has built an innovative modular PPU for Hall thrusters, including discharge, magnet, heater and keeper supplies, and an interface module. This high-performance PPU offers resonant circuit topologies, magnetics design, modularity, and a stable and sustained operation during severe Hall effect thruster current oscillations. Laboratory testing has demonstrated discharge module efficiency of 96 percent, which is considerably higher than current state of the art.

  6. High-performance LED luminaire for sports hall

    Science.gov (United States)

    Lee, Xuan-Hao; Yang, Jin-Tsung; Chien, Wei-Ting; Chang, Jung-Hsuan; Lo, Yi-Chien; Lin, Che-Chu; Sun, Ching-Cherng

    2015-09-01

    In this paper, we present a luminaire design with anti-glare and energy-saving effects for sports hall. Compared with traditional lamps using in a badminton court, the average illuminance on the ground of the proposed LED luminaire is enhanced about 300%. Besides, the uniformity is obviously enhanced and improved. The switch-on speed of lighting in sports hall is greatly reduced from 5-10 minutes to 1 second. The simulation analysis and the corresponding experiment results are demonstrated.

  7. Nuclear power reactors

    International Nuclear Information System (INIS)

    1982-11-01

    After an introduction and general explanation of nuclear power the following reactor types are described: magnox thermal reactor; advanced gas-cooled reactor (AGR); pressurised water reactor (PWR); fast reactors (sodium cooled); boiling water reactor (BWR); CANDU thermal reactor; steam generating heavy water reactor (SGHWR); high temperature reactor (HTR); Leningrad (RMBK) type water-cooled graphite moderated reactor. (U.K.)

  8. Research reactors

    International Nuclear Information System (INIS)

    Merchie, Francois

    2015-10-01

    This article proposes an overview of research reactors, i.e. nuclear reactors of less than 100 MW. Generally, these reactors are used as neutron generators for basic research in matter sciences and for technological research as a support to power reactors. The author proposes an overview of the general design of research reactors in terms of core size, of number of fissions, of neutron flow, of neutron space distribution. He outlines that this design is a compromise between a compact enough core, a sufficient experiment volume, and high enough power densities without affecting neutron performance or its experimental use. The author evokes the safety framework (same regulations as for power reactors, more constraining measures after Fukushima, international bodies). He presents the main characteristics and operation of the two families which represent almost all research reactors; firstly, heavy water reactors (photos, drawings and figures illustrate different examples); and secondly light water moderated and cooled reactors with a distinction between open core pool reactors like Melusine and Triton, pool reactors with containment, experimental fast breeder reactors (Rapsodie, the Russian BOR 60, the Chinese CEFR). The author describes the main uses of research reactors: basic research, applied and technological research, safety tests, production of radio-isotopes for medicine and industry, analysis of elements present under the form of traces at very low concentrations, non destructive testing, doping of silicon mono-crystalline ingots. The author then discusses the relationship between research reactors and non proliferation, and finally evokes perspectives (decrease of the number of research reactors in the world, the Jules Horowitz project)

  9. Reactor physics and reactor computations

    International Nuclear Information System (INIS)

    Ronen, Y.; Elias, E.

    1994-01-01

    Mathematical methods and computer calculations for nuclear and thermonuclear reactor kinetics, reactor physics, neutron transport theory, core lattice parameters, waste treatment by transmutation, breeding, nuclear and thermonuclear fuels are the main interests of the conference

  10. Anisotropic intrinsic spin Hall effect in quantum wires

    International Nuclear Information System (INIS)

    Cummings, A W; Akis, R; Ferry, D K

    2011-01-01

    We use numerical simulations to investigate the spin Hall effect in quantum wires in the presence of both Rashba and Dresselhaus spin-orbit coupling. We find that the intrinsic spin Hall effect is highly anisotropic with respect to the orientation of the wire, and that the nature of this anisotropy depends strongly on the electron density and the relative strengths of the Rashba and Dresselhaus spin-orbit couplings. In particular, at low densities, when only one subband of the quantum wire is occupied, the spin Hall effect is strongest for electron momentum along the [1-bar 10] axis, which is the opposite of what is expected for the purely 2D case. In addition, when more than one subband is occupied, the strength and anisotropy of the spin Hall effect can vary greatly over relatively small changes in electron density, which makes it difficult to predict which wire orientation will maximize the strength of the spin Hall effect. These results help to illuminate the role of quantum confinement in spin-orbit-coupled systems, and can serve as a guide for future experimental work on the use of quantum wires for spin-Hall-based spintronic applications. (paper)

  11. The quantum Hall's effect: A quantum electrodynamic phenomenon

    International Nuclear Information System (INIS)

    Arbab, A. I.

    2012-01-01

    We have applied Maxwell's equations to study the physics of quantum Hall's effect. The electromagnetic properties of this system are obtained. The Hall's voltage, V H = 2πħ 2 n s /em, where n s is the electron number density, for a 2-dimensional system, and h = 2πħ is the Planck's constant, is found to coincide with the voltage drop across the quantum capacitor. Consideration of the cyclotronic motion of electrons is found to give rise to Hall's resistance. Ohmic resistances in the horizontal and vertical directions have been found to exist before equilibrium state is reached. At a fundamental level, the Hall's effect is found to be equivalent to a resonant LCR circuit with L H = 2π m/e 2 n s and C H = me 2 /2πħ 2 n s satisfying the resonance condition with resonant frequency equal to the inverse of the scattering (relaxation) time, τ s . The Hall's resistance is found to be R H = √L H /C H . The Hall's resistance may be connected with the impedance that the electron wave experiences when it propagates in the 2-dimensional gas. (condensed matter: electronic structure, electrical, magnetic, and optical properties)

  12. Signatures of lattice geometry in quantum and topological Hall effect

    International Nuclear Information System (INIS)

    Göbel, Börge; Mook, Alexander; Mertig, Ingrid; Henk, Jürgen

    2017-01-01

    The topological Hall effect (THE) of electrons in skyrmion crystals (SkXs) is strongly related to the quantum Hall effect (QHE) on lattices. This relation suggests to revisit the QHE because its Hall conductivity can be unconventionally quantized. It exhibits a jump and changes sign abruptly if the Fermi level crosses a van Hove singularity. In this Paper, we investigate the unconventional QHE features by discussing band structures, Hall conductivities, and topological edge states for square and triangular lattices; their origin are Chern numbers of bands in the SkX (THE) or of the corresponding Landau levels (QHE). Striking features in the energy dependence of the Hall conductivities are traced back to the band structure without magnetic field whose properties are dictated by the lattice geometry. Based on these findings, we derive an approximation that allows us to determine the energy dependence of the topological Hall conductivity on any two-dimensional lattice. The validity of this approximation is proven for the honeycomb lattice. We conclude that SkXs lend themselves for experiments to validate our findings for the THE and—indirectly—the QHE. (paper)

  13. Tunnelling anomalous and planar Hall effects (Conference Presentation)

    Science.gov (United States)

    Matos-Abiague, Alex; Scharf, Benedikt; Han, Jong E.; Hankiewicz, Ewelina M.; Zutic, Igor

    2016-10-01

    We theoretically show how the interplay between spin-orbit coupling (SOC) and magnetism can result in a finite tunneling Hall conductance, transverse to the applied bias. For two-dimensional tunnel junctions with a ferromagnetic lead and magnetization perpendicular to the current flow, the detected anomalous Hall voltage can be used to extract information not only about the spin polarization but also about the strength of the interfacial SOC. In contrast, a tunneling current across a ferromagnetic barrier on the surface of a three-dimensional topological insulator (TI) can induce a planar Hall response even when the magnetization is oriented along the current flow[1]. The tunneling nature of the states contributing to the planar Hall conductance can be switched from the ordinary to the Klein regimes by the electrostatic control of the barrier strength. This allows for an enhancement of the transverse response and a giant Hall angle, with the tunneling planar Hall conductance exceeding the longitudinal component. Despite the simplicity of a single ferromagnetic region, the TI/ferromagnet system exhibits a variety of functionalities. In addition to a spin-valve operation for magnetic sensing and storing information, positive, negative, and negative differential conductances can be tuned by properly adjusting the barrier potential and/or varying the magnetization direction. Such different resistive behaviors in the same system are attractive for potential applications in reconfigurable spintronic devices. [1] B. Scharf, A. Matos-Abiague, J. E. Han, E. M. Hankiewicz, and I. Zutic, arXiv:1601.01009 (2016).

  14. A holographic model for the fractional quantum Hall effect

    Energy Technology Data Exchange (ETDEWEB)

    Lippert, Matthew [Institute for Theoretical Physics, University of Amsterdam,Science Park 904, 1090GL Amsterdam (Netherlands); Meyer, René [Kavli Institute for the Physics and Mathematics of the Universe (WPI), The University of Tokyo,Kashiwa, Chiba 277-8568 (Japan); Taliotis, Anastasios [Theoretische Natuurkunde, Vrije Universiteit Brussel andThe International Solvay Institutes,Pleinlaan 2, B-1050 Brussels (Belgium)

    2015-01-08

    Experimental data for fractional quantum Hall systems can to a large extent be explained by assuming the existence of a Γ{sub 0}(2) modular symmetry group commuting with the renormalization group flow and hence mapping different phases of two-dimensional electron gases into each other. Based on this insight, we construct a phenomenological holographic model which captures many features of the fractional quantum Hall effect. Using an SL(2,ℤ)-invariant Einstein-Maxwell-axio-dilaton theory capturing the important modular transformation properties of quantum Hall physics, we find dyonic diatonic black hole solutions which are gapped and have a Hall conductivity equal to the filling fraction, as expected for quantum Hall states. We also provide several technical results on the general behavior of the gauge field fluctuations around these dyonic dilatonic black hole solutions: we specify a sufficient criterion for IR normalizability of the fluctuations, demonstrate the preservation of the gap under the SL(2,ℤ) action, and prove that the singularity of the fluctuation problem in the presence of a magnetic field is an accessory singularity. We finish with a preliminary investigation of the possible IR scaling solutions of our model and some speculations on how they could be important for the observed universality of quantum Hall transitions.

