WorldWideScience

Sample records for calculation p1 b1

  1. Comparative analysis between P1 and B1 equations for neutron moderation

    International Nuclear Information System (INIS)

    In order to calculate the neutron flux in nuclear reactors, B1 or P1 equations are solved by numerical methods for several groups of energy. The neutron fluxes obtained from the solutions of the B1 and P1 equations are similar when they are applied to large nuclear power reactors. However, an important difference between the two fluxes is that the system of P1 equations uses one more approximation than the B1 system and then, its flux is less precise. The present work shows the relations between both equations and analyzes for what conditions the two equations systems are equivalent. Furthermore, this equations are numerically solved in 54 groups of energy for a quadrangular arrange. (author)

  2. Comparative analysis between P1 and B1 equations for neutron moderation; Analise comparativa entre os metodos de obtencao e das solucoes das equacoes P1 e B1 para moderacao de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Aquilino Senra; Silva, Fernando Carvalho da; Cardoso, Carlos Eduardo Santos [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia. Programa de Engenharia Nuclear

    2000-07-01

    In order to calculate the neutron flux in nuclear reactors, B1 or P1 equations are solved by numerical methods for several groups of energy. The neutron fluxes obtained from the solutions of the B1 and P1 equations are similar when they are applied to large nuclear power reactors. However, an important difference between the two fluxes is that the system of P1 equations uses one more approximation than the B1 system and then, its flux is less precise. The present work shows the relations between both equations and analyzes for what conditions the two equations systems are equivalent. Furthermore, this equations are numerically solved in 54 groups of energy for a quadrangular arrange. (author)

  3. 17 CFR 260.10b-1 - Calculation of percentages.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Calculation of percentages. 260.10b-1 Section 260.10b-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Calculation of percentages. The percentages of voting securities and other securities specified in section...

  4. Magnetic properties of Ak(ApB1-p)1Bh superlattices containing alloy disordered interfaces in a spin-1/2 model

    International Nuclear Information System (INIS)

    An Ising model is presented for a simple cubic-type structure, to determine the magnetic properties for superlattices of periodic Ak(ApB1-p)1Bh formula consisting of k layers of spin-1/2 A ions, h layers of spin-1/2 B ions and single layer disordered alloy interfaces between them. The interface layers are characterized by random arrangements of A and B ions so that (ApB1-p)1 is a two-dimensional thermodynamically stable alloy. The magnetic properties studied concern notably the phase diagrams and the sublattice magnetizations of these systems. The model is general and can be used for ferro- or anti-ferromagnetic A-B exchange couplings. In this paper the A-A and B-B exchange couplings are considered ferromagnetic with no loss of generality. An effective field theory is employed to calculate the properties of these systems. We apply the method to various Fek(Fep Tb1-p)1Tbh superlattices. The needed exchange constants for the two-dimensional alloy interface are calculated in the framework of this model, and used to calculate these properties for different concentrations 0≤p≤1, for these superlattices. The architecture and concentration dependence of the magnetic properties is an important feature of this paper, allowing a useful experimental analysis of similar systems. (author)

  5. Computer program /P1-GAS/ calculates the P-0 and P-1 transfer matrices for neutron moderation in a monatomic gas

    Science.gov (United States)

    Collier, G.; Gibson, G.

    1968-01-01

    FORTRAN 4 program /P1-GAS/ calculates the P-O and P-1 transfer matrices for neutron moderation in a monatomic gas. The equations used are based on the conditions that there is isotropic scattering in the center-of-mass coordinate system, the scattering cross section is constant, and the target nuclear velocities satisfy a Maxwellian distribution.

  6. Relativistic calculations of 3s21S0-3s3p 1P1 and 3s21S0-3s3p 3P1,2 transition probabilities in the Mg isoelectronic sequence

    International Nuclear Information System (INIS)

    Using the multi-configuration Dirac—Fock self-consistent field method and the relativistic configuration-interaction method, calculations of transition energies, oscillator strengths and rates are performed for the 3s21S0-3s3p 1P1 spin-allowed transition, 3s21S0-3s3p 3P1,2 intercombination and magnetic quadrupole transition in the Mg isoelectronic sequence (Mg I, Al II, Si III, P IV and S V). Electron correlations are treated adequately, including intravalence electron correlations. The influence of the Breit interaction on oscillator strengths and transition energies are investigated. Quantum electrodynamics corrections are added as corrections. The calculation results are found to be in good agreement with the experimental data and other theoretical calculations. (atomic and molecular physics)

  7. Suppression of the SOS-inducing activity of Trp-P-1 and aflatoxin B1 by meso-dihydroguaiaretic acid from Machilus thunbergii in the Salmonella typhimurium TA1535/pSK1002 umu test.

    Science.gov (United States)

    Miyazawa, M; Okuno, Y; Oshiro, K; Kasahara, H; Shimamura, H; Nakamura, S; Kameoka, H

    1998-07-01

    The methanol extract from Machilus thunbergii showed a suppressive effect on umu gene expression of the SOS response in Salmonella typhimurium TA1535/pSK1002 against the mutagen, 3-amino-1,4-dimethyl-5H-pyrido[4,3-b]indole (Trp-P-1), which requires liver metabolizing enzymes. The methanol extract from M. thunbergii was successively re-extracted with chloroform, butanol and water. A suppressive compound in the chloroform extract fraction was isolated by SiO2 column chromatography and identified as meso-dihydroguaiaretic acid by GC-MS, and 1H- and 13C-NMR spectroscopy. Meso-dihydroguaiaretic acid inhibited of the SOS-inducing activity of Trp-P-1 in the umu test. Gene expression was suppressed by 62% at less than 0.18 mumol/ml, the ID50 value being 0.08 mumol/ml. Compound 1 was also assayed with aflatoxin B1 (AfB1) and showed a suppressive effect. PMID:9720227

  8. Calculation of a leak in the bottom of a bwr-pressure vessel using THYDE-B1

    International Nuclear Information System (INIS)

    The present report describes the modelling of a boiling water reactor of the Gemeinschaftskraftwerk Tullnerfeld (GKT) plant type. The corresponding input data set for the Japanese computer code THYDE-B1 allows the simulation of the thermohydraulic transient within the reactor coolant system during a loss of coolant accident. The initiating event 'Leak in the Reactor Pressure Vessel Bottom' has been calculated as an application exercise. The results are discussed using graphic representation, where one should be aware that the calculated data do not correspond with any specific plant configuration of the boiling water reactor generic design. 1 ref., 7 figs. (Author)

  9. Relativistic calculations of 3s2 1S0-3s3p 1P1 and 3s2 1S0-3s3p 3P1,2 transition probabilities in the Mg isoelectronic sequence

    Institute of Scientific and Technical Information of China (English)

    Cheng Cheng; Gao Xiang; Qing Bo; Zhang Xiao-Le; Li Jia-Ming

    2011-01-01

    Using the multi-configuration Dirac-Fock self-consistent field method and the relativistic configuration-interaction method, calculations of transition energies, oscillator strengths and rates are performed for the 3s2 1S0-3s3p 1P1 spinallowed transition, 3s2 1S0-3s3p 3P1,2 intercombination and magnetic quadrupole transition in the Mg isoelectronic sequence (Mg Ⅰ, Al Ⅱ, Si ⅢⅢ, P Ⅳ and S Ⅴ). Electron correlations are treated adequately, including intravalence electron correlations. The influence of the Breit interaction on oscillator strengths and transition energies are investigated. Quantum electrodynamics corrections are added as corrections. The calculation results are found to be in good agreement with the experimental data and other theoretical calculations.

  10. Numerical calculations of photoassociation of cold 85Rb2 molecules to the 1g(5P1 / 2) State

    Science.gov (United States)

    Bergeman, Thomas

    2016-05-01

    Data obtained at the University of Connecticut by Jianbing Qi, Dajun Wang, Ye Huang, H. K. Pechkis, E. E. Eyler, P. Gould and W. C. Stwalley in 2003 have been only partially analyzed and assigned. In, transitions observed by Qi et al. to the 0u+ state were presented. Ref. analyzed transitions of 87Rb2 to the 1g(P1 / 2) state, simplified by double spin polarization, observed in the D. Heinzen Laboratory. Transitions to 0g- and 1g levels without double spin polarization are more problematical. This is a preliminary report, based on data obtained by Qi et al. with a dense array of spectral lines, having certain signal:noise limitations. Supported by US NSF.

  11. Subsonic aerodynamic and flutter characteristics of several wings calculated by the SOUSSA P1.1 panel method

    Science.gov (United States)

    Yates, E. C., Jr.; Cunningham, H. J.; Desmarais, R. N.; Silva, W. A.; Drobenko, B.

    1982-01-01

    Several applications of the steady, oscillatory, and unsteady subsonic and supersonic aerodynamics (SOUSSA) computer program to wings with steady and oscillatory motion, including flutter, are discussed. The program employs a generalized Green's function to the full, time-dependent potential-flow equation to obtain an integral equation for the velocity potential at any point in a flow, even points on a body or whole bodies in a flow. Aerodynamic calculations are provided for two rectangular wings, a clipped-tip delta wing, and two swept wings with and without a fuselage. The number and distribution of the finite element panels are varied in order to demonstrate the convergence of the results. The results are shown to be close to those of lifting-surface theory, and further applications with bodies having deformities, arbitrary shapes, motions, and deformations are indicated.

  12. Ab initio calculations of accurate dissociation energy and analytic potential energy function for the second excited state B1П of 7LiH

    Institute of Scientific and Technical Information of China (English)

    Shi De-Heng; Liu Yu-Fang; Sun Jin-Feng; Zhu Zun-Lùe; Yang Xiang-Dong

    2006-01-01

    The reasonable dissociation limit of the second excited singlet state B1П of 7LiH molecule is obtained. The obtained over the internuclear distance ranging from about 0.10 nm to 0.54 nm, and has a least-square fit to the analytic compared with previous theoretical results. The equilibrium internuclear distance obtained by geometry optimization is found to be quite different from that obtained by single-point energy scanning under the same calculation condition.comparison of the theoretical calculations of dissociation energies, equilibrium interatomic distances and the analytic potential energy function with those obtained by previous theoretical results clearly shows that the present work is more theories.

  13. Hopping and band mobilities of pentacene, rubrene, and 2,7-dioctyl[1]benzothieno[3,2-b][1]benzothiophene (C8-BTBT) from first principle calculations

    Science.gov (United States)

    Kobayashi, Hajime; Kobayashi, Norihito; Hosoi, Shizuka; Koshitani, Naoki; Murakami, Daisuke; Shirasawa, Raku; Kudo, Yoshihiro; Hobara, Daisuke; Tokita, Yuichi; Itabashi, Masao

    2013-07-01

    Hopping and band mobilities of holes in organic semiconductors at room temperature were estimated from first principle calculations. Relaxation times of charge carriers were evaluated using the acoustic deformation potential model. It is found that van der Waals interactions play an important role in determining accurate relaxation times. The hopping mobilities of pentacene, rubrene, and 2,7-dioctyl[1]benzothieno[3,2-b][1]benzothiophene (C8-BTBT) in bulk single crystalline structures were found to be smaller than 4 cm2/Vs, whereas the band mobilities were estimated between 36 and 58 cm2/Vs, which are close to the maximum reported experimental values. This strongly suggests that band conductivity is dominant in these materials even at room temperature.

  14. Ab-initio calculation of the 2s21S0-2s3p 3P1 intercombination transition in beryllium-like ions

    International Nuclear Information System (INIS)

    Transition probabilities of the 2s21S0-2s3p 1,3P1 intercombination and resonance lines have been calculated for 14 beryllium-like ions in the atomic range 7 ≤ Z ≤ 36. We used multiconfiguration Dirac-Fock wave functions to explore the effects of configuration interaction, of electron rearrangement as well as of relativity in a consistent scheme along the isoelectronic sequence. To show the number of configurations needed in a proper expansion of the wave functions we systematically enlarged the basis from small to large-scale. For the low-Z elements, virtual excitations of the 2s and 3p electrons up to the 5l subshells contribute significantly to the intercombination probability even though the transition energies remain almost unaffected by excitations beyond the 3l shells. The incomplete orthogonality of the orbital functions due to the rearrangement of the electron density clearly shifts the intercombination rates and appears to be independent of the configuration expansion. This effect decreases, as expected, at higher nuclear charges. (orig.)

  15. Large-scale relativistic configuration-interaction calculation of the 2s21S0--2s2p 3P1 intercombination transition in C III

    International Nuclear Information System (INIS)

    A large-scale, relativistic configuration-interaction (RCI) method has been developed for precision calculations of transition oscillator strengths. It is based on the no-pair Hamiltonian and employs finite B-spline basis functions. For the 2s21S0--2s2p 3P1 intercombination transition in berylliumlike carbon, the present RCI expansions reach close to 200 000 configurations, and include all single and double excitations from valence-valence, core-valence, and core-core interactions, along with dominant triple and quadruple excitations. Resulting length- and velocity-gauge transition rates are very well converged, but still differ by a factor of 2. This strong gauge dependence is found to arise from the neglect of negative-energy states which has negligible effects on length-gauge results but can affect velocity-gauge results significantly. The present intercombination transition rate for C III of 101.6±0.7 sec-1 differs from the measured value of 102.94±0.14 sec-1 [Doerfert , Phys. Rev. Lett. 78, 4355 (1997)] by about 1.3%

  16. B1 Aerogels

    DEFF Research Database (Denmark)

    Duer, Karsten; Svendsen, Sv Aa Højgaard

    1996-01-01

    DGU that was developped during the project. B12 and B14 have measured the g-value and the U-value respectively of the aerogel DGU.Furthermore calculations of the energy saving potential by using aerogel windows in selected residential and commercial buildings under different climatic conditions were...... carried out as part of the A2/A3 project.The B1 Aerogel project has been carried out with partition of the following nations: Denmark, Finland, France, Germany, Japan, Norway, Sweden and the United Kingdom....

  17. Multiconfigurational-Dirac-Fock calculation of the 2s21S0--2s2p 3P1 spin-forbidden transition for the Be-like isoelectronic sequence

    International Nuclear Information System (INIS)

    Accurate ab initio multiconfigurational-Dirac-Fock (MCDF) calculations of the lifetimes of the spin-forbidden 2s21S0--2s2p 3P1 transition and the allowed 2s21S0--2s2p 1P1 transition in Be-like ions have been performed. The importance of the inclusion of the Breit interaction to obtain accurate fine-structure splittings and mixing coefficients is discussed and the noted discrepancy between the length and velocity gauges for the intercombination line in the lighter ions is addressed. Different optimization procedures are evaluated. For C III the experimental intercombination transition rate has been measured to be 121.9 s-1 with an accuracy of 6%. The current calculation gives 100.3±4 s-1, in agreement with other recent calculations

  18. Vitamin B1

    Science.gov (United States)

    ... Prize Alfred Nobel's Life and Work Teachers' Questionnaire Vitamin B1 - About The Chicken Farm educational game and ... the game window. Reading: "Christian Eijkman, Beriberi and Vitamin B1" - Who was Eijkman and why did he ...

  19. Calculations of 2s2S1/2-2p2P1/2,3/2 Transition Energies for Lithium-Like Systems from Na Ⅸ to Ca ⅩⅤⅢ

    Institute of Scientific and Technical Information of China (English)

    陈超; 王治文

    2002-01-01

    The transition energies (2s2S1/2 - 2p2P1/2,s/2) of lithium-like systems with nuclear charge from Z = 11-20are calculated by using a full-core pins correlation method. Relativistic and mass-polarization effects on theenergies are included as the first-order perturbation corrections. The quantum-electrodynamics contributions tothe transition energy are evaluated by using effective nuclear charge. Our results are in excellent agreement withprevious theoretical and experimental data available in the literature.

  20. Ab initio calculation on accurate analytic potential energy functions and harmonic frequencies of c3∑+g and B1∏u states of dimer 7Li2

    Institute of Scientific and Technical Information of China (English)

    Yu Ben-Hai; Shi De-Heng; Sun Jin-Feng; Zhu Zun-Lue; Liu Yu-Fang; Yang Xiang-Dong

    2007-01-01

    The comparison between single-point energy scanning (SPES) and geometry optimization (OPT) in determining the equilibrium geometries of c3∑+g and B1∏u states of dimer 7Li2 is made at numerous basis sets by using a symmetryadapted-cluster configuration-interaction (SAC-CI) method in the Gaussian 03 program package. In this paper the difference of the equilibrium geometries obtained by SPES and by OPT is reported. The results obtained by SPES are found to be more reasonable than those obtained by OPT in full active space at the present SAC-CI level of theory. And the conclusion is attained that the cc-PVTZ is a most suitable basis set for these states. The calculated dissociation energies and equilibrium geometries are 0.8818 eV and 0.3090 nm for c3∑+g state, and 0.3668 eV and 0.2932 nm for B1∏u state respectively. The potential energy curves are calculated over a wide internuclear distance range from about 2.5a0 to 37a0 and have a least-squares fit into the Murrell-Sorbie function. According to the calculated analytic potential energy functions, the harmonic frequencies (ωe) and other spectroscopic data (ωeχe, Be and αe) are calculated. Comparison of the theoretical determinations at present work with the experiments and other theories clearly shows that the present work is the most complete effort and thus represents an improvement over previous theoretical results.

  1. QED calculation of the 2p1/2-2s and 2p3/2-2s transition energies and the ground-state hyperfine splitting in lithiumlike scandium

    CERN Document Server

    Kozhedub, Y S; Artemiev, A N; Oreshkina, N S; Shabaev, V M; Tupitsyn, I I; Volotka, A V; Plunien, G

    2007-01-01

    We present the most accurate up-to-date theoretical values of the ${2p_{1/2}}$-${2s}$ and ${2p_{3/2}}$-${2s}$ transition energies and the ground-state hyperfine splitting in ${\\rm Sc}^{18+}$. All two- and three-electron contributions to the energy values up to the two-photon level are treated in the framework of bound-state QED without $\\aZ$-expansion. The interelectronic interaction beyond the two-photon level is taken into account by means of the large-scale configuration-interaction Dirac-Fock-Sturm (CI-DFS) method. The relativistic recoil correction is calculated with many-electron wave functions in order to take into account the electron-correlation effect. The accuracy of the transition energy values is improved by a factor of five compared to the previous calculations. The CI-DFS calculation of interelectronic-interaction effects and the evaluation of the QED correction in an effective screening potential provide significant improvement for the $2s$ hyperfine splitting. The results obtained are in a go...

  2. Gromov-Witten Theory of P^1xP^1xP^1

    OpenAIRE

    Karp, Dagan; Ranganathan, Dhruv

    2012-01-01

    We use elementary geometric techniques to exhibit an explicit equivalence between certain sectors of the Gromov-Witten theories of blowups of P^1xP^1xP^1 and P^3. In particular, we prove that the all genus, virtual dimension zero Gromov-Witten theory of the blowup of P^3 at points coincides with that of the blowup at points of P^1xP^1xP^1, for non-exceptional classes. We observe a toric symmetry of the Gromov-Witten theory of P^1xP^1xP^1 analogous and intimately related to Cremona symmetry of...

  3. aflatoxina b1

    Directory of Open Access Journals (Sweden)

    A. Valdivia

    2004-01-01

    Full Text Available Con el objetivo de probar que la suplementación dietética de ácido elágico (AE o N-Acetilcisteína (NAC en pollos de engorda, atenúa los efectos de una intoxicación aguda por la aflatoxina B1 (AFB1, se intoxicaron con AFB1 pura, tres grupos de diez pollos cada uno (3.0 mb/kg pc, IP. Otros tres grupos recibieron solamente el vehículo (aceite de maíz 2.0 ml/kg pc, IP. Cuatro días antes se administró un alimento testigo, o bien, la misma dieta adicionada con AE (2.5 g/kg o NAC (200 mg/kg pc/6 h. A las 24 horas de la administración de AFB1, se cuantificaron las concentraciones hepáticas de glutatión (GSH, de actividad enzimática específica de la transferasa de glutatión (GST, alanina aminotransferasa, aspartato aminotransferasa y de proteínas hepáticas totales. Los resultados mostraron que NAC atenúa el impacto negativo de la AFB1 sobre el crecimiento corporal y al igual que AE, incrementa la GST y revierte parcialmente los efectos de AFB1 sobre GSH, lo cual sugiere que ambas sustancias pudieran conferir un efecto protector de las aves

  4. Gromov-Witten Theory of P^1\\timesP^1\\timesP^1

    CERN Document Server

    Karp, Dagan

    2012-01-01

    We prove equivalences between the Gromov-Witten theories of four blowups of P1\\timesP1\\timesP1 and P3. In particular, we prove that the all genus, virtual dimension zero Gromov-Witten theory of the blowup of P3 at points precisely coincides with that of the blowup at points of P1 \\times P1 \\times P1, for non-exceptional classes. It follows that the all-genus stationary Gromov-Witten theory of P1 \\times P1 \\times P1 coincides with that of P3 in low degree. We also prove there exists a toric symmetry of the Gromov-Witten theory of P1\\timesP1\\timesP1 analogous to and intimately related to Cremona symmetry of P3. Enumerative applications are given.

  5. Doubly excited 2s2p 1,3p1 resonances in photoionization of helium

    Institute of Scientific and Technical Information of China (English)

    Wan Jian-Jie; Dong Chen-Zhong

    2009-01-01

    The multi-configuration Dirac-Fock (MCDF) method is implemented to study doubly excited 2s2p 1,3P1 resonances of the helium atom and the interference between photoionization and photoexcitation autoionization processes.In order to reproduce the total photoionization sprectra,the excited energies from the ground ls2 1 S0 state to the doubly excited 2s2p 1'3P1 states and the relevant Auger decay rates and widths are calculated in detail. Furthermore,the interference profile determined by the so-called Fano parameters q and p2 is also reproduced. Good agreement is found between the present results and other available theoretical and experimental results. This indeed shows a promising way to investigate the Fano resonances in photoionization of atoms within the MCDF scheme,although there are some discrepancies in the present calculations of the 2s2p 3P1 state.

  6. Reference: P1BS [PLACE

    Lifescience Database Archive (English)

    Full Text Available P1BS Schunmann PH, Richardson AE, Smith FW, Delhaize E. Characterization of promoter expre...ssion patterns derived from the Pht1 phosphate transporter genes of barley (Hordeum vulgare L.). J Exp Bot. 55: 855-865. (2004) PubMed: 15020637 ...

  7. KENO, Multigroup P1 Scattering Monte-Carlo Transport Calculation for Criticality, Keff, Flux in 3-D. KENO-5, SCALE-1 Module with Pn Scattering, Super-grouping, Diffusion Albedo Reflection

    International Nuclear Information System (INIS)

    1 - Description of problem or function: KENO is a multigroup, Monte Carlo criticality code containing a special geometry package which allows easy description of systems composed of cylinders, spheres, and cuboids (rectangular parallelepipeds) arranged in any order with only one restriction. They cannot be rotated or translated. Each geometrical region must be described as completely enclosing all regions interior to it. For systems not describable using this special geometry package, the program can use the generalized geometry package (GEOM) developed for the O5R Monte Carlo code. It allows any system that can be described by a collection of planes and/or quadratic surfaces, arbitrarily oriented and intersecting in arbitrary fashion. The entire problem can be mocked up in generalized geometry, or one generalized geometry unit or box type can be used alone or in combination with standard KENO units or box types. Rectangular arrays of fissile units are allowed with or without external reflector regions. Output from KENO consists of keff for the system plus an estimate of its standard deviation and the leakage, absorption, and fissions for each energy group plus the totals for all groups. Flux as a function of energy group and region and fission densities as a function of region are optional output. KENO-4: Added features include a neutron balance edit, PICTURE routines to check the input geometry, and a random number sequencing subroutine written in FORTRAN-4. 2 - Method of solution: The scattering treatment used in KENO assumes that the differential neutron scattering cross section can be represented by a P1 Legendre polynomial. Absorption of neutrons in KENO is not allowed. Instead, at each collision point of a neutron tracking history the weight of the neutron is reduced by the absorption probability. When the neutron weight has been reduced below a specified point for the region in which the collision occurs, Russian roulette is played to determine if the

  8. On the Hilbert functions of sets of points in P^1 x P^1 x P^1

    OpenAIRE

    Guardo, Elena; Van Tuyl, Adam

    2014-01-01

    Let H_X be the trigraded Hilbert function of a set X of reduced points in P^1 x P^1 x P^1. We show how to extract some geometric information about X from H_X. This note generalizes a similar result of Giuffrida, Maggioni, and Ragusa about sets of points in P^1 x P^1.

  9. On Products of Property b1

    Institute of Scientific and Technical Information of China (English)

    Jianjun WANG; Peiyong ZHU

    2012-01-01

    In this note,we present that:(1) Let X=σ{Xα:α ∈ A} be |A|-paracompact (resp.,hereditarily |A|-paracompact).If every finite subproduct of {Xα:α ∈ A} has property b1 (resp.,hereditarily property b1),then so is X.(2) Let X be a P-space and Y a metric space.Then,X × Y has property b1 iff X has property b1.(3) Let X be a strongly zero-dimensional and compact space.Then,X × Y has property b1 iff Y has property b1.

  10. Formation of deeply bound ultracold Sr_2 molecules by photoassociation near the ^1S + ^3P_1 intercombination line

    OpenAIRE

    Skomorowski, Wojciech; Moszynski, Robert; Koch, Christiane P.

    2012-01-01

    We predict feasibility of the photoassociative formation of Sr_2 molecules in arbitrary vibrational levels of the electronic ground state based on state-of-the-art ab initio calculations. Key is the strong spin-orbit interaction between the c^3\\Pi_u, A^1\\Sigma_u^+ and B^1\\Sigma_u^+ states. It creates not only an effective dipole moment allowing free-to-bound transitions near the ^1S + ^3P_1 intercombination line but also facilitates bound-to-bound transitions via resonantly coupled excited st...

  11. Cyclin B1 Vaccine Delays Spontaneous Tumors

    Science.gov (United States)

    Laura A, Vella; Min, Yu; Amy, Phillips; Olivera J, Finn

    2012-01-01

    We previously identified cyclin B1-specific T cells and antibodies in cancer patients with cyclin B1+ tumors and also in some healthy individuals. We also demonstrated that these responses may be important in cancer immunosurveillance by showing that vaccination against cyclin B1 prevents growth of transplantable cyclin B1+ tumors in mice. Constitutive overexpression of cyclin B1 was determined to correlate with the lack of p53 function. This allowed us to use p53−/− mice as a model that better approximates human disease. p53−/− mice spontaneously develop cyclin B1+ tumors. At 5–6 weeks of age, when the mice were still healthy with no evidence of tumor, they received the cyclin B1 vaccine and were then observed for tumor growth. We demonstrate that cyclin B1 vaccination can delay spontaneous cyclin B1+ tumor growth and increases median survival of tumor bearing p53−/− mice. PMID:19769738

  12. 2D supergravity in p+1 dimensions

    OpenAIRE

    Gustafsson, H.; Lindstrom, U.

    1998-01-01

    We describe new $N$-extended 2D supergravities on a $(p+1)$-dimensional (bosonic) space. The fundamental objects are moving frame densities that equip each $(p+1)$-dimensional point with a 2D ``tangent space''. The theory is presented in a $[p+1, 2]$ superspace. For the special case of $p=1$ we recover the 2D supergravities in an unusual form. The formalism has been developed with applications to the string-parton picture of $D$-branes at strong coupling in mind.

  13. Quantum Cohomology of Hilb^2(P^1xP^1) and Enumerative Applications

    OpenAIRE

    Pontoni, Dalide

    2004-01-01

    We compute the Small Quantum Cohomology of Hilb^2(P^1xP^1) and determine recursively most of the Big Quantum Cohomology. We prove a relationship between the invariants so obtained and the enumerative geometry of hyperelliptic curves in P^1xP^1. This extends the results obtained by Graber for Hilb^2(P^2) and hyperelliptic curves in P^2.

  14. Fungal degradation of aflatoxin B1.

    Science.gov (United States)

    Shantha, T

    1999-01-01

    A number of fungal cultures were screened to select an organism suitable to be used in the detoxification of aflatoxin B1. They were co-cultured in Czapek-Dox-Casamino acid medium with aflatoxin B1 producing Aspergillus flavus. Several fungal cultures were found to prevent synthesis of aflatoxin B1 in liquid culture medium. Among these Phoma sp., Mucor sp., Trichoderma harzianum, Trichoderma sp. 639, Rhizopus sp. 663, Rhizopus sp. 710, Rhizopus sp. 668, Alternaria sp. and some strains belonging to the Sporotrichum group (ADA IV B14(a), ADA SF VI BF (9), strain 720) could inhibit aflatoxin synthesis by > or =90%. A few fungi, namely ADA IV B1, ADA F1, ADA F8, also belonging to the Sporotrichum group, were less efficient than the Phoma sp. The Cladosporium sp. and A. terreus sp. were by far the least efficient, registering aflatoxin biosynthesis are also capable of degrading the preformed toxin. Among these, Phoma sp. was the most efficient destroying about 99% of aflatoxin B1. The cell free extract of Phoma sp. destroyed nearly 50 microg aflatoxin B1 100 ml(-1) culture medium (90% of the added toxin), and this was more effective than its own culture filtrate over 5 days incubation at 28+/-2 degrees C. The degradation was gradual: 35% at 24 h, 58% at 48 h, 65% at 72 h, 85% at 96 h and 90% at 120 h. The possibility of a heat stable enzymatic activity in the cell free extract of Phoma is proposed. PMID:10945479

  15. Observation of B-meson decays to b_1 pi and b_1 K

    CERN Document Server

    Aubert, B; Boutigny, D; Karyotakis, Yu; Lees, J P; Poireau, V; Prudent, X; Tisserand, V; Zghiche, A; Garra Tico, J; Graugès-Pous, E; López, L; Palano, A; Pappagallo, M; Eigen, G; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Button-Shafer, J; Cahn, R N; Groysman, Y; Jacobsen, R G; Kadyk, J A; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lopes-Pegna, D; Lynch, G; Mir, L M; Orimoto, T J; Osipenkov, I L; Ronan, M T; Tackmann, K; Tanabé, T; Wenzel, W A; Del Amo-Sánchez, P; Hawkes, C M; Watson, A T; Held, T; Koch, H; Pelizaeus, M; Schröder, T; Steinke, M; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Khan, A; Saleem, M; Teodorescu, L; Blinov, V E; Bukin, A D; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Foulkes, S D; Gary, J W; Liu, F; Long, O; Shen, B C; Zhang, L; Paar, H P; Rahatlou, S; Sharma, V; Berryhill, J W; Campagnari, C; Cunha, A; Dahmes, B; Hong, T M; Kovalskyi, D; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Wilson, M G; Winstrom, L O; Chen, E; Cheng, C H; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Chen, S; Ford, W T; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Olivas, A; Smith, J G; Ulmer, K A; Wagner, S R; Zhang, J; Gabareen, A M; Soffer, A; Toki, W H; Wilson, R J; Winklmeier, F; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Klose, V; Kobel, M J; Lacker, H M; Mader, W F; Nogowski, R; Schubert, J; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Lombardo, V; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Muheim, F; Playfer, S; Robertson, A I; Watson, J E; Xie, Y; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Prencipe, E; Santoro, V; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzo, A; Contri, R; Lo Vetere, M; Macri, M M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Santroni, A; Tosi, S; Chaisanguanthum, K S; Morii, M; Wu, J; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Bard, D J; Dauncey, P D; Flack, R L; Nash, J A; Panduro-Vazquez, W; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Ziegler, V; Cochran, J; Crawley, H B; Dong, L; Eyges, V; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bequilleux, J; D'Orazio, A; Davier, M; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Rodier, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wang, W F; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Burke, J P; Chavez, C A; Forster, I J; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Schofield, K C; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Menges, W; Sacco, R; Cowan, G; Flächer, H U; Hopkins, D A; Paramesvaran, S; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Allison, J; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Blaylock, G; Dallapiccola, C; Hertzbach, S S; Li, X; Moore, T B; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Koeneke, K; Sciolla, G; Sekula, S J; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Zheng, Y; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaro, A; Palombo, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Brunet, S; Côté, D; Simard, M; Taras, P; Viaud, F B; Nicholson, H; De Nardo, Gallieno; Fabozzi, F; Lista, L; Monorchio, D; Sciacca, C; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; Knoepfel, K J; LoSecco, J M; Benelli, G; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Gagliardi, N; Gaz, A; Margoni, M; Morandin, M; Pompili, A; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Ben-Haim, E; Briand, H; Calderini, G; Chauveau, J; David, P; Del Buono, L; De La Vaissière, C; Hamon, O; Leruste, P; Malcles, J; Ocariz, J; Pérez, A; Prendki, J; Gladney, L; Biasini, M; Covarelli, R; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Carpinelli, M; Cenci, R; Cervelli, A; Forti, F

    2007-01-01

    We present the results of searches for decays of B mesons to final states with a b_1 meson and a charged pion or kaon. The data, collected with the BaBar detector at the Stanford Linear Accelerator Center, represent 382 million B-Bbar pairs produced in e+e- annihilation. The results for the branching fractions are, in units of 10^{-6}, B(B+ -> b1^0 pi+) = 6.7 +/- 1.7 +/- 1.0 (4.0 sigma), B(B+ -> b1^0 K+ = 9.1+/- 1.7+/- 1.0 (5.3 sigma), B(B0 -> b1^-/+ pi^+/-) = 10.9 +/- 1.2 +/- 0.9 (8.9 sigma), and B(B0 -> b1^-K+) = 7.4 +/- 1.0 +/- 1.0 (6.1 sigma), with the assumption that B(b_1 -> omega pi)=1. We also measure charge and flavor asymmetries Ach(B+ -> b1^0 pi+) = 0.05 +/- 0.16 +/- 0.02, Ach(B+ -> b1^0 K+ = -0.46 +/- 0.20 +/- 0.02, Ach(B0 -> b1^-/+ pi^+/-) = -0.05 +/- 0.10 +/- 0.02, C(B0 -> b1^-/+ pi^+/-) = -0.22 +/- 0.23 +/- 0.05, deltaC(B0 -> b1^-/+ pi^+/-) = -1.04 +/- 0.23 +/- 0.08, and Ach(B0 -> b1^-K+) = -0.07 +/- 0.12 +/- 0.02, The first error quoted is statistical, the second systematic, and for the branch...