  15. A holographic model for the fractional quantum Hall effect

    Science.gov (United States)

    Lippert, Matthew; Meyer, René; Taliotis, Anastasios

    2015-01-01

    Experimental data for fractional quantum Hall systems can to a large extent be explained by assuming the existence of a Γ0(2) modular symmetry group commuting with the renormalization group flow and hence mapping different phases of two-dimensional electron gases into each other. Based on this insight, we construct a phenomenological holographic model which captures many features of the fractional quantum Hall effect. Using an -invariant Einstein-Maxwell-axio-dilaton theory capturing the important modular transformation properties of quantum Hall physics, we find dyonic diatonic black hole solutions which are gapped and have a Hall conductivity equal to the filling fraction, as expected for quantum Hall states. We also provide several technical results on the general behavior of the gauge field fluctuations around these dyonic dilatonic black hole solutions: we specify a sufficient criterion for IR normalizability of the fluctuations, demonstrate the preservation of the gap under the action, and prove that the singularity of the fluctuation problem in the presence of a magnetic field is an accessory singularity. We finish with a preliminary investigation of the possible IR scaling solutions of our model and some speculations on how they could be important for the observed universality of quantum Hall transitions.

  16. Calculated organ doses for Mayak production association central hall using ICRP and MCNP.

    Science.gov (United States)

    Choe, Dong-Ok; Shelkey, Brenda N; Wilde, Justin L; Walk, Heidi A; Slaughter, David M

    2003-03-01

    As part of an ongoing dose reconstruction project, equivalent organ dose rates from photons and neutrons were estimated using the energy spectra measured in the central hall above the graphite reactor core located in the Russian Mayak Production Association facility. Reconstruction of the work environment was necessary due to the lack of personal dosimeter data for neutrons in the time period prior to 1987. A typical worker scenario for the central hall was developed for the Monte Carlo Neutron Photon-4B (MCNP) code. The resultant equivalent dose rates for neutrons and photons were compared with the equivalent dose rates derived from calculations using the conversion coefficients in the International Commission on Radiological Protection Publications 51 and 74 in order to validate the model scenario for this Russian facility. The MCNP results were in good agreement with the results of the ICRP publications indicating the modeling scenario was consistent with actual work conditions given the spectra provided. The MCNP code will allow for additional orientations to accurately reflect source locations.

  17. Design features of BREST reactors. Experimental work to advance the concept of BREST reactors. Results and plans

    International Nuclear Information System (INIS)

    Filin, A.I.; Orlov, V.V.; Leonov, V.N.; Sila-Novitskij, A.G.; Smirnov, V.S.; Tsikunov, V.S.

    2001-01-01

    Principle designs of 300 MW(th) and 1200 MW(th) lead-cooled fast reactors are presented. Reactors of various output are shown to be built using the same principles. In conjunction with increased output and to implement inherent safety concept in BREST-1200 reactor design a number of new solutions, which may be used in BREST-300 concept too, has been taken including: pool-type reactor design not requiring metal vessel, hence, not limiting reactor power; new handling system allowing to reduce central hall and building dimensions as a whole; emergency cooling system using Field pipes, immersed directly in lead, which may be used to cool down reactor under normal conditions; by-pass line incorporated in coolant loop allowing to refuse the actively actuating valve initiated in pumps shut down. (author)

  18. Research reactors

    International Nuclear Information System (INIS)

    Kowarski, L.

    1955-01-01

    It brings together the techniques data which are involved in the discussion about the utility for a research institute to acquire an atomic reactor for research purposes. This type of decision are often taken by non-specialist people who can need a brief presentation of a research reactor and its possibilities in term of research before asking advises to experts. In a first part, it draws up a list of the different research programs which can be studied by getting a research reactor. First of all is the reactor behaviour and kinetics studies (reproducibility factor, exploration of neutron density, effect of reactor structure, effect of material irradiation...). Physical studies includes study of the behaviour of the control system, studies of neutron resonance phenomena and study of the fission process for example. Chemical studies involves the study of manipulation and control of hot material, characterisation of nuclear species produced in the reactor and chemical effects of irradiation on chemical properties and reactions. Biology and medicine research involves studies of irradiation on man and animals, genetics research, food or medical tools sterilization and neutron beams effect on tumour for example. A large number of other subjects can be studied in a reactor research as reactor construction material research, fabrication of radioactive sources for radiographic techniques or applied research as in agriculture or electronic. The second part discussed the technological considerations when choosing the reactor type. The technological factors, which are considered for its choice, are the power of the reactor, the nature of the fuel which is used, the type of moderator (water, heavy water, graphite or BeO) and the reflector, the type of coolants, the protection shield and the control systems. In the third part, it described the characteristics (place of installation, type of combustible and comments) and performance (power, neutron flux ) of already existing

  19. BSRF-3B3 Medium Energy X-ray Beamline and Its Application for XAFS Research

    International Nuclear Information System (INIS)

    Ma Chenyan; Cui Mingqi; Zhou Kejin; Zhao Yidong; Tian Yulian; Wu Ziyu; Zheng Lei; Zhu Jie; Zhao Jia; Chen Kai; Sun Lijuan

    2007-01-01

    A new medium X-ray beamline 3B3 covering energy from 1.2 keV up to 6.0 keV was built at Beijing Synchrotron Radiation Facility (BSRF) in 2005. With perfect capability of high monochromaticity, good focus and low harmonics, it could be applied to study metrology, optic component characteristics and medium X-ray absorption spectroscopy (XAS). A simple XAFS apparatus has been set up and some measurements such as S, P, Cl, Ca, Al, Mg K-edge X-ray absorption fine structure (XAFS) in their compounds have also been carried out. The results show that it is feasible to do XAFS research at 3B3 beamline under present condition. The fabrication of a more delicate medium XAFS spectrometer is underway including transmission, fluorescence and electronic yield modes

  20. Modeling amorphous Si3B3N7: Structure and elastic properties

    International Nuclear Information System (INIS)

    Hannemann, A.; Schoen, J.C.; Jansen, M.; Putz, H.; Lengauer, T.

    2004-01-01

    We investigate the structure and elastic properties of the amorphous high-temperature ceramic a-Si 3 B 3 N 7 . Several different structural models are generated and their properties such as the radial and angular distribution functions, the degree of local order, the density, the bulk modulus and the phonon spectrum, are calculated and compared with the experiment. The best structural agreement between model and experimental observations is found for models exhibiting a certain degree of local ( 3 B 3 N 7 has not been synthesized by cooling from the melt but via the polymerization and subsequent pyrolysis of molecular precursors. Furthermore, we suggest that, due to the synthesis process, stable nanoscale cavities (diameter 3 )

  1. Thymoma (World Health Organization type B3) with neuroendocrine differentiation in multiple endocrine neoplasia type 1

    OpenAIRE

    Tomita, Masaki; Ichiki, Nobuhiko; Ayabe, Takanori; Tanaka, Hiroyuki; Kataoka, Hiroaki; Nakamura, Kunihide

    2017-01-01

    Abstract Thymic epithelial tumors occur in 1?5% of patients with multiple endocrine neoplasia type 1 (MEN 1). Majority of these thymic epithelial tumors are thymic carcinoids and patients with thymoma in MEN 1 is rare. Furthermore, thymoma with neuroendocrine differentiation was also rarely reported. Herein, we report a 68-year-old man having type B3 thymoma with neuroendocrine differentiation in MEN 1 and to the best of our knowledge this is the first such case ever reported.

  2. Measles outbreak linked to European B3 outbreaks, Wales, United Kingdom, 2017.

    Science.gov (United States)

    Currie, Jonny; Davies, Llion; McCarthy, Joanne; Perry, Malorie; Moore, Catherine; Cottrell, Simon; Bowley, Mererid; Williams, Chris; Shankar, Ananda Giri; Stiff, Rhianwen

    2017-10-01

    The United Kingdom achieved interrupted endemic measles transmission for 36 months in 2016. Despite this, ongoing challenges from sporadic measles cases typically imported from abroad remain. We summarise a B3 measles genotype outbreak in south-east Wales occurring between May and September 2017, linked with other European outbreaks, and lessons learnt. Seventeen confirmed cases and one probable case occurred principally in education and healthcare-settings. Six confirmed cases attended healthcare settings when infectious, without being isolated.

  3. Vibrational thermodynamics of Fe90Zr7B3 nanocrystalline alloy from nuclear inelastic scattering

    DEFF Research Database (Denmark)

    Stankov, S.; Miglierini, M.; Chumakov, A. I.

    2010-01-01

    Recently we determined the iron-partial density of vibrational states (DOS) of nanocrystalline Fe(90)Zr(7)B(3) (Nanoperm), synthesized by crystallization of an amorphous precursor, for various stages of nanocrystallization separating the DOS of the nanograins from that of the interfaces [S. Stank......, vibrational entropy, and lattice specific heat as the material transforms from amorphous, through nanocrystalline, to fully crystallized state. The reported results shed new light on the previously observed anomalies in the vibrational thermodynamics of nanocrystalline materials....

  4. checkCIF/PLATON report Datablock: b3_0m

    Indian Academy of Sciences (India)

    As a result the full set of tests cannot be run. No syntax errors found. CIF dictionary Interpreting this report. Datablock: b3_0m. Bond precision: C-C = 0.0207 A. Wavelength=0.71073. Cell: a=11.0782(11) b=6.6521(7) c=12.1645(12) alpha=90 beta=101.798(4) gamma=90. Temperature: 296 K. Calculated. Reported. Volume.

  5. Theoretical study of B3-to-B1 phase transition in ZnS

    International Nuclear Information System (INIS)

    Li, Qiang; Zhang, Rui; Lv, Tianquan; Cao, Qilong

    2016-01-01

    The pressure-induced phase transformation from B3 to B1 structures in ZnS using first-principle projector-augmented wave method is studied. To understand the nature and driving force behind the transition, the interesting properties in both phases, including enthalpy, phonon dispersion curves and elastic constants, are systematically investigated. The results show that the calculated transition pressure is within the range of 16.33 GPa to 19.04 GPa, which is in good agreement with the available experimental and theoretical data. The transition process can be viewed as the appearance and disappearance of very slight lattice distortion accompanied by the movement of Zn and S atoms along the [111] crystallographic axis. The physical driving force of the B3–B1 phase transition is confirmed to be a coupling effect between the mechanical instability of B3 phase under pressure and the softening acoustic phonon mode resulting from the pressure-induced lattice deformation. For B1 phase, it is further predicted that a new phase transition takes place at about 59.9 GPa. - Highlights: • The phase transformation from B3 to B1 structures in ZnS is studied using first-principle method. • The predicted transition pressure is within the range of 16.33 to 19.04 GPa. • The transition process can be viewed as the appearance and disappearance of very slight lattice distortion. • Physical driving force of the transition is a coupling effect between the mechanical instability and softening phonon. • For B1 phase, it is further predicted that a new phase transition takes place at about 59.9 GPa.

  6. Expression of OATP1B3 determines uptake of Gd-EOB-DTPA in hepatocellular carcinoma

    OpenAIRE

    Narita, Masato; Hatano, Etsuro; Arizono, Shigeki; Miyagawa-Hayashino, Aya; Isoda, Hiroyoshi; Kitamura, Koji; Yasuchika, Kentaro; Nitta, Takashi; Uemoto, Shinji

    2009-01-01

    Background: Gadolinium-ethoxybenzyl-diethylenetriamine pentaacetic acid (Gd-EOB-DTPA) is an MRI contrast agent with perfusion and hepatoselective properties. The purpose of the study was to examine uptake of Gd-EOB-DTPA in the hepatobiliary phase in hepatocellular carcinoma (HCC). Methods: A retrospective analysis of 22 patients with HCC who underwent preoperative Gd-EOB-DTPA-enhanced MRI was performed. Enhancement ratios (ERs) and expression levels of the organic anion transporter (OATP) 1B3...

  7. Analysis of the radiometric survey during the Argonauta reactor operation

    International Nuclear Information System (INIS)

    Oliveira, Eara de S.L.; Cardozo, Katia K.M.; Silva, Joao Carlos P.; Santos, Joao Regis dos

    2013-01-01

    The Argonaut reactor at the Institute of Nuclear Engineering-IEN/CNEN, operates normally, the powers between 1.7 and 340 W on neutrongraphy procedures, production of radionuclides and experimental reactor physics lessons to postgraduate courses. The doses from neutrons and gamma radiation are measured when the reactor is critical, inside the reactor hall and surrounding regions. A study of the data obtained was performed to evaluate the daily need of this survey in the reactor hall. Taking into account the principle ALARA, which aims to optimize and minimize the dose received by the individual, we propose, in this work, through an analysis of the acquired data in occupational radiometric surveys, a reformulation of the area monitoring routine practiced by the team of radiological protection of the Institute of Nuclear Engineering - IEN/CNEN-RJ, whereas other monitoring routines regarding the radiological protection are also applied in the routine of the reactor. The operations under review occurred with the reactor operating 340 W power at intervals of 60, 120 and 180 minutes, in monitoring points in controlled areas, supervised and free. The results showed significant dose values in the output of the J-Channel 9 when the operation occurs with this open. With 180 minutes of operation, the measured values of dose rate were lower than the values at 60 min and 120 operations min. At the point in the supervised area, offsite to the reactor hall, situated in the direction of the J-Channel 9, the value reduces more than 14% in any operating time in relation to the dose rate measured at the point opposite the canal. There is a 50% reduction in the dose rates for operations with and J-9 closed. The results suggest a new frequency of radiometric survey whose mode of operation is maintained in similar conditions, since combined with other relevant practices of radiation protection

  8. DISK FORMATION IN MAGNETIZED CLOUDS ENABLED BY THE HALL EFFECT

    International Nuclear Information System (INIS)

    Krasnopolsky, Ruben; Shang, Hsien; Li Zhiyun

    2011-01-01

    Stars form in dense cores of molecular clouds that are observed to be significantly magnetized. A dynamically important magnetic field presents a significant obstacle to the formation of protostellar disks. Recent studies have shown that magnetic braking is strong enough to suppress the formation of rotationally supported disks in the ideal MHD limit. Whether non-ideal MHD effects can enable disk formation remains unsettled. We carry out a first study on how disk formation in magnetic clouds is modified by the Hall effect, the least explored of the three non-ideal MHD effects in star formation (the other two being ambipolar diffusion and Ohmic dissipation). For illustrative purposes, we consider a simplified problem of a non-self-gravitating, magnetized envelope collapsing onto a central protostar of fixed mass. We find that the Hall effect can spin up the inner part of the collapsing flow to Keplerian speed, producing a rotationally supported disk. The disk is generated through a Hall-induced magnetic torque. Disk formation occurs even when the envelope is initially non-rotating, provided that the Hall coefficient is large enough. When the magnetic field orientation is flipped, the direction of disk rotation is reversed as well. The implication is that the Hall effect can in principle produce both regularly rotating and counter-rotating disks around protostars. The Hall coefficient expected in dense cores is about one order of magnitude smaller than that needed for efficient spin-up in these models. We conclude that the Hall effect is an important factor to consider in studying the angular momentum evolution of magnetized star formation in general and disk formation in particular.

  9. Reactor container

    International Nuclear Information System (INIS)

    Naruse, Yoshihiro.

    1990-01-01

    The thickness of steel shell plates in a reactor container embedded in sand cussions is monitored to recognize the corrosion of the steel shell plates. That is, the reactor pressure vessel is contained in a reactor container shell and the sand cussions are disposed on the lower outside of the reactor container shell to elastically support the shell. A pit is disposed at a position opposing to the sand cussions for measuring the thickness of the reactor container shell plates. The pit is usually closed by a closing member. In the reactor container thus constituted, the closing member can be removed upon periodical inspection to measure the thickness of the shell plates. Accordingly, the corrosion of the steel shell plates can be recognized by the change of the plate thickness. (I.S.)

  10. Hybrid reactors

    International Nuclear Information System (INIS)

    Moir, R.W.

    1980-01-01

    The rationale for hybrid fusion-fission reactors is the production of fissile fuel for fission reactors. A new class of reactor, the fission-suppressed hybrid promises unusually good safety features as well as the ability to support 25 light-water reactors of the same nuclear power rating, or even more high-conversion-ratio reactors such as the heavy-water type. One 4000-MW nuclear hybrid can produce 7200 kg of 233 U per year. To obtain good economics, injector efficiency times plasma gain (eta/sub i/Q) should be greater than 2, the wall load should be greater than 1 MW.m -2 , and the hybrid should cost less than 6 times the cost of a light-water reactor. Introduction rates for the fission-suppressed hybrid are usually rapid

  11. Nuclear reactor

    International Nuclear Information System (INIS)

    Garabedian, G.

    1988-01-01

    A liquid reactor is described comprising: (a) a reactor vessel having a core; (b) one or more satellite tanks; (c) pump means in the satellite tank; (d) heat exchanger means in the satellite tank; (e) an upper liquid metal conduit extending between the reactor vessel and the satellite tank; (f) a lower liquid metal duct extending between the reactor vessel and satellite tanks the upper liquid metal conduit and the lower liquid metal duct being arranged to permit free circulation of liquid metal between the reactor vessel core and the satellite tank by convective flow of liquid metal; (g) a separate sealed common containment vessel around the reactor vessel, conduits and satellite tanks; (h) the satellite tank having space for a volume of liquid metal that is sufficient to dampen temperature transients resulting from abnormal operating conditions

  12. Nuclear reactor

    International Nuclear Information System (INIS)

    Batheja, P.; Huber, R.; Rau, P.

    1985-01-01

    Particularly for nuclear reactors of small output, the reactor pressure vessel contains at least two heat exchangers, which have coolant flowing through them in a circuit through the reactor core. The circuit of at least one heat exchanger is controlled by a slide valve, so that even for low drive forces, particularly in natural circulation, the required even loading of the heat exchanger is possible. (orig./HP) [de

  13. Heterogeneous reactors

    International Nuclear Information System (INIS)

    Moura Neto, C. de; Nair, R.P.K.