  16. Calorons, Nahm's equations on S^1 and bundles over P^1xP^1

    OpenAIRE

    Charbonneau, Benoit; Hurtubise, Jacques

    2006-01-01

    The moduli space of solutions to Nahm's equations of rank (k,k+j) on the circle, and hence, of SU(2) calorons of charge (k,j), is shown to be equivalent to the moduli of holomorphic rank 2 bundles on P^1xP^1 trivialized at infinity with c_2=k and equipped with a flag of degree j along P^1x{0}. An explicit matrix description of these spaces is given by a monad construction

  17. Arithmetically Cohen-Macaulay sets of points in P^1 x P^1

    CERN Document Server

    Guardo, Elena

    2015-01-01

    This brief presents a solution to the interpolation problem for arithmetically Cohen-Macaulay (ACM) sets of points in the multiprojective space P^1 x P^1.  It collects the various current threads in the literature on this topic with the aim of providing a self-contained, unified introduction while also advancing some new ideas.  The relevant constructions related to multiprojective spaces are reviewed first, followed by the basic properties of points in P^1 x P^1, the bigraded Hilbert function, and ACM sets of points.  The authors then show how, using a combinatorial description of ACM points in P^1 x P^1, the bigraded Hilbert function can be computed and, as a result, solve the interpolation problem.  In subsequent chapters, they consider fat points and double points in P^1 x P^1 and demonstrate how to use their results to answer questions and problems of interest in commutative algebra.  Throughout the book, chapters end with a brief historical overview, citations of related results, and, where relevan...

  18. 维生素B1

    Institute of Scientific and Technical Information of China (English)

    郭俊生

    2007-01-01

    维生素B1又称硫胺素(thiamine)、抗脚气病因子、抗神经炎因子等,是维生素中发现最早的一种。早在公元前2697年,我国医书《内经》曾对脚气病进行过详细的论述,但发现维生素B1是一种必需的营养物质是在19世纪末和20世纪初。1897年,荷兰内科医生Eijkman发现脚气病是由于食精白米所致,用米糠或糙米可防治此病。1911年,Funk在伦敦Lister研究所从米糠中提取到这种治疗脚气病的物质,因为具有胺的性质,因此称之为“生命胺”,

  19. Radiative transition probabilities for the B 1PI - X 1SIGMA+ and B 1PI - A 1SIGMA+ of 7LiH

    International Nuclear Information System (INIS)

    The recently reported (J. Chem. Phys. 66, 5412 (1977)) hybrid potential curves for the X 1Σ+ and A 1Σ+ states of LiH and the herein reported hybrid potential curve for the B 1Pi state of LiH are combined with the ab initio transition moments of Docken and Hinze (J. Chem. Phys. 57, 4936 (1972)) to calculate radiative transition probabilities between all B 1Pi (v' less than or equal to 2) and all X 1Σ+ (v'' less than or equal to 23) and A 1Σ+ (v'' less than or equal to 26) vibrational levels of 7LiH. The strongest single emission band found is the B 1Pi (v' = 2) → X 1Σ+ (v'' = 23) band between the highest ''long-range'' levels in each potential. For all B 1Pi levels, the emission is dominated by B → X rather than B → A emission

  20. Separators of Arithmetically Cohen-Macaulay fat points in P^1 x P^1

    CERN Document Server

    Guardo, Elena

    2010-01-01

    Let Z be a set of fat points in P^1 x P^1 that is also arithmetically Cohen-Macaulay (ACM). We describe how to compute the degree of a separator of a fat point of multiplicity m for each point in the support of Z using only a numerical description of Z. Our formula extends the case of reduced points which was previously known.

  1. 118-B-1 excavation treatability test procedures

    International Nuclear Information System (INIS)

    This treatability study has two purposes: to support development of the approach to be used for burial ground remediation, and to provide specific engineering information for the design of burial grounds receiving waste generated from the 100 Area removal actions. Data generated from this test will also provide performance and cost information necessary for detailed analysis of alternatives for burial ground remediation. Further details on the test requirements, milestones and data quality objectives are described in detail in the 118-B-1 Excavation Treatability Test Plan (DOE/RL-94-43). These working procedures are intended for use by field personnel to implement the requirements of the milestone. A copy of the detailed Test Plan will be kept on file at the on-site field support trailer, and will be available for review by field personnel

  2. 118-B-1 excavation treatability test procedures

    Energy Technology Data Exchange (ETDEWEB)

    Frain, J.M.

    1994-08-01

    This treatability study has two purposes: to support development of the approach to be used for burial ground remediation, and to provide specific engineering information for the design of burial grounds receiving waste generated from the 100 Area removal actions. Data generated from this test will also provide performance and cost information necessary for detailed analysis of alternatives for burial ground remediation. Further details on the test requirements, milestones and data quality objectives are described in detail in the 118-B-1 Excavation Treatability Test Plan (DOE/RL-94-43). These working procedures are intended for use by field personnel to implement the requirements of the milestone. A copy of the detailed Test Plan will be kept on file at the on-site field support trailer, and will be available for review by field personnel.

  3. Syntheses and Bioactivity of 4"-Sulfonate-5-triphenylsilyl Avermectin B1a and Ivermectin B1a Derivatives

    Institute of Scientific and Technical Information of China (English)

    LIAO Lian-an; FANG Hong-yun; LI Zheng-ming; ZHAO Wei-guang; FAN Zhi-jin

    2004-01-01

    Fourteen new derivatives of avermectin B1a and ivermectin B1a were synthesized from C5-O-triphenylsilyl avermectin B1a and ivermectin B1a(yield from 40% to 83%). Their chemical structures were characterized by means of IR, 1H NMR, 13C NMR and FAB-MS spectrometries. Some of them show excellent insecticidal activity.

  4. Vitamin B1 (thiamine) and dementia.

    Science.gov (United States)

    Gibson, Gary E; Hirsch, Joseph A; Fonzetti, Pasquale; Jordan, Barry D; Cirio, Rosanna T; Elder, Jessica

    2016-03-01

    The earliest and perhaps best example of an interaction between nutrition and dementia is related to thiamine (vitamin B1). Throughout the last century, research showed that thiamine deficiency is associated with neurological problems, including cognitive deficits and encephalopathy. Multiple similarities exist between classical thiamine deficiency and Alzheimer's disease (AD) in that both are associated with cognitive deficits and reductions in brain glucose metabolism. Thiamine-dependent enzymes are critical components of glucose metabolism that are reduced in the brains of AD patients and by thiamine decline, and a decrease in their levels could account for the reduction in glucose metabolism. In preclinical models, reduced thiamine can drive AD-like abnormalities, including memory deficits, neuritic plaques, and hyperphosphorylation of tau. Furthermore, excess thiamine diminishes AD-like pathologies. In addition to dietary deficits, drugs or other manipulations that interfere with thiamine absorption can cause thiamine deficiency. Elucidating the reasons why the brains of AD patients are functionally thiamine deficient and determining the effects of thiamine restoration may provide critical information to help treat patients with AD. PMID:26971083

  5. Isolation and characterization of P1 minireplicons, lambda-P1:5R and lambda-P1:5L.

    OpenAIRE

    Sternberg, N; Austin, S

    1983-01-01

    We have isolated two new classes of P1 miniplasmids, called lambda-P1:5R and lambda-P1:5L, by the in vivo extension of a cloned P1 fragment, EcoRI-5, which by itself is not capable of plasmid replication. The lambda-P1:5R plasmids contain EcoRI-5 plus a variable portion of the adjacent P1 EcoRI fragment 8. They have a copy number like that of P1 (about 1 per host chromosome), are faithfully segregated at cell division, and are subject to incompatibility exerted by either a single copy of P1 o...

  6. Globally generated vector bundles on $\\mathbf{P}^1 \\times \\mathbf{P}^1 \\times \\mathbf{P}^1$ with low first Chern classes

    OpenAIRE

    Ballico, Edoardo; Huh, Sukmoon; Malaspina, Francesco

    2015-01-01

    We classify globally generated vector bundles on $\\mathbf{P}^1 \\times \\mathbf{P}^1 \\times \\mathbf{P}^1$ with small first Chern class, i.e. $c_1= (a_1, a_2, a_3)$, $a_i \\le 2$. Our main method is to investigate the associated smooth curves to globally generated vector bundles via the Hartshorne-Serre correspondence.

  7. Genome Sequences of Three Pseudoalteromonas Strains (P1-8, P1-11, and P1-30), Isolated from the Marine Hydroid Hydractinia echinata

    OpenAIRE

    Klassen, Jonathan L; Rischer, Maja; Wolf, Thomas; Guo, Huijuan; Shelest, Ekaterina; Clardy, Jon; Beemelmanns, Christine

    2015-01-01

    The genomes of three Pseudoalteromonas strains (P1-8, P1-11, and P1-30) were sequenced and assembled. These genomes will inform future study of the genes responsible for the production of biologically active compounds responsible for these strains’ antimicrobial, biofouling, and algicidal activities.

  8. Synthesis of 5-Deoxy-5-Acyloxyiminoavermectin B1 Derivatives

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Four 5-deoxy-5-acyloxyiminoavermectin B1 derivatives 4a~d were synthesized via three steps from avermectin B1 and their biological activities were tested against Heliothis armigera,Laphygma exigua and Musca domestica.

  9. Draft Genome Sequences of Six Pseudoalteromonas Strains, P1-7a, P1-9, P1-13-1a, P1-16-1b, P1-25, and P1-26, Which Induce Larval Settlement and Metamorphosis in Hydractinia echinata

    OpenAIRE

    Klassen, Jonathan L; Wolf, Thomas; Rischer, Maja; Guo, Huijuan; Shelest, Ekaterina; Clardy, Jon; Beemelmanns, Christine

    2015-01-01

    To gain a broader understanding of the importance of a surface-associated lifestyle and morphogenic capability, we have assembled and annotated the genome sequences of Pseudoalteromonas strains P1-7a, P1-9, P1-13-1a, P1-16-1b, P1-25, and P1-26, isolated from Hydractinia echinata. These genomes will allow detailed studies on bacterial factors mediating interkingdom communication.

  10. Compound list: aflatoxin B1 [Open TG-GATEs

    Lifescience Database Archive (English)

    Full Text Available aflatoxin B1 AFB1 00165 ftp://ftp.biosciencedbc.jp/archive/open-tggates/LATEST/Human/in_vitro/aflat...oxin_B1.Human.in_vitro.Liver.zip ftp://ftp.biosciencedbc.jp/archive/open-tggates/LATEST/Rat/in_vivo/Liver/Single/aflatoxin_B1.Rat.in_vivo.Liver.Single.zip ...

  11. 26 CFR 48.4061(b)-1 - Imposition of tax.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Imposition of tax. 48.4061(b)-1 Section 48.4061(b)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS... Taxable Fuel Automotive and Related Items § 48.4061(b)-1 Imposition of tax. (a) In general. Section...

  12. Mycoplasma pneumoniae P1 Type 1- and Type 2-Specific Sequences within the P1 Cytadhesin Gene of Individual Strains

    OpenAIRE

    Dorigo-Zetsma, J. Wendelien; Wilbrink, Berry; Dankert, Jacob; Zaat, Sebastian A.J.

    2001-01-01

    Mycoplasma pneumoniae strains traditionally are divided into two types, based on sequence variation in the P1 gene. Recently, however, we have identified 8 P1 subtypes by restriction fragment length polymorphism analysis. In the present study the P1 gene sequences of three P1 type 1 and two P1 type 2 M. pneumoniae strains were analyzed. A new P1 gene sequence in a type 1 strain with partial similarity to a recently reported variable region in the P1 gene of an M. pneumoniae type 2 strain (T. ...

  13. Aflatoxin B1: Mechanism of mutagenesis

    Directory of Open Access Journals (Sweden)

    Regina M. Santella

    2007-02-01

    Full Text Available

    Aflatoxins are a group of toxic and carcinogenic fungal metabolites that frequently contaminate corn, peanuts and other products. Aflatoxin B1 (AFB1, the most potent of these, is metabolized by the cytochrome P450 system into a number of hydroxylated metabolites and glutathione conjugates in the process of conversion to more hydrophilic forms for urinary excretion. Unfortunately, one of these metabolites is the aflatoxin-8,9-epoxide that is produced in two forms, endo and exo. Glutathione S-transferases (GST are able to conjugate and detoxify this reactive intermediate. Species differences in susceptibility to the effects of AFB1 are partially related to differences in expression of specific GSTs that are able to conjugate the epoxide to glutathione. The exo epoxide is able to intercalate into DNA and this is followed by reaction of the C8 position of the epoxide with the N7 position of guanine.

    NMR studies of oligonucleotide duplexes containing the adduct have demonstrated that the adduct exists with the aromatic portion intercalated on the 5' face of the guanine residue with Watson-Crick base pairing maintained.

    However, this covalent adduct is chemically unstable due to the charge on the ribose ring. As a result, the guanine can be released from the DNA leaving an apurinic site. This released guanine adduct can be detected in the urine and serves as a biomarker of exposure to AFB1. Alternatively, the ribose ring opens forming a stable formamidopyrimidine (FAPY adduct. This adduct somewhat stabilizes the DNA duplex. Time course studies in animals have demonstrated that the N7 adduct is rapidly removed, probably because it causes more distortion in the helix, while the FAPY adduct is more

  14. Search for B-meson decays to b1ρ and b1K*

    Science.gov (United States)

    Aubert, B.; Karyotakis, Y.; Lees, J. P.; Poireau, V.; Prencipe, E.; Prudent, X.; Tisserand, V.; Garra Tico, J.; Grauges, E.; Martinelli, M.; Palano, A.; Pappagallo, M.; Eigen, G.; Stugu, B.; Sun, L.; Battaglia, M.; Brown, D. N.; Hooberman, B.; Kerth, L. T.; Kolomensky, Yu. G.; Lynch, G.; Osipenkov, I. L.; Tackmann, K.; Tanabe, T.; Hawkes, C. M.; Soni, N.; Watson, A. T.; Koch, H.; Schroeder, T.; Asgeirsson, D. J.; Hearty, C.; Mattison, T. S.; McKenna, J. A.; Barrett, M.; Khan, A.; Randle-Conde, A.; Blinov, V. E.; Bukin, A. D.; Buzykaev, A. R.; Druzhinin, V. P.; Golubev, V. B.; Onuchin, A. P.; Serednyakov, S. I.; Skovpen, Yu. I.; Solodov, E. P.; Todyshev, K. Yu.; Bondioli, M.; Curry, S.; Eschrich, I.; Kirkby, D.; Lankford, A. J.; Lund, P.; Mandelkern, M.; Martin, E. C.; Stoker, D. P.; Atmacan, H.; Gary, J. W.; Liu, F.; Long, O.; Vitug, G. M.; Yasin, Z.; Sharma, V.; Campagnari, C.; Hong, T. M.; Kovalskyi, D.; Mazur, M. A.; Richman, J. D.; Beck, T. W.; Eisner, A. M.; Heusch, C. A.; Kroseberg, J.; Lockman, W. S.; Martinez, A. J.; Schalk, T.; Schumm, B. A.; Seiden, A.; Wang, L.; Winstrom, L. O.; Cheng, C. H.; Doll, D. A.; Echenard, B.; Fang, F.; Hitlin, D. G.; Narsky, I.; Ongmongkolkul, P.; Piatenko, T.; Porter, F. C.; Andreassen, R.; Mancinelli, G.; Meadows, B. T.; Mishra, K.; Sokoloff, M. D.; Bloom, P. C.; Chavez, A.; Ford, W. T.; Gaz, A.; Hirschauer, J. F.; Nagel, M.; Nauenberg, U.; Smith, J. G.; Wagner, S. R.; Ayad, R.; Toki, W. H.; Wilson, R. J.; Feltresi, E.; Hauke, A.; Jasper, H.; Karbach, T. M.; Merkel, J.; Petzold, A.; Spaan, B.; Wacker, K.; Kobel, M. J.; Nogowski, R.; Schubert, K. R.; Schwierz, R.; Bernard, D.; Latour, E.; Verderi, M.; Clark, P. J.; Playfer, S.; Watson, J. E.; Andreotti, M.; Bettoni, D.; Bozzi, C.; Calabrese, R.; Cecchi, A.; Cibinetto, G.; Fioravanti, E.; Franchini, P.; Luppi, E.; Munerato, M.; Negrini, M.; Petrella, A.; Piemontese, L.; Santoro, V.; Baldini-Ferroli, R.; Calcaterra, A.; de Sangro, R.; Finocchiaro, G.; Pacetti, S.; Patteri, P.; Peruzzi, I. M.; Piccolo, M.; Rama, M.; Zallo, A.; Contri, R.; Guido, E.; Lo Vetere, M.; Monge, M. R.; Passaggio, S.; Patrignani, C.; Robutti, E.; Tosi, S.; Chaisanguanthum, K. S.; Morii, M.; Adametz, A.; Marks, J.; Schenk, S.; Uwer, U.; Bernlochner, F. U.; Klose, V.; Lacker, H. M.; Lueck, T.; Volk, A.; Bard, D. J.; Dauncey, P. D.; Tibbetts, M.; Behera, P. K.; Charles, M. J.; Mallik, U.; Cochran, J.; Crawley, H. B.; Dong, L.; Eyges, V.; Meyer, W. T.; Prell, S.; Rosenberg, E. I.; Rubin, A. E.; Gao, Y. Y.; Gritsan, A. V.; Guo, Z. J.; Arnaud, N.; Béquilleux, J.; D'Orazio, A.; Davier, M.; Derkach, D.; Firmino da Costa, J.; Grosdidier, G.; Le Diberder, F.; Lepeltier, V.; Lutz, A. M.; Malaescu, B.; Pruvot, S.; Roudeau, P.; Schune, M. H.; Serrano, J.; Sordini, V.; Stocchi, A.; Wormser, G.; Lange, D. J.; Wright, D. M.; Bingham, I.; Burke, J. P.; Chavez, C. A.; Fry, J. R.; Gabathuler, E.; Gamet, R.; Hutchcroft, D. E.; Payne, D. J.; Touramanis, C.; Bevan, A. J.; Clarke, C. K.; di Lodovico, F.; Sacco, R.; Sigamani, M.; Cowan, G.; Paramesvaran, S.; Wren, A. C.; Brown, D. N.; Davis, C. L.; Denig, A. G.; Fritsch, M.; Gradl, W.; Hafner, A.; Alwyn, K. E.; Bailey, D.; Barlow, R. J.; Jackson, G.; Lafferty, G. D.; West, T. J.; Yi, J. I.; Anderson, J.; Chen, C.; Jawahery, A.; Roberts, D. A.; Simi, G.; Tuggle, J. M.; Dallapiccola, C.; Salvati, E.; Cowan, R.; Dujmic, D.; Fisher, P. H.; Henderson, S. W.; Sciolla, G.; Spitznagel, M.; Yamamoto, R. K.; Zhao, M.; Patel, P. M.; Robertson, S. H.; Schram, M.; Biassoni, P.; Lazzaro, A.; Lombardo, V.; Palombo, F.; Stracka, S.; Cremaldi, L.; Godang, R.; Kroeger, R.; Sonnek, P.; Summers, D. J.; Zhao, H. W.; Simard, M.; Taras, P.; Nicholson, H.; de Nardo, G.; Lista, L.; Monorchio, D.; Onorato, G.; Sciacca, C.; Raven, G.; Snoek, H. L.; Jessop, C. P.; Knoepfel, K. J.; Losecco, J. M.; Wang, W. F.; Corwin, L. A.; Honscheid, K.; Kagan, H.; Kass, R.; Morris, J. P.; Rahimi, A. M.; Sekula, S. J.; Wong, Q. K.; Blount, N. L.; Brau, J.; Frey, R.; Igonkina, O.; Kolb, J. A.; Lu, M.; Rahmat, R.; Sinev, N. B.; Strom, D.; Strube, J.; Torrence, E.; Castelli, G.; Gagliardi, N.; Margoni, M.; Morandin, M.; Posocco, M.; Rotondo, M.; Simonetto, F.; Stroili, R.; Voci, C.; Del Amo Sanchez, P.; Ben-Haim, E.; Bonneaud, G. R.; Briand, H.; Chauveau, J.; Hamon, O.; Leruste, Ph.; Marchiori, G.; Ocariz, J.; Perez, A.; Prendki, J.; Sitt, S.; Gladney, L.; Biasini, M.; Manoni, E.; Angelini, C.; Batignani, G.; Bettarini, S.; Calderini, G.; Carpinelli, M.; Cervelli, A.; Forti, F.; Giorgi, M. A.; Lusiani, A.; Morganti, M.; Neri, N.; Paoloni, E.; Rizzo, G.; Walsh, J. J.; Lopes Pegna, D.; Lu, C.; Olsen, J.; Smith, A. J. S.; Telnov, A. V.; Anulli, F.; Baracchini, E.; Cavoto, G.; Faccini, R.; Ferrarotto, F.; Ferroni, F.; Gaspero, M.; Jackson, P. D.; Li Gioi, L.

    2009-09-01

    We present a search for decays of B mesons to final states with a b1 meson and a ρ or K*(892) meson. The search is based on a data sample consisting of 465 million B Bmacr pairs collected by the BABAR detector at the SLAC National Accelerator Laboratory. We do not observe any statistically significant signal. The upper limits we set on the branching fractions range from 1.4 to 8.0×10-6 at the 90% confidence level, including systematic uncertainties.

  15. Charge-cloud alignment in the electron-impact excitation of 138Ba( . . .6s6p 1P1)

    International Nuclear Information System (INIS)

    We have determined charge-cloud alignment parameters Pl+ and γ for electron-impact excitation of the (6s21S0) to (6s6p 1P1) transition in 138Ba by measuring the superelastic scattering of electrons from laser-excited 138Ba. Four electron-impact energies were studied and scattering-angle coverage in each case was sufficient to allow the observation of pronounced structure in the behavior of these parameters. Comparison of our measurements with two distorted-wave theories [R. E. H. Clark, J. Abdallah, Jr., G. Csanak, and S. P. Kramer, Phys. Rev. A 40, 2935 (1989); R. Srivastava, T. Zuo, R. P. McEachran, and A. D. Stauffer, J. Phys. B 25, 3709 (1992)] reveals generally excellent agreement except at the lowest impact energy studied where these theories fail completely to reproduce the observed behavior of Pl+. Our low-impact-energy data have also been compared with a close-coupling calculation [I. I. Fabrikant, Izv. Akad. Nauk Latv. SSR, Ser. Fiz. Tekhn. 6, 11 (1985)] which qualitatively reproduces the observed behavior of Pl+ and γ but fails to give quantitative agreement

  16. Eerste ervaringen met voerdosering in vleeskuikenstal P1

    OpenAIRE

    Harn, van, J.

    1994-01-01

    In de vleeskuikenstal P1 van PP is het gedoseerd voeren beproefd. Het doel van deze (pilot)proef was te kijken welke (technische) problemen zich voordeden wanneer in stal P1 gedoseerd gevoerd zou worden

  17. Mutations in the P1 promoter region of Micromonospora echinospora.

    OpenAIRE

    Lin, L S; Rothstein, D. M.

    1992-01-01

    We demonstrated previously that the promoters P1a, P1b, and P1c are very closely spaced and are coordinately turned on during stationary phase in Micromonospora echinospora. To determine the nucleotides important for promoter recognition, we characterized mutations that were defective in transcription from the P1b start site, using Streptomyces lividans as the host. Two mutations upstream of the start site resulted in a drastic loss of promoter activity, while two mutations downstream of the ...

  18. Non-commutative P-1-bundles over commutative schemes

    OpenAIRE

    Van den Bergh, Michel

    2012-01-01

    In this paper we develop the theory of non-commutative P-1-bundles over commutative (smooth) schemes. Such non-commutative P-1-bundles occur in the theory of D-modules but our definition is more general. We can show that every non-commutative deformation of a Hirzebruch surface is given by a non-commutative P-1-bundle over P-1 in our sense.

  19. Isotope shifts of the 4s2 1S0 -> 4s5p 1P1 transition and hyperfine splitting of the 4s5p 1P1 state in calcium

    OpenAIRE

    Mortensen, A.; Lindballe, J. J. T.; Jensen, I. S.; Staanum, P.; Voigt, D.; Drewsen, M.

    2004-01-01

    Using a technique based on production of ion Coulomb crystals, the isotope shifts of the 4s2 1S0 -> 4s5p 1P1 transition for all naturally occurring isotopes of calcium as well as the hyperfine splitting of the 4s5p 1P1 state in Ca-43 have been measured. The field shift and specific mass shift coefficients as well as the hyperfine structure constants for Ca-43 have been derived from the data.

  20. Study of infrared emission spectroscopy for the B(1)Δg-A(1)Πu and B'(1)Σg(+)-A(1)Πu systems of C2.

    Science.gov (United States)

    Chen, Wang; Kawaguchi, Kentarou; Bernath, Peter F; Tang, Jian

    2016-02-14

    Thirteen bands for the B(1)Δg-A(1)Πu system and eleven bands for the B'(1)Σg(+)-A(1)Πu system of C2 were identified in the Fourier transform infrared emission spectra of hydrocarbon discharges. The B'(1)Σg(+)v = 4 and the B(1)Δg v = 6, 7, and 8 vibrational levels involved in nine bands were studied for the first time. A direct global analysis with Dunham parameters was carried out satisfactorily for the B(1)Δg-A(1)Πu system except for a small perturbation in the B(1)Δg v = 6 level. The calculated rovibrational term energies up to B(1)Δg v = 12 showed that the level crossing between the B(1)Δg and d(3)Πg states is responsible for many of the prominent perturbations in the Swan system observed previously. Nineteen forbidden transitions of the B(1)Δg-a(3)Πu transition were identified and the off-diagonal spin-orbit interaction constant AdB between d(3)Πg and B(1)Δg was derived as 8.3(1) cm(-1). For the B'(1)Σg(+)-A(1)Πu system, only individual band analyses for each vibrational level in the B'(1)Σg(+) state could be done satisfactorily and Dunham parameters obtained from these effective parameters showed that the anharmonic vibrational constant ωexe is anomalously small (nearly zero). Inspection of the RKR (Rydberg-Klein-Rees) potential curves for the B'(1)Σg(+) and X(1)Σg(+) states revealed that an avoided crossing or nearly avoided crossing may occur around 30,000 cm(-1), which is responsible for the anomalous molecular constants in these two states. PMID:26874482

  1. Construction of HEK293 cells stably expressing wild-type organic anion transporting polypeptide 1B1 (OATP1B1*1a) and variant OATP1B1*1b and OATP1B1*15.

    Science.gov (United States)

    Chen, M; Qu, B X; Chen, X L; Hu, H H; Jiang, H D; Yu, L S; Zhou, Q; Zeng, S

    2016-06-01

    A transgenic cell line stably expressing the human organic anion transporting polypeptide (OATP1B1) was established. Human Embryonic Kidney 293 (HEK293) cell line stably expressing OATP1B1*1a sequence was amplified through PCR with the extracted total RNA as templates from human liver, then subcloned into the plasmid pMD19-T and verified by sequencing. OATP1B1*1b/OATP1B1*15 mutant sequences were obtained by site-directed mutation PCR with pMD19-T/ OATP1B1*1a as templates. The plasmids pcDNA3.1(+)/OATP1B1*1a, *1b and *15 were constructed and transfected into HEK293 cell line using Lipofectamine 2000 transfection reagent. Several stable transfected clones were obtained after selection with G418. Using rosuvastatin as a probe substrate of OATP1B1, the intracellular rosuvastatin accumulation in HEK293 and HEK-OATP1B1*1a, *1b and *15 monoclone cells were validated by a ultra-performance liquid chromatography-tandem mass spectrometry. OATP1B1 mRNA and protein expression were detected by RT-PCR and Western blot, respectively. The results from RT-PCR, rosuvastatin uptake and Western blot assay indicated that human OATP1B1 was highly expressed in transfected cells compared with controls. The HEK-293 cell lines stably expressing human OATP1B1-wild and variant (HEK-OATP1B1, *1b and *15) are potential models to study drug transport in vitro. PMID:27455553

  2. Construction of HEK293 cells stably expressing wild-type organic anion transporting polypeptide 1B1 (OATP1B1*1a) and variant OATP1B1*1b and OATP1B1*15.

    Science.gov (United States)

    Chen, M; Qu, B X; Chen, X L; Hu, H H; Jiang, H D; Yu, L S; Zhou, Q; Zeng, S

    2016-06-01

    A transgenic cell line stably expressing the human organic anion transporting polypeptide (OATP1B1) was established. Human Embryonic Kidney 293 (HEK293) cell line stably expressing OATP1B1*1a sequence was amplified through PCR with the extracted total RNA as templates from human liver, then subcloned into the plasmid pMD19-T and verified by sequencing. OATP1B1*1b/OATP1B1*15 mutant sequences were obtained by site-directed mutation PCR with pMD19-T/ OATP1B1*1a as templates. The plasmids pcDNA3.1(+)/OATP1B1*1a, *1b and *15 were constructed and transfected into HEK293 cell line using Lipofectamine 2000 transfection reagent. Several stable transfected clones were obtained after selection with G418. Using rosuvastatin as a probe substrate of OATP1B1, the intracellular rosuvastatin accumulation in HEK293 and HEK-OATP1B1*1a, *1b and *15 monoclone cells were validated by a ultra-performance liquid chromatography-tandem mass spectrometry. OATP1B1 mRNA and protein expression were detected by RT-PCR and Western blot, respectively. The results from RT-PCR, rosuvastatin uptake and Western blot assay indicated that human OATP1B1 was highly expressed in transfected cells compared with controls. The HEK-293 cell lines stably expressing human OATP1B1-wild and variant (HEK-OATP1B1, *1b and *15) are potential models to study drug transport in vitro.

  3. Surface Binding of Aflatoxin B1 by Lactic Acid Bacteria

    OpenAIRE

    Haskard, Carolyn A.; El-Nezami, Hani S.; Kankaanpää, Pasi E.; Salminen, Seppo; Ahokas, Jorma T.

    2001-01-01

    Specific lactic acid bacterial strains remove toxins from liquid media by physical binding. The stability of the aflatoxin B1 complexes formed with 12 bacterial strains in both viable and nonviable (heat- or acid-treated) forms was assessed by repetitive aqueous extraction. By the fifth extraction, up to 71% of the total aflatoxin B1 remained bound. Nonviable bacteria retained the highest amount of aflatoxin B1. Lactobacillus rhamnosus strain GG (ATCC 53103) and L. rhamnosus strain LC-705 (DS...

  4. A full CI treatment of the 1A1, 1B1, and 3B1 states of SiH2

    Science.gov (United States)

    Bauschlicher, Charles W., Jr.; Taylor, Peter R.

    1987-01-01

    Full CI calculations are presented for the 1A1, 3B1, and 1B1 states of SiH2 at their respective equilibrium geometries and at geometries with the SiH bonds stretched. These results are compared with those obtained from single-reference and multireference CI calculations. The computed Te values agree well with the full CI results, provided that the effects of higher-than-double excitations are accounted for either by the Davidson correction or by a multireference approach. When the SiH bonds are stretched, the single-reference methods are not sufficiently flexible, and only CASSCF/MRCI achieves chemical accuracy (i.e., agrees with the full CI to 1 kcal/mol). Overall, the accuracy of the various approximate methods is very similar to that found for H2O, NH2, and CH2.

  5. MAN1B1 deficiency: an unexpected CDG-II.

    Directory of Open Access Journals (Sweden)

    Daisy Rymen

    Full Text Available Congenital disorders of glycosylation (CDG are a group of rare metabolic diseases, due to impaired protein and lipid glycosylation. In the present study, exome sequencing was used to identify MAN1B1 as the culprit gene in an unsolved CDG-II patient. Subsequently, 6 additional cases with MAN1B1-CDG were found. All individuals presented slight facial dysmorphism, psychomotor retardation and truncal obesity. Generally, MAN1B1 is believed to be an ER resident alpha-1,2-mannosidase acting as a key factor in glycoprotein quality control by targeting misfolded proteins for ER-associated degradation (ERAD. However, recent studies indicated a Golgi localization of the endogenous MAN1B1, suggesting a more complex role for MAN1B1 in quality control. We were able to confirm that MAN1B1 is indeed localized to the Golgi complex instead of the ER. Furthermore, we observed an altered Golgi morphology in all patients' cells, with marked dilatation and fragmentation. We hypothesize that part of the phenotype is associated to this Golgi disruption. In conclusion, we linked mutations in MAN1B1 to a Golgi glycosylation disorder. Additionally, our results support the recent findings on MAN1B1 localization. However, more work is needed to pinpoint the exact function of MAN1B1 in glycoprotein quality control, and to understand the pathophysiology of its deficiency.

  6. Isotope shifts of 6s5d(3)D-6s6p(1)P(1) transitions in neutral barium

    NARCIS (Netherlands)

    Dammalapati, U.; De, S.; Jungmann, K.; Willmann, L.

    2009-01-01

    First laser spectroscopic measurements of the 6s5d(3)D(1)-6s6p(1)P(1) and 6s5d(3)D(2)-6s6p(1)P(1) transitions in several isotopes of atomic barium have been performed. The hyperfine structure of these transitions was optically resolved and isotope shifts for even and odd isotopes were determined. Th

  7. Formation of deeply bound ultracold Sr_2 molecules by photoassociation near the ^1S + ^3P_1 intercombination line

    CERN Document Server

    Skomorowski, Wojciech; Koch, Christiane P

    2012-01-01

    We predict feasibility of the photoassociative formation of Sr_2 molecules in arbitrary vibrational levels of the electronic ground state based on state-of-the-art ab initio calculations. Key is the strong spin-orbit interaction between the c^3\\Pi_u, A^1\\Sigma_u^+ and B^1\\Sigma_u^+ states. It creates not only an effective dipole moment allowing free-to-bound transitions near the ^1S + ^3P_1 intercombination line but also facilitates bound-to-bound transitions via resonantly coupled excited state rovibrational levels to deeply bound rovibrational levels of the ground X^1\\Sigma_g^+ potential, with v" as low as v"=6. The spin-orbit interaction is responsible for both optical pathways. Therefore, those excited state levels that have the largest bound-to-bound transition moments to deeply bound ground state levels also exhibit a sufficient photoassociation probability, comparable to that of the lowest weakly bound excited state level previously observed by Zelevinsky et al. [Phys. Rev. Lett. 96, 203201 (2006)]. Ou...

  8. A full CI treatment of the 1A1-3B1 separation in methylene

    Science.gov (United States)

    Bauschlicher, Charles W., Jr.; Taylor, Peter R.

    1986-01-01

    The accuracy of recent theoretical computations of the total energies and the adiabatic separation of the 1A1 and 3B1 states of CH2 is investigated on the basis of complete CI calculations using the double-zeta basis sets of Dunning (1970). The results are presented in a table and characterized in detail. The errors in the separation values are found to range from less than 0.01 kcal/mol for a CASSCF/MRSDCI calculation, to 0.38 kcal/mol for a Davidson-corrected SCF/SDCI calculation, to 14.17 kcal/mol for an uncorrected SCF calculation.

  9. 26 CFR 31.3401(b)-1 - Payroll period.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Payroll period. 31.3401(b)-1 Section 31.3401(b... Collection of Income Tax at Source § 31.3401(b)-1 Payroll period. (a) The term payroll period means the... elapsed and receives the remainder at the end of the week, the payroll period is still the calendar...