    1979-08-01

    The microscopic study of a cell is meant for the determination of the infinite multiplication factor of the cell, which is given by the four factor formula: K(infinite) = n(epsilon)pf. The analysis of an homogeneous reactor is similar to that of an heterogeneous reactor, but each factor of the four factor formula can not be calculated by the formulas developed in the case of an homogeneous reactor. A great number of methods was developed for the calculation of heterogeneous reactors and some of them are discussed. (Author) [pt

  14. Hamaoka Atomic Energy Hall, Chubu Electric Power Co. , Inc

    Energy Technology Data Exchange (ETDEWEB)

    Kawasaki, Y [Chubu Electric Power Co. Inc., Nagoya (Japan)

    1979-10-01

    Hamaoka Nuclear Power Station was constructed in the very large site of about 1.6 million m/sup 2/ surrounded by sand dunes and pine forests at the southern tip of Shizuoka Prefecture. Hamaoka Atomic Energy Hall was built on the right side of this power station. This hall had been planned as a part of the works commemorating the 20th anniversary of the founding of the company, and was opened in August, 1972. The building is of steel frame type, and has two floors of 1135 m/sup 2/ total area. The first floor comprises cinema room, power generation corner and open gallery, and the second floor comprises meeting room, native land corner and observation room. Moreover, there is observation platform on the roof. The purpose of the hall is coexistence and coprosperity with the regional residents, and 13 persons make explanations to visitors having reached to 1.9 million as of the end of June, 1979. It is incorporated in the sightseeing route centering around the Omaezaki lighthouse. The cinema hall accommodates 120 men, and the films concerning nuclear power generation and the construction of a nuclear power plant are shown. In the power generation corner, the explanation on nuclear power generation is made with models and panels. The third hall is being built now as energy corner, and it will be completed in autumn, 1979.

  15. Hamaoka Atomic Energy Hall, Chubu Electric Power Co., Inc

    International Nuclear Information System (INIS)

    Kawasaki, Yukio

    1979-01-01

    Hamaoka Nuclear Power Station was constructed in the very large site of about 1.6 million m 2 surrounded by sand dunes and pine forests at the southern tip of Shizuoka Prefecture. Hamaoka Atomic Energy Hall was built on the right side of this power station. This hall had been planned as a part of the works commemorating the 20th anniversary of the founding of the company, and was opened in August, 1972. The building is of steel frame type, and has two floors of 1135 m 2 total area. The first floor comprises cinema room, power generation corner and open gallery, and the second floor comprises meeting room, native land corner and observation room. Moreover, there is observation platform on the roof. The purpose of the hall is coexistence and coprosperity with the regional residents, and 13 persons make explanations to visitors having reached to 1.9 million as of the end of June, 1979. It is incorporated in the sightseeing route centering around the Omaezaki lighthouse. The cinema hall accommodates 120 men, and the films concerning nuclear power generation and the construction of a nuclear power plant are shown. In the power generation corner, the explanation on nuclear power generation is made with models and panels. The third hall is being built now as energy corner, and it will be completed in autumn, 1979. (Kako, I.)

  16. Higher (odd dimensional quantum Hall effect and extended dimensional hierarchy

    Directory of Open Access Journals (Sweden)

    Kazuki Hasebe

    2017-07-01

    Full Text Available We demonstrate dimensional ladder of higher dimensional quantum Hall effects by exploiting quantum Hall effects on arbitrary odd dimensional spheres. Non-relativistic and relativistic Landau models are analyzed on S2k−1 in the SO(2k−1 monopole background. The total sub-band degeneracy of the odd dimensional lowest Landau level is shown to be equal to the winding number from the base-manifold S2k−1 to the one-dimension higher SO(2k gauge group. Based on the chiral Hopf maps, we clarify the underlying quantum Nambu geometry for odd dimensional quantum Hall effect and the resulting quantum geometry is naturally embedded also in one-dimension higher quantum geometry. An origin of such dimensional ladder connecting even and odd dimensional quantum Hall effects is illuminated from a viewpoint of the spectral flow of Atiyah–Patodi–Singer index theorem in differential topology. We also present a BF topological field theory as an effective field theory in which membranes with different dimensions undergo non-trivial linking in odd dimensional space. Finally, an extended version of the dimensional hierarchy for higher dimensional quantum Hall liquids is proposed, and its relationship to quantum anomaly and D-brane physics is discussed.

  17. G. Stanley Hall, Child Study, and the American Public.

    Science.gov (United States)

    Young, Jacy L

    2016-01-01

    In the final decades of the 19th century psychologist Granville Stanley Hall was among the most prominent pedagogical experts in the nation. The author explores Hall's carefully crafted persona as an educational expert, and his engagements with the American public, from 1880 to 1900, arguably the height of his influence. Drawing from accounts of Hall's lecture circuit in the popular press, a map of his talks across the nation is constructed to assess the geographic scope of his influence. These talks to educators on the psychology underlying childhood and pedagogy, and his views and research on child life more generally, were regularly discussed in newspapers and popular periodicals. The venues in which Hall's ideas were disseminated, discussed, and in some cases, dismissed are described. His efforts to mobilize popular support for, and assistance with, his research endeavors in child study are also discussed. Such efforts were controversial both within the burgeoning field of psychology and among the public. Through his various involvements in pedagogy, and concerted efforts to engage with the American public, Hall helped establish psychology's relevance to parenting and educational practices.

  18. Seville City Hall Chapter Room ceiling decoration

    Directory of Open Access Journals (Sweden)

    Robador, M. D.

    2010-02-01

    Full Text Available The present article describes a chemical and physical study of the colour, chemical composition and mineral phases of the decorative materials in the Seville City Hall Chapter House ceiling. The findings showed that the inner most layer of material, calcite, was covered with white lead, in turn concealed under a layer of gilded bole. The ceiling underwent re-gilding, also over bole, due in all likelihood to wear on the original gold leaf. In the nineteenth century, the entire ceiling with the exception of the inscriptions was whitewashed with calcite and white lead. Silver was employed on King John I’s sword (coffer 27. Gold leaf was used to adorn the royal attributes: crowns, belts, sceptres, swords and rosary beads. The high reliefs were likewise gilded. The pigments identified on the ceiling adornments included azurite, malachite, vermilion and gas black. A lime and ground dolomite mortar was used throughout.

    El objetivo de este trabajo es el estudio de diferentes aspectos, como el color, la composición química y las fases mineralógicas presentes en los diferentes materiales que forman la ornamentación del techo de la Sala Capitular del Ayuntamiento de Sevilla, mediante métodos físicos y químicos. Nuestros resultados muestran que el dorado fue realizado sobre una capa de bol previamente depositada sobre una lámina de blanco de plomo que cubría un estrato de calcita. Posteriormente, y probablemente debido a alteraciones en el dorado original, el techo fue de nuevo dorado usando una técnica similar. En el siglo XIX, casi todo el techo, excepto las zonas con inscripciones, fue blanqueado usando una mezcla de calcita y blanco de plomo. Se empleó plata para cubrir la espada del rey Juan I (casetón 27. Finísimas láminas de oro se usaron para decorar los atributos reales: coronas, cinturones, cetros, espadas y rosarios. En diferentes partes de la decoración fueron detectados pigmentos como azurita, malaquita, bermellón y

  19. Pré-resfriamento em água de lichia 'B3' mantida em armazenamento refrigerado Hydrocooling of 'B3' lychee fruit maintained in cold storage

    Directory of Open Access Journals (Sweden)

    Juan Saavedra del Aguila

    2009-11-01

    Full Text Available Este experimento visou a estudar o efeito de diferentes temperaturas e tempos de pré-resfriamento em água sobre a qualidade de lichias 'B3', após a frigoconservação. Os tratamentos foram: T1 = controle (sem pré-resfriamento; T2 = imersão por cinco minutos em água a 2,5°C; T3 = imersão por 10 minutos em água a 2,5°C; T4 = imersão por 20 minutos em água a 2,5°C; T5 = imersão por sete minutos em água a 6°C; T6 = imersão por 20 minutos em água a 8°C e T7 = imersão por 10 minutos em água a 10°C. Após a aplicação dos respectivos tratamentos, os frutos foram acondicionados em filmes de polietileno de 24µm, selados e posteriormente armazenados a 5°C e 90% UR, por um período de sete dias, seguido por três dias de comercialização simulada a 20°C e 70% UR. O delineamento experimental foi inteiramente ao acaso, com tratamentos fatoriais de 7x3 (tratamentosxtempo. Foram utilizadas quatro repetições por tratamento, sendo cada uma composta por 150g de frutos. Determinaram-se: perda de massa fresca, coloração (L*, a e b, escurecimento (% e podridões (%. De acordo com os resultados, o pré-resfriamento com água reduz a percentagem de escurecimento, o decréscimo da luminosidade (L* e os valores de a. Por outro lado, esse tratamento favorece o surgimento de altos índices de podridão.This project studied the effects of different precooling temperatures and times with water on lychee 'B3' fruit quality cold storage. The treatments were: T1 = control (without precooling; T2 = immersed in water at 2.5°C for five minutes; T3 = immersed in water at 2.5°C for ten minutes; T4 = immersed in water at 2.5°C for 20 minutes; T5 = immersed in water at 6°C for seven minutes; T6 = immersed in water at 8°C for 20 minutes and T7 = immersed in water at 10°C for ten minutes. After treatments application, the fruits were then placed into polyethylene bags of 24µm, sealed, and stored for seven days at 5°C and 90% RH, plus 3 days at 20

  20. El Médico de su Honra (The Doctor of his Own Honor by Calderón de la Barca: The Honor as a Cause of Exemption of the Penal Responsibility in the Baroque Spain

    Directory of Open Access Journals (Sweden)