  10. SerpinB1 Promotes Pancreatic β Cell Proliferation

    Energy Technology Data Exchange (ETDEWEB)

    Quaamari, Abdelfattah; Dirice, Ercument; Gedeon, Nicholas; Hu, Jiang; Zhou, Jian-Ying; Shirakawa, Jun; Hou, Lifei; Goodman, Jessica; Karampelias, Christos; Qiang, Guifeng; Boucher, Jeremie; Martinez, Rachael; Gritsenko, Marina A.; De Jesus, Dario F.; Kahraman, Sevim; Bhatt, Shweta; Smith, Richard D.; Beer, Hans-Dietmar; Jungtrakoon, Prapaporn; Gong, Yanping; Goldfine, Allison B.; Liew, Chong Wee; Doria, Alessandro; Andersson, Olov; Qian, Weijun; Remold-O' Donnell, Eileen; Kulkami, Rohit N.

    2016-01-12

    Compensatory β-cell growth in response to insulin resistance is a common feature in diabetes. We recently reported that liver-derived factors participate in this compensatory response in the liver insulin receptor knockout (LIRKO) mouse, a model of significant islet hyperplasia. Here we show that serpinB1 is a liver-derived secretory protein that controls β-cell proliferation. SerpinB1 is abundant in the hepatocyte secretome and sera derived from LIRKO mice. SerpinB1 and small molecule compounds that partially mimic serpinB1 activity enhanced proliferation of zebrafish, mouse and human β-cells. We report that serpinB1-induced β-cell replication requires protease inhibition activity and mice lacking serpinB1 exhibit attenuated β-cell replication in response to insulin resistance. Finally, SerpinB1-treatment of islets modulated signaling proteins in growth and survival pathways such as MAPK, PKA and GSK3. Together, these data implicate SerpinB1 as a protein that can potentially be harnessed to enhance functional β-cell mass in patients with diabetes.

  11. OECD 28-days oral toxicity study on fumonisin B1

    NARCIS (Netherlands)

    Nijs M de; Egmond HP van; Jong WH de; Loveren H van; LPI; ARO; MGB

    1999-01-01

    Het beschreven experiment werd uitgevoerd om inzicht te verkrijgen over effecten van lage doseringen fumonisine B1 op target organen en het immuunsysteem. Mannelijke ratten van drie weken oud werden oraal via maagsonde behandeld met 0, 0,19, 0,75 of 3 mg/kg lichaamsgewicht fumonisine B1, dagelij

  12. 29 CFR 2520.104b-1 - Disclosure.

    Science.gov (United States)

    2010-07-01

    ... of this chapter, and section 414(b) of the Internal Revenue Code of 1954 and 26 CFR 1.414(f) (40 FR... 29 Labor 9 2010-07-01 2010-07-01 false Disclosure. 2520.104b-1 Section 2520.104b-1 Labor... REPORTING AND DISCLOSURE UNDER THE EMPLOYEE RETIREMENT INCOME SECURITY ACT OF 1974 RULES AND REGULATIONS...

  13. 77 FR 32599 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-06-01

    ... possible sale to provide the regeneration, overhaul, modifications, and logistics support of 4 Lockheed... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of...

  14. 78 FR 36534 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2013-06-18

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Defense Security Cooperation Agency... of a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of... contractor technical and logistics support services, and other related elements of logistics support....

  15. 78 FR 50045 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2013-08-16

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Defense Security Cooperation Agency... of a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of... engineering, technical and logistics support services, and other related elements of logistics support....

  16. 76 FR 60455 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-09-29

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of section... engineering, technical and logistics support services, and other related elements of logistical and...

  17. 76 FR 72684 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-11-25

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Defense Security Cooperation Agency... of a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of... engineering, technical and logistics support services, and other related elements of logistical and...

  18. 78 FR 41039 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2013-07-09

    ... elements of logistics support. The estimated cost is $170 million. The proposed sale will contribute to the... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of...

  19. 26 CFR 11.410(b)-1 - Minimum coverage requirements.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 14 2010-04-01 2010-04-01 false Minimum coverage requirements. 11.410(b)-1 Section 11.410(b)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) TEMPORARY INCOME TAX REGULATIONS UNDER THE EMPLOYEE RETIREMENT INCOME SECURITY...

  20. 77 FR 52698 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-08-30

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Defense Security Cooperation Agency... of a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of...: 18 AGM-65K2 MAVERICK All-Up- Round Missiles, 36 TGM-65K2 Captive Air Training Missiles, 3...

  1. 77 FR 42709 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-07-20

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of section... Services under Consideration for Purchase: 700 AGM-114K3A or AGM-114R3 HELLFIRE tactical missiles,...

  2. 76 FR 68432 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-11-04

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Defense Security Cooperation Agency... of a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of... Purchase: 70 AGM-158 Joint Air-to- Surface Standoff Missiles (JASSM), 2 test vehicles, support and...

  3. 78 FR 26330 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2013-05-06

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Defense Security Cooperation Agency... of a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of... Services under Consideration for Purchase: 500 AGM-114-N4/P4 HELLFIRE missiles. (iv) Military...

  4. 76 FR 60461 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-09-29

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of section...: 500 AGM-114R3 HELLFIRE II missiles, containers, spare and repair parts, support and test...

  5. 77 FR 40026 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-07-06

    ... of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... a section 36(b)(1) arms sales notification. This is published to fulfill the requirements of section... Consideration for Purchase: 300 AGM-114R3 HELLFIRE II missiles, containers, spare and repair parts, support...

  6. 26 CFR 1.7702B-1 - Consumer protection provisions.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false Consumer protection provisions. 1.7702B-1 Section 1.7702B-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME...-Term Care Insurance Model Act (Model Act) and Long-Term Care Insurance Model Regulation...

  7. Interaction of vitamin B1 with bovine serum albumin investigation using vitamin B1-selective electrode: potentiometric and molecular modeling study.

    Science.gov (United States)

    Hosseinzadeh, Reza; Khorsandi, Khatereh

    2016-09-01

    Vitamin B1 or thiamin is one of the B vitamins. All B vitamins help the body to convert food (carbohydrates) into fuel (glucose), which produces energy. The B vitamins are necessary for healthy skin, eyes, hair, and liver. It also could help the nervous system function properly, and is necessary for brain functions. Drug interactions with protein can affect the distribution of the drug and eliminate the drug in living systems. In this study, the binding of thiamine hydrochloride (vitamin B1) to bovine serum albumin (BSA) was evaluated using a new proposed vitamin B1 (thiamine)-selective membrane electrode under various experimental conditions, such as pH, ionic strength, and protein concentration; in addition molecular modeling was applied as well. The binding isotherms plotted based on potentiometric data and analyzed using the Wyman binding potential concept. The apparent binding constant was determined and used for the calculation of intrinsic Gibbs free energy of binding. According to the electrochemical and molecular docking results, it can be concluded that the hydrophobic interactions and hydrogen binding are major interactions between BSA and vitamin B1. PMID:26372107

  8. Interaction of vitamin B1 with bovine serum albumin investigation using vitamin B1-selective electrode: potentiometric and molecular modeling study.

    Science.gov (United States)

    Hosseinzadeh, Reza; Khorsandi, Khatereh

    2016-09-01

    Vitamin B1 or thiamin is one of the B vitamins. All B vitamins help the body to convert food (carbohydrates) into fuel (glucose), which produces energy. The B vitamins are necessary for healthy skin, eyes, hair, and liver. It also could help the nervous system function properly, and is necessary for brain functions. Drug interactions with protein can affect the distribution of the drug and eliminate the drug in living systems. In this study, the binding of thiamine hydrochloride (vitamin B1) to bovine serum albumin (BSA) was evaluated using a new proposed vitamin B1 (thiamine)-selective membrane electrode under various experimental conditions, such as pH, ionic strength, and protein concentration; in addition molecular modeling was applied as well. The binding isotherms plotted based on potentiometric data and analyzed using the Wyman binding potential concept. The apparent binding constant was determined and used for the calculation of intrinsic Gibbs free energy of binding. According to the electrochemical and molecular docking results, it can be concluded that the hydrophobic interactions and hydrogen binding are major interactions between BSA and vitamin B1.

  9. Dual effects of phloretin on aflatoxin B1 metabolism: activation and detoxification of aflatoxin B1.

    Science.gov (United States)

    Gao, Shang Shang; Chen, Xiao Yan; Zhu, Ri Zhe; Choi, Byung-Min; Kim, Sun Jun; Kim, Bok-Ryang

    2012-01-01

    Typically, chemopreventive agents involve either induction of phase II detoxifying enzymes and/or inhibition of cytochrome P450 enzymes (CYPs) that are required for the activation of procarcinogens. In this study, we investigated the protective effects of phloretin against aflatoxin B1 (AFB1) activation to the ultimate carcinogenic intermediate, AFB(1)-8, 9-epoxide (AFBO), and its subsequent detoxification. Phloretin markedly inhibited formation of the epoxide with human liver microsomes in a dose-dependent manner. Phloretin also inhibited the activities of nifedipine oxidation and ethoxyresorufin O-deethylase (EROD) in human liver microsomes. These data show that phloretin strongly inhibits CYP1A2 and CYP3A4 activities, which are involved in the activation of AFB1. Phloretin increased glutathione S-transferase (GST) activity of alpha mouse liver 12 (AML 12) cells in a dose-dependent manner. GST activity toward AFBO in cell lysates treated with 20 μM phloretin was 23-fold that of untreated control cell lysates. The expression of GSTA3, GSTA4, GSTM1, GSTP1 and GSTT1 was induced by phloretin in a dose-dependent manner in AML 12 cells. GSTP1, GSTM1, and GSTT1 were able to significantly increase the conjugation of AFBO with glutathione. Concurrently, induction of the GST isozyme genes was partially associated with the Nrf2/ARE pathway. Taken together, the results demonstrate that phloretin has a strong chemopreventive effect against AFB1 through its inhibitory effect on CYP1A2, CYP3A4, and its inductive effect on GST activity. PMID:22253071

  10. Light-Cone Distribution Amplitudes for the Light $1^1P_1$ Mesons

    OpenAIRE

    Yang, Kwei-Chou

    2005-01-01

    We present a study of light-cone distribution amplitudes of the light $1^1P_1$ mesons. The first few Gegenbauer moments of leading twist light-cone distribution amplitudes are calculated by using the QCD sum rule technique.

  11. Analytical potential energy function and spectroscopyparameters for B1Ⅱ state of KH

    Institute of Scientific and Technical Information of China (English)

    Jingjuan Liang; Chuanlu Yang; Lizhi Wang; Qinggang Zhang

    2011-01-01

    Multi-reference configuration interaction is used to produce potential energy curves (PECs) for the excited B1II state of KH molecule. To investigate the correlation effect of core-valence electrons, five schemes are employed which include the different correlated electrons and different active spaces. The PECs are fitted into analytical potential energy functions (APEFs). The spectroscopic parameters, ro-vibrational levels, and transition frequencies are determined based on the APEFs and compared with available experimental and theoretical data. The molecular properties for B1II obtained in this letter, which are better than those available in literature, can be reproduced with calculations using the suitable correlated electrons and active space of orbitals.%Multi-reference configuration interaction is used to produce potential energy curves (PECs) for the excited B1Ⅱ state of KH molecule.To investigate the correlation effect of core-valence electrons,five schemes are employed which include the different correlated electrons and different active spaces.The PECs are fitted into analytical potential energy functions (APEFs).The spectroscopic parameters,ro-vibrational levels,and transition frequencies are determined based on the APEFs and compared with available experimental and theoretical data.The molecular properties for B1Ⅱ obtained in this letter,which are better than those available in literature,can be reproduced with calculations using the suitable correlated electrons and active space of orbitals.

  12. The b1 structure function and nuclear pions

    International Nuclear Information System (INIS)

    The b1 structure function is measurable in deep inelastic scattering from polarized nuclei with unpolarized beams. The contributions of nuclear pions are evaluated and found to be small, about 2%. 8 refs

  13. Analysis of CYP27B1 in multiple sclerosis

    Science.gov (United States)

    Ross, Jay P; Bernales, Cecily Q; Lee, Joshua D; Sadovnick, A Dessa; Traboulsee, Anthony L; Vilariño-Güell, Carles

    2016-01-01

    The analysis of genetic variability in CYP27B1 and its effect on risk of multiple sclerosis (MS) has yielded conflicting results. Here we describe a study to genetically characterize CYP27B1 and elucidate its role on MS risk in the Canadian population. Sequencing CYP27B1 failed to identify mutations known to cause loss of enzymatic activity, however genotyping of p.R389H in cases and controls identified the mutation in one multi-incident family (allele frequency = 0.03%) in which the p.R389H mutation segregates with disease in five family members diagnosed with MS, thus providing additional support for CYP27B1 p.R389H in the pathogenicity of MS. PMID:24308945

  14. Supercritical Fluid Extraction of Aflatoxin B 1 from Soil

    Science.gov (United States)

    This research describes the development of a Supercritical Fluid Extraction (SFE) method to recover aflatoxin B1 from fortified soil. The effects of temperature, pressure, modifier (identity and percentage), and extraction type were assessed. Using the optimized SFE conditions, ...

  15. Synthesis of 4"-benzyloxyimino-4"-deoxyavermectin B1a derivatives

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Six new 4"-benzyloxyimino-4"-deoxyavermectin B1a derivatives were synthesized from avermectin B1a by the selective protection of C-5-hydroxy group, oxidation of C-4"-hydroxy group, and deprotection followed by reaction with O-substituted hydroxylamine hydrochlorides. Their structures were confirmed by IR, 1H NMR, 13C NMR and MS. Insecticidal activities of the derivatives against Phopalosiphum pseudobrassicae, Spodoptera exigua and Pluteua xylosteua were evaluated.

  16. Linear systems over P1xP1 with base points of multiplicity bounded by three

    OpenAIRE

    Lenarcik, Tomasz

    2008-01-01

    We propose a combinatorial method of proving non-specialty of a linear system of curves with multiple points in general positions. As an application we obtain a classification of special linear systems on P1xP1 for which the multiplicities do not exceed 3.

  17. Secant Varieties of (P ^1) X .... X (P ^1) (n-times) are NOT Defective for n \\geq 5

    OpenAIRE

    Catalisano, M. V.; Geramita, A.; Gimigliano, A.

    2008-01-01

    Let V_n be the Segre embedding of (P^1) x ... X (P^1) (n times). We prove that the higher secant varieties, \\sigma_s(V_n), always have the expected dimension, except for \\sigma_3(V_4), which is of dimension 1 less than expected.

  18. Prediction of B1 to B10 phase transition in LuN under pressure: An ab-initio investigation

    Science.gov (United States)

    Sahoo, B. D.; Mukherjee, D.; Joshi, K. D.; Kaushik, T. C.; Gupta, Satish C.

    2016-05-01

    Ab-initio total energy calculations have been performed in lutetium nitride (LuN) as a function of hydrostatic compression to understand the high pressure behavior of this compound. Our calculations predict a phase transition from ambient rocksalt type structure (B1 phase) to a tetragonal structure (B10 phase) at ~ 240 GPa. The phase transition has been identified as first order in nature with volume discontinuity of ~ 6%. The predicted high pressure phase has been found to be stable up to at least 400 GPa, the maximum pressure up to which calculations have been performed.Further, to substantiate the results of static lattice calculations analysis of lattice dynamic stability of B1 and B10 phase has been carried out at different pressures. Apart from this, we have analyzed the lattice dynamic stability CsCl type (B2) phase around the 240 GPa, the pressure reported for B1 to B2 transition in previous all-electron calculations by Gupta et al. 2013. We find that the B2 structure is lattice dynamically unstable at this pressure and remains unstable up to ~ 400 GPa, ruling out the possibility of B1 to B2 phase transition at least up to ~ 400 GPa. Further, the theoretically determined equation of state has been utilized to derive various physical quantities such as zero pressure equilibrium volume, bulk modulus, and pressure derivative of bulk modulus of B1 phase at ambient conditions.

  19. Adjoint P1 equations solution for neutron slowing down

    International Nuclear Information System (INIS)

    In some applications of perturbation theory, it is necessary know the adjoint neutron flux, which is obtained by the solution of adjoint neutron diffusion equation. However, the multigroup constants used for this are weighted in only the direct neutron flux, from the solution of direct P1 equations. In this work, the adjoint P1 equations are derived by the neutron transport equation, the reversion operators rules and analogies between direct and adjoint parameters. The direct and adjoint neutron fluxes resulting from the solution of P1 equations were used to three different weighting processes, to obtain the macrogroup macroscopic cross sections. It was found out noticeable differences among them. (author)

  20. STS-113 P1 Truss payload in the SSPF

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- Inside the Space Station Processing Facility, the P1 Truss Segment is lowered into the payload canister. The P1 truss is the primary payload for Mission STS-113. It is the first port truss segment which will be attached to the Station'''s central truss segment, S0. Once delivered, the P1 truss will remain stowed until flight 12A.1. The mission will also deliver the Expedition 6 crew to the Station and return Expedition 5 to Earth. Space Shuttle Endeavour is scheduled to launch no earlier than Nov. 10 on the 11-day mission.

  1. Genetic and physical map of a P1 miniplasmid.

    OpenAIRE

    Austin, S.; Hart, F; Abeles, A; Sternberg, N

    1982-01-01

    The prophage form of bacteriophage P1 is a unit-copy plasmid which is maintained with great fidelity in its Escherichia coli host. The plasmid maintenance functions of P1 are clustered in one region of the genome. An 11.5-kilobase fragment from this region has been cloned into a lambda delta att vector and promotes stable unit-copy plasmid maintenance. The properties of the lambda vector facilitated the isolation of deletion mutants affecting the P1 DNA. Twenty-eight deletion mutants were iso...

  2. Suppression of Zeeman Relaxation in Cold Collisions of \\(^2P_{1/2}\\) Atoms

    OpenAIRE

    Tscherbul, T.V.; Buchachenko, A. A.; Dalgarno, Alexander; Lu, M.-J.; Weinstein, J. D.

    2009-01-01

    We present a combined experimental and theoretical study of angular momentum depolarization in cold collisions of \\(^2P\\) atoms in the presence of an external magnetic field. We show that collision-induced Zeeman relaxation of Ga\\(^2P_{1/2}\\) and In \\(^2P_{1/2}\\) atoms in cold \\(^4\\)He gas is dramatically suppressed compared to atoms in \\(^2P_{3/2}\\) states. Using rigorous quantum-scattering calculations based on ab initio interaction potentials, we demonstrate that Zeeman transitions in coll...

  3. Pölynhallinta ja suojaaminen P1-puhtausluokassa

    OpenAIRE

    Rouvinen, Tommi

    2014-01-01

    P1-puhtausluokitus on lisääntymässä, ja se on erittäin ajankohtainen asia rakentami-sessa. Laadukasta ja terveellistä saneeraustyötä vaaditaan yhä useammassa hankkeessa, ja varsinkin julkiset rakennukset pyrkivät P1-luokkaan. Tämän opinnäytetyön tarkoituksena on tutkia, mitä P1-puhtausluokitus tarkoittaa ja mitä vaatimuksia sillä on työmaan näkökulmasta. Tavoitteena on selvittää, millä kei-noin pölynhallinta kannattaa tehdä ja miksi on tärkeätä, että työmaa on siisti ja täyttää P1-puhtausl...

  4. P1 peptidase – a mysterious protein of family Potyviridae

    Indian Academy of Sciences (India)

    Jana Rohožková; Milan Navrátil

    2011-03-01

    The Potyviridae family, named after its type member, Potato virus Y (PVY), is the largest of the 65 plant virus groups and families currently recognized. The coding region for P1 peptidase is located at the very beginning of the viral genome of the family Potyviridae. Until recently P1 was thought of as serine peptidase with RNA-binding activity and with possible influence in cell-to-cell viral spreading. This N-terminal protein, among all of the potyviruses, is the most divergent protein: varying in length and in its amino acid sequence. Nevertheless, P1 peptidase in many ways is still a mysterious viral protein. In this review, we would like to offer a comprehensive overview, discussing the proteomic, biochemical and phylogenetic views of the P1 protein.

  5. System of adjoint P1 equations for neutron moderation

    International Nuclear Information System (INIS)

    In some applications of perturbation theory, it is necessary know the adjoint neutron flux, which is obtained by the solution of adjoint neutron diffusion equation. However, the multigroup constants used for this are weighted in only the direct neutron flux, from the solution of direct P1 equations. In this work, this procedure is questioned and the adjoint P1 equations are derived by the neutron transport equation, the reversion operators rules and analogies between direct and adjoint parameters. (author)

  6. Hodge structures associated to SU(p,1)

    CERN Document Server

    Abdulali, Salman

    2012-01-01

    Let A be a general member of a PEL family of abelian varieties such that the semisimple part of the Hodge group of A is a product of copies of SU(p,1) for some p>1. We show that any effective Tate twist of a Hodge structure occurring in the cohomology of a power of A is isomorphic to a Hodge structure in the cohomology of some abelian variety.

  7. Occurrence of aflatoxin B1 in natural products.

    Science.gov (United States)

    Prado, Guilherme; Altoé, Aline F; Gomes, Tatiana C B; Leal, Alexandre S; Morais, Vanessa A D; Oliveira, Marize S; Ferreira, Marli B; Gomes, Mateus B; Paschoal, Fabiano N; von S Souza, Rafael; Silva, Daniela A; Cruz Madeira, Jovita E G

    2012-10-01

    The media claims for the consumption of natural resource-based food have gradually increased in both developing and developed countries. The interest in the safety of these products is partially due to the possible presence of toxigenic fungi acting as mycotoxin producers, such as aflatoxins produced during the secondary metabolism of Aspergillus flavus, A. parasiticus and A. nomius. Aflatoxins, mainly aflatoxin B1, are directly associated with liver cancer in human beings. This paper is aimed at evaluating the presence of aflatoxin B1 in a few vegetable drugs, dried plant extracts and industrialized products traded in 2010 in the city of Belo Horizonte, State of Minas Gerais, Brazil. The method used for the quantification of aflatoxin B1 was based on extraction through acetone:water (85:15), immunoaffinity column purification followed by separation and detection in high efficiency liquid chromatography. Under the conditions of analysis, the Limits of Detection and Quantification were 0.6 µg kg(-1) and 1.0 µg kg(-1) respectively. The complete sets of analyses were carried out in duplicate. Aflatoxin B1 was noticed in a single sample (aflatoxin B1 contamination in the products under analysis. However, it is required to establish a broad monitoring program in order to obtain additional data and check up on the actual extension of contamination. PMID:24031973

  8. Occurrence of aflatoxin B1 in natural products

    Directory of Open Access Journals (Sweden)

    Guilherme Prado

    2012-12-01

    Full Text Available The media claims for the consumption of natural resource-based food have gradually increased in both developing and developed countries. The interest in the safety of these products is partially due to the possible presence of toxigenic fungi acting as mycotoxin producers, such as aflatoxins produced during the secondary metabolism of Aspergillus flavus, A. parasiticus and A. nomius. Aflatoxins, mainly aflatoxin B1, are directly associated with liver cancer in human beings. This paper is aimed at evaluating the presence of aflatoxin B1 in a few vegetable drugs, dried plant extracts and industrialized products traded in 2010 in the city of Belo Horizonte, State of Minas Gerais, Brazil. The method used for the quantification of aflatoxin B1 was based on extraction through acetone:water (85:15, immunoaffinity column purification followed by separation and detection in high efficiency liquid chromatography. Under the conditions of analysis, the Limits of Detection and Quantification were 0.6 µg kg-1 and 1.0 µg kg-1respectively. The complete sets of analyses were carried out in duplicate. Aflatoxin B1 was noticed in a single sample (< 1.0 µg kg-1. The results revealed low aflatoxin B1contamination in the products under analysis. However, it is required to establish a broad monitoring program in order to obtain additional data and check up on the actual extension of contamination.

  9. CYP264B1 from Sorangium cellulosum So ce56: a fascinating norisoprenoid and sesquiterpene hydroxylase.

    Science.gov (United States)

    Ly, Thuy T B; Khatri, Yogan; Zapp, Josef; Hutter, Michael C; Bernhardt, Rita

    2012-07-01

    Many terpenes and terpenoid compounds are known as bioactive substances with desirable fragrance and medicinal activities. Modification of such compounds to yield new derivatives with desired properties is particularly attractive. Cytochrome P450 monooxygenases are potential enzymes for these reactions due to their capability of performing different reactions on a variety of substrates. We report here the characterization of CYP264B1 from Sorangium cellulosum So ce56 as a novel sesquiterpene hydroxylase. CYP264B1 was able to convert various sesquiterpenes including nootkatone and norisoprenoids (α-ionone and β-ionone). Nootkatone, an important grapefruit aromatic sesquiterpenoid, was hydroxylated mainly at position C-13. The product has been shown to have the highest antiproliferative activity compared with other nootkatone derivatives. In addition, CYP264B1 was found to hydroxylate α- and β-ionone, important aroma compounds of floral scents, regioselectively at position C-3. The products, 3-hydroxy-β-ionone and 13-hydroxy-nootkatone, were confirmed by (1)H and (13)C NMR. The kinetics of the product formation was analyzed by high-performance liquid chromatography, and the K ( m ) and k (cat) values were calculated. The results of docking α-/β-ionone and nootkatone into a homology model of CYP264B1 revealed insights into the structural basis of these selective hydroxylations. PMID:22223101

  10. Numerical study of the static and pitching RISØ-B1-18 airfoil

    DEFF Research Database (Denmark)

    Bertagnolio, Franck

    2004-01-01

    The objective of this report is the better understanding of the physics of the aeroelastic motion of wind turbine blades in order to improve the numerical models used for their design. In this study, the case of the RISØ-B1-18 airfoil which was equippedand measured in an open jet wind tunnel...... is studied. Two and three dimensional Navier-Stokes calculations using the k-w SST and Detached Eddy Simulation turbulence models are conducted. An engineering semi-empirical dynamic stall model is also used forperforming calculations. Computational results are compared to the experimental results...

  11. Variability in equatorial B0 and B1

    International Nuclear Information System (INIS)

    Variability of ionospheric profile parameters B0 and B1, below the F2 peak is investigated for an equatorial station at two levels of solar activities. The whole 24 hours of the day and the four seasons of the year are covered. Absolute and relative variability indices were utilized in the study. Some evidences of correlations of variability index and profiles parameters were observed. Daytime values of relative variability in B1 at solar minimum were found to be greater than those of solar maximum. (author)

  12. Seasonal behaviour of B0 and B1

    International Nuclear Information System (INIS)

    A preliminary analysis of the thickness parameter B0 and the shape parameter B1 is presented. Noon electron density profiles recorded at five ionospheric stations during different seasonal and solar activity conditions are used in the study. The results show that both parameters present a seasonal trend with minimum value for B0 during the local winter and maximum during the local summer. This behaviour is inverted for B1. Discrepancies with IRI-90 model are found. (author). 8 refs, 4 figs, 2 tabs

  13. Base substitution mutations induced by metabolically activated aflatoxin B1.

    Science.gov (United States)

    Foster, P L; Eisenstadt, E; Miller, J H

    1983-05-01

    We have determined the base substitutions generated by metabolically activated aflatoxin B1 in the lacI gene of a uvrB- strain of Escherichia coli. By monitoring over 70 different nonsense mutation sites, we show that activated aflatoxin B1 specifically induced GxC leads to TxA transversions. One possible pathway leading to this base change involves depurination at guanine residues. We consider this mechanism of mutagenesis in the light of our other findings that the carcinogens benzo[a]pyrene diol epoxide and N-acetoxyacetylaminofluorene also specifically induce GxC leads to TxA transversions. PMID:6405385

  14. Base substitution mutations induced by metabolically activated aflatoxin B1.

    OpenAIRE

    Foster, P. L.; Eisenstadt, E; Miller, J H

    1983-01-01

    We have determined the base substitutions generated by metabolically activated aflatoxin B1 in the lacI gene of a uvrB- strain of Escherichia coli. By monitoring over 70 different nonsense mutation sites, we show that activated aflatoxin B1 specifically induced GxC leads to TxA transversions. One possible pathway leading to this base change involves depurination at guanine residues. We consider this mechanism of mutagenesis in the light of our other findings that the carcinogens benzo[a]pyren...

  15. System of adjoint P1 equations for neutron moderation; Sistema de equacoes P1 adjuntas para a moderacao de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Aquilino Senra; Silva, Fernando Carvalho da; Cardoso, Carlos Eduardo Santos [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia. Programa de Engenharia Nuclear

    2000-07-01

    In some applications of perturbation theory, it is necessary know the adjoint neutron flux, which is obtained by the solution of adjoint neutron diffusion equation. However, the multigroup constants used for this are weighted in only the direct neutron flux, from the solution of direct P1 equations. In this work, this procedure is questioned and the adjoint P1 equations are derived by the neutron transport equation, the reversion operators rules and analogies between direct and adjoint parameters. (author)

  16. Wind tunnel tests of Risø-B1-18 and Risø-B1-24

    DEFF Research Database (Denmark)

    Fuglsang, P.; Bak, Christian; Gaunaa, Mac;

    2003-01-01

    This report contains 2D measurements of the Risø-B1-18 and Risø-B1-24 airfoils. The aerodynamic properties were derived from pressure measurements on the airfoil surface and in the wake. The measurements were conducted in the VELUX open jet wind tunnel,which has a background turbulence intensity...... of the measurements was good and the agreement between measurements and numerical CFD predictions with EllipSys2D wasgood. For both airfoils predictions with turbulent flow captured very well the shapes of lift and drag curves as well as the magnitude of maximum lift. Measurements of Risø-B1-18 showed...

  17. 76 FR 79658 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-12-22

    ... Proposed Issuance of Letter of Offer Pursuant to Section 36(b)(1) of the Arms Export Control Act (U) (i... Other 10 million TOTAL 60 million * as defined in Section 47(6) of the Arms Export Control Act. (iii... Anti-Tank Guided Missiles, tripods, JAVELIN Weapon Effects Simulators, enhanced basic skills...

  18. 77 FR 77040 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-12-31

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF DEFENSE Office of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... unguided BLU-111B/B free-fall bomb into precision-guided ``smart'' bomb. The control and airfoil...

  19. 77 FR 77043 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-12-31

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF DEFENSE Office of the Secretary 36(b)(1) Arms Sales Notification AGENCY: Department of Defense, Defense Security... into precision-guided ``smart'' munitions. By adding a new tail section containing Inertial...

  20. 76 FR 69707 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-11-09

    ... defeat perimeter security threats and readily employ counter- and anti-terrorism measures. The RSLF... Section 36(b)(1) of the Arms Export Control Act, as Amended (i) Prospective Purchaser: Kingdom of Saudi... million. Other 2 million. Total 33 million. *As defined in Section 47(6) of the Arms Export Control...

  1. Aspergillus flavus and aflatoxin B1 in flour production.

    Science.gov (United States)

    Halt, M

    1994-10-01

    This paper discusses the results of investigations of contamination with aflatoxin-producing fungi and aflatoxin B1 affecting 545 samples of wheat grains, 475 samples of intermediate products of wheat grain being milled to flour (like middlings) and 238 samples of flour. A significant contamination with moulds was detected in analyzed samples. Although Aspergillus (34.87%) and Penicillium (32.37%) dominated, other types were also present, e.g., Cladosporium, Fusarium, Mucor, Alternaria, Rhizopus, Absidia and Trichoderma (listed in order of frequency). The presence of Aspergillus flavus, the known aflatoxin producer, was detected in 9.94% of analyzed samples. Isolates of A. Flavus were capable of producing aflatoxin B1 under favourable conditions. Aflatoxin B1 was found in 76.8% of samples contaminated with A. flavus. The highest contamination with aflatoxin B1 was detected in wheat grain samples (mean value of 16.3 micrograms/kg) and in intermediate products of wheat grain being milled to flour (mean value of 11.13 micrograms/kg). Contamination was lower in flour samples (mean value of 4.13 micrograms/kg). With regard to proposed standards given by the FAO and WHO, under which the content of aflatoxin should not exceed 30 micrograms/kg in food products, only two of 96 samples did not meet these criteria. PMID:7859854

  2. 76 FR 72180 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-11-22

    ... continues to be, an important force for political stability and economic progress in East Asia. The Royal... Section 36(b)(1) of the Arms Export Control Act, as amended (i) Prospective Purchaser: Malaysia. (ii... Arms Export Control Act. Policy Justification Malaysia--AIM-9X-2 SIDEWINDER Missiles The Government...

  3. 26 CFR 1.167(b)-1 - Straight line method.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Straight line method. 1.167(b)-1 Section 1.167(b... Straight line method. (a) In general. Under the straight line method the cost or other basis of the... may be reduced to a percentage or fraction. The straight line method may be used in determining...

  4. 26 CFR 1.677(b)-1 - Trusts for support.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) INCOME TAXES Grantors and Others Treated As Substantial Owners § 1.677(b)-1 Trusts for support... the child of the grantor, whom the grantor or his spouse is legally obligated to support. If income of... extent income of the current year is actually applied for the support or maintenance of his spouse....

  5. 77 FR 70153 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-11-23

    ... in the region. The principal contractors will be Raytheon/Lockheed Martin Javelin Joint Venture in... Section 36(b)(1) of the Arms Export Control Act, as amended (i) Prospective Purchaser: Oman (ii) Total... Section 47(6) of the Arms Export Control Act. POLICY JUSTIFICATION Oman--Javelin Missile The Sultanate...

  6. 77 FR 70151 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2012-11-23

    ... region. The principal contractors will be Raytheon/Lockheed Martin Javelin Joint Venture (JJV) in Tucson... Section 36(b)(1) of the Arms Export Control Act, as amended (i) Prospective Purchaser: Indonesia. (ii... defined in Section 47(6) of the Arms Export Control Act. (iii) Description and Quantity or Quantities...

  7. Aflatoxin B1content in patients with hepatic diseases Aflatoxina B1 en pacientes con enfermedades hepáticas

    Directory of Open Access Journals (Sweden)

    Clara López

    2002-08-01

    Full Text Available Aflatoxins are toxic metabolites of some Aspergillus flavus, A. parasiticus and A. nomius strains that occur in many foods and feeds. There are four major natural occurring aflatoxins: B1, B2, G1 and G2. These toxins can cause illness in human beings and animals. Aflatoxin B1 is the most abundant and toxic member of the family, and it is also the most potent hepatocarcinogen known. In order to estimate the potential human health risk of AFB1, it is useful to measure blood concentration. The presence of aflatoxin B1 in patients was evaluated by high-performance liquid chromatography, in serum samples, obtained from 20 patient volunteers with hepatic disease. Out of the 20 patients, the presence of AFB1 was detected in only one of them, in a concentration of 0.47 ng/cm³. Nevertheless, this result should draw the attention of control organizations in Argentina to the need for a thorough food and feed inspection.Las aflatoxinas son metabolitos tóxicos producidos por cepas de Aspergillus flavus, A. parasiticus y A. nomius, presentes en alimentos y piensos. Las cuatro aflatoxinas principales son: aflatoxina B1, B2, G1 y G2. Dichas toxinas pueden causar enfermedades tanto en seres humanos como en animales. La aflatoxina B1 es la más abundante y la más tóxica del grupo y es también el más potente hepatocarcinógeno conocido. El objetivo de este trabajo fue detectar la presencia de aflatoxina B1 en sangre humana para estimar el riesgo potencial de la salud. La determinación de aflatoxina B1 fue realizada por cromatografía líquida de alto rendimiento, en suero de 20 pacientes voluntarios con enfermedades hepáticas. En sólo uno de estos pacientes se detectó la presencia de aflatoxina B1, en una concentración de 0.47ng/cm³. Estos resultados deberían ser tenidos en cuenta por los responsables de la vigilancia y control de los alimentos en la Argentina.