    José Palacio González

    2014-12-01

    Full Text Available The notion of honor or reputation is at the very core of the Spanish theatre in the baroque period. This fact could not be correctly understood without taking into consideration the obsession about purity of blood, having got a relevant influence in the Spanish society daily life since the expulsion of the Jewish population and the taking over of Grenade in 1492, as well as the first rank role played by the clerical and political power against the reform movement into the Church. One additional element that should be included into this general frame of reference is the structural inability of the Spanish economy to take off, after the end of the middle-age, in a process leading to a beginning of industrial revolution, with the subsequent assumption of modern values that necessarily would come out of that process. The most telling example of the importance of the idea of honor in the Spanish baroque theatre is, with no doubt, The Doctor of his own honor (El medico de su honra, by Calderón de la Barca, which plot turns around the announced death of an innocent lady suspicioned of adultery, just because of an unhappy sets of events. In the play the jealousy is less determinant for the purpose of the plot that the need for the husband to eliminate any element of uncertainty, as far as his reputation is concerned. The King understands the husband’s motivation and forgives him. Such a conception of honor has left, till very recent times, a major mark in the evolution of the Spanish society, even at a legislative level. El concepto de honor o reputación es un elemento fundamental en el teatro barroco español. Este hecho no se puede entender correctamente sin tener en cuenta la obsesión por la pureza de sangre, concepto con una influencia relevante en la vida cotidiana de la sociedad española desde la expulsión de la población judía y la conquista de Granada en 1492, así como por el papel fundamental desempeñado por el poder clerical y pol

  1. Los sistemas de barrancos mexicanos, un recurso potencial para el turismo alternativo. El caso de los Barrancos del río Calderón, Estado de México

    Directory of Open Access Journals (Sweden)

    José Isabel Juan Pérez

    2009-01-01

    Full Text Available El sistema de barrancos del río Calderón, ubicado al sureste del Estado de México,que comprende porciones de los municipios de Villa Guerrero, Ixtapan de La Sal y Zumpahuacán, representa un elemento geográfico de trascendencia para las familias de la región. En este lugar coexisten diversos ecosistemas con elementos geográficos, paisajísticos, geomorfológicos, hidrológicos y amplia biodiversidad que pueden ser utilizados para el turismo alternativo. Mediante el método geográfico, incluyendo cartografía automatizada, fotointerpretación y trabajo de campo, se determinó el potencial natural y sociocultural que posee el sistema de barrancos. La investigación se sustentó en la Teoría General de Sistemas y la Ecología Cultural, complementándose con fundamentos de Geografía Cultural y conceptos de Turismo, que permitieron analizar a los barrancos como un sistema integrado en el que convergen componentes físicos, biológicos y socioculturales. El resultado más relevante es que los elementos bióticos y abióticos del sistema de barrancos están siendo impactados por las actividades económicas y extractivas de los pobladores de la región, sin embargo, aún poseen recursos que mediante un programa de manejo pueden ser utilizados para realizar actividades ecoturísticas encaminadas al desarrollo local, las que al mismo tiempo coadyuven a la protección de los elementos naturales más representativos del sistema.

  2. Trends in preference, programming and design of concert halls for symphonic music

    DEFF Research Database (Denmark)

    Gade, Anders Christian

    2008-01-01

    This paper discusses the evolution in taste regarding concert hall acoustics and how this can be reflected in the new halls being built today. The clients' and listener's preferences are not only based on listening in existing halls; but also on listening to reproduced music recorded with microph......This paper discusses the evolution in taste regarding concert hall acoustics and how this can be reflected in the new halls being built today. The clients' and listener's preferences are not only based on listening in existing halls; but also on listening to reproduced music recorded...

  3. Identification of measles virus genotype B3 associated with outbreaks in Islamabad, Pakistan, 2013-2015.

    Science.gov (United States)

    Zaidi, Syed Sohail Zahoor; Hameed, Abdul; Suleman Rana, Muhammad; Alam, Muhammad Masroor; Umair, Massab; Aamir, Uzma Bashir; Hussain, Maqbool; Sharif, Salmaan; Shaukat, Shahzad; Angez, Mehar; Khurshid, Adnan

    2017-11-09

    Measles virus infection remains a significant cause of childhood mortality and morbidity despite continued global efforts and the availability of a safe and effective vaccine. Molecular analysis of indigenous measles viruses could provide critical information on outbreak linkages and transmission pathways that can aid the implementation of appropriate control programs in Pakistan. Blood samples and throat swabs were collected from subjects suspected with measles in Islamabad, Pakistan from 2013 to 2015. Serum samples were tested for the presence of measles immunoglobulin M (IgM) antibodies using enzyme-linked immunosorbent assay (ELISA) while throat swabs were used for the isolation (Vero/SLAM cell line) and subsequent characterization and phylogenetic analysis of measles strains. Of 373 blood samples, 66% tested positive for measles IgM. Male subjects were more often infected (58%) than female (42%) with the highest frequency of positive cases (63%) in the 0-5-years age group. Among the positive cases, only 13% had received one or two doses of the measles vaccine, while 87% were unvaccinated. Of 80 throat swabs, 29 (36%) showed a measles virus-specific cytopathic effect (CPE) and were characterized as genotype B3 through partial sequencing of the nucleoprotein (N) gene. Phylogenetic analysis revealed the Pakistani B3 strains to be closely related to strains from neighboring countries (Iran and Afghanistan) as well as with B3 viruses from the USA, Germany, and the UK. The study results showed that despite the availability of an effective vaccine, the burden of measles infections is very high in Pakistan due to poor routine immunization coverage even in major cities, including the capital city of Islamabad. It is imperative that national health authorities take urgent strategic steps to improve routine immunization and implement adequate molecular identification methods to tackle future measles outbreaks. Copyright © 2017 The Authors. Published by Elsevier Ltd

  4. Interactions and encapsulation of vitamins C, B3, and B6 with dendrimers in water.

    Science.gov (United States)

    Boisselier, Elodie; Liang, Liyuan; Dalko-Csiba, Maria; Ruiz, Jaime; Astruc, Didier

    2010-05-25

    Titrations of commercial diaminobutane (DAB) and polyamidoamine (PAMAM) dendrimers by vitamins C (ascorbic acid, AA), B(3) (nicotinic acid), and B(6) (pyridoxine) were monitored by (1)H NMR spectroscopy using the chemical shifts of both dendrimer and vitamin protons and analyzed by comparison with the titration of propylamine. Quaternarizations of the terminal primary amino groups and intradendritic tertiary amino groups, which are nearly quantitative with vitamin C, were characterized by more or less sharp variations (Deltadelta) of the (1)H chemical shift (delta) at the equivalence points. The peripheral primary amino groups of the DAB dendrimers were quaternarized first, but not selectively, whereas a sharp chemical-shift variation was recorded for the inner methylene protons near the tertiary amines, thereby indicating encapsulation, when all the dendritic amines were quaternarized. With DAB-G5-64-NH(2), some excess acid is required to protonate the inner amino groups, presumably because of basicity decrease due to excess charge repulsion. On the other hand, this selectivity was not observed with PAMAM dendrimers. The special case of the titration of the dendrimers by vitamin B(6) indicates only dominant supramolecular hydrogen-bonding interactions and no quaternarization, with core amino groups being privileged, which indicates the strong tendency to encapsulate vitamins. With vitamin B(3), a carboxylic acid, titration of DAB-G3-16-NH(2) shows that only six peripheral amino groups are protonated on average, even with excess vitamin B(3), because protonation is all the more difficult due to increased charge repulsion, as positive charges accumulate around the dendrimer. Inner amino groups interact with this vitamin, however, thus indicating encapsulation presumably with supramolecular hydrogen bonding without much charge transfer.

  5. Modular invariance, universality and crossover in the quantum Hall effect

    International Nuclear Information System (INIS)

    Dolan, Brian P.

    1999-01-01

    An analytic form for the conductivity tensor in crossover between two quantum Hall plateaux is derived, which appears to be in good agreement with existing experimental data. The derivation relies on an assumed symmetry between quantum Hall states, a generalisation of the law of corresponding states from rational filling factors to complex conductivity, which has a mathematical expression in terms of an action of the modular group on the upper-half complex conductivity plane. This symmetry implies universality in quantum Hall crossovers. The assumption that the β-function for the complex conductivity is a complex analytic function, together with some experimental constraints, results in an analytic expression for the crossover, as a function of the external magnetic field

  6. Carl Gustav Jung and Granville Stanley Hall on Religious Experience.

    Science.gov (United States)

    Kim, Chae Young

    2016-08-01

    Granville Stanley Hall (1844-1924) with William James (1842-1910) is the key founder of psychology of religion movement and the first American experimental or genetic psychologist, and Carl Gustav Jung (1875-1961) is the founder of the analytical psychology concerned sympathetically about the religious dimension rooted in the human subject. Their fundamental works are mutually connected. Among other things, both Hall and Jung were deeply interested in how the study of religious experience is indispensable for the depth understanding of human subject. Nevertheless, except for the slight indication, this common interest between them has not yet been examined in academic research paper. So this paper aims to articulate preliminary evidence of affinities focusing on the locus and its function of the inner deep psychic dimension as the religious in the work of Hall and Jung.

  7. Admittance of multiterminal quantum Hall conductors at kilohertz frequencies

    International Nuclear Information System (INIS)

    Hernández, C.; Consejo, C.; Chaubet, C.; Degiovanni, P.

    2014-01-01

    We present an experimental study of the low frequency admittance of quantum Hall conductors in the [100 Hz, 1 MHz] frequency range. We show that the frequency dependence of the admittance of the sample strongly depends on the topology of the contacts connections. Our experimental results are well explained within the Christen and Büttiker approach for finite frequency transport in quantum Hall edge channels taking into account the influence of the coaxial cables capacitance. In the Hall bar geometry, we demonstrate that there exists a configuration in which the cable capacitance does not influence the admittance measurement of the sample. In this case, we measure the electrochemical capacitance of the sample and observe its dependence on the filling factor

  8. Admittance of multiterminal quantum Hall conductors at kilohertz frequencies

    Energy Technology Data Exchange (ETDEWEB)

    Hernández, C. [Departamento de Física, Universidad Militar Nueva Granada, Carrera 11 101-80 Bogotá D.C. (Colombia); Consejo, C.; Chaubet, C., E-mail: christophe.chaubet@univ-montp2.fr [Université Montpellier 2, Laboratoire Charles Coulomb UMR5221, F-34095 Montpellier, France and CNRS, Laboratoire Charles Coulomb UMR5221, F-34095 Montpellier (France); Degiovanni, P. [Université de Lyon, Fédération de Physique Andrée Marie Ampère, CNRS, Laboratoire de Physique de l' Ecole Normale Supérieure de Lyon, 46 allée d' Italie, 69364 Lyon Cedex 07 (France)

    2014-03-28

    We present an experimental study of the low frequency admittance of quantum Hall conductors in the [100 Hz, 1 MHz] frequency range. We show that the frequency dependence of the admittance of the sample strongly depends on the topology of the contacts connections. Our experimental results are well explained within the Christen and Büttiker approach for finite frequency transport in quantum Hall edge channels taking into account the influence of the coaxial cables capacitance. In the Hall bar geometry, we demonstrate that there exists a configuration in which the cable capacitance does not influence the admittance measurement of the sample. In this case, we measure the electrochemical capacitance of the sample and observe its dependence on the filling factor.

  9. Crossover between spin swapping and Hall effect in disordered systems

    KAUST Repository

    Saidaoui, Hamed Ben Mohamed

    2015-07-16

    We theoretically study the crossover between spin Hall effect and spin swapping, a recently predicted phenomenon that consists of the interchange between the current flow and its spin polarization directions [M. B. Lifshits and M. I. Dyakonov, Phys. Rev. Lett. 103, 186601 (2009)]. Using a tight-binding model with spin-orbit coupled disorder, spin Hall effect, spin relaxation, and spin swapping are treated on equal footing. We demonstrate that spin swapping and spin Hall effect present very different dependencies as a function of the spin-orbit coupling and disorder strengths and confirm that the former exceeds the latter in the parameter range considered. Three setups are proposed for the experimental observation of the spin swapping effect.

  10. The quantum Hall effect in quantum dot systems

    International Nuclear Information System (INIS)

    Beltukov, Y M; Greshnov, A A

    2014-01-01

    It is proposed to use quantum dots in order to increase the temperatures suitable for observation of the integer quantum Hall effect. A simple estimation using Fock-Darwin spectrum of a quantum dot shows that good part of carriers localized in quantum dots generate the intervals of plateaus robust against elevated temperatures. Numerical calculations employing local trigonometric basis and highly efficient kernel polynomial method adopted for computing the Hall conductivity reveal that quantum dots may enhance peak temperature for the effect by an order of magnitude, possibly above 77 K. Requirements to potentials, quality and arrangement of the quantum dots essential for practical realization of such enhancement are indicated. Comparison of our theoretical results with the quantum Hall measurements in InAs quantum dot systems from two experimental groups is also given

  11. Diaphragm Effect of Steel Space Roof Systems in Hall Structures

    Directory of Open Access Journals (Sweden)

    Mehmet FENKLİ

    2015-09-01

    Full Text Available Hall structures have been used widely for different purposes. They have are reinforced concrete frames and shear wall with steel space roof systems. Earthquake response of hall structures is different from building type structures. One of the most critical nodes is diaphragm effect of steel space roof on earthquake response of hall structures. Diaphragm effect is depending on lateral stiffness capacity of steel space roof system. Lateral stiffness of steel space roof system is related to modulation geometry, support conditions, selected sections and system geometry. In current paper, three representative models which are commonly used in Turkey were taken in to account for investigation. Results of numerical tests were present comparatively

  12. Novel Hall sensors developed for magnetic field imaging systems

    International Nuclear Information System (INIS)

    Cambel, Vladimir; Karapetrov, Goran; Novosad, Valentyn; Bartolome, Elena; Gregusova, Dagmar; Fedor, Jan; Kudela, Robert; Soltys, Jan

    2007-01-01

    We report here on the fabrication and application of novel planar Hall sensors based on shallow InGaP/AlGaAs/GaAs heterostructure with a two-dimensional electron gas (2DEG) as an active layer. The sensors are developed for two kinds of experiments. In the first one, magnetic samples are placed directly on the Hall sensor. Room temperature experiments of permalloy objects evaporated onto the sensor are presented. In the second experiment, the sensor scans close over a multigranular superconducting sample prepared on a YBCO thin film. Large-area and high-resolution scanning experiments were performed at 4.2 K with the Hall probe scanning system in a liquid helium flow cryostat

  13. Crossover between spin swapping and Hall effect in disordered systems

    KAUST Repository

    Saidaoui, Hamed Ben Mohamed; Otani, Y.; Manchon, Aurelien

    2015-01-01

    We theoretically study the crossover between spin Hall effect and spin swapping, a recently predicted phenomenon that consists of the interchange between the current flow and its spin polarization directions [M. B. Lifshits and M. I. Dyakonov, Phys. Rev. Lett. 103, 186601 (2009)]. Using a tight-binding model with spin-orbit coupled disorder, spin Hall effect, spin relaxation, and spin swapping are treated on equal footing. We demonstrate that spin swapping and spin Hall effect present very different dependencies as a function of the spin-orbit coupling and disorder strengths and confirm that the former exceeds the latter in the parameter range considered. Three setups are proposed for the experimental observation of the spin swapping effect.

  14. ε-iron nitrides: Intrinsic anomalous Hall ferromagnets

    Directory of Open Access Journals (Sweden)

    Guo-Ke Li

    2015-02-01

    Full Text Available The anomalous Hall effect in ε-iron nitrides (ε-Fe3-xN, 0 ≤ x ≤ 1 has been systematically investigated taking advantage of the fact that the exchange splitting of ε-Fe3-xN can be continuously tuned through the nitrogen concentration. It has been found that the anomalous Hall conductivity, σ x y A H , is proportional to the saturation magnetization MS, i.e., σ x y A H = S H M S , across significant variations in the saturation magnetization (96–1146 emu/cc. This relationship is in excellent agreement with the intrinsic mechanism as well as with the unified theory of AHE. Our results also demonstrate that the anomalous Hall conductivity is sensitive to the exchange splitting of the band structure.

  15. Can ensemble condition in a hall be improved and measured?

    DEFF Research Database (Denmark)

    Gade, Anders Christian

    1988-01-01

    of the ceiling reflectors; and (c) changing the position of the orchestra on the platform. These variables were then tested in full scale experiments in the hall including subjective evaluation by the orchestra in order to verify their effects under practical conditions. New objective parameters, which showed......In collaboration with the Danish Broadcasting Corporation an extensive series of experiments has been carried out in The Danish Radio Concert Hall with the practical purpose of trying to improve the ensemble conditions on the platform for the resident symphony orchestra. First, a series...... very high correlations with the subjective data, also made it possible to compare the improvements with conditions as recently measured in famous European Halls. Besides providing the needed results, the experiments also shed some light on how musicians change their criteria for judging acoustic...

  16. Overview of NASA Iodine Hall Thruster Propulsion System Development

    Science.gov (United States)

    Smith, Timothy D.; Kamhawi, Hani; Hickman, Tyler; Haag, Thomas; Dankanich, John; Polzin, Kurt; Byrne, Lawrence; Szabo, James

    2016-01-01

    NASA is continuing to invest in advancing Hall thruster technologies for implementation in commercial and government missions. The most recent focus has been on increasing the power level for large-scale exploration applications. However, there has also been a similar push to examine applications of electric propulsion for small spacecraft in the range of 300 kg or less. There have been several recent iodine Hall propulsion system development activities performed by the team of the NASA Glenn Research Center, the NASA Marshall Space Flight Center, and Busek Co. Inc. In particular, the work focused on qualification of the Busek 200-W BHT-200-I and development of the 600-W BHT-600-I systems. This paper discusses the current status of iodine Hall propulsion system developments along with supporting technology development efforts.

  17. Vaporization Rate Analysis of Primary Cooling Water from Reactor PUSPATI TRIGA (RTP) Tank

    International Nuclear Information System (INIS)

    Tonny Anak Lanyau; Mohd Fazli Zakaria; Yahya Ismail

    2011-01-01

    Primary cooling system consists of pumps, heat exchangers, probes, a nitrogen-16 diffuser and associated valves is connected to the reactor TRIGA PUSPATI (RTP) tank by aluminium pipes. Both the primary cooling system and the reactor tank is filled with demineralized light water (H 2 O), which serves as a coolant, moderator as well as shielding. During reactor operation, vaporization in the reactor tank will reduce the primary water and contribute to the formation of vapor in the reactor hall. The vaporization may influence the function of the water subsequently may affect the safety of the reactor operation. It is essential to know the vaporization rate of the primary water to ensure its functionality. This paper will present the vaporization rate of the primary cooling water from the reactor tank and the influence of temperature of the water in the reactor tank to the vaporization rate. (author)

  18. A los tuyos con razón o sin ella Redes de poder, candidaturas y recomendaciones en el estado soberano de Santander (1859-1886). El caso de la red del general Solón Wilches Calderón

    OpenAIRE

    Guerra, Adriano Israel

    2015-01-01

    Esta investigación busca primero, a manera de balance, presentar los textos realizados sobre el tema específico del General Solón Wilches Calderón en el Estado Soberano de Santander. Luego se profundiza en el concepto central que estamos utilizando: Redes de poder, sin dejar de definir otros aspectos teóricos. El primer capítulo tiene por objetivo principal dibujar el mapa político durante el Estado Soberano de Santander estableciendo sus principales actores, grupos, conflictos y sus proyecto...