  8. "超"售迈凯轮P1

    Institute of Scientific and Technical Information of China (English)

    2013-01-01

    在本届日内瓦车展上,一直备受关注的超级跑车迈凯轮P1量产版车型终于亮相了,这款仅售375辆的车型虽然标价800多万元,但已预订一空,不要埋怨迈凯轮P1的产量小,曾经创下当时最快量产车的世界纪录的迈凯轮F1也只生产了100辆,所以迈凯轮P1已经算是超售了。

  9. Transcriptional Auto-Regulation of RUNX1 P1 Promoter.

    Directory of Open Access Journals (Sweden)

    Milka Martinez

    Full Text Available RUNX1 a member of the family of runt related transcription factors (RUNX, is essential for hematopoiesis. The expression of RUNX1 gene is controlled by two promoters; the distal P1 promoter and the proximal P2 promoter. Several isoforms of RUNX1 mRNA are generated through the use of both promoters and alternative splicing. These isoforms not only differs in their temporal expression pattern but also exhibit differences in tissue specificity. The RUNX1 isoforms derived from P2 are expressed in a variety of tissues, but expression of P1-derived isoform is restricted to cells of hematopoietic lineage. However, the control of hematopoietic-cell specific expression is poorly understood. Here we report regulation of P1-derived RUNX1 mRNA by RUNX1 protein. In silico analysis of P1 promoter revealed presence of two evolutionary conserved RUNX motifs, 0.6kb upstream of the transcription start site, and three RUNX motifs within 170bp of the 5'UTR. Transcriptional contribution of these RUNX motifs was studied in myeloid and T-cells. RUNX1 genomic fragment containing all sites show very low basal activity in both cell types. Mutation or deletion of RUNX motifs in the UTR enhances basal activity of the RUNX1 promoter. Chromatin immunoprecipitation revealed that RUNX1 protein is recruited to these sites. Overexpression of RUNX1 in non-hematopoietic cells results in a dose dependent activation of the RUNX1 P1 promoter. We also demonstrate that RUNX1 protein regulates transcription of endogenous RUNX1 mRNA in T-cell. Finally we show that SCL transcription factor is recruited to regions containing RUNX motifs in the promoter and the UTR and regulates activity of the RUNX1 P1 promoter in vitro. Thus, multiple lines of evidence show that RUNX1 protein regulates its own gene transcription.

  10. Cytochrome P3-450 cDNA encodes aflatoxin B1-4-hydroxylase.

    Science.gov (United States)

    Faletto, M B; Koser, P L; Battula, N; Townsend, G K; Maccubbin, A E; Gelboin, H V; Gurtoo, H L

    1988-09-01

    Aflatoxin B1 (AFB1), a potent hepatocarcinogen and ubiquitous dietary contaminant in some countries, is detoxified to aflatoxin M1 (AFM1) via cytochrome P-450-mediated AFB1-4-hydroxylase. Genetic studies in mice have demonstrated that the expression of AFB1-4-hydroxylase is regulated by the aryl hydrocarbon locus and suggested that different cytochrome P-450 isozymes catalyze AFB1-4-hydroxylase and aryl hydrocarbon hydroxylase activities. We have now examined lysates from mammalian cells infected with recombinant vaccinia viruses containing expressible cytochrome P1-450 or P3-450 cDNAs for their ability to metabolize AFB1 to AFM1. Our results show that cytochrome P3-450 cDNA specifies AFB1-4-hydroxylase. This is the first direct assignment of a specific cytochrome P-450 to an AFB1 detoxification pathway. This finding may have relevance to the dietary modulation of AFB1 hepatocarcinogenesis.

  11. STS-113 P1 Truss paylad in Payload Changeout Room

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. - From the Payload Changeout Room on Launch Pad 39A, the P1 truss payload, plus the Crew and Equipment Translation Aid (CETA) cart B, are moved into the payload bay of Space Shuttle Endeavour. Scheduled to launch Nov. 10 on mission STS-113, Endeavour will make the 16th assembly flight to the International Space Station. Once delivered, the P1 truss will remain stowed until flight 12A.1 in 2003 when it will be attached to the central truss segment, S0, on the Space Station. The mission will also deliver the Expedition 6 crew to the Station and return Expedition 5 to Earth.

  12. Abnormal Expressions of Age, RAGE, TGF- b1 and TGF- b1 Receptor in Colonic Wall Contributed to STZ-Induced Diabetic Colon Remodeling

    DEFF Research Database (Denmark)

    Zhao, Jingbo; Gregersen, Hans

    2016-01-01

    glycation end product (AGE) and AGE receptor (RAGE) were up-regulated in the diabetic colon wall (2). However, it lacks data in relation to the association between AGE, RAGE, transforming growth factor- b1 (TGF-b1) and TGFb1 receptor expressions with colon morphological and biomechanical remodeling...... glucose level was measured. The parameters of morphometric and biomechanical properties of colonic segments were obtained from diabetic (DM) and normal (Con) rats. The expressions of AGE, RAGE, TGF- b1 and TGF- b1 receptor were detected in different layers of the colon by immunohistochemistry. In order...... to determine the expressions of AGE, RAGE, TGF- b1 and TGF- b1 receptor in association with other parameters, and to see interrelation among AGE, RAGE, TGF- b1 and TGF- b1 receptor expressions, the multiple linear regression analysis was done. Results: The expressions of AGE, RAGE, TGF-b1 and TGF- b1 receptor...

  13. Biochemical characterization of the GM2 gangliosidosis B1 variant

    Directory of Open Access Journals (Sweden)

    J.C. Tutor

    2004-06-01

    Full Text Available The deficiency of the A isoenzyme of ß-hexosaminidase (Hex produced by different mutations of the gene that codes for the alpha subunit (Tay-Sachs disease has two variants with enzymological differences: the B variant consists of the absence of Hex A isoenzyme and the B1 variant produces an inactive Hex A isoenzyme for the hydrolysis of the GM2 ganglioside and synthetic substrates with negative charge. In contrast to the early childhood form of the B variant, the B1 variant appears at a later clinical stage (3 to 7 years of age with neurodegenerative symptoms leading to the death of the patient in the second decade of life. The most frequent mutation responsible for the GM2 gangliosidosis B1 variant is R178H, which has a widespread geographic and ethnic distribution. The highest incidence has been described in Portugal, which has been suggested as the point of origin of this mutation. Biochemical characterization of this lysosomal disease is carried out using negatively charged synthetic alpha subunit-specific sulfated substrates, since Hex A isoenzyme heat-inactivation assays are not applicable. However, the determination of the apparent activation energy of Hex using the neutral substrate 3,3'-dichlorophenolsulfonphthaleinyl N-acetyl-ß-D-glucosaminide, may offer a valid alternative. The presence of an alpha subunit in the alphaß heterodimer Hex A means that its activation energy (41.8 kJ/mol is significantly lower than that of the ßß homodimer Hex B (75.1 kJ/mol; however, as mutation inactivates the alpha subunit, the Hex A of the B1 variant presents an activation energy that is similar to that of the Hex B isoenzyme.

  14. Rapid Immunoenzyme Assay of Aflatoxin B1 Using Magnetic Nanoparticles

    OpenAIRE

    Urusov, Alexandr E.; Alina V. Petrakova; Vozniak, Maxim V.; Zherdev, Anatoly V.; Boris B. Dzantiev

    2014-01-01

    The main limitations of microplate-based enzyme immunoassays are the prolonged incubations necessary to facilitate heterogeneous interactions, the complex matrix and poorly soluble antigens, and the significant sample dilutions often required because of the presence of organic extractants. This study presents the use of antibody immobilization on the surface of magnetic particles to overcome these limitations in the detection of the mycotoxin, aflatoxin B1. Features of the proposed system are...

  15. Occurrence of aflatoxin B1 in natural products

    OpenAIRE

    Guilherme Prado; Altoé, Aline F.; Tatiana C. B. Gomes; Leal, Alexandre S.; Morais, Vanessa A. D.; Marize S. Oliveira; Marli B. Ferreira; Gomes, Mateus B.; Fabiano N. Paschoal; Rafael von S. Souza; Daniela A. Silva; Cruz Madeira, Jovita E. G.

    2012-01-01

    The media claims for the consumption of natural resource-based food have gradually increased in both developing and developed countries. The interest in the safety of these products is partially due to the possible presence of toxigenic fungi acting as mycotoxin producers, such as aflatoxins produced during the secondary metabolism of Aspergillus flavus, A. parasiticus and A. nomius. Aflatoxins, mainly aflatoxin B1, are directly associated with liver cancer in human beings. This paper is aime...

  16. Improving MRI surface coil decoupling to reduce B1 distortion

    Science.gov (United States)

    Larson, Christian

    As clinical MRI systems continue to advance, larger focus is being given to image uniformity. Good image uniformity begins with generating uniform magnetic fields, which are easily distorted by induced currents on receive-only surface coils. It has become an industry standard to combat these induced currents by placing RF blocking networks on surface coils. This paper explores the effect of blocking network impedance of phased array surface coils on B1 distortion. It has been found and verified, that traditional approaches for blocking network design in complex phased arrays can leave undesirable B1 distortions at 3 Tesla. The traditional approach of LC tank blocking is explored, but shifts from the idea that higher impedance equals better B1 distortion at 3T. The result is a new design principle for a tank with a finite inductive reactance at the Larmor Frequency. The solution is demonstrated via simulation using a simple, single, large tuning loop. The same loop, along with a smaller loop, is used to derive the new design principle, which is then applied to a complex phased array structure.

  17. Study of Infrared Emission Spectroscopy for the B1Δg-A1Πu and B'1Σg+-A1Πu Systems of C2

    Science.gov (United States)

    Tang, Jian; Chen, Wang; Kawaguchi, Kentarou; Bernath, Peter F.

    2016-06-01

    Recently, we carried out the perturbation analysis of C_2 spectra and identified forbidden singlet-triplet intersystem transitions, which aroused further interest in other C_2 spectra for the many low-lying electronic states of this fundamental molecule. In 1988, the B1Δg-A1Πu and B'1Σg+-A1Πu band systems were discovered by Douay et al., who observed eight bands of the B1Δg-A1Πu system with v up to 5 for the B1Δg state and six bands of the B'1Σg+-A1Πu system with v up to 3 for the B'1Σg+ state in the Fourier transform infrared emission spectra of hydrocarbon discharges. In the work presented here, we identified twenty-four bands of the two systems, among which the B'1Σg+ v = 4 and the B1Δg v = 6, 7 and 8 vibrational levels involved in nine bands were studied for the first time. A direct global analysis with Dunham parameters was carried out satisfactorily for the B1Δg-A1Πu system except for a small perturbation in the B1Δg v = 6 level. The calculated rovibrational term energies up to B1Δg v = 12 showed that the level crossing between the B1Δg and d3Πg states is responsible for many of the prominent perturbations in the Swan system observed previously. Nineteen lines of the B1Δg-a3Πu forbidden transitions were identified and the off-diagonal spin-orbit interaction constant AdB between d3Πg and B1Δg was derived as 8.3(1) wn. For the B'1Σg+-A1Πu system, only individual band analyses for each vibrational level in the B'1Σg+ state could be done satisfactorily and Dunham parameters obtained from these effective parameters showed that the anharmonic vibrational constant ω_e x_e is anomalously small (nearly zero). Inspection of the RKR potential curves for the B'1Σg+ and X1Σg+ states revealed that an avoided crossing may occur around 30000 wn, which is responsible for the anomalous molecular constants in these two states. W. Chen, K. Kawaguchi, P. F. Bernath, and J. Tang, J. Chem. Phys., 141, 064317 (2015) M. Douay, R. Nietmann and P. F. Bernath

  18. Wind tunel tests of Risoe-B1-18 and Risoe-B1-24

    Energy Technology Data Exchange (ETDEWEB)

    Fuglsang, P.; Bak, C.; Gaunaa, M.; Antoniou, I.

    2003-01-01

    This report contains 2D measurements of the Risoe-B1-18 and Risoe-B1-24 airfoils. The aerodynamic properties were derived from pressure measurements on the airfoil surface and in the wake. The measurements were conducted in the VELUX open jet wind tunnel, which has a background turbulence intensity of 1%, and an inlet flow velocity of 42 m/s. The airfoil sections had a chord of 0.600 m giving a Reynolds number of 1.6Oe106. The span was 1.9 m and end plates were used to minimize 3D flow effects. The measurements comprised both static and dynamic inflow. Static inflow covered angles of attack from 5o to 30 deg. Dynamic inflow was obtained by pitching the airfoil in a harmonic motion around various mean angles of attack. The test matrix involved smooth flow, various kinds of leading edge roughness, stall strips, vortex generators and Gurney flaps in different combinations. The quality of the measurements was good and the agreement between measurements and numerical CFD predictions with EllipSys2D was good. For both airfoils predictions with turbulent flow captured very well the shapes of lift and drag curves as well as the magnitude of maximum lift. Measurements of Risoe-B1-18 showed that the maximum lift coefficient was 1.64 at an angle of attack of approximately 13 deg. The airfoil was not very sensitive to leading edge roughness despite its high maximum lift. Measurements with stall strips showed that stall strips could control the level of maximum lift. The Risoe-B1-24 measurements showed that the maximum lift coefficient was 1.62 at an angle of attack of approximately 14 deg. The airfoil was only little sensitive to leading edge roughness despite its high relative thickness and high maximum lift. Measurements with delta wing shaped vortex generators increased the maximum lift coefficient to 2.02 and measurements with Gurney flaps increased the maximum lift coefficient to 1.85. Measurements with combination of vortex generators and Gurney flaps showed a maximum

  19. Effect of water molecules on the fluorescence enhancement of Aflatoxin B1 mediated by Aflatoxin B1:beta-cyclodextrin complexes. A theoretical study.

    Science.gov (United States)

    Ramírez-Galicia, Guillermo; Garduño-Juárez, Ramón; Gabriela Vargas, M

    2007-01-01

    In order to explain the observed fluorescence enhancement of Aflatoxin B1 (AFB1) when forming AFB1:beta-cyclodextrin (AFB1:beta-CD) inclusion complexes, we have performed a theoretical (quantum chemistry calculations) study of AFB1 and AFB1:beta-CD in vacuum and in the presence of aqueous solvent. The AM1 method was used to calculate the absorption and emission wavelengths of these molecules. With the help of density functional theory (DFT) and time-dependent DFT (TDDFT) vibrational frequencies and related excitation energies of AFB1 and AFB1.(H2O)m = 4,5,6,11 were calculated. On the basis of these calculations we propose a plausible mechanism for the fluorescence enhancement of AFB1 in the presence of beta-CD: (1) before photoexcitation of AFB1 to its S1 excited state, there is a vibrational coupling between the vibrational modes involving the AFB1 carbonyl groups and the bending modes of the nearby water molecules (CG + WM); (2) these interactions allow a thermal relaxation of the excited AFB1 molecules that results in fluorescence quenching; (3) when the AFB1 molecules form inclusion complexes with beta-CD the CG + WM interaction decreases; and (4) this gives rise to a fluorescence enhancement.

  20. Study of di-pion Bottomonium Transitions and Search for the h_b(1P) State

    Energy Technology Data Exchange (ETDEWEB)

    Lees, J.P.; Poireau, V.; Tisserand, V.; /Annecy, LAPP; Garra Tico, J.; Grauges, E.; /Barcelona U., ECM; Martinelli, M.; /INFN, Bari /Bari U.; Milanes, D.A.; /INFN, Bari; Palano, A.; Pappagallo, M.; /INFN, Bari /Bari U.; Eigen, G.; Stugu, B.; Sun, L.; /Bergen U.; Brown, D.N.; Kerth, L.T.; Kolomensky, Yu.G.; Lynch, G.; /UC, Berkeley; Koch, H.; Schroeder, T.; /Ruhr U., Bochum; Asgeirsson, D.J.; Hearty, C.; Mattison, T.S.; /British Columbia U. /Brunel U. /Novosibirsk, IYF /UC, Irvine /UC, Riverside /UC, Santa Barbara /UC, Santa Cruz /Caltech /Cincinnati U. /Colorado U. /Colorado State U. /Dortmund U. /Dresden, Tech. U. /Ecole Polytechnique /Edinburgh U. /INFN, Ferrara /INFN, Ferrara /Ferrara U. /INFN, Ferrara /Frascati /INFN, Genoa /Genoa U. /INFN, Genoa /INFN, Genoa /Genoa U. /INFN, Genoa /Indian Inst. Tech., Guwahati /Harvard U. /Harvey Mudd Coll. /Heidelberg U. /Humboldt U., Berlin /Imperial Coll., London /Iowa State U. /Iowa State U. /Johns Hopkins U. /Paris U., VI-VII /LLNL, Livermore /Liverpool U. /Queen Mary, U. of London /Royal Holloway, U. of London /Royal Holloway, U. of London /Louisville U. /Mainz U., Inst. Kernphys. /Manchester U. /Maryland U. /Massachusetts U., Amherst /MIT /McGill U. /INFN, Milan /Milan U. /INFN, Milan /INFN, Milan /Milan U. /Mississippi U. /Montreal U. /INFN, Naples /Naples U. /NIKHEF, Amsterdam /NIKHEF, Amsterdam /Notre Dame U. /Ohio State U. /Oregon U. /INFN, Padua /Padua U. /INFN, Padua /INFN, Padua /Padua U. /Paris U., VI-VII /INFN, Perugia /Perugia U. /INFN, Pisa /Pisa U. /INFN, Pisa /Pisa, Scuola Normale Superiore /INFN, Pisa /Pisa U. /INFN, Pisa /INFN, Pisa /Pisa U. /INFN, Pisa /Princeton U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /INFN, Rome /Rome U. /INFN, Rome /Rostock U. /Rutherford /DAPNIA, Saclay /SLAC /South Carolina U. /Southern Methodist U. /Stanford U., Phys. Dept. /SUNY, Albany /Tel Aviv U. /Tennessee U. /Texas Nuclear Corp., Austin /Texas U., Dallas /INFN, Turin /Turin U. /INFN, Trieste /Trieste U. /Valencia U. /Victoria U. /Warwick U. /Wisconsin U., Madison

    2011-12-09

    We study inclusive di-pion decays using a sample of 108 x 10{sup 6} {Upsilon}(3S) events recorded with the BABAR detector. We search for the decay mode {Upsilon}(3S) {yields} {pi}{sup +}{pi}{sup -}h{sub b} (1P) and find no evidence for the bottomonium spin-singlet state h{sub b}(1P) in the invariant mass distribution recoiling against the {pi}{sup +}{pi}{sup -} system. Assuming the h{sub b}(1P) mass to be 9.900 GeV/c{sup 2}, we measure the upper limit on the branching fraction {Beta}[{Upsilon}(3S) {yields} {pi}{sup +}{pi}{sup -}h{sub b}(1P)] < 1.2 x 10{sup -4}, at 90% confidence level. We also investigate the {chi}{sub bJ}(2P) {yields} {pi}{sup +}{pi}{sup -} {chi}{sub bJ}(1P), {Upsilon}(3S) {yields} {pi}{sup +}{pi}{sup -}{Upsilon}(2S), and {Upsilon}(2S) {yields} {pi}{sup +}{pi}{sup -}{Upsilon}(1S) di-pion transitions and present an improved measurement of the branching fraction of the {Upsilon}(3S) {yields} {pi}{sup +}{pi}{sup -}{Upsilon}(2S) decay and of the {Upsilon}(3S) - {Upsilon}(2S) mass difference.

  1. First observation of the hadronic transition $ \\Upsilon(4S) \\to \\eta h_{b}(1P)$ and new measurement of the $h_b(1P)$ and $\\eta_b(1S)$ parameters

    CERN Document Server

    Tamponi, U; Abdesselam, A; Aihara, H; Arinstein, K; Asner, D M; Atmacan, H; Aushev, T; Ayad, R; Badhrees, I; Bakich, A M; Barberio, E; Bhardwaj, V; Bhuyan, B; Biswal, J; Bondar, A; Bonvicini, G; Bozek, A; Bračko, M; Browder, T E; Červenkov, D; Chen, A; Cheon, B G; Cho, K; Chobanova, V; Choi, S -K; Choi, Y; Cinabro, D; Danilov, M; Doležal, Z; Drásal, Z; Drutskoy, A; Eidelman, S; Epifanov, D; Farhat, H; Fast, J E; Ferber, T; Fulsom, B G; Gaur, V; Gabyshev, N; Garmash, A; Getzkow, D; Gillard, R; Goh, Y M; Golob, B; Haba, J; Hayasaka, K; Hayashii, H; He, X H; Hedges, M T; Hou, W -S; Iijima, T; Inami, K; Ishikawa, A; Jaegle, I; Joffe, D; Julius, T; Kato, E; Katrenko, P; Kichimi, H; Kiesling, C; Kim, D Y; Kim, H J; Kim, J H; Kim, K T; Kim, S H; Kinoshita, K; Kodyš, P; Korpar, S; Križan, P; Krokovny, P; Kumita, T; Kuzmin, A; Lange, J S; Lewis, P; Libby, J; Lukin, P; Matvienko, D; Miyabayashi, K; Miyata, H; Mizuk, R; Mohanty, G B; Moll, A; Mori, T; Nakano, E; Nakao, M; Nanut, T; Natkaniec, Z; Nayak, M; Nisar, N K; Nishida, S; Ogawa, S; Okuno, S; Olsen, S L; Ostrowicz, W; Oswald, C; Pakhlova, G; Pal, B; Park, H; Pedlar, T K; Pesántez, L; Pestotnik, R; Petriřc, M; Piilonen, L E; Ribežl, E; Ritter, M; Rostomyan, A; Ryu, S; Sakai, Y; Sandilya, S; Santelj, L; Sanuki, T; Sato, Y; Savinov, V; Schneider, O; Schnell, G; Schwanda, C; Semmler, D; Senyo, K; Sevior, M E; Shapkin, M; Shebalin, V; Shen, C P; Shibata, T -A; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Sohn, Y -S; Sokolov, A; Starič, M; Steder, M; Stypula, J; Tanida, K; Teramoto, Y; Trabelsi, K; Uchida, M; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Van Hulse, C; Vanhoefer, P; Varner, G; Vinokurova, A; Vossen, A; Wagner, M N; Wang, M -Z; Wang, X L; Watanabe, Y; Williams, K M; Won, E; Yamaoka, J; Yashchenko, S; Zhang, Z P; Zhilich, V; Zhulanov, V; Zupanc, A

    2015-01-01

    Using a sample of $771.6 \\times 10^{6}$ $\\Upsilon(4S)$ decays collected by the Belle experiment at the KEKB $e^+e^-$ collider, we observe for the first time the transition $\\Upsilon(4S) \\to \\eta h_b(1P)$ with the branching fraction ${\\cal B}[\\Upsilon(4S) \\to \\eta h_b(1P)]= (2.18 \\pm 0.11 \\pm 0.18) \\times 10^{-3}$ and we measure the $h_b(1P)$ mass $M_{h_{b}(1P)} = (9899.3 \\pm 0.4 \\pm 1.0)$ MeV/$c^{2}$, corresponding to the hyperfine splitting $\\Delta M_{\\mathrm HF}(1P) = (0.6 \\pm 0.4 \\pm 1.0)$ MeV/$c^{2}$. Using the transition $h_b(1P) \\to \\gamma \\eta_b(1S)$, we measure the $\\eta_b(1S)$ mass $M_{\\eta_{b}(1S)} = (9400.7 \\pm 1.7 \\pm 1.6)$ MeV/$c^{2}$, corresponding to $\\Delta M_{\\mathrm HF}(1S) = (59.6 \\pm 1.7 \\pm 1.6)$ MeV/$c^{2}$, the $\\eta_b(1S)$ width $\\Gamma_{\\eta_{b}(1S)} = (8 ^{+6}_{-5} \\pm 5)$ MeV/$c^{2}$ and the branching fraction ${\\cal B}[h_b(1P) \\to \\gamma \\eta_b(1S)]= (56 \\pm 8 \\pm 4) \\%$.

  2. Theoretical study of B3-to-B1 phase transition in ZnS

    Science.gov (United States)

    Li, Qiang; Zhang, Rui; Lv, Tianquan; Cao, Qilong

    2016-10-01

    The pressure-induced phase transformation from B3 to B1 structures in ZnS using first-principle projector-augmented wave method is studied. To understand the nature and driving force behind the transition, the interesting properties in both phases, including enthalpy, phonon dispersion curves and elastic constants, are systematically investigated. The results show that the calculated transition pressure is within the range of 16.33 GPa to 19.04 GPa, which is in good agreement with the available experimental and theoretical data. The transition process can be viewed as the appearance and disappearance of very slight lattice distortion accompanied by the movement of Zn and S atoms along the [111] crystallographic axis. The physical driving force of the B3-B1 phase transition is confirmed to be a coupling effect between the mechanical instability of B3 phase under pressure and the softening acoustic phonon mode resulting from the pressure-induced lattice deformation. For B1 phase, it is further predicted that a new phase transition takes place at about 59.9 GPa.

  3. Experimental validation of hyperthermia SAR treatment planning using MR B1+ imaging

    International Nuclear Information System (INIS)

    In this paper the concept of using B1+ imaging as a means to validate SAR models for radiofrequency hyperthermia is presented. As in radiofrequency hyperthermia, in common clinical MR imaging which applies RF frequencies between 64 and 128 MHz, the RF field distribution inside a patient is largely determined by the dielectric distribution of the anatomy. Modern MR imaging techniques allow measurement of the RF magnetic field component B1+ making it possible to measure at high resolution the dielectric interaction of the RF field with the patient. Given these considerations, we propose to use MR imaging to verify the validity of our dielectric patient model used for SAR models of radiofrequency hyperthermia. The aim of this study was to investigate the feasibility of this concept by performing B1+ measurements and simulations on cylindrical split phantoms consisting of materials with dielectric properties similar to human tissue types. Important topics of investigation were the accuracy and sensitivity of B1+ measurements and the validity of the electric model of the MR body coil. The measurements were performed on a clinical 1.5 T MR scanner with its quadrature body coil operating at 64 MHz. It was shown that even small B1+ variations of 2 to 5% could be measured reliably in the phantom experiments. An electrical model of the transmit coil was implemented on our FDTD-based hyperthermia treatment planning platform and the RF field distributions were calculated assuming an idealized quadrature current distribution in the coil. A quantitatively good correlation between measurements and simulations was found for phantoms consisting of water and oil, while highly conductive phantoms show considerable deviations. However, assuming linear excitation for these conductive phantoms resulted in good correspondence. As an explanation it is suggested that the coil is being detuned due to the inductive nature of the conductive phantoms, breaking up the phase difference of π/2

  4. Towards the understanding of 11p1 meson mass spectrum

    Institute of Scientific and Technical Information of China (English)

    Feng Xue-Chao; Jiang Feng-Chun; Chang Tong-Qin; Feng Jun-Lan

    2008-01-01

    Based on the meson-meson mixing and Regge trajectory, this paper establishes the mass relations which can describe the mass spectrum of 11P1 meson state. Using these mass relations, it obtains the mass of KIB, h1 (1380) and hc(1P) to be 1358.5MeV, 1468 MeV and 3543.9 MeV, respectively. The results axe compared with other theoretical results and should be tested by experiments in the future.

  5. P1 Truss Radiator assembly processing at KSC

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- In the Space Station Processing Facility, an overhead crane moves the newly arrived radiator assembly toward a workstand. The radiator is part of the payload on mission STS-113, which also includes the first port truss segment, P1 Truss, to be attached to the central truss segment, S0 Truss, on the International Space Station. Once delivered, the will remain stowed until flight 12A.1. STS-113 is scheduled to launch Oct. 6, 2002

  6. Safety evaluation of nuclease P1 from Penicillium citrinum.

    Science.gov (United States)

    Okado, Nobuo; Hasegawa, Kazushige; Mizuhashi, Fukutaro; Lynch, Barry S; Vo, Trung D; Roberts, Ashley S

    2016-02-01

    Nuclease P1 has been widely used in the food industry to enhance or create flavor. One commercial source of this enzyme is Penicillium citrinum, an anamorphic mesophilic fungus with a long history of safe use in Europe and Asia as a fermentation organism used in the production of ribonucleases. Given the intended use in food for human consumption, and noting its potential presence at trace levels in finished products, a series of safety studies including an in vitro Ames and chromosome aberration assay, an in vivo rat erythrocyte micronucleus assay and a 90-day oral toxicity study in rats were conducted. No mutagenic activity was observed in the Ames assay. Equivocal activity in the chromosome aberration assay was not replicated in the micronucleus assay at doses of up to 1007 mg total organic solids (TOS)/kg body weight (bw)/day. Following oral administration of nuclease P1 at dosages of 10.1, 101 or 1007 mg TOS/kg bw/day to Sprague-Dawley rats, no adverse effects on any study parameter were observed. The no-observed-adverse-effect level was considered to be 1007 mg TOS/kg bw/day. The results of the genotoxicity studies and subchronic rat study support the safe use in food production of nuclease P1 produced from P. citrinum.

  7. Characterization and adsorption of Lactobacillus virulent phage P1.

    Science.gov (United States)

    Chen, X; Xi, Y; Zhang, H; Wang, Z; Fan, M; Liu, Y; Wu, W

    2016-09-01

    Bacteriophage infection of lactic acid bacteria is considered an important problem worldwide in the food fermentation industry, as it may produce low quality or unsafe foods, cause fermentation failure, and result in economic losses. To increase current knowledge on the properties of Lactobacillus virulent phages, we evaluated the effect of divalent cations, temperature, pH, and chloramphenicol on the adsorption ability of Lactobacillus virulent phage P1. Phage P1 was isolated from the abnormal fermentation liquid of Lactobacillus plantarum IMAU10120. The results showed that this phage belonged to the Siphoviridae family. The latent period of this phage was 45min, and the burst time was 90min. Burst size was 132.88±2.37 phage counts expressed per milliliter per infective center. This phage showed good tolerance at different temperatures, but incubation at 50°C only affected its adsorption. Adsorption rate reached a maximum value between 30 and 42°C. A high adsorption value of phage infectivity was obtained from pH 6 to 8. Moreover, calcium ions promoted and increased the adsorption capacity of phage P1, but magnesium ions had negative effects. Chloramphenicol had no effect on phage adsorption. This study increased current knowledge on the characterization and biological aspects of Lactobacillus virulent phages, and may provide some basic information that can be used to design successful antiphage strategies in the food industry. PMID:27372579

  8. Direct Band Gap Gallium Antimony Phosphide (GaSbxP(1-x)) Alloys.

    Science.gov (United States)

    Russell, H B; Andriotis, A N; Menon, M; Jasinski, J B; Martinez-Garcia, A; Sunkara, M K

    2016-01-01

    Here, we report direct band gap transition for Gallium Phosphide (GaP) when alloyed with just 1-2 at% antimony (Sb) utilizing both density functional theory based computations and experiments. First principles density functional theory calculations of GaSbxP(1-x) alloys in a 216 atom supercell configuration indicate that an indirect to direct band gap transition occurs at x = 0.0092 or higher Sb incorporation into GaSbxP(1-x). Furthermore, these calculations indicate band edge straddling of the hydrogen evolution and oxygen evolution reactions for compositions ranging from x = 0.0092 Sb up to at least x = 0.065 Sb making it a candidate for use in a Schottky type photoelectrochemical water splitting device. GaSbxP(1-x) nanowires were synthesized by reactive transport utilizing a microwave plasma discharge with average compositions ranging from x = 0.06 to x = 0.12 Sb and direct band gaps between 2.21 eV and 1.33 eV. Photoelectrochemical experiments show that the material is photoactive with p-type conductivity. This study brings attention to a relatively uninvestigated, tunable band gap semiconductor system with tremendous potential in many fields. PMID:26860470

  9. Direct Band Gap Gallium Antimony Phosphide (GaSbxP1-x) Alloys

    Science.gov (United States)

    Russell, H. B.; Andriotis, A. N.; Menon, M.; Jasinski, J. B.; Martinez-Garcia, A.; Sunkara, M. K.

    2016-02-01

    Here, we report direct band gap transition for Gallium Phosphide (GaP) when alloyed with just 1-2 at% antimony (Sb) utilizing both density functional theory based computations and experiments. First principles density functional theory calculations of GaSbxP1-x alloys in a 216 atom supercell configuration indicate that an indirect to direct band gap transition occurs at x = 0.0092 or higher Sb incorporation into GaSbxP1-x. Furthermore, these calculations indicate band edge straddling of the hydrogen evolution and oxygen evolution reactions for compositions ranging from x = 0.0092 Sb up to at least x = 0.065 Sb making it a candidate for use in a Schottky type photoelectrochemical water splitting device. GaSbxP1-x nanowires were synthesized by reactive transport utilizing a microwave plasma discharge with average compositions ranging from x = 0.06 to x = 0.12 Sb and direct band gaps between 2.21 eV and 1.33 eV. Photoelectrochemical experiments show that the material is photoactive with p-type conductivity. This study brings attention to a relatively uninvestigated, tunable band gap semiconductor system with tremendous potential in many fields.

  10. Common Variants in the ATP2B1 Gene Are Associated With Susceptibility to Hypertension

    Science.gov (United States)

    Tabara, Yasuharu; Kohara, Katsuhiko; Kita, Yoshikuni; Hirawa, Nobuhito; Katsuya, Tomohiro; Ohkubo, Takayoshi; Hiura, Yumiko; Tajima, Atsushi; Morisaki, Takayuki; Miyata, Toshiyuki; Nakayama, Tomohiro; Takashima, Naoyuki; Nakura, Jun; Kawamoto, Ryuichi; Takahashi, Norio; Hata, Akira; Soma, Masayoshi; Imai, Yutaka; Kokubo, Yoshihiro; Okamura, Tomonori; Tomoike, Hitonobu; Iwai, Naoharu; Ogihara, Toshio; Inoue, Itsuro; Tokunaga, Katsushi; Johnson, Toby; Caulfield, Mark; Munroe, Patricia; Umemura, Satoshi; Ueshima, Hirotsugu; Miki, Tetsuro

    2016-01-01

    Hypertension is one of the most common complex genetic disorders. We have described previously 38 single nucleotide polymorphisms (SNPs) with suggestive association with hypertension in Japanese individuals. In this study we extend our previous findings by analyzing a large sample of Japanese individuals (n=14 105) for the most associated SNPs. We also conducted replication analyses in Japanese of susceptibility loci for hypertension identified recently from genome-wide association studies of European ancestries. Association analysis revealed significant association of the ATP2B1 rs2070759 polymorphism with hypertension (P=5.3×10−5; allelic odds ratio: 1.17 [95% CI: 1.09 to 1.26]). Additional SNPs in ATP2B1 were subsequently genotyped, and the most significant association was with rs11105378 (odds ratio: 1.31 [95% CI: 1.21 to 1.42]; P=4.1×10−11). Association of rs11105378 with hypertension was cross-validated by replication analysis with the Global Blood Pressure Genetics consortium data set (odds ratio: 1.13 [95% CI: 1.05 to 1.21]; P=5.9×10−4). Mean adjusted systolic blood pressure was highly significantly associated with the same SNP in a meta-analysis with individuals of European descent (P=1.4×10−18). ATP2B1 mRNA expression levels in umbilical artery smooth muscle cells were found to be significantly different among rs11105378 genotypes. Seven SNPs discovered in published genome-wide association studies were also genotyped in the Japanese population. In the combined analysis with replicated 3 genes, FGF5 rs1458038, CYP17A1, rs1004467, and CSK rs1378942, odds ratio of the highest risk group was 2.27 (95% CI: 1.65 to 3.12; P=4.6×10−7) compared with the lower risk group. In summary, this study confirmed common genetic variation in ATP2B1, as well as FGF5, CYP17A1, and CSK, to be associated with blood pressure levels and risk of hypertension. PMID:20921432

  11. Determination of aflatoxin B1 in medical herbs: interlaboratory study.

    Science.gov (United States)

    Arranz, Isabel; Sizoo, Eric; van Egmond, Hans; Kroeger, Katy; Legarda, Teresa M; Burdaspal, Pedro; Reif, Klaus; Stroka, Joerg

    2006-01-01

    A method was developed for the determination of aflatoxin B1 in medical herbs (senna pods, botanical name Cassia angustifolia; devil's claw, botanical name Harpagophytum procumbens; and ginger roots, botanical name Zingiber officinale). The method, which was tested in a mini-collaborative study by 4 laboratories, is based on an immunoaffinity cleanup followed by reversed-phase high-performance liquid chromatography separation and fluorescence detection after post-column derivatization. It allows the quantitation of aflatoxin B1 at levels lower than 2 ng/g. A second extractant (acetone-water) was tested and compared to the proposed methanol-water extractant. Several post-column derivatization options (electrochemically generated bromine, photochemical reaction, and chemical bromination) as well as different integration modes (height versus area) were also investigated. No differences were found depending on the choice of derivatization system or the signal integration mode used. The method was tested for 3 different matrixes: senna pods, ginger root, and devil's claw. Performance characteristics were established from the results of the study and resulted in HorRat values ranging from 0.12 to 0.75 with mean recoveries from 78 to 91% for the extraction with methanol-water and HorRat values ranging from 0.10-1.03 with mean recoveries from 98 to 103% for the extraction with acetone-water. As a result, the method, with all tested variations, was found to be fit-for-purpose for the determination of aflatoxin B1 in medical herbs at levels of 1 microg/kg and above. PMID:16792057

  12. Isotope shifts of the 2$p_{3/2}$-2$p_{1/2}$ transition in B-like ions

    CERN Document Server

    Zubova, N A; Tupitsyn, I I; Shabaev, V M; Kozhedub, Y S; Plunien, G; Brandau, C; Stohlker, Th

    2016-01-01

    Isotope shifts of the 2$p_{3/2}$-2$p_{1/2}$ transition in B-like ions are evaluated for a wide range of the nuclear charge number: Z=8-92. The calculations of the relativistic nuclear recoil and nuclear size effects are performed using a large scale configuration-interaction Dirac-Fock-Sturm method. The corresponding QED corrections are also taken into account. The results of the calculations are compared with the theoretical values obtained with other methods. The accuracy of the isotope shifts of the 2$p_{3/2}$-2$p_{1/2}$ transition in B-like ions is significantly improved.

  13. Isotope shifts of the 2 p3 /2-2 p1 /2 transition in B-like ions

    Science.gov (United States)

    Zubova, N. A.; Malyshev, A. V.; Tupitsyn, I. I.; Shabaev, V. M.; Kozhedub, Y. S.; Plunien, G.; Brandau, C.; Stöhlker, Th.

    2016-05-01

    Isotope shifts of the 2 p3 /2-2 p1 /2 transition in B-like ions are evaluated for a wide range of the nuclear charge number: Z =8 -92 . The calculations of the relativistic nuclear recoil and nuclear size effects are performed using a large-scale configuration-interaction Dirac-Fock-Sturm method. The corresponding QED corrections are also taken into account. The results of the calculations are compared with the theoretical values obtained with other methods. The accuracy of the isotope shifts of the 2 p3 /2-2 p1 /2 transition in B-like ions is significantly improved.

  14. Sphingosine 1-Phosphate Receptor 1 (S1P1) Upregulation and Amelioration of Experimental Autoimmune Encephalomyelitis by an S1P1 Antagonist

    OpenAIRE

    Cahalan, Stuart M.; Gonzalez-Cabrera, Pedro J.; Nguyen, Nhan; Guerrero, Miguel; Cisar, Elizabeth A. George; Leaf, Nora B.; Brown, Steven J.; Roberts, Edward; Rosen, Hugh

    2013-01-01

    Sphingosine 1-phosphate receptor 1 (S1P1) is a G protein–coupled receptor that is critical for proper lymphocyte development and recirculation. Agonists to S1P1 are currently in use clinically for the treatment of multiple sclerosis, and these drugs may act on both S1P1 expressed on lymphocytes and S1P1 expressed within the central nervous system. Agonists to S1P1 and deficiency in S1P1 both cause lymphocyte sequestration in the lymph nodes. In the present study, we show that S1P1 antagonism ...

  15. Phylogenetic and functional conservation of the NKR-P1F and NKR-P1G receptors in rat and mouse.

    OpenAIRE

    Kveberg, Lise; Dai, Ke-Zheng; Inngjerdingen, Marit; Brooks, Colin G.; Fossum, Sigbjørn; Vaage, John T.

    2011-01-01

    Two clusters of rat Nkrp1 genes can be distinguished based on phylogenetic relationships and functional characteristics. The proximal (centromeric) cluster encodes the well-studied NKR-P1A and NKR-P1B receptors and the distal cluster, the largely uncharacterized, NKR-P1F and NKR-P1G receptors. The inhibitory NKR-P1G receptor is expressed only by the Ly49s3+ NK cell subset as detected by RT-PCR, while the activating NKR-P1F receptor is detected in both Ly49s3+ and NKR-P1B+ NK cells. The mouse ...

  16. Immunological analysis of potato leafroll luteovirus (PLRV) P1 expression identifies a 25 kDa RNA-binding protein derived via P1 processing.

    OpenAIRE

    Prüfer, D; Kawchuk, L; Monecke2, M; Nowok, S; Fischer, R.; Rohde, W

    1999-01-01

    Mono- and polyclonal antibodies directed against different domains of the potato leafroll luteovirus (PLRV) P1 (ORF1) protein were applied to the analysis of P1 expression during PLRV replication in planta. Western analyses detected P1 and a protein of approximately 25 kDa (P1-C25) that accumulated to readily detectable amounts in PLRV-infected plants, but was not detected by in vitro cell-free translation of P1. P1-C25 represents the C-terminus of P1 and is a proteolytic cleavage product pro...

  17. The CHESS survey of the L1157-B1 shock

    Science.gov (United States)

    Busquet, G.; Lefloch, B.; Benedettini, M.; Codella, C.; Cabrit, S.; Ceccarelli, C.; Vasta, M.; Viti, S.; Giannini, T.; Nisini, B.; Cernicharo, J.; Lorenzani, A.

    2012-03-01

    Outflows generated by protostars heavily affect the kinematics and chemistry of the hosting molecular cloud due to strong shocks. These shocks heats and compress the ambient dense gas switching on a complex chemistry that leads to an enhancement of the abundance of several species, as reported in ``chemically active'' outflows, whose archetype is the outflow of the low-mass Class 0 protostar L1157. We present the results of the spectral survey of the shock region L1157-B1 carried out with PACS, SPIRE and HIFI instruments in the framework of the Herschel key program CHESS. The high spectral resolution data from HIFI show that different excitation conditions coexist in the B1 shock while the high PACS spatial resolution data shows a different spatial distribution of the the detected specie. We will discuss the properties of the different gas components and present the physical conditions derived from different species. We will present a first comparison with shock models highlighting the complex structure of this shocked region.

  18. DELF B1 200 activités

    CERN Document Server

    Bloomfield, Anatole

    2006-01-01

    L'ouvrage est organisé par compétences de réception et de production. Chaque partie propose d'abord une présentation de l'épreuve correspondante, puis les activités de préparation suivies d'épreuves-types et d'une auto-évaluation. Dans le cadre d'une approche actionnelle, les activités fournissent les outils nécessaires à la préparation des examens. Elles donnent des exemples concrets répondant aux attentes des candidats comme à celle des examinateurs. LeNouveau DELF B1 propose des activités précises en vue d'atteindre les compétences nécessaires aux épreuves (oral, écrit, réception, production); sa simplicité et sa pédagogie en font une méthode complète. Dans la tradition de la collection Nouvel Entraînez-vous, cet ouvrage est pratique, didactique et se prête à une utilisation en autonomie ou en classe.Le niveau B1 dit " avancé " évalue un niveau de compétence où l'apprenant peut se considérer comme étant indépendant. Arrivé à ce stade, il est apte de comprendre l'inform...

  19. Screening and Initial Binding Assessment of Fumonisin B1 Aptamers

    Directory of Open Access Journals (Sweden)

    Maria C. DeRosa

    2010-11-01

    Full Text Available Fumonisins are mycotoxins produced by Fusarium verticillioides and F. proliferatum, fungi that are ubiquitous in corn (maize. Insect damage and some other environmental conditions result in the accumulation of fumonisins in corn-based products worldwide. Current methods of fumonisin detection rely on the use of immunoaffinity columns and high-performance liquid chromatography (HPLC. The use of aptamers offers a good alternative to the use of antibodies in fumonisin cleanup and detection due to lower costs and improved stability. Aptamers are single-stranded oligonucleotides that are selected using Systematic Evolution of Ligands by EXponential enrichment (SELEX for their ability to bind to targets with high affinity and specificity. Sequences obtained after 18 rounds of SELEX were screened for their ability to bind to fumonisin B1. Six unique sequences were obtained, each showing improved binding to fumonisin B1 compared to controls. Sequence FB1 39 binds to fumonisin with a dissociation constant of 100 ± 30 nM and shows potential for use in fumonisin biosensors and solid phase extraction columns.

  20. Rapid Immunoenzyme Assay of Aflatoxin B1 Using Magnetic Nanoparticles

    Directory of Open Access Journals (Sweden)

    Alexandr E. Urusov

    2014-11-01

    Full Text Available The main limitations of microplate-based enzyme immunoassays are the prolonged incubations necessary to facilitate heterogeneous interactions, the complex matrix and poorly soluble antigens, and the significant sample dilutions often required because of the presence of organic extractants. This study presents the use of antibody immobilization on the surface of magnetic particles to overcome these limitations in the detection of the mycotoxin, aflatoxin B1. Features of the proposed system are a high degree of nanoparticle dispersion and methodologically simple immobilization of the antibodies by adsorption. Reactions between the immobilized antibodies with native and labeled antigens are conducted in solution, thereby reducing the interaction period to 5 min without impairing the analytical outcome. Adsorption of immunoglobulins on the surface of magnetic nanoparticles increases their stability in aqueous-organic media, thus minimizing the degree of sample dilution required. Testing barley and maize extracts demonstrated a limit of aflatoxin B1 detection equal to 20 pg/mL and total assay duration of 20 min. Using this method, only the 3-fold dilution of the initial methanol/water (60/40 extraction mixture in the microplate wells is necessary. The proposed pseudo-homogeneous approach could be applied toward immunodetection of a wide range of compounds.

  1. Rapid immunoenzyme assay of aflatoxin B1 using magnetic nanoparticles.

    Science.gov (United States)

    Urusov, Alexandr E; Petrakova, Alina V; Vozniak, Maxim V; Zherdev, Anatoly V; Dzantiev, Boris B

    2014-01-01

    The main limitations of microplate-based enzyme immunoassays are the prolonged incubations necessary to facilitate heterogeneous interactions, the complex matrix and poorly soluble antigens, and the significant sample dilutions often required because of the presence of organic extractants. This study presents the use of antibody immobilization on the surface of magnetic particles to overcome these limitations in the detection of the mycotoxin, aflatoxin B1. Features of the proposed system are a high degree of nanoparticle dispersion and methodologically simple immobilization of the antibodies by adsorption. Reactions between the immobilized antibodies with native and labeled antigens are conducted in solution, thereby reducing the interaction period to 5 min without impairing the analytical outcome. Adsorption of immunoglobulins on the surface of magnetic nanoparticles increases their stability in aqueous-organic media, thus minimizing the degree of sample dilution required. Testing barley and maize extracts demonstrated a limit of aflatoxin B1 detection equal to 20 pg/mL and total assay duration of 20 min. Using this method, only the 3-fold dilution of the initial methanol/water (60/40) extraction mixture in the microplate wells is necessary. The proposed pseudo-homogeneous approach could be applied toward immunodetection of a wide range of compounds. PMID:25412219

  2. H2S in the L1157-B1 bow shock

    Science.gov (United States)

    Holdship, Jonathan; Viti, Serena; Jimenez-Serra, Izaskun; Lefloch, Bertrand; Codella, Claudio; Podio, Linda; Benedettini, Milena; Fontani, Francesco; Bachiller, Rafael; Tafalla, Mario; Ceccarelli, Cecilia

    2016-11-01

    Sulphur-bearing molecules are highly reactive in the gas phase of the interstellar medium. However, the form in which most of the sulphur is locked on to interstellar dust grains is unknown. By taking advantage of the short time-scales of shocks in young molecular outflows, one could track back the main form of sulphur in the ices. In this paper, six transitions of H2S and its isotopologues in the L1157-B1 bow shock have been detected using data from the Herschel-Chemical HErschel Surveys of Star forming regions survey and the IRAM-30m Astrochemical Surveys At IRAM large programme. These detections are used to calculate the properties of H2S gas in L1157-B1 through use of a rotation diagram and to explore the possible carriers of sulphur on the grains. The isotopologue detections allow the first calculation of the H2S deuteration fraction in an outflow from a low-mass protostar. The fractional abundance of H2S in the region is found to be 6.0 × 10-7 and the deuteration fraction is 2 × 10-2. In order to investigate the form of sulphur on the grains, a chemical model is run with four different networks, each with different branching ratios for the freeze out of sulphur-bearing species into molecules such as OCS and H2S. It is found that the model best fits the data when at least half of each sulphur-bearing species hydrogenates when freezing. We therefore conclude that a significant fraction of sulphur in L1157-B1 is likely to be locked in H2S on the grains.

  3. H2S in the L1157-B1 Bow Shock

    Science.gov (United States)

    Holdship, Jonathan; Viti, Serena; Jimenez-Serra, Izaskun; Lefloch, Bertrand; Codella, Claudio; Podio, Linda; Benedettini, Milena; Fontani, Francesco; Bachiller, Rafael; Tafalla, Mario; Ceccarelli, Cecilia

    2016-08-01

    Sulfur-bearing molecules are highly reactive in the gas phase of the ISM. However, the form in which most of the sulfur is locked onto interstellar dust grains is unknown. By taking advantage of the short time-scales of shocks in young molecular outflows, one could track back the main form of sulfur in the ices. In this paper, six transitions of H2S and its isotopologues in the L1157-B1 bowshock have been detected using data from the Herschel-CHESS survey and the IRAM-30m ASAI large program. These detections are used to calculate the properties of H2S gas in L1157-B1 through use of a rotation diagram and to explore the possible carriers of sulfur on the grains. The isotopologue detections allow the first calculation of the H2S deuteration fraction in an outflow from a low mass protostar. The fractional abundance of H2S in the region is found to be 6.0× 10-7 and the deuteration fraction is 2× 10-2. In order to investigate the form of sulfur on the grains, a chemical model is run with four different networks, each with different branching ratios for the freeze out of sulfur bearing species into molecules such as OCS and H2S. It is found that the model best fits the data when at least half of each sulfur bearing species hydrogenates when freezing. We therefore conclude that a significant fraction of sulfur in L1157-B1 is likely to be locked in H2S on the grains.

  4. H2S in the L1157-B1 Bow shock

    CERN Document Server

    Holdship, Jonathan; Jimenez-Serra, Izaskun; Lefloch, Bertrand; Codella, Claudio; Podio, Linda; Benedettini, Milena; Fontani, Francesco; Bachiller, Rafael; Tafalla, Mario; Ceccarelli, Cecilia

    2016-01-01

    Sulfur-bearing molecules are highly reactive in the gas phase of the ISM. However, the form in which most of the sulfur is locked onto interstellar dust grains is unknown. By taking advantage of the short time-scales of shocks in young molecular outflows, one could track back the main form of sulfur in the ices. In this paper, six transitions of H$_2$S and its isotopologues in the L1157-B1 bowshock have been detected using data from the Herschel-CHESS survey and the IRAM-30m ASAI large program. These detections are used to calculate the properties of H$_2$S gas in L1157-B1 through use of a rotation diagram and to explore the possible carriers of sulfur on the grains. The isotopologue detections allow the first calculation of the H$_2$S deuteration fraction in an outflow from a low mass protostar. The fractional abundance of H$_2$S in the region is found to be 6.0$\\times$10$^{-7}$ and the deuteration fraction is 2$\\times$10$^{-2}$. In order to investigate the form of sulfur on the grains, a chemical model is r...

  5. Performance Simulation of Cathode Strip Chamber Protype P1.

    CERN Document Server

    Velichko, Georgy

    2000-01-01

    The results of simulation of the P1 prototype performance are presented. The P1 prototype is a full scale six-layers trapezoidal cathode strip chamber module designed for the CMS End Cap Muon System. The module was tested at Fermilab with cosmic rays. In this work, complete simulation from the initial ionization to the final amplitude and time distributions of the signals from the CSC as well as the reconstruction of the track coordinate was performed. The physical parameters of the electron behaviour in the gas mixture ( 27% Ar, 29% CF4, 44% CO2) are taken from the Biagi program with the Townsend coefficient and electrons attachment renormalized to fit the observed gas amplification factor and the spatial resolution dependence on a beam entrance angle. The simulation program has reproduced well the measured parameters of the P0' prototype including the time and spatial resolutions. This consideration showed also that 85% of the initial number of ionization electrons are lost due to attachment to gas mixture ...

  6. Plectin isoform P1b and P1d deficiencies differentially affect mitochondrial morphology and function in skeletal muscle

    Science.gov (United States)

    Winter, Lilli; Kuznetsov, Andrey V.; Grimm, Michael; Zeöld, Anikó; Fischer, Irmgard; Wiche, Gerhard

    2015-01-01

    Plectin, a versatile 500-kDa cytolinker protein, is essential for muscle fiber integrity and function. The most common disease caused by mutations in the human plectin gene, epidermolysis bullosa simplex with muscular dystrophy (EBS-MD), is characterized by severe skin blistering and progressive muscular dystrophy. Besides displaying pathological desmin-positive protein aggregates and degenerative changes in the myofibrillar apparatus, skeletal muscle specimens of EBS-MD patients and plectin-deficient mice are characterized by massive mitochondrial alterations. In this study, we demonstrate that structural and functional alterations of mitochondria are a primary aftermath of plectin deficiency in muscle, contributing to myofiber degeneration. We found that in skeletal muscle of conditional plectin knockout mice (MCK-Cre/cKO), mitochondrial content was reduced, and mitochondria were aggregated in sarcoplasmic and subsarcolemmal regions and were no longer associated with Z-disks. Additionally, decreased mitochondrial citrate synthase activity, respiratory function and altered adenosine diphosphate kinetics were characteristic of plectin-deficient muscles. To analyze a mechanistic link between plectin deficiency and mitochondrial alterations, we comparatively assessed mitochondrial morphology and function in whole muscle and teased muscle fibers of wild-type, MCK-Cre/cKO and plectin isoform-specific knockout mice that were lacking just one isoform (either P1b or P1d) while expressing all others. Monitoring morphological alterations of mitochondria, an isoform P1b-specific phenotype affecting the mitochondrial fusion–fission machinery and manifesting with upregulated mitochondrial fusion-associated protein mitofusin-2 could be identified. Our results show that the depletion of distinct plectin isoforms affects mitochondrial network organization and function in different ways. PMID:26019234

  7. Absolute frequency measurement of the magnesium intercombination transition $^1S_0 \\to ^3P_1$

    OpenAIRE

    Friebe, Jan; Pape, André; Riedmann, Matthias; Moldenhauer, Karsten; Mehlstäubler, Tanja; Rehbein, Nils; Lisdat, Christian; Rasel, Ernst M.; Ertmer, Wolfgang; Schnatz, Harald; Lipphardt, Burghard; Grosche, Gesine

    2007-01-01

    We report on a frequency measurement of the $(3s^2)^1S_0\\to(3s3p)^3P_1$ clock transition of $^{24}$Mg on a thermal atomic beam. The intercombination transition has been referenced to a portable primary Cs frequency standard with the help of a femtosecond fiber laser frequency comb. The achieved uncertainty is $2.5\\times10^{-12}$ which corresponds to an increase in accuracy of six orders of magnitude compared to previous results. The measured frequency value permits the calculation of several ...

  8. J/P=1/2+, J/P=3/2+ masses in statistical model

    CERN Document Server

    Kaur, Amanpreet

    2016-01-01

    The mass formulae for the baryon octet and decuplet are calculated. These formulae are function of constituent quark masses and spin spin interaction terms for the quarks inside the baryons. The coe?cients in the mass formulae is estimated by the statistical model for J/P=1/2+, J/P=3/2+, incorporating the contributions from \\sea" containing uu; dd; ss pairs and gluons . The measured masses are presented and found to be matching good with some of the experimental and theoretical data.

  9. Critical role of P1-Runx1 in mouse basophil development

    OpenAIRE

    Mukai, Kaori; BenBarak, Maya J.; Tachibana, Masashi; Nishida, Keigo; Karasuyama, Hajime; Taniuchi, Ichiro; Galli, Stephen J.

    2012-01-01

    Runx1P1N/P1N mice are deficient in the transcription factor distal promoter-derived Runt-related transcription factor 1 (P1-Runx1) and have a > 90% reduction in the numbers of basophils in the BM, spleen, and blood. In contrast, Runx1P1N/P1N mice have normal numbers of the other granulocytes (neutrophils and eosinophils). Although basophils and mast cells share some common features, Runx1P1N/P1N mice have normal numbers of mast cells in multiple tissues. Runx1P1N/P1N mice fail to develop a ba...

  10. First Observation of the Hadronic Transition ϒ(4S)→ηh(b)(1P) and New Measurement of the h(b)(1P) and η(b)(1S) Parameters.

    Science.gov (United States)

    Tamponi, U; Mussa, R; Abdesselam, A; Aihara, H; Arinstein, K; Asner, D M; Atmacan, H; Aushev, T; Ayad, R; Badhrees, I; Bakich, A M; Barberio, E; Bhardwaj, V; Bhuyan, B; Biswal, J; Bondar, A; Bonvicini, G; Bozek, A; Bračko, M; Browder, T E; Červenkov, D; Chen, A; Cheon, B G; Cho, K; Chobanova, V; Choi, S-K; Choi, Y; Cinabro, D; Danilov, M; Doležal, Z; Drásal, Z; Drutskoy, A; Eidelman, S; Epifanov, D; Farhat, H; Fast, J E; Ferber, T; Fulsom, B G; Gaur, V; Gabyshev, N; Garmash, A; Getzkow, D; Gillard, R; Goh, Y M; Golob, B; Haba, J; Hayasaka, K; Hayashii, H; He, X H; Hedges, M T; Hou, W-S; Iijima, T; Inami, K; Ishikawa, A; Jaegle, I; Joffe, D; Julius, T; Kato, E; Katrenko, P; Kichimi, H; Kiesling, C; Kim, D Y; Kim, H J; Kim, J H; Kim, K T; Kim, S H; Kinoshita, K; Kodyš, P; Korpar, S; Križan, P; Krokovny, P; Kumita, T; Kuzmin, A; Lange, J S; Lewis, P; Libby, J; Lukin, P; Matvienko, D; Miyabayashi, K; Miyata, H; Mizuk, R; Mohanty, G B; Moll, A; Mori, T; Nakano, E; Nakao, M; Nanut, T; Natkaniec, Z; Nayak, M; Nisar, N K; Nishida, S; Ogawa, S; Okuno, S; Olsen, S L; Ostrowicz, W; Oswald, C; Pakhlova, G; Pal, B; Park, H; Pedlar, T K; Pesántez, L; Pestotnik, R; Petrič, M; Piilonen, L E; Ribežl, E; Ritter, M; Rostomyan, A; Ryu, S; Sakai, Y; Sandilya, S; Santelj, L; Sanuki, T; Sato, Y; Savinov, V; Schneider, O; Schnell, G; Schwanda, C; Semmler, D; Senyo, K; Sevior, M E; Shapkin, M; Shebalin, V; Shen, C P; Shibata, T-A; Shiu, J-G; Shwartz, B; Sibidanov, A; Simon, F; Sohn, Y-S; Sokolov, A; Starič, M; Steder, M; Stypula, J; Tanida, K; Teramoto, Y; Trabelsi, K; Uchida, M; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Van Hulse, C; Vanhoefer, P; Varner, G; Vinokurova, A; Vossen, A; Wagner, M N; Wang, M-Z; Wang, X L; Watanabe, Y; Williams, K M; Won, E; Yamaoka, J; Yashchenko, S; Zhang, Z P; Zhilich, V; Zhulanov, V; Zupanc, A

    2015-10-01

    Using a sample of 771.6×10(6) ϒϒ(4S) decays collected by the Belle experiment at the KEKB e(+)e(-) collider, we observe, for the first time, the transition ϒ(4S)→ηh(b)(1P) with the branching fraction B[ϒ(4S)→ηh(b)(1P)]=(2.18±0.11±0.18)×10(-3) and we measure the h(b)(1P) mass M(h(b)(1P))=(9899.3±0.4±1.0)  MeV/c(2), corresponding to the hyperfine (HF) splitting ΔM(HF)(1P)=(0.6±0.4±1.0)  MeV/c(2). Using the transition h(b)(1P)→γη(b)(1S), we measure the η(b)(1S) mass M(η(b)(1S))=(9400.7±1.7±1.6)  MeV/c(2), corresponding to ΔM(HF)(1S)=(59.6±1.7±1.6)  MeV/c(2), the η(b)(1S) width Γ(η(b)(1S))=(8(-5)(+6)±5)  MeV/c(2) and the branching fraction B[h(b)(1P)→γη(b)(1S)]=(56±8±4)%. PMID:26551806

  11. Sur l'\\'equation $X^2-\\varepsilon_2\\varepsilon_{p_1p_2}\\varepsilon_{2p_1p_2}=0$

    OpenAIRE

    Azizi, Abdelmalek; Zekhnini, Abdelkader; Taous, Mohammed

    2015-01-01

    Let $p_1\\equiv p_2\\equiv5 \\pmod8$ be prime numbers such that $\\left(\\frac{p_1}{p_2}\\right)=-1$. Let $\\mathbb{L}=Q(\\sqrt2, \\sqrt{p_1p_2})$ Our goal is to resolve the equation $X^2-\\varepsilon_2\\varepsilon_{p_1p_2}\\varepsilon_{2p_1p_2}=0$ in $\\mathbb{L}$, where $\\varepsilon_j$ are fundamental units of real quadratic subfields of $Q(\\sqrt2, \\sqrt{p_1p_2})$.

  12. Redesignation of a Purported P1.15 Subtype-Specific Meningococcal Monoclonal Antibody as a P1.19-Specific Reagent

    OpenAIRE

    Wedege, E.; Caugant, D A; Musacchio, A; Saunders, N. B.; Zollinger, W. D.

    1999-01-01

    Two reference monoclonal antibodies against the meningococcal P1.15 subtype PorA, MN3C5C and 2-1-P1.15, showed only partial concordant recognition of meningococcal isolates. Cyanogen bromide cleavage of P1.19,15 PorA, peptide mapping, and sequencing of porA regions demonstrated that 2-1-P1.15 was specific for subtype P1.19, and henceforth it is to be redesignated as 2-1-P1.19.

  13. A Theoretical Study of 8-Chloro-9-Hydroxy-Aflatoxin B1, the Conversion Product of Aflatoxin B1 by Neutral Electrolyzed Water

    Science.gov (United States)

    Escobedo-González, René; Méndez-Albores, Abraham; Villarreal-Barajas, Tania; Aceves-Hernández, Juan Manuel; Miranda-Ruvalcaba, René; Nicolás-Vázquez, Inés

    2016-01-01

    Theoretical studies of 8-chloro-9-hydroxy-aflatoxin B1 (2) were carried out by Density Functional Theory (DFT). This molecule is the reaction product of the treatment of aflatoxin B1 (1) with hypochlorous acid, from neutral electrolyzed water. Determination of the structural, electronic and spectroscopic properties of the reaction product allowed its theoretical characterization. In order to elucidate the formation process of 2, two reaction pathways were evaluated—the first one considering only ionic species (Cl+ and OH−) and the second one taking into account the entire hypochlorous acid molecule (HOCl). Both pathways were studied theoretically in gas and solution phases. In the first suggested pathway, the reaction involves the addition of chlorenium ion to 1 forming a non-classic carbocation assisted by anchimeric effect of the nearest aromatic system, and then a nucleophilic attack to the intermediate by the hydroxide ion. In the second studied pathway, as a first step, the attack of the double bond from the furanic moiety of 1 to the hypochlorous acid is considered, accomplishing the same non-classical carbocation, and again in the second step, a nucleophilic attack by the hydroxide ion. In order to validate both reaction pathways, the atomic charges, the highest occupied molecular orbital and the lowest unoccupied molecular orbital were obtained for both substrate and product. The corresponding data imply that the C9 atom is the more suitable site of the substrate to interact with the hydroxide ion. It was demonstrated by theoretical calculations that a vicinal and anti chlorohydrin is produced in the terminal furan ring. Data of the studied compound indicate an important reduction in the cytotoxic and genotoxic potential of the target molecule, as demonstrated previously by our research group using different in vitro assays. PMID:27455324

  14. A Theoretical Study of 8-Chloro-9-Hydroxy-Aflatoxin B1, the Conversion Product of Aflatoxin B1 by Neutral Electrolyzed Water

    Directory of Open Access Journals (Sweden)

    René Escobedo-González

    2016-07-01

    Full Text Available Theoretical studies of 8-chloro-9-hydroxy-aflatoxin B1 (2 were carried out by Density Functional Theory (DFT. This molecule is the reaction product of the treatment of aflatoxin B1 (1 with hypochlorous acid, from neutral electrolyzed water. Determination of the structural, electronic and spectroscopic properties of the reaction product allowed its theoretical characterization. In order to elucidate the formation process of 2, two reaction pathways were evaluated—the first one considering only ionic species (Cl+ and OH− and the second one taking into account the entire hypochlorous acid molecule (HOCl. Both pathways were studied theoretically in gas and solution phases. In the first suggested pathway, the reaction involves the addition of chlorenium ion to 1 forming a non-classic carbocation assisted by anchimeric effect of the nearest aromatic system, and then a nucleophilic attack to the intermediate by the hydroxide ion. In the second studied pathway, as a first step, the attack of the double bond from the furanic moiety of 1 to the hypochlorous acid is considered, accomplishing the same non-classical carbocation, and again in the second step, a nucleophilic attack by the hydroxide ion. In order to validate both reaction pathways, the atomic charges, the highest occupied molecular orbital and the lowest unoccupied molecular orbital were obtained for both substrate and product. The corresponding data imply that the C9 atom is the more suitable site of the substrate to interact with the hydroxide ion. It was demonstrated by theoretical calculations that a vicinal and anti chlorohydrin is produced in the terminal furan ring. Data of the studied compound indicate an important reduction in the cytotoxic and genotoxic potential of the target molecule, as demonstrated previously by our research group using different in vitro assays.

  15. Micrococcin P1 - A bactericidal thiopeptide active against Mycobacterium tuberculosis.

    Science.gov (United States)

    Degiacomi, Giulia; Personne, Yoann; Mondésert, Guillaume; Ge, Xueliang; Mandava, Chandra Sekhar; Hartkoorn, Ruben C; Boldrin, Francesca; Goel, Pavitra; Peisker, Kristin; Benjak, Andrej; Barrio, Maria Belén; Ventura, Marcello; Brown, Amanda C; Leblanc, Véronique; Bauer, Armin; Sanyal, Suparna; Cole, Stewart T; Lagrange, Sophie; Parish, Tanya; Manganelli, Riccardo

    2016-09-01

    The lack of proper treatment for serious infectious diseases due to the emergence of multidrug resistance reinforces the need for the discovery of novel antibiotics. This is particularly true for tuberculosis (TB) for which 3.7% of new cases and 20% of previously treated cases are estimated to be caused by multi-drug resistant strains. In addition, in the case of TB, which claimed 1.5 million lives in 2014, the treatment of the least complicated, drug sensitive cases is lengthy and disagreeable. Therefore, new drugs with novel targets are urgently needed to control resistant Mycobacterium tuberculosis strains. In this manuscript we report the characterization of the thiopeptide micrococcin P1 as an anti-tubercular agent. Our biochemical experiments show that this antibiotic inhibits the elongation step of protein synthesis in mycobacteria. We have further identified micrococcin resistant mutations in the ribosomal protein L11 (RplK); the mutations were located in the proline loop at the N-terminus. Reintroduction of the mutations into a clean genetic background, confirmed that they conferred resistance, while introduction of the wild type RplK allele into resistant strains re-established sensitivity. We also identified a mutation in the 23S rRNA gene. These data, in good agreement with previous structural studies suggest that also in M. tuberculosis micrococcin P1 functions by binding to the cleft between the 23S rRNA and the L11 protein loop, thus interfering with the binding of elongation factors Tu and G (EF-Tu and EF-G) and inhibiting protein translocation. PMID:27553416

  16. Predominant porB1A and porB1B genotypes and correlation of gene mutations with drug resistance in Neisseria gonorrhoeae isolates in Eastern China

    Directory of Open Access Journals (Sweden)

    Tang Renxian

    2010-11-01

    Full Text Available Abstract Background Variations of porB1A and porB1B genes and their serotypes exist in Neisseria gonorrhoeae isolates from different geographical areas, and some site mutations in the porB1B gene correlate with drug resistance. Methods The β-lactamase production of N. gonorrhoeae isolates was determined by paper acidometric test and nitrocefin discs. The porB1A and porB1B genes of 315 non-penicillinase-producting N. gonorrhoeae (non-PPNG strains were amplified by PCR for sequencing to determine serotypes and site mutations. A duplex PCR was designed to simultaneously detect both porB1A and porB1B genes. Penicillin and tetracycline resistance was assessed by an in vitro drug sensitivity test. Results Of the N. gonorrhoeae isolates, 31.1% tested positive for porB1A and 68.9% for porB1B genes. All the 98 porB1A+ isolates belonging to IA6 serotype with either no mutation at the 120 and 121 sites (88.8% or a D120G (11.2% mutation and were no resistance to both penicillin and tetracycline. Among the 217 porB1B+ isolates, 26.7%, 22.6% and 11.5% belonged to IB3, IB3/6 and IB4 serotypes, respectively. Particularly, two novel chimeric serotypes, IB3/6-IB2 and IB2-IB4-IB2, were found in 77 and 8 porB1B+ isolates. Two hundred and twelve (97.7% of the porB1B+ isolates were presented G120 and/or A121 mutations with 163 (76.9% at both sites. Interestingly, within the 77 porB1B+ isolates belonging to IB3/6-IB2 serotype, 15 were discovered to possess novel deletions at both A121 and N122 sites. All the replacement mutations at these sites in PorB1B were correlated with resistance and the deletion mutation showed the highest resistance. Conclusion N. gonorrhoeae isolates circulating in Eastern China include a sole PorB1A serotype (IA6 and five PorB1B serotypes. Multiple mutations in porB1B genes, including novel A121 and N122 deletions, are correlated with high levels of penicillin and tetracycline resistance.