  19. La sucesión exitosa de un Grupo Empresario Familiar a la futura Generación a través de un Modelo de Dirección Estratégica Caso: Grupo Calderón Comercio Exterior y Logística Integral

    OpenAIRE

    Chang Gonzáles, Viviana

    2012-01-01

    TESIS A TEXTO COMPLETO La presente tesis delimita los factores que enfrenta el Grupo Familiar Calderón de Comercio Exterior y Logística Integral con respecto a la futura sucesión y determina como la aplicación de un Modelo de Dirección Estratégica facilitaría el proceso. El objetivo general de esta investigación es: Determinar la situación actual del recurso humano y miembros de familia con respecto a laborar o ser propietarios de Grupos Empresarios familiares en conjunto con el Caso de P...

  20. Hall effect in a strong magnetic field: Direct comparisons of compressible magnetohydrodynamics and the reduced Hall magnetohydrodynamic equations

    International Nuclear Information System (INIS)

    Martin, L. N.; Dmitruk, P.; Gomez, D. O.

    2010-01-01

    In this work we numerically test a model of Hall magnetohydrodynamics in the presence of a strong mean magnetic field: the reduced Hall magnetohydrodynamic model (RHMHD) derived by [Gomez et al., Phys. Plasmas 15, 102303 (2008)] with the addition of weak compressible effects. The main advantage of this model lies in the reduction of computational cost. Nevertheless, up until now the degree of agreement with the original Hall MHD system and the range of validity in a regime of turbulence were not established. In this work direct numerical simulations of three-dimensional Hall MHD turbulence in the presence of a strong mean magnetic field are compared with simulations of the weak compressible RHMHD model. The results show that the degree of agreement is very high (when the different assumptions of RHMHD, such as spectral anisotropy, are satisfied). Nevertheless, when the initial conditions are isotropic but the mean magnetic field is maintained strong, the results differ at the beginning but asymptotically reach a good agreement at relatively short times. We also found evidence that the compressibility still plays a role in the dynamics of these systems, and the weak compressible RHMHD model is able to capture these effects. In conclusion the weak compressible RHMHD model is a valid approximation of the Hall MHD turbulence in the relevant physical context.

  1. Slurry reactors

    Energy Technology Data Exchange (ETDEWEB)

    Kuerten, H; Zehner, P [BASF A.G., Ludwigshafen am Rhein (Germany, F.R.)

    1979-08-01

    Slurry reactors are designed on the basis of empirical data and model investigations. It is as yet not possible to calculate the flow behavior of such reactors. The swarm of gas bubbles and cluster formations of solid particles and their interaction in industrial reactors are not known. These effects control to a large extent the gas hold-up, the gas-liquid interface and, similarly as in bubble columns, the back-mixing of liquids and solids. These hydrodynamic problems are illustrated in slurry reactors which constructionally may be bubble columns, stirred tanks or jet loop reactors. The expected effects are predicted by means of tests with model systems modified to represent the conditions in industrial hydrogenation reactors. In his book 'Mass Transfer in Heterogeneous Catalysis' (1970) Satterfield complained of the lack of knowledge about the design of slurry reactors and hence of the impossible task of the engineer who has to design a plant according to accepted rules. There have been no fundamental changes since then. This paper presents the problems facing the engineer in designing slurry reactors, and shows new development trends.

  2. Reactor safety

    International Nuclear Information System (INIS)

    Butz, H.P.; Heuser, F.W.; May, H.

    1985-01-01

    The paper comprises an introduction into nuclear physics bases, the safety concept generally speaking, safety devices of pwr type reactors, accident analysis, external influences, probabilistic safety assessment and risk studies. It further describes operational experience, licensing procedures under the Atomic Energy Law, research in reactor safety and the nuclear fuel cycle. (DG) [de

  3. Nuclear reactor

    International Nuclear Information System (INIS)

    Mysels, K.J.; Shenoy, A.S.

    1976-01-01

    A nuclear reactor is described in which the core consists of a number of fuel regions through each of which regulated coolant flows. The coolant from neighbouring fuel regions is combined in a manner which results in an averaging of the coolant temperature at the outlet of the core. By this method the presence of hot streaks in the reactor is reduced. (UK)

  4. Reactor container

    International Nuclear Information System (INIS)

    Kato, Masami; Nishio, Masahide.

    1987-01-01

    Purpose: To prevent the rupture of the dry well even when the melted reactor core drops into a reactor pedestal cavity. Constitution: In a reactor container in which a dry well disposed above the reactor pedestal cavity for containing the reactor pressure vessel and a torus type suppression chamber for containing pressure suppression water are connected with each other, the pedestal cavity and the suppression chamber are disposed such that the flow level of the pedestal cavity is lower than the level of the pressure suppression water. Further, a pressure suppression water introduction pipeway for introducing the pressure suppression water into the reactor pedestal cavity is disposed by way of an ON-OFF valve. In case if the melted reactor core should fall into the pedestal cavity, the ON-OFF valve for the pressure suppression water introduction pipeway is opened to introduce the pressure suppression water in the suppression chamber into the pedestal cavity to cool the melted reactor core. (Ikeda, J.)

  5. RA Reactor

    International Nuclear Information System (INIS)

    1989-01-01

    This chapter includes the following: General description of the RA reactor, organization of work, responsibilities of leadership and operators team, regulations concerning operation and behaviour in the reactor building, regulations for performing experiments, regulations and instructions for inserting samples into experimental channels [sr

  6. Reactor physics

    International Nuclear Information System (INIS)

    Ait Abderrahim, H.

    1998-01-01

    Progress in research on reactor physics in 1997 at the Belgian Nuclear Research Centre SCK/CEN is described. Activities in the following four domains are discussed: core physics, ex-core neutron transport, experiments in Materials Testing Reactors, international benchmarks

  7. DFT/B3LYP study of tocopherols and chromans antioxidant action energetics

    International Nuclear Information System (INIS)

    Klein, Erik; Lukes, Vladimir; Ilcin, Michal

    2007-01-01

    Gas-phase reaction enthalpies related to the individual steps of three phenolic antioxidants action mechanisms - hydrogen atom transfer (HAT), single-electron transfer-proton transfer (SET-PT) and sequential proton loss electron transfer (SPLET) for four tocopherols and seven chromans - were calculated using DFT/B3LYP method. For α-tocopherol, one of the chromans and phenol, reaction enthalpies in water were computed. In comparison to gas phase, water causes severe changes in the energetics of studied compounds antioxidant action. From the thermodynamic point of view, entering SPLET mechanism represents the most probable process in water

  8. DFT/B3LYP study of tocopherols and chromans antioxidant action energetics

    Energy Technology Data Exchange (ETDEWEB)

    Klein, Erik [Institute of Physical Chemistry and Chemical Physics, Slovak University of Technology, Radlinskeho 9, SK-812 37 Bratislava (Slovakia)], E-mail: erik.klein@stuba.sk; Lukes, Vladimir; Ilcin, Michal [Institute of Physical Chemistry and Chemical Physics, Slovak University of Technology, Radlinskeho 9, SK-812 37 Bratislava (Slovakia)

    2007-07-09

    Gas-phase reaction enthalpies related to the individual steps of three phenolic antioxidants action mechanisms - hydrogen atom transfer (HAT), single-electron transfer-proton transfer (SET-PT) and sequential proton loss electron transfer (SPLET) for four tocopherols and seven chromans - were calculated using DFT/B3LYP method. For {alpha}-tocopherol, one of the chromans and phenol, reaction enthalpies in water were computed. In comparison to gas phase, water causes severe changes in the energetics of studied compounds antioxidant action. From the thermodynamic point of view, entering SPLET mechanism represents the most probable process in water.

  9. Measles in Italy: Co-circulation of B3 variants during 2014.

    Science.gov (United States)

    Magurano, Fabio; Baggieri, Melissa; Bordi, Licia; Lalle, Eleonora; Chironna, Maria; Lazzarotto, Tiziana; Amendola, Antonella; Baldanti, Fausto; Ansaldi, Filippo; Filia, Antonietta; Declich, Silvia; Iannazzo, Stefania; Pompa, Maria Grazia; Bucci, Paola; Marchi, Antonella; Nicoletti, Loredana

    2016-06-01

    In 2013, the majority of the WHO/EUR countries reported an annual incidence of >1 case per one million population indicating that the elimination target is far from being met. Thus, there is the urgent need to uncover and analyze chains of measles virus (MV) transmission with the objective to identify vulnerable groups and avoid possible routes of introduction of MV variants in the European population. The analysis of molecular epidemiology of MV B3 strains identified in 2014 has shown that four different variants co-circulated in Italy, including the strain that caused a cruise-line ship outbreak at the beginning of the year. © 2015 Wiley Periodicals, Inc.