  17. Fumonisin B1 and the kidney: modes of action for renal tumor formation by fumonisin B1 in rodents.

    Science.gov (United States)

    Müller, Stephanie; Dekant, Wolfgang; Mally, Angela

    2012-10-01

    The mycotoxin fumonisin B1 (FB1) is an important contaminant of maize and maize-based products. In rodent toxicity studies, FB1 was shown to be hepato- and nephrotoxic, and to induce renal tumors in rats when administered via the diet. Of particular note are the aggressive growth characteristics of FB1-induced tumors with a high potential to metastasize. While genotoxicity does not appear to contribute to FB1 carcinogenicity, it is well established that FB1-mediated disruption of sphingolipid metabolism plays a key role in FB1 toxicity. This review provides an overview on human dietary exposure to FB1, FB1 toxicity and carcinogenicity, and potential mechanisms involved in FB1-mediated tumor formation, with a particular focus on cellular functions of sphingolipids and biological consequences of FB1-mediated perturbation of sphingolipid metabolism. PMID:22771819

  18. Generation and characterization of a Cyp4b1 null mouse and the role of CYP4B1 in the activation and toxicity of Ipomeanol.

    Science.gov (United States)

    Parkinson, Oliver T; Liggitt, H Denny; Rettie, Allan E; Kelly, Edward J

    2013-08-01

    4-Ipomeanol (IPO) is a prototypical pulmonary toxin that requires P450-mediated metabolic activation to reactive intermediates in order to elicit its toxic effects. CYP4B1 is a pulmonary enzyme that has been shown, in vitro, to have a high capacity for bioactivating IPO. In order to determine, unambiguously, the role of CYP4B1 in IPO bioactivation in vivo, we generated Cyp4b1 null mice following targeted disruption of the gene downstream of exon 1. Cyp4b1 (-/-) mice are viable and healthy, with no overt phenotype, and no evidence of compensatory upregulation of other P450 isoforms in any of the tissues examined. Pulmonary and renal microsomes prepared from male Cyp4b1 (-/-) mice exhibited no detectable expression of the protein and catalyzed the in vitro bioactivation of IPO at IPO (20mg/kg) to Cyp4b1 (+/+) mice resulted in characteristic lesions in the lung, and to a lesser extent in the kidney, which were completely absent in Cyp4b1 (-/-) mice. We conclude that CYP4B1 is a critical enzyme for the bioactivation of IPO in vivo and that the Cyp4b1 (-/-) mouse is a useful model for studying CYP4B1-dependent metabolism and toxicity. PMID:23748241

  19. Aflatoxin B1 in poultry: toxicology, metabolism and prevention.

    Science.gov (United States)

    Rawal, Sumit; Kim, Ji Eun; Coulombe, Roger

    2010-12-01

    Aflatoxins (AF) are ubiquitous in corn-based animal feed and causes hepatotoxic and hepatocarcinogenic effects. The most important AF in terms of toxic potency and occurrence is aflatoxin B1 (AFB1). Poultry, especially turkeys, are extremely sensitive to the toxic and carcinogenic action of AFB1, resulting in millions of dollars in annual losses to producers due to reduced growth rate, increased susceptibility to disease, reduced egg production and other adverse effects. The extreme sensitivity of turkeys and other poultry to AFB1 is associated with efficient hepatic cytochrome P450-mediated bioactivation and deficient detoxification by glutathione S-transferases (GST). Discerning the biochemical and molecular mechanisms of this extreme sensitivity of poultry to AFB1, will contribute in the development of novel strategies to increase aflatoxin resistance. Since AFB1 is an unavoidable contaminant of corn-based poultry feed, chemoprevention strategies aimed at reducing AFB1 toxicity in poultry and in other animals have been the subject of numerous studies. This brief review summarizes many of the key recent findings regarding the action of aflatoxins in poultry.

  20. Aflatoxin B1 transfer and metabolism in human placenta.

    Science.gov (United States)

    Partanen, Heidi A; El-Nezami, Hani S; Leppänen, Jukka M; Myllynen, Päivi K; Woodhouse, Heather J; Vähäkangas, Kirsi H

    2010-01-01

    Aflatoxin B1 (AFB1), a common dietary contaminant, is a major risk factor of hepatocellular carcinoma (HCC). Early onset of HCC in some countries in Africa and South-East Asia indicates the importance of early life exposure. Placenta is the primary route for various compounds, both nutrients and toxins, from the mother to the fetal circulation. Furthermore, placenta contains enzymes for xenobiotic metabolism. AFB1, AFB1-metabolites, and AFB1-albumin adducts have been detected in cord blood of babies after maternal exposure during pregnancy. However, the role that the placenta plays in the transfer and metabolism of AFB1 is not clear. In this study, placental transfer and metabolism of AFB1 were investigated in human placental perfusions and in in vitro studies. Eight human placentas were perfused with 0.5 or 5microM AFB1 for 2-4 h. In vitro incubations with placental microsomal and cytosolic proteins from eight additional placentas were also conducted. Our results from placental perfusions provide the first direct evidence of the actual transfer of AFB1 and its metabolism to aflatoxicol (AFL) by human placenta. In vitro incubations with placental cytosolic fraction confirmed the capacity of human placenta to form AFL. AFL was the only metabolite detected in both perfusions and in vitro incubations. Since AFL is less mutagenic, but putatively as carcinogenic as AFB1, the formation of AFL may not protect the fetus from the toxicity of AFB1.

  1. Genotoxicity of aflatoxin B1 and its ammonium derivatives.

    Science.gov (United States)

    Márquez Márquez, R; Tejada de Hernandez, I; Madrigal Bujaidar, E

    1995-01-01

    Aflatoxin (AF) B1 is a main contaminant in diverse agricultural products. In an attempt to reduce this problem and the hazards to human health, an AFB1 inactivating system with ammonia has been developed. In this work we evaluated the efficiency of the system in mice using micronucleus (MN) and sister chromatid exchange (SCE) analysis. Four groups of animals were fed for 8 weeks with a special diet mainly composed of maize: (1) uncontaminated; (2) uncontaminated/inactivated; (3) contaminated/inactivated; and (4) contaminated. We evaluated MN at weekly intervals in peripheral blood, and in weeks 4 and 8 SCE frequencies were quantified in bone marrow cells. The results shows that animals fed with AFB1 contaminated/inactivated maize had a 45% lower level of induced cytogenetic damage than those animals fed with AFB1 contaminated but not inactivated maize. A residual amount of AFB1 after the inactivating treatment and reconversion back to AFB1 in the organism may account for the remaining increased levels of SCE and MN.

  2. Regulation of nucleotide excision repair by nuclear lamin b1.

    Directory of Open Access Journals (Sweden)

    Veronika Butin-Israeli

    Full Text Available The nuclear lamins play important roles in the structural organization and function of the metazoan cell nucleus. Recent studies on B-type lamins identified a requirement for lamin B1 (LB1 in the regulation of cell proliferation in normal diploid cells. In order to further investigate the function of LB1 in proliferation, we disrupted its normal expression in U-2 OS human osteosarcoma and other tumor cell lines. Silencing LB1 expression induced G1 cell cycle arrest without significant apoptosis. The arrested cells are unable to mount a timely and effective response to DNA damage induced by UV irradiation. Several proteins involved in the detection and repair of UV damage by the nucleotide excision repair (NER pathway are down-regulated in LB1 silenced cells including DDB1, CSB and PCNA. We propose that LB1 regulates the DNA damage response to UV irradiation by modulating the expression of specific genes and activating persistent DNA damage signaling. Our findings are relevant to understanding the relationship between the loss of LB1 expression, DNA damage signaling, and replicative senescence.

  3. Phosphorous chemistry in the shocked region L1157 B1

    CERN Document Server

    Aota, Takuhiro

    2012-01-01

    We study the evolution of phosphorous-bearing species in one-dimensional C-shock models. We find that the abundances of P-bearing species depend sensitively on the elemental abundance of P in the gas phase and on the abundance of N atoms in the pre-shock gas. The observed abundance of PN and the non-detection of PO towards L1157 B1 are reproduced in C-shock models with shock velocity v=20km s-1 and pre-shock density n(H2) =10^4 - 10^5, if the elemental abundance of P in the gas phase is 10^-9 and the N-atom abundance is n(N)/nH - 10^-5 in the pre-shock gas. We also find that P-chemistry is sensitive to O- and N-chemistry, because N atoms are destroyed mainly by OH and NO. We identify the reactions of O-bearing and N-bearing species that significantly affect P chemistry.

  4. Pressure dependent elastic and structural (B3-B1) properties of Ga based monopnictides

    International Nuclear Information System (INIS)

    By formulating an effective interionic interaction potential that incorporates the long-range Coulomb, the covalency effects, the charge transfer caused by the deformation of the electron shells of the overlapping ions, the Hafemeister and Flygare type short-range overlap repulsion extended up to the second neighbour ions and the van der Waals (vdW) interaction, the pressure dependent elastic and thermodynamical properties of the III-V semiconductors as GaY (Y = N, P, As) are studied. The estimated values of phase transition pressure of GaY (Y = N, P, As) are in reasonably good agreement with the available data on the phase transition pressures (Pt = 41, 22, 17 GPa). The vast volume discontinuity in pressure-volume phase diagram identifies a structural phase transition from zinc-blende (B3) to rock salt (B1) structure. Later on, the Poisson's ratio ν, the ratio RS/B of S (Voigt averaged shear modulus) over B (bulk modulus), elastic anisotropy parameter, elastic wave velocity, average wave velocity and Debye temperature as functions of pressure is calculated. From Poisson's ratio and the ratio RS/B it is inferred that GaY (Y = N, P, As) is brittle [ductile] in zinc-blende (B3) [Sodium Chloride (B1)] phase. To our knowledge this is the first quantitative theoretical prediction of the pressure dependence of ductile (brittle) nature of GaY compounds and still awaits experimental confirmations.

  5. Measurement and assessment of aflatoxin B1 and its producing molds in Iranian sausages and burgers

    Directory of Open Access Journals (Sweden)

    Siavash Maktabi

    2016-09-01

    Full Text Available Abstract Introduction: Aflatoxin B1 (AFB1 is one of the most well-known hepatocarcinogens in humans. Contamination of raw materials, used in the production of sausages and burgers, with aflatoxin producing molds can lead to increased level of aflatoxin in the final products and can impose hazards to human health. Unfortunately, aflatoxin is resistant to heating and freezing processes, etc. and can remain in these products untile consumption. Methods: During a six-month period, 45 sausage and 53 burger samples from valid brands across the country were randomly purchased from the stores. The samples were analyzed for AFB1 by ELISA technique. Meanwhile, the number of molds was calculated and aflatoxin producing molds were identified by direct and slide culture methods. Results: The findings showed that 2 susage samples (4.9% and 3 burger samples (6.3% were contaminated with >1 ng/g aflatoxin. Moreover, 4 burger samples (8.9% contaminated with mold included aspergillus flavus, aspergillus niger, mucor, and penicillium while, none of the susage samples showed mold contamination. Conclusion: The Iranian meat products had a relative aflatoxin B1 contamination during the study period, but the contamination rate was low and in allowable range. Standard hygienic preparation and packaging of meat products molds is recommended to reduce fungal contamination, especially aflatoxin-producing molds.

  6. Millimetre continuum observations of comet C/2009 P1 (Garradd)

    CERN Document Server

    Boissier, J; Groussin, O; Lamy, P; Biver, N; Crovisier, J; Colom, P; Moreno, R; Jorda, L; Piétu, V

    2013-01-01

    Little is known about the physical properties of the nuclei of Oort cloud comets. Measuring the thermal emission of a nucleus is one of the few means for deriving its size and constraining some of its thermal properties. We attempted to measure the nucleus size of the Oort cloud comet C/2009 P1 (Garradd). We used the Plateau de Bure Interferometer to measure the millimetric thermal emission of this comet at 157 GHz (1.9 mm) and 266 GHz (1.1 mm). Whereas the observations at 266 GHz were not usable due to bad atmospheric conditions, we derived a 3-sigma upper limit on the comet continuum emission of 0.41 mJy at 157 GHz. Using a thermal model for a spherical nucleus with standard thermal parameters, we found an upper limit of 5.6 km for the radius. The dust contribution to our signal is estimated to be negligible. Given the water production rates measured for this comet and our upper limit, we estimated that Garradd was very active, with an active fraction of its nucleus larger than 50%.

  7. Polarimetric studies of Comet C/2009 P1 (Garradd)

    CERN Document Server

    Das, H S; Wolf, S; Bertrang, G; Roy, P Deb; Chakraborty, A

    2013-01-01

    We present the optical imaging polarimetric observations of comet C/2009 P1(Garradd) at three different phase angles e.g., 28.2$^\\circ$, 28.1$^\\circ$ and 21.6$^\\circ$. The observations were carried out using IUCAA Faint Object Spectrograph and Camera mounted on Cassegrain focus of the 2-m Telescope of IGO, IUCAA, Pune in R$_{comet}$, R photometric bands, on 21 and 22 March 2012 and ARIES Imaging Polarimeter mounted on Cassegrain focus of the 1.04-m Sampurnanand Telescope of ARIES, Nainital in R photometric band, on 23 May 2012. We show the presence of a jet activity in the rotational gradient treated image of comet Garradd at phase angle 28.1$^\\circ$. These jets are mainly oriented towards the Sun and extended up to $\\sim$ 5100 km from the cometary photocenter. The antisolar extension of jet seems to be fainter, which is extended up to $\\sim$ 1800 km. It is found that the comet Garradd shows negative polarization at phase angle 21.6$^\\circ$. The degree of polarization derived for Garradd is in good agreement ...

  8. The body vitamin B1 levels of rats fed a diet containing the minimum requirement of vitamin B1 is reduced by exercise.

    Science.gov (United States)

    Shibata, Katsumi; Fukuwatari, Tsutomu

    2013-01-01

    It is thought that increasing energy expenditure increases consumption of vitamin B1, leading to an increase in the requirement of vitamin B1. However, evidence supporting this hypothesis is lacking. To examine the hypothesis, initially, we determined the minimum requirement of vitamin B1 for weaning rats. We found that the minimum requirement of vitamin B1 for optimum growth of weaning rats was around 0.786 mg thiamin/kg diet. Next, rats fed a diet containing the minimum requirement of vitamin B1 were forced to swim until exhaustion. Concentrations of vitamin B1 in the blood and liver as well as urinary excretion of swimming rats decreased significantly compared with those of non-swimming rats (prats fed the diet containing a sufficient amount of vitamin B1 (4.720 mg thiamin/kg diet), vitamin B1 amounts in the blood, liver and urine were not affected by swimming. We clearly and firstly showed the reduction of body vitamin B1 following increases in energy expenditure. PMID:23727637

  9. PENGARUH KETEBALAN SUBSTRAT PADA FERMENTASI TEMPE TERHADAP KADAR VITAMIN B1 (THE INFLUENCE OF SUBSTRATE THICKNESS DURING TEMPE FERMENTATION ON VITAMINS B1 LEVEL

    Directory of Open Access Journals (Sweden)

    Fifi Retiaty

    2012-12-01

    Full Text Available ABSTRACT The level of vitamin B1 in tempe could be increased by modifying the surface of substrate during soybean fermentation. This research aimed to know the influence of substrate thickness during soybean fermentation into tempe to the levels of vitamin B1. The design of this research was completed randomized design with two replication. Vitamin B1 content was analyzed on raw soybeans, boiled soybeans, and tempe using spectrophotometer methods. The substrate thicknesses examined were 0.25 cm, 0.50 cm and 1.00cm. Vitamin B1 level on raw soybean was 0.7436 mg percent and on boiled soybean was 0.4898 mg percent, while in tempe with substrate thickness  0.25 cm, 0.50 cm and 1.00 cm, the vitamin B1 contents were 1.1413, 0.9044, and 0.7130 mg percent respectively. The thickness of tempe substrate affected on vitamin B1 content. A thinner substrate resulted on higher vitamin B1 level. Keywords: fermentation, tempe, vitamin B1   ABSTRAK Kadar vitamin B1 pada tempe dapat ditingkatkan dengan memodifikasi permukaan dari substrat dalam fermentasi kedelai. Tujuan penelitian ini adalah untuk mengetahui pengaruh ketebalan substrat pada fermentasi kedelai menjadi tempe terhadap kadar vitamin B1. Disain penelitian ini adalah Rancangan Acak Lengkap dengan dua kali ulangan. Kadar vitamin B1 dianalisis pada kedelai mentah, kedelai rebus, dan tempe dengan menggunakan metode spektrofotometri. Ketebalan substrat yang diteliti adalah 0.25 cm, 0,50 cm, 1,00 cm. Kadar vitamin B1 pada  kedelai mentah adalah 0,7436 mg persen dan pada kedelai rebus adalah 0.4898 mg persen. Sedangkan kadar vitamin B1 pada tempe dengan ketebalan 0,25, 0,5 dan 1 cm secara berturut-turut adalah 1,1413 mg persen , 0,9044 mg persen dan 0,7130 mg persen. Ketebalan substar tempe berpengaruh pada kandungan vitamin B1. Semakin tipis substrat, akan menghasilkan vitamin B1 yang semakin tinggi. [Penel Gizi Makan 2012, 35(2: 182-188]   Kata Kunci: fermentasi, tempe, vitamin B1

  10. Co-expression of CYP27B1 enzyme with the 1.5kb CYP27B1 promoter-luciferase transgene in the mouse.

    Science.gov (United States)

    Anderson, Paul H; Hendrix, Ivanka; Sawyer, Rebecca K; Zarrinkalam, Reza; Manavis, Jim; Sarvestani, Ghafar T; May, Brian K; Morris, Howard A

    2008-03-26

    The renal enzyme 25-hydroxyvitamin D 1alpha-hydroxylase (CYP27B1), responsible for the synthesis of circulating. 1,25-dihydroxyvitamin D (1,25D), is also expressed in a number of non-renal tissues. The regulation of CYP27B1 expression by the short flanking promoter outside the kidney is, however, largely unknown. We have used a transgenic mice expressing the 1.5kb promoter of the human CYP27B1 gene fused to the firefly luciferase gene in order to investigate tissue-specific CYP27B1 expression. These transgenic animals demonstrated co-localised luciferase and endogenous CYP27B1 expression in kidney proximal convoluted tubular cells. Strong co-expression of luciferase and CYP27B1 also occurred in neurons and Purkinje cells of the cerebellum and in Leydig and Sertoli cells of the testes. Other tissues to exhibit CYP27B1-promoter directed luciferase activity included lung, prostate, trabecular bone and jejunum as well as the choroid epithelium. The tissue specific changes in luciferase activity were age-related. These findings demonstrate that the proximal 1.5kb 5' flanking region of the CYP27B1 gene directs the expression of CYP27B1 in a number of known and novel tissues in a specific manner. PMID:18313834

  11. Fumonisin B1 facilitates seizures induced by pentylenetetrazol in mice.

    Science.gov (United States)

    Poersch, Alice Bertotto; Trombetta, Francielle; Souto, Naiéli Schiefelbein; de Oliveira Lima, Camilla; Braga, Ana Cláudia Monteiro; Dobrachinski, Fernando; Ribeiro, Leandro Rodrigo; Soares, Félix Alexandre Antunes; Fighera, Michele Rechia; Royes, Luiz Fernando Freire; Oliveira, Mauro Schneider; Furian, Ana Flávia

    2015-01-01

    Fumonisin B1 (FB1) is a Fusarium spp. mycotoxin which constitutes a major public health issue because of its worldwide distribution and diversity of toxic effects.While the liver and kidney are considered the major target organs of FB1 toxicity in several species, evidence indicates that FB1 may be toxic to the brain. To further investigate the effects of FB1 on the central nervous system the present study aimed to test the hypothesis that acute FB1 exposure causes brain hyperexcitability and the potential underlying mechanisms. For these purposes, adult male C57BL/6 mice were injected with FB1 (8 mg/kg, i.p.) or its vehicle and 30 min thereafter received with a low dose of the classical convulsant pentylenetetrazol (PTZ, 30 mg/kg, i.p.) or its vehicle. After behavioral evaluation the cerebral cortex and the hippocampus were collected for analysis of Na(+),K(+)-ATPase activity, mitochondrial membrane potential (ΔΨm) and mitochondrial complex I and II activities. We found that FB1 reduced the latency for PTZ-induced myoclonic jerks and increased the number of these events. After exposure to FB1 total and α1 Na(+),K(+)-ATPase activities increased in cerebral cortex, whereas the same enzyme activities decreased in the hippocampus. Although no changes in mitochondrial complex I and II activities were found, acute exposure to FB1 increased ΔΨm in the cerebral cortex. Altogether, present results indicate that FB1 causes brain hyperexcitability in vivo, and that mitochondrial dysfunction may represent a potential underlying mechanism. PMID:26342287

  12. Aflatoxin B1 Degradation by a Pseudomonas Strain

    Science.gov (United States)

    Sangare, Lancine; Zhao, Yueju; Folly, Yawa Minnie Elodie; Chang, Jinghua; Li, Jinhan; Selvaraj, Jonathan Nimal; Xing, Fuguo; Zhou, Lu; Wang, Yan; Liu, Yang

    2014-01-01

    Aflatoxin B1 (AFB1), one of the most potent naturally occurring mutagens and carcinogens, causes significant threats to the food industry and animal production. In this study, 25 bacteria isolates were collected from grain kernels and soils displaying AFB1 reduction activity. Based on its degradation effectiveness, isolate N17-1 was selected for further characterization and identified as Pseudomonas aeruginosa. P. aeruginosa N17-1 could degrade AFB1, AFB2 and AFM1 by 82.8%, 46.8% and 31.9% after incubation in Nutrient Broth (NB) medium at 37 °C for 72 h, respectively. The culture supernatant of isolate N17-1 degraded AFB1 effectively, whereas the viable cells and intra cell extracts were far less effective. Factors influencing AFB1 degradation by the culture supernatant were investigated. Maximum degradation was observed at 55 °C. Ions Mn2+ and Cu2+ were activators for AFB1 degradation, however, ions Mg2+, Li+, Zn2+, Se2+, Fe3+ were strong inhibitors. Treatments with proteinase K and proteinase K plus SDS significantly reduced the degradation activity of the culture supernatant. No degradation products were observed based on preliminary LC-QTOF/MS analysis, indicating AFB1 was metabolized to degradation products with chemical properties different from that of AFB1. The results indicated that the degradation of AFB1 by P. aeruginosa N17-1 was enzymatic and could have a great potential in industrial applications. This is the first report indicating that the isolate of P. aeruginosa possesses the ability to degrade aflatoxin. PMID:25341538

  13. Aflatoxin B1 is toxic to porcine oocyte maturation.

    Science.gov (United States)

    Liu, Jun; Wang, Qiao-Chu; Han, Jun; Xiong, Bo; Sun, Shao-Chen

    2015-07-01

    As a toxic secondary metabolite of Aspergillus species, Aflatoxin B1 (AFB1) is a major food and feed contaminant in tropical and sub-tropical regions with high temperature and humidity. It has been reported to be toxic to the female reproductive system in laboratory and domestic animals. In the present study, the influence of acute exposure to AFB1 (10 and 50 μM, 44h) on porcine oocyte maturation and its possible mechanism were investigated. The maturation rates of oocytes decreased significantly in the presence of 50 μM of AFB1. Cell cycle analysis showed that most oocytes were arrested at germinal vesicle breakdown or meosis I stage. However, actin assembly, spindle structure and chromosome alignment were not disrupted after exposure to 50 μM AFB1. Further study showed that DNA methylation levels increased in treated oocytes (50 μM). Histone methylation levels were also analysed after treatment (50 μM): H3K27me3 and H3K4me2 levels decreased, whereas H3K9me3 level increased, indicating that epigenetic modification was affected. AFB1 treatment (50 μM) also induced oxidative stress and further led to autophagy, as shown by accumulation of reactive oxygen species, up-regulated LC3 protein expression and increased mRNA levels of ATG3, ATG5 and ATG7. Annexin V-FITC staining assay revealed that AFB1 treatment (50 μM) resulted in oocyte early apoptosis, which was confirmed by increased Bak, Bax, Bcl-xl mRNA levels. Collectively, our results suggest that AFB1 disrupts porcine oocyte maturation through changing epigenetic modifications as well as inducing oxidative stress, excessive autophagy and apoptosis.

  14. AFLATOXIN B1 RESIDUES IN EGGS AND FLESH OF LAYING HENS FED AFLATOXIN B1 CONTAMINATED DIET

    Directory of Open Access Journals (Sweden)

    Saqer Mohammad Herzallah

    2013-01-01

    Full Text Available Aflatoxin B1(AFB1 and total Aflatoxins (AFT contaminated feed effect on aflatoxins residue level in eggs, muscles (breast, leg, organs (liver, kidney, gizzard and excreted aflatoxins in chicken litter of layer hens were monitored. Laying hens were on four levels of aflatoxins for 6 weeks and monitored weekly for the change in both AFB1 and AFT levels. Pronouncedly, the AFB1 and AFT were detected in eggs, muscles (legs, breast, organs (liver, kidney and gizzard and litter in noticeable amounts. Total Aflatoxin (AFT level was lowest in chicken breast (0.63 ppb and highest in liver (2.12 ppb and gizzard (1.22 ppb of chicken fed diet with 965.12 ppb. Whereas, AFB1 residue was 0.66 ppb in eggs, 1.59 ppb in liver tissues of hens given feed contaminated with 894.12 ppb. Residue level of AFB1 was high in liver and kidney of all treatments. The chicken breast tissues were lowest in AFB1 and AFT of values 0.72 and 0.63, respectively. Eggs production was significantly (p<0.05 affected with AFB1 contaminated feed and egg production was decreased by more than 30%.

  15. Evidence for positive regulation of plasmid prophage P1 replication: integrative suppression by copy mutants.

    OpenAIRE

    Froehlich, B J; Tatti, K; Scott, J R

    1983-01-01

    Like low-copy-number plasmids including P1 wild type, multicopy P1 mutants (P1 cop, maintained at five to eight copies per chromosome) can suppress the thermosensitive phenotype of an Escherichia coli dnaA host by forming a cointegrate. At 40 degrees C in a dnaA host suppressed by P1 cop, the only copy of P1 is the one in the host chromosome. Trivial explanations of the lack of extrachromosomal copies of P1 cop have been eliminated: (i) during integrative suppression, the P1 cop plasmid does ...

  16. 17 CFR 270.57b-1 - Exemption for downstream affiliates of business development companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption for downstream affiliates of business development companies. 270.57b-1 Section 270.57b-1 Commodity and Securities Exchanges....57b-1 Exemption for downstream affiliates of business development companies....

  17. 26 CFR 1.263(b)-1 - Expenditures for advertising or promotion of good will.

    Science.gov (United States)

    2010-04-01

    ... good will. 1.263(b)-1 Section 1.263(b)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.263(b)-1 Expenditures for... section 733 or section 451 of the Internal Revenue Code of 1939, in computing its excess profits...

  18. Strain background modifies phenotypes in the ATP8B1-deficient mouse

    NARCIS (Netherlands)

    S. Shah; U.R. Sanford; J.C. Vargas; H. Xu; A. Groen; C.C. Paulusma; J.P. Grenert; L. Pawlikowska; S. Sen; R.P.J. Oude Elferink; L.N. Bull

    2010-01-01

    BACKGROUND: Mutations in ATP8B1 (FIC1) underlie cases of cholestatic disease, ranging from chronic and progressive (progressive familial intrahepatic cholestasis) to intermittent (benign recurrent intrahepatic cholestasis). The ATP8B1-deficient mouse serves as an animal model of human ATP8B1 deficie

  19. EphB1 Suppression in Acute Myelogenous Leukemia : Regulating the DNA Damage Control System

    NARCIS (Netherlands)

    Kampen, K. R.; Scherpen, F. J. G.; Garcia-Manero, G.; Yang, H.; Kaspers, G. J. L.; Cloos, J.; Zwaan, C. M.; van den Heuvel-Eibrink, M. M.; Kornblau, S. M.; De Bont, E. S. J. M.

    2015-01-01

    Loss of ephrin receptor (EphB1) expression may associate with aggressive cancer phenotypes; however, the mechanism of action remains unclear. To gain detailed insight into EphB1 function in acute myelogenous leukemia (AML), comprehensive analysis of EphB1 transcriptional regulation was conducted. In

  20. 26 CFR 48.4062(b)-1 - Rebuilt parts or accessories sold on an exchange basis.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Rebuilt parts or accessories sold on an exchange basis. 48.4062(b)-1 Section 48.4062(b)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE..., Tires, Tubes, Tread Rubber, and Taxable Fuel Automotive and Related Items § 48.4062(b)-1 Rebuilt...

  1. 22 CFR 9b.1 - Press access to the Department of State.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Press access to the Department of State. 9b.1 Section 9b.1 Foreign Relations DEPARTMENT OF STATE GENERAL REGULATIONS GOVERNING DEPARTMENT OF STATE PRESS BUILDING PASSES § 9b.1 Press access to the Department of State. (a) Media correspondents without...

  2. Proteasomal degradation of human CYP1B1: effect of the Asn453Ser polymorphism on the post-translational regulation of CYP1B1 expression.

    Science.gov (United States)

    Bandiera, Silvio; Weidlich, Simone; Harth, Volker; Broede, Peter; Ko, Yun; Friedberg, Thomas

    2005-02-01

    Allelic variations in CYP1B1 are reported to modulate the incidence of several types of cancer. To provide a mechanistic basis for this association, we investigated the impact of nonsilent allelic changes on the intracellular levels and post-translational regulation of CYP1B1 protein. When transiently expressed in COS-1 cells, either in the presence or absence of recombinant cytochrome P450 reductase, the cellular level of the CYP1B1.4 allelic variant (containing a Ser at the amino acid position 453; Ser453) was 2-fold lower compared with the other four allelic CYP1B1 proteins (containing Asn453), as analyzed by both immunoblotting and ethoxyresorufin O-deethylase activity. This difference was caused by post-translational regulation; as in the presence of cycloheximide, the rate of degradation of immunodetectable and enzymatically active CYP1B1.4 was distinctly faster than that of CYP1B1.1. Pulse-chase analysis revealed that the half-life of CYP1B1.4 was a mere 1.6 h compared with 4.8 h for CYP1B1.1. The presence of the proteasome inhibitor MG132 [N-benzoyloxycarbonyl (Z)-Leu-Leuleucinal] increased the stability not only of immunodetectable CYP1B1, but also--unexpectedly given the size of the proteasome access channel--increased the stability of enzymatically active CYP1B1. The data presented herein also demonstrate that CYP1B1 is targeted for its polymorphism-dependent degradation by polyubiquitination but not phosphorylation. Our results importantly provide a mechanism to explain the recently reported lower incidence of endometrial cancer in individuals carrying the CYP1B1*4 compared with the CYP1B1*1 haplo-type. In addition, the mechanistic paradigms revealed herein may explain the strong overexpression of CYP1B1 in tumors compared with nondiseased tissues. PMID:15486049

  3. Tame automorphisms of C^3 with multidegree of the form (p_1,p_2,d_3)

    OpenAIRE

    Karaś, Marek

    2009-01-01

    Let d_3 >= p_2 > p_1 >= 3 be integers such that p_1,p_2 are prime numbers. In this paper we show that the sequence (p_1,p_2,d_3) is the multidegree of some tame automorphisms of C^3 if and only if d_3 is in p_1*N+p_2*N, i.e. if and only if d_3 is a linear combination of p_1 and p_2 with coefficients in N.

  4. CYP1B1 expression, a potential risk factor for breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Goth-Goldstein, Regine; Erdmann, Christine A.; Russell, Marion

    2001-05-31

    CYP1B1 expression in non-tumor breast tissue from breast cancer patients and cancer-free individuals was determined to test the hypothesis that high CYP1B1 expression is a risk factor for breast cancer. Large interindividual variations in CYP1B1 expression were found with CYP1B1 levels notably higher in breast cancer patients than cancer-free individuals. The results indicate that CYP1B1 might play a role in breast cancer either through increased PAH activation or through metabolism of endogenous estrogen to a carcinogenic derivative.

  5. Neuronal SH2B1 is essential for controlling energy and glucose homeostasis

    OpenAIRE

    Ren, Decheng; Zhou, Yingjiang; Morris, David; Li, Minghua; Li, Zhiqin; Rui, Liangyou

    2007-01-01

    SH2B1 (previously named SH2-B), a cytoplasmic adaptor protein, binds via its Src homology 2 (SH2) domain to a variety of protein tyrosine kinases, including JAK2 and the insulin receptor. SH2B1-deficient mice are obese and diabetic. Here we demonstrated that multiple isoforms of SH2B1 (α, β, γ, and/or δ) were expressed in numerous tissues, including the brain, hypothalamus, liver, muscle, adipose tissue, heart, and pancreas. Rat SH2B1β was specifically expressed in neural tissue in SH2B1-tran...

  6. An extremal problem on potentially Kp,1,1-graphic sequences

    OpenAIRE

    Lai, Chunhui

    2005-01-01

    A sequence S is potentially K_p,1,1 graphical if it has a realization containing a K_p,1,1 as a subgraph, where K_p,1,1 is a complete 3-partite graph with partition sizes p,1,1. Let σ (K_p,1,1, n) denote the smallest degree sum such that every n-term graphical sequence S with σ (S)≥ σ (K_p,1,1, n) is potentially K_p,1,1 graphical. In this paper, we prove that σ (K_p,1,1, n)≥ 2[((p+1)(n-1)+2)/2] for n ≥ p+2. We conjecture that equality holds for n ≥ 2p+4. We prove that this conjecture is true ...

  7. An extremal problem on potentially $K_{p,1,1}$-graphic sequences

    OpenAIRE

    Chunhui Lai

    2004-01-01

    A sequence $S$ is potentially $K_{p,1,1}$ graphical if it has a realization containing a $K_{p,1,1}$ as a subgraph, where $K_{p,1,1}$ is a complete 3-partite graph with partition sizes $p,1,1$. Let $\\sigma(K_{p,1,1}, n)$ denote the smallest degree sum such that every $n$-term graphical sequence $S$ with $\\sigma(S)\\geq \\sigma(K_{p,1,1}, n)$ is potentially $K_{p,1,1}$ graphical. In this paper, we prove that $\\sigma (K_{p,1,1}, n)\\geq 2[((p+1)(n-1)+2)/2]$ for $n \\geq p+2.$ We conjecture that equ...

  8. Dependence of B1+ and B1− Field Patterns of Surface Coils on the Electrical Properties of the Sample and the MR Operating Frequency

    Science.gov (United States)

    Vaidya, Manushka V.; Collins, Christopher M.; Sodickson, Daniel K.; Brown, Ryan; Wiggins, Graham C.; Lattanzi, Riccardo

    2016-01-01

    In high field MRI, the spatial distribution of the radiofrequency magnetic (B1) field is usually affected by the presence of the sample. For hardware design and to aid interpretation of experimental results, it is important both to anticipate and to accurately simulate the behavior of these fields. Fields generated by a radiofrequency surface coil were simulated using dyadic Green’s functions, or experimentally measured over a range of frequencies inside an object whose electrical properties were varied to illustrate a variety of transmit (B1+) and receive (B1−) field patterns. In this work, we examine how changes in polarization of the field and interference of propagating waves in an object can affect the B1 spatial distribution. Results are explained conceptually using Maxwell’s equations and intuitive illustrations. We demonstrate that the electrical conductivity alters the spatial distribution of distinct polarized components of the field, causing “twisted” transmit and receive field patterns, and asymmetries between |B1+| and |B1−|. Additionally, interference patterns due to wavelength effects are observed at high field in samples with high relative permittivity and near-zero conductivity, but are not present in lossy samples due to the attenuation of propagating EM fields. This work provides a conceptual framework for understanding B1 spatial distributions for surface coils and can provide guidance for RF engineers.

  9. Nonlinear Zeeman effect in photoassociation spectra of $^{40}$Ca near the $^3$P$_1$+$^1$S$_0$ asymptote

    CERN Document Server

    Tiemann, Eberhard; Pachomow, Evgenij; Riehle, Fritz; Sterr, Uwe

    2015-01-01

    We present calculations of the Zeeman effect of narrow photoassociation lines of $^{40}$Ca near the $^3$P$_1$ + $^1$S$_0$ asymptote. Using a coupled-channel model we find a nonlinear Zeeman effect that even at low fields of a few mT amounts to several kHz. With this model we analyze previous measurements and give corrected long range dispersion coefficients of the $^3\\Pi_{u}$ and $^3\\Sigma^+ _{u}$ states.

  10. Numerical study of the static and pitching RISOe-B1-18 airfoil[STALL

    Energy Technology Data Exchange (ETDEWEB)

    Bertagnolio, F.

    2004-01-01

    The objective of this report is the better understanding of the physics of the aeroelastic motion of wind turbine blades in order to improve the numerical models used for their design. In this study, the case of the RISOe-B1-18 airfoil which was equipped and measured in an open jet wind tunnel is studied. Two and three dimensional Navier-Stokes calculations using the k-w SST and Detached Eddy Simulation turbulence models are conducted. An engineering semi-empirical dynamic stall model is also used for performing calculations. Computational results are compared to the experimental results that are available both for the static airfoil and in the case of pitching motions. It is shown that the Navier-Stokes simulations can reproduced the main characteristic features of the flow. The DES model seems also to be able to reproduce some details of the unsteady aerodynamics. The Navier-Stokes computations can then be used to improve the performance of the engineering model. (au)

  11. Risk Assessment on Dietary Exposure to Aflatoxin B1 in Post-Harvest Peanuts in the Yangtze River Ecological Region

    Directory of Open Access Journals (Sweden)

    Xiaoxia Ding

    2015-10-01

    Full Text Available Based on the 2983 peanut samples from 122 counties in six provinces of China’s Yangtze River ecological region collected between 2009–2014, along with the dietary consumption data in Chinese resident nutrition and health survey reports from 2002 and 2004, dietary aflatoxin exposure and percentiles in the corresponding statistics were calculated by non-parametric probability assessment, Monte Carlo simulation and bootstrap sampling methods. Average climatic conditions in the Yangtze River ecological region were calculated based on the data from 118 weather stations via the Thiessen polygon method. The survey results found that the aflatoxin contamination of peanuts was significantly high in 2013. The determination coefficient (R2 of multiple regression reflected by the aflatoxin B1 content with average precipitation and mean temperature in different periods showed that climatic conditions one month before harvest had the strongest impact on aflatoxin B1 contamination, and that Hunan and Jiangxi provinces were greatly influenced. The simulated mean aflatoxin B1 intake from peanuts at the mean peanut consumption level was 0.777–0.790 and 0.343–0.349 ng/(kg·d for children aged 2–6 and standard adults respectively. Moreover, the evaluated cancer risks were 0.024 and 0.011/(100,000 persons·year respectively, generally less than China’s current liver cancer incidence of 24.6 cases/(100,000 persons·year. In general, the dietary risk caused by peanut production and harvest was low. Further studies would focus on the impacts of peanut circulation and storage on aflatoxin B1 contamination risk assessment in order to protect peanut consumers’ safety and boost international trade.

  12. Specific binding of a naturally occurring amyloidogenic fragment of Streptococcus mutans adhesin P1 to intact P1 on the cell surface characterized by solid state NMR spectroscopy

    International Nuclear Information System (INIS)

    The P1 adhesin (aka Antigen I/II or PAc) of the cariogenic bacterium Streptococcus mutans is a cell surface-localized protein involved in sucrose-independent adhesion and colonization of the tooth surface. The immunoreactive and adhesive properties of S. mutans suggest an unusual functional quaternary ultrastructure comprised of intact P1 covalently attached to the cell wall and interacting with non-covalently associated proteolytic fragments thereof, particularly the ∼57-kDa C-terminal fragment C123 previously identified as Antigen II. S. mutans is capable of amyloid formation when grown in a biofilm and P1 is among its amyloidogenic proteins. The C123 fragment of P1 readily forms amyloid fibers in vitro suggesting it may play a role in the formation of functional amyloid during biofilm development. Using wild-type and P1-deficient strains of S. mutans, we demonstrate that solid state NMR (ssNMR) spectroscopy can be used to (1) globally characterize cell walls isolated from a Gram-positive bacterium and (2) characterize the specific binding of heterologously expressed, isotopically-enriched C123 to cell wall-anchored P1. Our results lay the groundwork for future high-resolution characterization of the C123/P1 ultrastructure and subsequent steps in biofilm formation via ssNMR spectroscopy, and they support an emerging model of S. mutans colonization whereby quaternary P1-C123 interactions confer adhesive properties important to binding to immobilized human salivary agglutinin

  13. Specific binding of a naturally occurring amyloidogenic fragment of Streptococcus mutans adhesin P1 to intact P1 on the cell surface characterized by solid state NMR spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Wenxing; Bhatt, Avni [University of Florida, Department of Biochemistry and Molecular Biology, College of Medicine (United States); Smith, Adam N. [University of Florida, Department of Chemistry, College of Liberal Arts and Sciences (United States); Crowley, Paula J.; Brady, L. Jeannine, E-mail: jbrady@dental.ufl.edu [University of Florida, Department of Oral Biology, College of Dentistry (United States); Long, Joanna R., E-mail: jrlong@ufl.edu [University of Florida, Department of Biochemistry and Molecular Biology, College of Medicine (United States)

    2016-02-15

    The P1 adhesin (aka Antigen I/II or PAc) of the cariogenic bacterium Streptococcus mutans is a cell surface-localized protein involved in sucrose-independent adhesion and colonization of the tooth surface. The immunoreactive and adhesive properties of S. mutans suggest an unusual functional quaternary ultrastructure comprised of intact P1 covalently attached to the cell wall and interacting with non-covalently associated proteolytic fragments thereof, particularly the ∼57-kDa C-terminal fragment C123 previously identified as Antigen II. S. mutans is capable of amyloid formation when grown in a biofilm and P1 is among its amyloidogenic proteins. The C123 fragment of P1 readily forms amyloid fibers in vitro suggesting it may play a role in the formation of functional amyloid during biofilm development. Using wild-type and P1-deficient strains of S. mutans, we demonstrate that solid state NMR (ssNMR) spectroscopy can be used to (1) globally characterize cell walls isolated from a Gram-positive bacterium and (2) characterize the specific binding of heterologously expressed, isotopically-enriched C123 to cell wall-anchored P1. Our results lay the groundwork for future high-resolution characterization of the C123/P1 ultrastructure and subsequent steps in biofilm formation via ssNMR spectroscopy, and they support an emerging model of S. mutans colonization whereby quaternary P1-C123 interactions confer adhesive properties important to binding to immobilized human salivary agglutinin.

  14. Heat shock protein B1-deficient mice display impaired wound healing.

    Directory of Open Access Journals (Sweden)

    Jonathan Crowe

    Full Text Available There is large literature describing in vitro experiments on heat shock protein (hspB1 but understanding of its function in vivo is limited to studies in mice overexpressing human hspB1 protein. Experiments in cells have shown that hspB1 has chaperone activity, a cytoprotective role, regulates inflammatory gene expression, and drives cell proliferation. To investigate the function of the protein in vivo we generated hspB1-deficient mice. HspB1-deficient fibroblasts display increased expression of the pro-inflammatory cytokine, interleukin-6, compared to wild-type cells, but reduced proliferation. HspB1-deficient fibroblasts exhibit reduced entry into S phase and increased expression of cyclin-dependent kinase inhibitors p27(kip1 and p21(waf1. The expression of hspB1 protein and mRNA is also controlled by the cell cycle. To investigate the physiological function of hspB1 in regulating inflammation and cell proliferation we used an excisional cutaneous wound healing model. There was a significant impairment in the rate of healing of wounds in hspB1-deficient mice, characterised by reduced re-epithelialisation and collagen deposition but also increased inflammation. HspB1 deficiency augments neutrophil infiltration in wounds, driven by increased chemokine (C-X-C motif ligand 1 expression. This appears to be a general mechanism as similar results were obtained in the air-pouch and peritonitis models of acute inflammation.

  15. Optimisation of Liquid Phase Separation on an Aflatoxin B1 Radioimmunoassay Kit

    International Nuclear Information System (INIS)

    Aflatoxins are secondary metabolites of Aspergillus flavus and A. parasiticus, which grow on a wide variety of food, feeds and their products. Aflatoxin, particularly aflatoxin B1 (AfB1) has wide biological activities including toxic, teratogenic, mutagenic and carcinogenic. Therefore the AfB1 content in foods should be met the requirement of food safety standard. Radioimmunoassay (RIA) technique is one of immunochemical methods or immunoassays which has been considered to be sensitive, specific, accurate and practical for detection of aflatoxin. This technique is based on immunological reaction using radioactive tracer. AfB1 was indirectly radiolabelled and then purified by using a solvent extraction. The tracer was then undergone a immunological testing by using a polyclonal antibody of AfB1. In order to produce AfB1 RIA kit which meets the standard quality’s requirement there are two parameters that have to be optimised. First is optimisation of kit components which consist : standard AfB1, AfB1 tracer (125I-AfB1) and AfB1 antibody. (author)

  16. On the gracefulness of the graphs P1 P4∨Tn%关于图P1 P4∨Tn的优美性

    Institute of Scientific and Technical Information of China (English)

    路线

    2014-01-01

    本文研究了一类图P1 P4∨Tn的优美性.利用构造函数标号的方法,证明了下面结论:对于任意正整数n,Tn是n个顶点的优美树,则当n≥2时,P1 P4∨Tn是优美图.其中,P1是1个顶点的平凡图,P4是4个顶点的路,图P1P4∨Tn是把P1之中的顶点与Tn之中的每一个顶点之间都通过一个P4连接起来所得到的.

  17. NOAA Climate Data Record (CDR) of Gridded Satellite Data from ISCCP B1 (GridSat-B1) Infrared Channel Brightness Temperature, Version 2

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Gridded Satellite (GridSat-B1) data provides a uniform set of quality controlled geostationary satellite observations for the visible, infrared window and...

  18. Cell stress promotes the association of phosphorylated HspB1 with F-actin.

    Directory of Open Access Journals (Sweden)

    Joseph P Clarke

    Full Text Available Previous studies have suggested that the small heat shock protein, HspB1, has a direct influence on the dynamics of cytoskeletal elements, in particular, filamentous actin (F-actin polymerization. In this study we have assessed the influence of HspB1 phosphorylation on its interaction(s with F-actin. We first determined the distribution of endogenous non-phosphorylated HspB1, phosphorylated HspB1 and F-actin in neuroendocrine PC12 cells by immunocytochemistry and confocal microscopy. We then investigated a potential direct interaction between HspB1 with F-actin by precipitating F-actin directly with biotinylated phalloidin followed by Western analyses; the reverse immunoprecipitation of HspB1 was also carried out. The phosphorylation influence of HspB1 in this interaction was investigated by using pharmacologic inhibition of p38 MAPK. In control cells, HspB1 interacts with F-actin as a predominantly non-phosphorylated protein, but subsequent to stress there is a redistribution of HspB1 to the cytoskeletal fraction and a significantly increased association of pHspB1 with F-actin. Our data demonstrate HspB1 is found in a complex with F-actin both in phosphorylated and non-phosphorylated forms, with an increased association of pHspB1 with F-actin after heat stress. Overall, our study combines both cellular and biochemical approaches to show cellular localization and direct demonstration of an interaction between endogenous HspB1 and F-actin using methodolgy that specifically isolates F-actin.

  19. Wavelength and oscillator strength of dipole transition 1s22p-1s2nd for Mn22+ ion

    Institute of Scientific and Technical Information of China (English)

    WANG ZhiWen; WANG YaNan; HU MuHong; LI XinRu; LIU Ying

    2008-01-01

    The transition energies, wavelengths and dipole oscillator strengths of 1s22p-1s2nd (3≤n≤9) for Mn22+. ion are calculated. The fine structure splittings of 1s2nd (n ≤9) states for this ion are also evaluated. In calculating energy, the higher-order relativistic contribution is estimated under a hydrogenic approximation. The quantum defect of Rydberg series 1s2nd is determined according to the quantum defect theory. The results obtained in this paper excellently agree with the experi-mental data available in literatures.

  20. Highly selective and potent agonists of sphingosine-1-phosphate 1 (S1P1) receptor.

    Science.gov (United States)

    Vachal, Petr; Toth, Leslie M; Hale, Jeffrey J; Yan, Lin; Mills, Sander G; Chrebet, Gary L; Koehane, Carol A; Hajdu, Richard; Milligan, James A; Rosenbach, Mark J; Mandala, Suzanne

    2006-07-15

    Novel series of sphingosine-1-phosphate (S1P) receptor agonists were developed through a systematic SAR aimed to achieve high selectivity for a single member of the S1P family of receptors, S1P1. The optimized structure represents a highly S1P1-selective and efficacious agonist: S1P1/S1P2, S1P1/S1P3, S1P1/S1P4>10,000-fold, S1P1/S1P5>600-fold, while EC50 (S1P1) <0.2 nM. In vivo experiments are consistent with S1P1 receptor agonism alone being sufficient for achieving desired lymphocyte-lowering effect.

  1. Evidence for the eta_b(2S) and observation of h_b(1P) -> eta_b(1S) gamma and h_b(2P) -> eta_b(1S) gamma

    CERN Document Server

    Mizuk, R; Bondar, A; Pedlar, T K; Adachi, I; Aihara, H; Arinstein, K; Aulchenko, V; Aushev, T; Aziz, T; Bakich, A M; Bay, A; Belous, K; Bhardwaj, V; Bhuyan, B; Bischofberger, M; Bonvicini, G; Bozek, A; Bračko, M; Browder, T E; Chekelian, V; Chen, A; Chen, P; Cheon, B G; Chilikin, K; Chistov, R; Cho, I -S; Cho, K; Choi, S -K; Choi, Y; Dalseno, J; Danilov, M; Doležal, Z; Drásal, Z; Drutskoy, A; Eidelman, S; Epifanov, D; Fast, J E; Gaur, V; Gabyshev, N; Garmash, A; Golob, B; Haba, J; Hara, T; Hayasaka, K; Hayashii, H; Horii, Y; Hoshi, Y; Hou, W -S; Hsiung, Y B; Hyun, H J; Iijima, T; Ishikawa, A; Itoh, R; Iwabuchi, M; Iwasaki, Y; Iwashita, T; Jaegle, I; Julius, T; Kang, J H; Kapusta, P; Kawasaki, T; Kim, H J; Kim, H O; Kim, J H; Kim, K T; Kim, M J; Kim, Y J; Kinoshita, K; Ko, B R; Koblitz, S; Kodyš, P; Korpar, S; Kouzes, R T; Križan, P; Krokovny, P; Kuhr, T; Kumita, T; Kuzmin, A; Kwon, Y -J; Lange, J S; Lee, S -H; Li, J; Libby, J; Liu, C; Liu, Y; Liu, Z Q; Liventsev, D; Louvot, R; Matvienko, D; McOnie, S; Miyabayashi, K; Miyata, H; Mohanty, G B; Mohapatra, D; Moll, A; Muramatsu, N; Mussa, R; Nakao, M; Natkaniec, Z; Ng, C; Nishida, S; Nishimura, K; Nitoh, O; Nozaki, T; Ohshima, T; Okuno, S; Olsen, S L; Onuki, Y; Pakhlov, P; Pakhlova, G; Park, C W; Park, H; Pestotnik, R; Petrič, M; Piilonen, L E; Poluektov, A; Röhrken, M; Sakai, Y; Sandilya, S; Santel, D; Sanuki, T; Sato, Y; Schneider, O; Schwanda, C; Senyo, K; Seon, O; Sevior, M E; Shapkin, M; Shen, C P; Shibata, T -A; Shiu, J -G; Shwartz, B; Sibidanov, A; Simon, F; Smerkol, P; Sohn, Y -S; Sokolov, A; Solovieva, E; Stanič, S; Starič, M; Sumihama, M; Sumiyoshi, T; Tanida, K; Tatishvili, G; Teramoto, Y; Tikhomirov, I; Trabelsi, K; Tsuboyama, T; Uchida, M; Uehara, S; Uglov, T; Unno, Y; Uno, S; Vanhoefer, P; Varner, G; Varvell, K E; Vinokurova, A; Vorobyev, V; Wang, C H; Wang, M -Z; Wang, P; Wang, X L; Watanabe, M; Watanabe, Y; Williams, K M; Won, E; Yabsley, B D; Yamaoka, J; Yamashita, Y; Yuan, C Z; Zhang, Z P; Zhilich, V

    2012-01-01

    We report the first evidence for the eta_b(2S) using the h_b(2P)->eta_b(2S)gamma transition and the first observation of the h_b(1P)->eta_b(1S)gamma and h_b(2P)->eta_b(1S)gamma transitions. The mass and width of the eta_b(1S) and eta_b(2S) are measured to be m_etab(1S)=(9402.4+-1.5+-1.8)MeV/c^2, m_etab(2S)=(9999.0+-3.5 +2.8-1.9)MeV/c^2 and Gamma_etab(1S)=(10.8 +4.0-3.7 +4.5-2.0)MeV. We also update the h_b(1P) and h_b(2P) mass measurements. We use a 133.4/fb data sample collected at energies near the Upsilon(5S) resonance with the Belle detector at the KEKB asymmetric-energy e+e- collider.

  2. Metabolism of aflatoxin B1 and identification of the major aflatoxin B1-DNA adducts formed in cultured human bronchus and colon

    DEFF Research Database (Denmark)

    1979-01-01

    Aflatoxin B1 and benzo(a)pyrene were activated by both cultured human bronchus and human colon as measured by binding to cellular DNA and protein. The binding of aflatoxin B1 to DNA was dose dependent, and the level of binding was higher in cultured human bronchus than it was in the colon. When...... compared to aflatoxin B1, the binding level of benzo(a)pyrene to both bronchial and colonic DNA was generally higher. The major adducts formed in both tissues by the interaction of aflatoxin B1 and DNA were chromatographically identical to 2,3-dihydro-2-(N7-guanyl)-3-hydroxyaflatoxin B1 (Structure 1...... in these two peaks, and the ratio of radioactivity between the peaks was nearly 1. In colonic DNA, the ratio between Structures 1 and 11 was approximately 2. These observations add aflatoxin B1 to the list of chemical procarcinogens metabolized by cultured human tissues and in which the carcinogen-DNA adducts...

  3. Montelukast Disposition: No Indication of Transporter-Mediated Uptake in OATP2B1 and OATP1B1 Expressing HEK293 Cells

    Directory of Open Access Journals (Sweden)

    Marie Brännström

    2015-12-01

    Full Text Available Clinical studies with montelukast show variability in effect and polymorphic OATP2B1-dependent absorption has previously been implicated as a possible cause. This claim has been challenged with conflicting data and here we used OATP2B1-transfected HEK293 cells to clarify the mechanisms involved. For montelukast, no significant difference in cell uptake between HEK-OATP2B1 and empty vector cell lines was observed at pH 6.5 or pH 7.4, and no concentration-dependent uptake was detected. Montelukast is a carboxylic acid, a relatively potent inhibitor of OATP1B1, OATP1B3, and OATP2B1, and has previously been postulated to be actively transported into human hepatocytes. Using OATP1B1-transfected HEK293 cells and primary human hepatocytes in the presence of OATP inhibitors we demonstrate for the first time that active OATP-dependent transport is unlikely to play a significant role in the human disposition of montelukast.

  4. Montelukast Disposition: No Indication of Transporter-Mediated Uptake in OATP2B1 and OATP1B1 Expressing HEK293 Cells.

    Science.gov (United States)

    Brännström, Marie; Nordell, Pär; Bonn, Britta; Davis, Andrew M; Palmgren, Anna-Pia; Hilgendorf, Constanze; Rubin, Katarina; Grime, Ken

    2015-01-01

    Clinical studies with montelukast show variability in effect and polymorphic OATP2B1-dependent absorption has previously been implicated as a possible cause. This claim has been challenged with conflicting data and here we used OATP2B1-transfected HEK293 cells to clarify the mechanisms involved. For montelukast, no significant difference in cell uptake between HEK-OATP2B1 and empty vector cell lines was observed at pH 6.5 or pH 7.4, and no concentration-dependent uptake was detected. Montelukast is a carboxylic acid, a relatively potent inhibitor of OATP1B1, OATP1B3, and OATP2B1, and has previously been postulated to be actively transported into human hepatocytes. Using OATP1B1-transfected HEK293 cells and primary human hepatocytes in the presence of OATP inhibitors we demonstrate for the first time that active OATP-dependent transport is unlikely to play a significant role in the human disposition of montelukast. PMID:26694455

  5. Flavonoids exhibit diverse effects on CYP11B1 expression and cortisol synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, Li-Chuan; Li, Lih-Ann, E-mail: lihann@nhri.org.tw

    2012-02-01

    CYP11B1 catalyzes the final step of cortisol biosynthesis. The effects of flavonoids on transcriptional expression and enzyme activity of CYP11B1 were investigated using the human adrenocortical H295R cell model. All tested nonhydroxylated flavones including 3′,4′-dimethoxyflavone, α-naphthoflavone, and β-naphthoflavone upregulated CYP11B1 expression and cortisol production, whereas apigenin and quercetin exhibited potent cytotoxicity and CYP11B1 repression at high concentrations. Nonhydroxylated flavones stimulated CYP11B1-catalyzed cortisol formation at transcriptional level. Resveratrol increased endogenous and substrate-supported cortisol production like nonhydroxylated flavones tested, but it had no effect on CYP11B1 gene expression and enzyme activity. Resveratrol appeared to alter cortisol biosynthesis at an earlier step. The Ad5 element situated in the − 121/− 106 region was required for basal and flavone-induced CYP11B1 expression. Overexpression of COUP-TFI did not improve the responsiveness of Ad5 to nonhydroxylated flavones. Although COUP-TFI overexpression increased CYP11B1 and CYP11B2 promoter activation, its effect was not mediated through the common Ad5 element. Treating cells with PD98059 (a flavone-type MEK1 inhibitor) increased CYP11B1 promoter activity, but not involving ERK signaling because phosphorylation of ERK1/2 remained unvarying throughout the course of treatment. Likewise, AhR was not responsible for the CYP11B1-modulating effects of flavonoids because inconsistency with their effects on AhR activation. 3′,4′-dimethoxyflavone and 8-Br-cAMP additively activated CYP11B1 promoter activity. H-89 reduced 3′,4′-dimethoxyflavone-induced CYP11B1 promoter activation but to a lesser extent as compared to its inhibition on cAMP-induced transactivation. Our data suggest that constant exposure to nonhydroxylated flavones raises a potential risk of high basal and cAMP-induced cortisol synthesis in consequence of increased CYP11B1

  6. 26 CFR 1.50B-1 - Definitions of WIN expenses and WIN employees.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Definitions of WIN expenses and WIN employees. 1.50B-1 Section 1.50B-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY INCOME TAX INCOME TAXES Rules for Computing Credit for Expenses of Work Incentive Programs § 1.50B-1 Definitions of WIN expenses and WIN employees. (a)...

  7. Apoptotic extinction of germ cells in testes of Cyp26b1 knockout mice.

    Science.gov (United States)

    MacLean, Glenn; Li, Hui; Metzger, Daniel; Chambon, Pierre; Petkovich, Martin

    2007-10-01

    Cyp26b1 encodes a retinoic acid (RA) metabolizing cytochrome P450 enzyme that is expressed in embryonic tissues undergoing morphogenesis, including the testes. We have generated transgenic mice lacking Cyp26b1 and have observed increased RA levels in embryonic testes. Cyp26b1(-/-) germ cells prematurely enter meiosis at embryonic d 13.5 and appear to arrest at pachytene stage. Furthermore, after embryonic d 13.5, a rapid increase in apoptosis is observed in male germ cells derived from Cyp26b1(-/-) embryos; germ cells are essentially absent in mutant male neonates. In contrast, testicular somatic cells appear to develop normally in the absence of Cyp26b1. Moreover, ovarian germ and somatic cells appear unaffected by the lack of CYP26B1. We also show that the synthetic retinoid Am580, which is resistant to CYP26 metabolism, induces meiosis of male germ cells in cultured gonads, suggesting that abnormal development of germ cells in the Cyp26b1(-/-) testes results from excess RA rather than the absence of CYP26B1-generated metabolites of RA. These results provide evidence that CYP26B1 maintains low levels of RA in the developing testes that blocks entry into meiosis and acts as a survival factor to prevent apoptosis of male germ cells.

  8. Ascorbate-Glutathione Cycle Alteration in Cadmium Sensitive Rice Mutant cadB-1

    Institute of Scientific and Technical Information of China (English)

    SHEN Guo-ming; ZHU Cheng; DU Qi-zhen; SHANGGUAN Li-na

    2012-01-01

    A rice cadmium (Cd) sensitive mutant cadB-1 was obtained using Agrobacterium tumefaciens mediated system.After exposure of cadB-1 and wild type (WT) rice seedlings to a range of Cd concentrations for 10 d,Cd accumulated to higher levels in roots,stems and leaves of both cadB-1 and WT with increasing external Cd concentrations,and the inhibition of seedling growth in cadB-1 was more serious than in WT.Hydrogen peroxide accumulation was higher in leaves and roots of cadB-1.The ratios of reduced glutathione (GSH)/oxidized glutathione (GSSG),ascorbate (ASC)/dehydroascorbate (DHA) and reduced nicotinamide adenine dinucleotide phosphate (NADPH)/oxidized nicotinamide adenine dinucleotide phosphate (NADP+) were lower in cadB-1 than in WT both in leaves and roots under high Cd levels.The activities of ascorbate peroxidase (APX),glutathione peroxidase (GR),dehydroascorbate reductase (DHAR) and monodehydroascorbate reductase (MDHAR) were also lower in cadB-1 than in WT both in leaves and roots under the treatment of high levels of Cd.Our results suggest that under Cd stress,the ASC-GSH cycle was more seriously inhibited in cadB-1 than in WT,indicating that the mutant cadB-1 is less able to scavenge reactive oxygen species and sensitive to Cd.

  9. Downregulation of kinin B1 receptor function by B2 receptor heterodimerization and signaling.

    Science.gov (United States)

    Zhang, Xianming; Brovkovych, Viktor; Zhang, Yongkang; Tan, Fulong; Skidgel, Randal A

    2015-01-01

    Signaling through the G protein-coupled kinin receptors B1 (kB1R) and B2 (kB2R) plays a critical role in inflammatory responses mediated by activation of the kallikrein-kinin system. The kB2R is constitutively expressed and rapidly desensitized in response to agonist whereas kB1R expression is upregulated by inflammatory stimuli and it is resistant to internalization and desensitization. Here we show that the kB1R heterodimerizes with kB2Rs in co-transfected HEK293 cells and natively expressing endothelial cells, resulting in significant internalization and desensitization of the kB1R response in cells pre-treated with kB2R agonist. However, pre-treatment of cells with kB1R agonist did not affect subsequent kB2R responses. Agonists of other G protein-coupled receptors (thrombin, lysophosphatidic acid) had no effect on a subsequent kB1R response. The loss of kB1R response after pretreatment with kB2R agonist was partially reversed with kB2R mutant Y129S, which blocks kB2R signaling without affecting endocytosis, or T342A, which signals like wild type but is not endocytosed. Co-endocytosis of the kB1R with kB2R was dependent on β-arrestin and clathrin-coated pits but not caveolae. The sorting pathway of kB1R and kB2R after endocytosis differed as recycling of kB1R to the cell surface was much slower than that of kB2R. In cytokine-treated human lung microvascular endothelial cells, pre-treatment with kB2R agonist inhibited kB1R-mediated increase in transendothelial electrical resistance (TER) caused by kB1R stimulation (to generate nitric oxide) and blocked the profound drop in TER caused by kB1R activation in the presence of pyrogallol (a superoxide generator). Thus, kB1R function can be downregulated by kB2R co-endocytosis and signaling, suggesting new approaches to control kB1R signaling in pathological conditions. PMID:25289859

  10. Plexin-B1 silencing inhibits ovarian cancer cell migration and invasion

    International Nuclear Information System (INIS)

    Elevated Plexin-B1 expression has been found in diverse human cancers and in non-neoplastic tissues, and it mediates diverse biological and pathological activities. However, whether or not Plexin-B1 expression is involved in human ovarian tumors remains unclear. In the present study, Plexin-B1 expression was explored in benign and malignant human ovarian tumor tissues. In addition, the impact of Plexin-B1 expression on ovarian cancer cell proliferation, migration and invasion were investigated in vitro. Plexin-B1 expression was analyzed in normal and benign ovarian tissues and serous ovarian tumors (both borderline and malignant) by immunohistochemical staining, as well as in four human ovarian cancer cell lines (A2780, C13*, SKOV3, and OV2008) by RT-PCR and western blot analyses. Furthermore, endogenous Plexin-B1 expression was suppressed by Plexin-B1 siRNA in SKOV3 cells, which overexpress Plexin-B1. Protein levels of Plexin-B1, AKT and AKTSer473 were examined by western blot analysis. Cell proliferation, migration and invasion were measured with MTT, wound healing and boyden chamber assays, respectively, and the cytoskeleton was monitored via F-actin staining. Expression levels of Plexin-B1 protein were significantly higher in serous ovarian carcinomas than in normal ovaries or benign ovarian neoplasms, and in the former, Plexin-B1 expression was positively correlated with lymphatic metastasis, and the membrane and cytoplasm of cancer cells stained positively. SKOV3 cells displayed the highest Plexin-B1 expression at both the mRNA and protein levels among the four tested human ovarian cancer cell lines and was selected as a cell model for further in vitro experiments. Plexin-B1 siRNA significantly suppressed phosphorylation of AKT at Ser473 in SKOV3 cells, but it did not alter total AKT expression. In addition, silencing of Plexin-B1 in SKOV3 cells inhibited cell migration and invasion and reorganized the cytoskeleton, whereas cell proliferation was not affected

  11. Source Expansion Nodal Solution of SP3 Equations with P1 Coarse Mesh Finite Difference Formulation

    International Nuclear Information System (INIS)

    In order to effectively account for the transport effects in core calculations, the SP3 equations are adopted in some of the existing nodal diffusion codes such as PARCS and DYN3D. The advantage of using the SP3 equations comes from the similarity between the SP3 equations and the diffusion or P1 equation that make it possible to use the existing code's architecture and solution methods that were developed for the nodal diffusion equation. The only difference is that there are one more balance equation and one additional unknown, the second angular moment. For the solution of the SP3 equations by the nodal method, the nodal expansion method was first developed and the source expansion nodal method(SENM) was introduced as an accurate kernel to capture correctly the drastic variation of the second angular moment near material interfaces. The exponential part of the source expansion nodal solution turned out to be very effective in describing the strong gradient in the second angular flux near the surface and this capability of SENM provides better accuracy than the corresponding NEM solution. On the other hand, a nodal solution kernel can be formulated locally employing either a one-node or two- node formulation. The one-node formulation requires incoming current conditions while the two-node formulation requires node average fluxes. In principle, these boundary conditions can be provided by the global coarse mesh finite difference (CMFD) solution that includes both zero-th and second angular moment fluxes. Inclusion of the second angular moments in the CMFD system, however, can lead to potential instability because of the large gradient of the second angular moments near each interface. This work is to develop a way not to use the second angular moment in the CMFD equation by keeping the ordinary P1 CMFD formulation

  12. An extremal problem on potentially $K_{p_{1},p_{2},...,p_{t}}$-graphic sequences

    OpenAIRE

    Lai, Chunhui

    2004-01-01

    A sequence $S$ is potentially $K_{p_{1},p_{2},...,p_{t}}$ graphical if it has a realization containing a $K_{p_{1},p_{2},...,p_{t}}$ as a subgraph, where $K_{p_{1},p_{2},...,p_{t}}$ is a complete t-partite graph with partition sizes $p_{1},p_{2},...,p_{t} (p_{1}\\geq p_{2}\\geq ...\\geq p_{t} \\geq 1)$. Let $\\sigma(K_{p_{1},p_{2},...,p_{t}}, n)$ denote the smallest degree sum such that every $n$-term graphical sequence $S$ with $\\sigma(S)\\geq \\sigma(K_{p_{1},p_{2},...,p_{t}}, n)$ is potentially $...