  10. Air leakage analysis of research reactor HANARO building in typhoon condition for the nuclear emergency preparedness

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Goany Up; Lee, Hae Cho; Kim, Bong Seok; Kim, Jong Soo; Choi, Pyung Kyu [Dept. of Emergency Preparedness, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-12-15

    To find out the leak characteristic of research reactor 'HANARO' building in a typhoon condition MELCOR code which normally is used to simulate severe accident behavior in a nuclear power plant was used to simulate the leak rate of air and fission products from reactor hall after the shutdown of the ventilation system of HANARO reactor building. For the simulation, HANARO building was designed by MELCOR code and typhoon condition passed through Daejeon in 2012 was applied. It was found that the leak rate is 0.1%·day{sup -1} of air, 0.004%·day{sup -1} of noble gas and 3.7×10{sup -5}%·day{sup -1} of aerosol during typhoon passing. The air leak rate of 0.1%·day can be converted into 1.36 m{sup 3}·hr{sup -1} , but the design leak rate in HANARO safety analysis report was considered as 600 m3·hr{sup -1} under the condition of 20 m·sec{sup -1} wind speed outside of the building by typhoon. Most of fission products during the maximum hypothesis accident at HANARO reactor will be contained in the reactor hall, so the direct radiation by remained fission products in the reactor hall will be the most important factor in designing emergency preparedness for HANARO reactor.

  11. Air leakage analysis of research reactor HANARO building in typhoon condition for the nuclear emergency preparedness

    International Nuclear Information System (INIS)

    Lee, Goany Up; Lee, Hae Cho; Kim, Bong Seok; Kim, Jong Soo; Choi, Pyung Kyu

    2016-01-01

    To find out the leak characteristic of research reactor 'HANARO' building in a typhoon condition MELCOR code which normally is used to simulate severe accident behavior in a nuclear power plant was used to simulate the leak rate of air and fission products from reactor hall after the shutdown of the ventilation system of HANARO reactor building. For the simulation, HANARO building was designed by MELCOR code and typhoon condition passed through Daejeon in 2012 was applied. It was found that the leak rate is 0.1%·day -1 of air, 0.004%·day -1 of noble gas and 3.7×10 -5 %·day -1 of aerosol during typhoon passing. The air leak rate of 0.1%·day can be converted into 1.36 m 3 ·hr -1 , but the design leak rate in HANARO safety analysis report was considered as 600 m3·hr -1 under the condition of 20 m·sec -1 wind speed outside of the building by typhoon. Most of fission products during the maximum hypothesis accident at HANARO reactor will be contained in the reactor hall, so the direct radiation by remained fission products in the reactor hall will be the most important factor in designing emergency preparedness for HANARO reactor

  12. Reactor core

    International Nuclear Information System (INIS)

    Azekura, Kazuo; Kurihara, Kunitoshi.

    1992-01-01

    In a BWR type reactor, a great number of pipes (spectral shift pipes) are disposed in the reactor core. Moderators having a small moderating cross section (heavy water) are circulated in the spectral shift pipes to suppress the excess reactivity while increasing the conversion ratio at an initial stage of the operation cycle. After the intermediate stage of the operation cycle in which the reactor core reactivity is lowered, reactivity is increased by circulating moderators having a great moderating cross section (light water) to extend the taken up burnup degree. Further, neutron absorbers such as boron are mixed to the moderator in the spectral shift pipe to control the concentration thereof. With such a constitution, control rods and driving mechanisms are no more necessary, to simplify the structure of the reactor core. This can increase the fuel conversion ratio and control great excess reactivity. Accordingly, a nuclear reactor core of high conversion and high burnup degree can be attained. (I.N.)

  13. Reactor container

    International Nuclear Information System (INIS)

    Fukazawa, Masanori.

    1991-01-01

    A system for controlling combustible gases, it has been constituted at present such that the combustible gases are controlled by exhausting them to the wet well of a reactor container. In this system, however, there has been a problem, in a reactor container having plenums in addition to the wet well and the dry well, that the combustible gases in such plenums can not be controlled. In view of the above, in the present invention, suction ports or exhaust ports of the combustible gas control system are disposed to the wet well, the dry well and the plenums to control the combustible gases in the reactor container. Since this can control the combustible gases in the entire reactor container, the integrity of the reactor container can be ensured. (T.M.)

  14. Reactor container

    International Nuclear Information System (INIS)

    Kojima, Yoshihiro; Hosomi, Kenji; Otonari, Jun-ichiro.

    1997-01-01

    In the present invention, a catalyst for oxidizing hydrogen to be disposed in a reactor container upon rupture of pipelines of a reactor primary coolant system is prevented from deposition of water droplets formed from a reactor container spray to suppress elevation of hydrogen concentration in the reactor container. Namely, a catalytic combustion gas concentration control system comprises a catalyst for oxidizing hydrogen and a support thereof. In addition, there is also disposed a water droplet deposition-preventing means for preventing deposition of water droplets in a reactor pressure vessel on the catalyst. Then, the effect of the catalyst upon catalytic oxidation reaction of hydrogen can be kept high. The local elevation of hydrogen concentration can be prevented even upon occurrence of such a phenomenon that various kinds of mobile forces in the container such as dry well cooling system are lost. (I.S.)

  15. Nuclear reactor

    International Nuclear Information System (INIS)

    Tilliette, Z.

    1975-01-01

    A description is given of a nuclear reactor and especially a high-temperature reactor in which provision is made within a pressure vessel for a main cavity containing the reactor core and a series of vertical cylindrical pods arranged in spaced relation around the main cavity and each adapted to communicate with the cavity through two collector ducts or headers for the primary fluid which flows downwards through the reactor core. Each pod contains two superposed steam-generator and circulator sets disposed in substantially symmetrical relation on each side of the hot primary-fluid header which conveys the primary fluid from the reactor cavity to the pod, the circulators of both sets being mounted respectively at the bottom and top ends of the pod

  16. Spin-Hall nano-oscillator: A micromagnetic study

    Energy Technology Data Exchange (ETDEWEB)

    Giordano, A.; Azzerboni, B.; Finocchio, G. [Department of Electronic Engineering, Industrial Chemistry and Engineering, University of Messina, C.da di Dio, I-98166 Messina (Italy); Carpentieri, M. [Department of Electrical and Information Engineering, Politecnico of Bari, via E. Orabona 4, I-70125 Bari (Italy); Laudani, A. [Department of Engineering, University of Roma Tre, via V. Volterra 62, I-00146 Roma (Italy); Gubbiotti, G. [Istituto Officina dei Materiali del CNR (CNR-IOM), Unità di Perugia c/o Dipartimento di Fisica e Geologia, Via A. Pascoli, 06123 Perugia (Italy)

    2014-07-28

    This Letter studies the dynamical behavior of spin-Hall nanoscillators from a micromagnetic point of view. The model parameters have been identified by reproducing recent experimental data quantitatively. Our results indicate that a strongly localized mode is observed for in-plane bias fields such as in the experiments, while predict the excitation of an asymmetric propagating mode for large enough out-of plane bias field similarly to what observed in spin-torque nanocontact oscillators. Our findings show that spin-Hall nanoscillators can find application as spin-wave emitters for magnonic applications where spin waves are used for transmission and processing information on nanoscale.

  17. Complex scattering dynamics and the quantum Hall effects

    International Nuclear Information System (INIS)

    Trugman, S.A.

    1994-01-01

    We review both classical and quantum potential scattering in two dimensions in a magnetic field, with applications to the quantum Hall effect. Classical scattering is complex, due to the approach of scattering states to an infinite number of dynamically bound states. Quantum scattering follows the classical behavior rather closely, exhibiting sharp resonances in place of the classical bound states. Extended scatterers provide a quantitative explanation for the breakdown of the QHE at a comparatively small Hall voltage as seen by Kawaji et al., and possibly for noise effects

  18. Impact of external conditions on energy consumption in industrial halls

    Science.gov (United States)

    Żabnieńśka-Góra, Alina

    2017-11-01

    The energy demand for heating the halls buildings is high. The impact on this may have the technology of production, building construction and technology requirements (HVAC systems). The isolation of the external partitions, the location of the object in relation to the surrounding buildings and the degree of the interior insolation (windows and skylights) are important in the context of energy consumption. The article discusses the impact of external conditions, wind and sunlight on energy demand in the industrial hall. The building model was prepared in IDA ICE 4.0 simulation software. Model validation was done based on measurements taken in the analyzed building.

  19. Hall effects on MHD flow past an accelerated plate

    Directory of Open Access Journals (Sweden)

    Deka R.K.

    2008-01-01

    Full Text Available The simultaneous effects of rotation and Hall current on the hydromagnetic flow past an accelerated horizontal plate relative to a rotating fluid is presented. It is found that for given values of m (Hall parameter, M (Hartmann number and an imposed rotation parameter Ω satisfying Ω = M 2m/(1 + m2, the transverse motion (transverse to the main flow disappears and the fluid moves in the direction of the plate only. The effects of the parameters m, M and Ω on the axial and transverse velocity profiles are shown graphically, whereas the effects of the parameters on the skin-friction components are shown by tabular values.

  20. Spectroscopy of snake states using a graphene Hall bar

    Energy Technology Data Exchange (ETDEWEB)

    Milovanović, S. P., E-mail: slavisa.milovanovic@gmail.com; Ramezani Masir, M., E-mail: mrmphys@gmail.com; Peeters, F. M., E-mail: francois.peeters@ua.ac.be [Departement Fysica, Universiteit Antwerpen, Groenenborgerlaan 171, B-2020 Antwerpen (Belgium)

    2013-12-02

    An approach to observe snake states in a graphene Hall bar containing a pn-junction is proposed. The magnetic field dependence of the bend resistance in a ballistic graphene Hall bar structure containing a tilted pn-junction oscillates as a function of applied magnetic field. We show that each oscillation is due to a specific snake state that moves along the pn-interface. Furthermore, depending on the value of the magnetic field and applied potential, we can control the lead in which the electrons will end up and hence control the response of the system.