  13. The Moduli of Flat U(p,1) Structures on Riemann Surfaces

    OpenAIRE

    Xia, Eugene Z.

    1999-01-01

    For a compact Riemann surface $X$ of genus $g > 1$, $\\Hom(\\pi_1(X), U(p,1))/U(p,1)$ is the moduli space of flat $\\U(p,1)$-connections on $X$. There is an integer invariant, $\\tau$, the Toledo invariant associated with each element in $\\Hom(\\pi_1(X), U(p,1))/U(p,1)$. If $q = 1$, then $-2(g-1) \\le \\tau \\le 2(g-1)$. This paper shows that $\\Hom(\\pi_1(X), U(p,1))/U(p,1)$ has one connected component corresponding to each $\\tau \\in 2Z$ with $-2(g-1) \\le \\tau \\le 2(g-1)$. Therefore the total number o...

  14. Gauge groups and matter fields for F-theory without Section on Double Covers of $\\mathbb{P}^1\\times\\mathbb{P}^1$ and Complete Intersections in $\\mathbb{P}^1\\times\\mathbb{P}^3$

    CERN Document Server

    Kimura, Yusuke

    2016-01-01

    In this paper, we investigate F-theory compactifications without a section to the fibration. We construct genus-one fibered Calabi-Yau 4-folds without a section, and compactify F-theory on these spaces. To build such models, we in particular focus our attention on the direct product of K3's. We consider i)a double cover of $\\mathbb{P}^1\\times\\mathbb{P}^1$ ramified over a bidegree (4,4) curve, and ii)the complete intersection of bidgree (1,2) and (1,2) hypersurfaces in $\\mathbb{P}^1\\times\\mathbb{P}^3$. A generic member of these surfaces is a genus-one fibered K3 surface lacking a section to the fibration. The direct product of such surface times a K3 gives a genus-one fibered Calabi-Yau 4-fold without a section. Among double covers of $\\mathbb{P}^1\\times\\mathbb{P}^1$ ramified over a bidegree (4,4) curve, we choose to consider members defined by special forms of equations, possessing automorphism group $\\mathbb{Z}_4$. With this choice, a detailed analysis of physics is possible from the geometry. With the above...

  15. Targeting cyclin B1 inhibits proliferation and sensitizes breast cancer cells to taxol

    Directory of Open Access Journals (Sweden)

    Strebhardt Klaus

    2008-12-01

    Full Text Available Abstract Background Cyclin B1, the regulatory subunit of cyclin-dependent kinase 1 (Cdk1, is essential for the transition from G2 phase to mitosis. Cyclin B1 is very often found to be overexpressed in primary breast and cervical cancer cells as well as in cancer cell lines. Its expression is correlated with the malignancy of gynecological cancers. Methods In order to explore cyclin B1 as a potential target for gynecological cancer therapy, we studied the effect of small interfering RNA (siRNA on different gynecological cancer cell lines by monitoring their proliferation rate, cell cycle profile, protein expression and activity, apoptosis induction and colony formation. Tumor formation in vivo was examined using mouse xenograft models. Results Downregulation of cyclin B1 inhibited proliferation of several breast and cervical cancer cell lines including MCF-7, BT-474, SK-BR-3, MDA-MB-231 and HeLa. After combining cyclin B1 siRNA with taxol, we observed an increased apoptotic rate accompanied by an enhanced antiproliferative effect in breast cancer cells. Furthermore, control HeLa cells were progressively growing, whereas the tumor growth of HeLa cells pre-treated with cyclin B1 siRNA was strongly inhibited in nude mice, indicating that cyclin B1 is indispensable for tumor growth in vivo. Conclusion Our data support the notion of cyclin B1 being essential for survival and proliferation of gynecological cancer cells. Concordantly, knockdown of cyclin B1 inhibits proliferation in vitro as well as in vivo. Moreover, targeting cyclin B1 sensitizes breast cancer cells to taxol, suggesting that specific cyclin B1 targeting is an attractive strategy for the combination with conventionally used agents in gynecological cancer therapy.

  16. Global gene profiling of aging lungs in Atp8b1 mutant mice

    Science.gov (United States)

    Soundararajan, Ramani; Stearns, Timothy M.; Czachor, Alexander; Fukumoto, Jutaro; Turn, Christina; Westermann-Clark, Emma; Breitzig, Mason; Tan, Lee; Lockey, Richard F.; King, Benjamin L.; Kolliputi, Narasaiah

    2016-01-01

    Objective Recent studies implicate cardiolipin oxidation in several age-related diseases. Atp8b1 encoding Type 4 P-type ATPases is a cardiolipin transporter. Mutation in Atp8b1 gene or inflammation of the lungs impairs the capacity of Atp8b1 to clear cardiolipin from lung fluid. However, the link between Atp8b1 mutation and age-related gene alteration is unknown. Therefore, we investigated how Atp8b1 mutation alters age-related genes. Methods We performed Affymetrix gene profiling of lungs isolated from young (7-9 wks, n=6) and aged (14 months, 14 M, n=6) C57BL/6 and Atp8b1 mutant mice. In addition, Ingenuity Pathway Analysis (IPA) was performed. Differentially expressed genes were validated by quantitative real-time PCR (qRT-PCR). Results Global transcriptome analysis revealed 532 differentially expressed genes in Atp8b1 lungs, 157 differentially expressed genes in C57BL/6 lungs, and 37 overlapping genes. IPA of age-related genes in Atp8b1 lungs showed enrichment of Xenobiotic metabolism and Nrf2-mediated signaling pathways. The increase in Adamts2 and Mmp13 transcripts in aged Atp8b1 lungs was validated by qRT-PCR. Similarly, the decrease in Col1a1 and increase in Cxcr6 transcripts was confirmed in both Atp8b1 mutant and C57BL/6 lungs. Conclusion Based on transcriptome profiling, our study indicates that Atp8b1 mutant mice may be susceptible to age-related lung diseases. PMID:27689529

  17. Simulations of symcap and layered NIF experiments with top/bottom laser asymmetry to impose P1 drive on capsules

    Science.gov (United States)

    Eder, D.; Spears, B.; Casey, D.; Pak, A.; Ma, T.; Izumi, N.; Pollock, B.; Weber, C.; Kritcher, A.; Jones, O.; Milovich, J.; Town, R.; Robey, H.; Hinkel, D.; Callahan, D.; Hatchett, S.; Knauer, J.; Yeamans, C.; Bleuel, D.; Nagel, S.; Hatarik, R.; Khan, S.; Sayre, D.; Caggiano, J.; Grim, G.; Eckart, M.; Fittinghoff, D.; Merrill, F.; Bradley, D.

    2016-05-01

    Integrated hohlraum/capsule post-shot simulation of the first full-scale cryogenic layered-DT experiment with top/bottom laser asymmetries of 8% is discussed. The imposed P1 Legendre mode drive on the capsule results in downward velocity of 85 ± 15 km/s as measured by neutron time of flight (NTOF) diagnostics and x-ray imagers, which is in excellent agreement with the calculated velocity of 87 km/s. The measured DT yield is approximately 30% less than the average of two comparable shots using the same 4 shock HiFoot pulse shape without drive asymmetry. The calculated DT yield of 5.0e15 is very close to the measured value of 4.86e15 for the shot with drive asymmetry, which implies that P1 effects dominate yield reduction. The neutron activation diagnostics (NADs) give clear indication of higher areal density in the direction of the north pole in excellent agreement with calculations. Integrated post-shot simulation of an earlier symcap (capsule with appropriate ablator thicknesses to act as a surrogate for an ignition capsule) experiment with laser asymmetries show that calculated neutron-wighted velocity is a strong function of capsule shape.

  18. Evidence for the h_b(1P) meson in the decay Upsilon(3S) --> pi0 h_b(1P)

    Energy Technology Data Exchange (ETDEWEB)

    Lees, J.P.

    2011-08-12

    Using a sample of 122 million {Upsilon}(3S) events recorded with the BABAR detector at the PEP-II asymmetric-energy e{sup +}e{sup -} collider at SLAC, we search for the h{sub b}(1P) spin-singlet partner of the P-wave {chi}{sub b}(1P) states in the sequential decay {Upsilon}(3S) {yields} {pi}{sup 0}h{sub b}(1P), h{sub b}(1P) {yields} {gamma}{eta}{sub b}(1S). We observe an excess of events above background in the distribution of the recoil mass against the {pi}{sup 0} at mass 9902 {+-} 4(stat.) {+-} 1(syst.) MeV/c{sup 2}. The width of the observed signal is consistent with experimental resolution, and its significance is 3.0 {sigma}, including systematic uncertainties. We obtain the value (3.7 {+-} 1.1 (stat.) {+-} 0.7 (syst.)) x 10{sup -4} for the product branching fraction {Beta}({Upsilon}(3S) {yields} {pi}{sup 0}h{sub b}) x {Beta}(h{sub b} {yields} {gamma}{eta}{sub b}).

  19. Observation of B+->b_1+K0 and search for B-meson decays to b_10K0 and b_1pi0

    CERN Document Server

    Aubert, B; Bóna, M; Karyotakis, Yu; Lees, J P; Poireau, V; Prencipe, E; Prudent, X; Tisserand, V; Garra Tico, J; Graugès-Pous, E; Lopezab, L; Palanoab, A; Pappagalloab, M; Eigen, G; Stugu, B; Sun, L; Abrams, G S; Battaglia, M; Brown, D N; Cahn, R N; Jacobsen, R G; Kerth, L T; Kolomensky, Yu G; Kukartsev, G; Lynch, G; Osipenkov, I L; Ronan, M T; Tackmann, K; Tanabé, T; Hawkes, C M; Soni, N; Watson, A T; Koch, H; Schröder, T; Walker, D; Asgeirsson, D J; Çuhadar-Dönszelmann, T; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Barrett, M; Khan, A; Teodorescu, L; Blinov, V E; Bukin, A D; Buzykaev, A R; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Gary, J W; Liu, F; Long, O; Shen, B C; Vitug, G M; Yasin, Z; Zhang, L; Sharma, V; Campagnari, C; Hong, T M; Kovalskyi, D; Mazur, M A; Richman, J D; Beck, T W; Eisner, A M; Flacco, C J; Heusch, C A; Kroseberg, J; Lockman, W S; Schalk, T; Schumm, B A; Seiden, A; Wang, L; Wilson, M G; Winstrom, L O; Cheng, C H; Doll, D A; Echenard, B; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Blanc, F; Bloom, P C; Clifton, Z C; Ford, W T; Gaz, A; Hirschauer, J F; Kreisel, A; Nagel, M; Nauenberg, U; Smith, J G; Ulmer, K A; Wagner, S R; Ayad, R; Soffer, A; Toki, W H; Wilson, R J; Altenburg, D D; Feltresi, E; Hauke, A; Jasper, H; Karbach, M; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Kobel, M J; Mader, W F; Nogowski, R; Schubert, K R; Schwierz, R; Sundermann, J E; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Thiebaux, C; Verderi, M; Clark, P J; Gradl, W; Playfer, S; Watson, J E; Andreottiab, M; Bettonia, D; Bozzia, C; Calabreseab, R; Cecchiab, A; Cibinettoab, G; Franchiniab, P; Luppiab, E; Negriniab, M; Petrellaab, A; Piemontesea, L; Santoroab, V; Baldini-Ferroli, R; Calcaterra, A; De Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Buzzoa, A; Contriab, R; Lo Vetereab, M; Macria, M M; Mongeab, M R; Passaggioa, S; Patrignaniab, C; Robuttia, E; Santroniab, A; Tosiab, S; Chaisanguanthum, K S; Morii, M; Dubitzky, R S; Marks, J; Schenk, S; Uwer, U; Klose, V; Lacker, H M; De Nardoab, G; Listaa, L; Monorchioab, D; Onoratoab, G; Sciaccaab, C; Bard, D J; Dauncey, P D; Nash, J A; Panduro-Vazquez, W; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Cochran, J; Crawley, H B; Dong, L; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Lae, C K; Denig, A G; Fritsch, M; Schott, G; Arnaud, N; Bquilleux, J; D'Orazio, A; Davier, M; Firminoda Costa, J; Grosdidier, G; Höcker, A; Lepeltier, V; Le Diberder, F; Lutz, A M; Pruvot, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Burke, J P; Chavez, C A; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Touramanis, C; Bevan, A J; George, K A; Di Lodovico, F; Sacco, R; Sigamani, M; Cowan, G; Flächer, H U; Hopkins, D A; Paramesvaran, S; Salvatore, F; Wren, A C; Brown, D N; Davis, C L; Alwyn, K E; Barlow, N R; Barlow, R J; Chia, Y M; Edgar, C L; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Dallapiccola, C; Hertzbach, S S; Li, X; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Koeneke, K; Sciolla, G; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Mclachlin, S E; Patel, P M; Robertson, S H; Lazzaroab, A; Lombardoa, V; Palomboab, F; Bauer, J M; Cremaldi, L; Eschenburg, V; Godang, R; Kroeger, R; Sanders, D A; Summers, D J; Zhao, H W; Simard, M; Taras, P; Viaud, F B; Nicholson, H; Baak, M A; Raven, G; Snoek, H L; Jessop, C P; Knoepfel, K J; LoSecco, J M; Wang, W F; Benelli, G; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Sekula, S J; Wong, Q K; Blount, N L; Brau, J E; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Castelliab, G; Gagliardiab, N; Margoniab, M; Morandina, M; Posoccoa, M; Rotondoa, M; Simonettoab, F; Stroiliab, R; Vociab, C; Del Amo-Sánchez, P; Ben-Haim, E; Briand, H; Calderini, G; Chauveau, J; David, P; Del Buono, L; Hamon, O; Leruste, P; Ocariz, J; Pérez, A; Prendki, J; Gladney, L; Biasiniab, M; Covarelliab, R; Manoniab, E; Angeliniab, C; Batignaniab, G; Bettariniab, S; Carpinelliab, M; Cervelliab, A; Fortiab, F; Giorgiab, M A; Lusianiac, A; Marchioriab, G; Morgantiab, M; Neriab, N; Paoloniab, E; Rizzoab, G; Walsha, J J; Biesiada, J; Lopes-Pegna, D; Lü, C; Olsen, J; Smith, A J S; Telnov, A V; Anullia, F; Baracchiniab, E; Cavotoa, G; del Reab, D; Di Marcoab, E; Facciniab, R

    2008-01-01

    We present the results of searches for decays of B mesons to final states with a b_1 meson and a neutral pion or kaon. The data, collected with the BABAR detector at the Stanford Linear Accelerator Center, represent 465 million BBbar pairs produced in e+e- annihilation. The results for the branching fractions are, in units of 1e-6, BR(B+ to b_1+K0) = 9.6+/-1.7+/-0.9, BR(B0 to b_10K0) = 5.1+/-1.8+/-0.5 (<7.8), BR(B+ to b_1+pi0) = 1.8+/-0.9+/-0.2 (<3.3), and BR(B0 to b_10pi0) = 0.4+/-0.8+/-0.2 (<1.9), with the assumption that BR(B_1 to omega pi)=1. We also measure the charge asymmetry A_ch(B+ to b_1+K0) = -0.03+/-0.15+/-0.02. The first error quoted is statistical, the second systematic, and the upper limits in parentheses indicate the 90% confidence level.

  20. Measuring electron-impact cross sections of water: elastic scattering and electronic excitation of the ã3B1 and Ã1B1 states

    Science.gov (United States)

    Matsui, Midori; Hoshino, Masamitsu; Kato, Hidetoshi; Ferreira da Silva, Fillipe; Limão-Vieira, Paulo; Tanaka, Hiroshi

    2016-04-01

    Here, we report elastic differential cross sections (DCSs) for electron scattering from water in the incident energy range of 2-100 eV. Furthermore, we present a complete study on the electronic excitation of the ã3B1 and Ã1B1 states at electron impact energies of 15, 20, and 30 eV and in the scattering angle range of 10° - 130°. Integral cross sections (ICSs) are determined from the DCSs. Measuring elastic DCSs in various experimental conditions confirmed the reproducibility of the data. The present results agree with the data previously obtained from a conventional collimating tube gas source. Ambiguities associated with the unfolding procedure of the electron energy loss (EEL) spectra for the electronic excitations have been reduced by comparison against the EEL spectrum at high electron impact energy and for small scattering angle. The reliability of the extracted DCSs is improved significantly for optically forbidden contributions from the overlap of the ã3B1 and Ã1B1 electronic states. The BEf-scaling model is also confirmed to produce the integral cross section for the optical allowed transition of the Ã1B1 state in the intermediate electron energy region above 15 eV.

  1. Nanocellulose coated with various free fatty acids can adsorb fumonisin B1, and decrease its toxicity.

    Science.gov (United States)

    Zadeh, Mohammad Hossein Balal; Shahdadi, Hossein

    2015-10-01

    The aim of this study was to evaluate the adsorption and biological properties of nanocellulose coated with free fatty acids (NCCFFAs). At first, nanocellulose was synthesized by acid hydrolysis, and then separately coated with different free fatty acids (FFAs), including lauric acid, alpha linoleic acid, oleic acid, and palmitic acid. Next, the serial concentrations of NCCFFAs (1, 10, 100, and 1000 μg/mL) was separately added to fumonisin B1 (FB1) at 1000 μg/mL, and separately incubated at 37 °C for 1, 2, and 3h. Then, the percentage of adsorption was calculated. In the next experiment, the viability of mouse liver cells was measured when they exposed to serial concentrations of NCCFFAs, FFAs, and FB1. This study showed that the increase of incubation time and concentration of NCCFFAs led to increase of FB1 adsorption. Although FFAs and NCCFFAs had no remarkable toxicity, the high toxicity was observed for FB1. Importantly, the toxicity of FB1 was highly decreased, when incubated together with FFAs or NCCFFAs. These novel adsorbents, NCCFFAs, can be used together with different foodstuffs to remove FB1. PMID:26142625

  2. Material properties and modeling characteristics for MnFeP1-xAsx materials for application in magnetic refrigeration

    DEFF Research Database (Denmark)

    Engelbrecht, Kurt; Nielsen, Kaspar Kirstein; Bahl, Christian R.H.;

    2013-01-01

    Compounds of MnFeP1-xAsx have received attention recently for their use in active magnetic regenerators (AMR) because of their relatively high isothermal entropy change and adiabatic temperature change with magnetization. However, the materials also generally exhibit a significant magnetic...... impact of hysteresis is a key element to guide successful material development and synthesis. The properties of a magnetocaloric MnFeP1-xAsx compound are characterized as a function of temperature and applied magnetic field, and the results are used to assess the effects of hysteresis on magnetocaloric...... properties. Different methods of building property functions from the measured specific heat, magnetization, and adiabatic temperature change are presented. It is shown that model predictions can be highly dependent on how the properties that are used by the AMR model are calculated. © 2013 AIP Publishing...

  3. UNC93B1 mediates host resistance to infection with Toxoplasma gondii.

    Directory of Open Access Journals (Sweden)

    Mariane B Melo

    Full Text Available UNC93B1 associates with Toll-Like Receptor (TLR 3, TLR7 and TLR9, mediating their translocation from the endoplasmic reticulum to the endolysosome, hence allowing proper activation by nucleic acid ligands. We found that the triple deficient '3d' mice, which lack functional UNC93B1, are hyper-susceptible to infection with Toxoplasma gondii. We established that while mounting a normal systemic pro-inflammatory response, i.e. producing abundant MCP-1, IL-6, TNFα and IFNγ, the 3d mice were unable to control parasite replication. Nevertheless, infection of reciprocal bone marrow chimeras between wild-type and 3d mice with T. gondii demonstrated a primary role of hemopoietic cell lineages in the enhanced susceptibility of UNC93B1 mutant mice. The protective role mediated by UNC93B1 to T. gondii infection was associated with impaired IL-12 responses and delayed IFNγ by spleen cells. Notably, in macrophages infected with T. gondii, UNC93B1 accumulates on the parasitophorous vacuole. Furthermore, upon in vitro infection the rate of tachyzoite replication was enhanced in non-activated macrophages carrying mutant UNC93B1 as compared to wild type gene. Strikingly, the role of UNC93B1 on intracellular parasite growth appears to be independent of TLR function. Altogether, our results reveal a critical role for UNC93B1 on induction of IL-12/IFNγ production as well as autonomous control of Toxoplasma replication by macrophages.

  4. 26 CFR 31.3302(b)-1 - Additional credit against tax.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Additional credit against tax. 31.3302(b)-1...) EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE Federal Unemployment Tax Act (Chapter 23, Internal Revenue Code of 1954) § 31.3302(b)-1...

  5. 26 CFR 1.410(b)-1 - Minimum coverage requirements (before 1994).

    Science.gov (United States)

    2010-04-01

    ....410(b)-1(b)(2). (6) Integration with Social Security Act. See section 401(a)(5) and the regulations thereunder for rules relating to integration of plans with the Social Security Act. (7) Different age and... service. The plan can be shown not to satisfy the requirements of IRC section 410(b)(1)(A) as follows:...

  6. 26 CFR 1.802(b)-1 - Tax on life insurance companies.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Tax on life insurance companies. 1.802(b)-1...) INCOME TAX (CONTINUED) INCOME TAXES Life Insurance Companies § 1.802(b)-1 Tax on life insurance companies... August 16, 1954, section 802(b) imposes a tax on the 1954 life insurance company taxable income of...

  7. Construction and Virulence of Filamentous Hemagglutinin Protein B1 Mutant of Pasteurella multocida in Chickens

    Institute of Scientific and Technical Information of China (English)

    GUO Dong-chun; QU Lian-dong; SUN Yan; ZHANG Ai-qin; LIU Jia-sen; LU Yan; LIU Pei-xin; YUAN Dong-wei; JIANG Qian; SI Chang-de

    2014-01-01

    Pasteurella multocida, a Gram-negative nonmotile coccobacillus, is the causative agent of fowl cholera, bovine hemorrhagic septicemia, enzoonotic pneumonia and swine atropic rhinitis. Two iflamentous hemagglutinin genes, fhaB1 and fhaB2, are the potential virulence factors. In this study, an inactivation fhaB1 mutant of P. multocida in avian strain C48-102 was constructed by a kanamycin-resistance cassette. The virulence of the fhaB1 mutant and the wild type strain was assessed in chickens by intranasal and intramuscular challenge. The inactivation of fhaB1 resulted in a high degree of attenuation when the chickens were challenged intranasally and a lesser degree when challenged intramuscularly. The fhaB1 mutant and the wild type strain were investigated their sensitivity to the antibody-dependent classical complement-mediated killing pathway in 90%convalescent chicken serum. The fhaB1 mutant was serum sensitive as the viability has reduced between untreated serum and heat inactivated chicken serum (P<0.007). These results conifrmed that FhaB1 played the critical roles in the bacterial pathogenesis and further studies were needed to investigate the mechanism which caused reduced virulence of the fhaB1 mutant.

  8. 26 CFR 1.6050B-1 - Information returns by person making unemployment compensation payments.

    Science.gov (United States)

    2010-04-01

    ... unemployment compensation payments. 1.6050B-1 Section 1.6050B-1 Internal Revenue INTERNAL REVENUE SERVICE... Information returns by person making unemployment compensation payments. For taxable years beginning after December 31, 1978, every person who makes payments of unemployment compensation (as defined in section...

  9. The use of MR B+1 imaging for validation of FDTD electromagnetic simulations of human anatomies

    International Nuclear Information System (INIS)

    In this study, MR B+1 imaging is employed to experimentally verify the validity of FDTD simulations of electromagnetic field patterns in human anatomies. Measurements and FDTD simulations of the B+1 field induced by a 3 T MR body coil in a human corpse were performed. It was found that MR B+1 imaging is a sensitive method to measure the radiofrequency (RF) magnetic field inside a human anatomy with a precision of approximately 3.5%. A good correlation was found between the B+1 measurements and FDTD simulations. The measured B+1 pattern for a human pelvis consisted of a global, diagonal modulation pattern plus local B+1 heterogeneties. It is believed that these local B+1 field variations are the result of peaks in the induced electric currents, which could not be resolved by the FDTD simulations on a 5 mm3 simulation grid. The findings from this study demonstrate that B+1 imaging is a valuable experimental technique to gain more knowledge about the dielectric interaction of RF fields with the human anatomy

  10. 26 CFR 48.4161(b)-1 - Imposition and rates of tax; bows and arrows.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Imposition and rates of tax; bows and arrows. 48.4161(b)-1 Section 48.4161(b)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS EXCISE TAXES MANUFACTURERS AND RETAILERS EXCISE TAXES Sporting Goods §...

  11. Preparation and application of new fluorescein-labeled fumonisins B1 in fluorescence polarization analysis technique

    Science.gov (United States)

    Objective: To prepare a new fluorescent tracer against common mycotoxins such as fumonisin B1 in order to replace 6-(4,6-Dichlorotriazinyl) aminofluorescein (6-DTAF), an expensive marker, and to develop a technique for quick detection of fumonisin B1 based on the principle of fluorescence polarizati...

  12. Data of evolutionary structure change: 1B1ZA-2NTSA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B1ZA-2NTSA 1B1Z 2NTS A A DPDPSQLHRSSLVKNLQNIYFLYE-GDPVTHENVKSVDQ...ELDYKVRKYLTDNKQLYTN--------------GPSKYETGYIKFIPKNKESFWFDFF-PEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT-- ...ine> 2NTS A 2NTSA 2NTS A 2NTS.../line> PHE CA 274 2NTS A 2NTS

  13. Data of evolutionary structure change: 1B1ZC-2NTSA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B1ZC-2NTSA 1B1Z 2NTS C A DPDPSQLHRSSLVKNLQNIYFLYE-GDPVTHENVKSVDQ...ELDYKVRKYLTDNKQLYTNG--------------PSKYETGYIKFIPKNKESFWFDFFP-EPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT-- ...e>THR CA 392 2NTS A 2NTS...CA 343 LYS CA 296 2NTS A 2NTS...208 PHE CA 276 THR CA 304 2NTS

  14. Data of evolutionary structure change: 1B1ZD-2NTSA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B1ZD-2NTSA 1B1Z 2NTS D A DPDPSQLHRSSLVKNLQNIYFLYE-GDPVTHENVKSVDQ...ELDYKVRKYLTDNKQLYT--------------NGPSKYETGYIKFIPKNKESFWFDFFP-EPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT-- ...R CA 395 2NTS A 2NTS... LYS CA 294 2NTS A 2NTS...e>PHE CA 282 THR CA 304 2NTS

  15. Data of evolutionary structure change: 1B1ZB-2NTSA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B1ZB-2NTSA 1B1Z 2NTS B A DPDPSQLHRSSLVKNLQNIYFLYE-GDPVTHENVKSVDQ...ELDYKVRKYLTDNKQLYT--------------NGPSKYETGYIKFIPKNKESFWFDFF-PEPEFTQSKYLMIYKDNETLDSNTSQIEVYLTT-- ...4 2NTS A 2NTSA 2NTS A 2NTSAPHE CA 283 2NTS A 2NTS

  16. 26 CFR 1.6038B-1 - Reporting of certain transfers to foreign corporations.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false Reporting of certain transfers to foreign corporations. 1.6038B-1 Section 1.6038B-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY... either: (1) The transferor (or one or more successors) properly entered into a gain recognition...

  17. 26 CFR 48.6416(b)(1)-2 - Determination of price readjustments.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Determination of price readjustments. 48.6416(b)(1)-2 Section 48.6416(b)(1)-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY... models are introduced, or a general price reduction affecting articles held in stock by the vendee as...

  18. Sulfolobus Replication Factor C stimulates the activity of DNA Polymerase B1

    DEFF Research Database (Denmark)

    Xing, Xuanxuan; Zhang, Likui; Guo, Li;

    2014-01-01

    Replication factor C (RFC) is known to function in loading proliferating cell nuclear antigen (PCNA) onto primed DNA, allowing PCNA to tether DNA polymerase for highly processive DNA synthesis in eukaryotic and archaeal replication. In this report, we show that an RFC complex from the...... with the ability of RFC to facilitate DNA binding by PolB1 through protein-protein interaction. These results suggest that Sulfolobus RFC may play a role in recruiting DNA polymerase for efficient primer extension, in addition to clamp loading, during DNA replication....... hyperthermophilic archaea of the genus Sulfolobus physically interacts with DNA polymerase B1 (PolB1) and enhances both the polymerase and 3'-5' exonuclease activities of PolB1 in an ATP-independent manner. Stimulation of the PolB1 activity by RFC is independent of the ability of RFC to bind DNA but is consistent...

  19. Cyp26b1 within the growth plate regulates bone growth in juvenile mice

    Energy Technology Data Exchange (ETDEWEB)

    Minegishi, Yoshiki [Department of Cell Growth and Differentiation, Center for iPS Cell Research and Application, Kyoto University, 53 Kawahara-cho, Shogoin, Sakyo-ku, Kyoto 606-8507 (Japan); Department of Plastic and Reconstructive Surgery, University of Fukui Hospital, 23-3 Matsuokashimoaizuki, Eiheiji-cho, Yoshida-gun, Fukui 910-1193 (Japan); Department of Plastic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Sakai, Yasuo [Department of Plastic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Department of Plastic Surgery, Bellland General Hospital, 500-3 Higashiyama Naka-ku, Sakai, Osaka 599-8247 (Japan); Yahara, Yasuhito [Department of Cell Growth and Differentiation, Center for iPS Cell Research and Application, Kyoto University, 53 Kawahara-cho, Shogoin, Sakyo-ku, Kyoto 606-8507 (Japan); Akiyama, Haruhiko [Department of Orthopaedic Surgery, Gifu University Graduate School of Medicine, 1-1 Yanagito, Gifu 501-1194 (Japan); Yoshikawa, Hideki [Department of Orthopaedic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Hosokawa, Ko [Department of Plastic Surgery, Osaka University Graduate School of Medicine, 2-2 Yamadaoka, Suita, Osaka 565-0871 (Japan); Tsumaki, Noriyuki, E-mail: ntsumaki@cira.kyoto-u.ac.jp [Department of Cell Growth and Differentiation, Center for iPS Cell Research and Application, Kyoto University, 53 Kawahara-cho, Shogoin, Sakyo-ku, Kyoto 606-8507 (Japan); Japan Science and Technology Agency, CREST, Tokyo 102-0075 (Japan)

    2014-11-07

    Highlights: • Retinoic acid and Cyp26b1 were oppositely localized in growth plate cartilage. • Cyp26b1 deletion in chondrocytes decreased bone growth in juvenile mice. • Cyp26b1 deletion reduced chondrocyte proliferation and growth plate height. • Vitamin A-depletion partially reversed growth plate abnormalities caused by Cyp26b1 deficiency. • Cyp26b1 regulates bone growth by controlling chondrocyte proliferation. - Abstract: Retinoic acid (RA) is an active metabolite of vitamin A and plays important roles in embryonic development. CYP26 enzymes degrade RA and have specific expression patterns that produce a RA gradient, which regulates the patterning of various structures in the embryo. However, it has not been addressed whether a RA gradient also exists and functions in organs after birth. We found localized RA activities in the diaphyseal portion of the growth plate cartilage were associated with the specific expression of Cyp26b1 in the epiphyseal portion in juvenile mice. To disturb the distribution of RA, we generated mice lacking Cyp26b1 specifically in chondrocytes (Cyp26b1{sup Δchon} cKO). These mice showed reduced skeletal growth in the juvenile stage. Additionally, their growth plate cartilage showed decreased proliferation rates of proliferative chondrocytes, which was associated with a reduced height in the zone of proliferative chondrocytes, and closed focally by four weeks of age, while wild-type mouse growth plates never closed. Feeding the Cyp26b1 cKO mice a vitamin A-deficient diet partially reversed these abnormalities of the growth plate cartilage. These results collectively suggest that Cyp26b1 in the growth plate regulates the proliferation rates of chondrocytes and is responsible for the normal function of the growth plate and growing bones in juvenile mice, probably by limiting the RA distribution in the growth plate proliferating zone.

  20. Cyp26b1 within the growth plate regulates bone growth in juvenile mice

    International Nuclear Information System (INIS)

    Highlights: • Retinoic acid and Cyp26b1 were oppositely localized in growth plate cartilage. • Cyp26b1 deletion in chondrocytes decreased bone growth in juvenile mice. • Cyp26b1 deletion reduced chondrocyte proliferation and growth plate height. • Vitamin A-depletion partially reversed growth plate abnormalities caused by Cyp26b1 deficiency. • Cyp26b1 regulates bone growth by controlling chondrocyte proliferation. - Abstract: Retinoic acid (RA) is an active metabolite of vitamin A and plays important roles in embryonic development. CYP26 enzymes degrade RA and have specific expression patterns that produce a RA gradient, which regulates the patterning of various structures in the embryo. However, it has not been addressed whether a RA gradient also exists and functions in organs after birth. We found localized RA activities in the diaphyseal portion of the growth plate cartilage were associated with the specific expression of Cyp26b1 in the epiphyseal portion in juvenile mice. To disturb the distribution of RA, we generated mice lacking Cyp26b1 specifically in chondrocytes (Cyp26b1Δchon cKO). These mice showed reduced skeletal growth in the juvenile stage. Additionally, their growth plate cartilage showed decreased proliferation rates of proliferative chondrocytes, which was associated with a reduced height in the zone of proliferative chondrocytes, and closed focally by four weeks of age, while wild-type mouse growth plates never closed. Feeding the Cyp26b1 cKO mice a vitamin A-deficient diet partially reversed these abnormalities of the growth plate cartilage. These results collectively suggest that Cyp26b1 in the growth plate regulates the proliferation rates of chondrocytes and is responsible for the normal function of the growth plate and growing bones in juvenile mice, probably by limiting the RA distribution in the growth plate proliferating zone

  1. 75 FR 23574 - Airworthiness Directives; CFM International, S.A. CFM56-5B1/P, -5B2/P, -5B3/P, -5B3/P1, -5B4/P...

    Science.gov (United States)

    2010-05-04

    ... INFORMATION: The FAA proposed to amend 14 CFR part 39 by superseding AD 2009-01-01, Amendment 39-15779 (73 FR... (74 FR 67834). That action proposed to require continuous monitoring of EGT margin deterioration... Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and (3) Will not have a...

  2. Transition energy and dipole oscillator strength for 1s22p-1s2nd of Cr21+ ion

    Institute of Scientific and Technical Information of China (English)

    Wang Zhi-Wen; Liu Ying; Hu Mu-Hong; Li Xin-Ru; Wang Ya-Nan

    2008-01-01

    The transition energies, wavelengths and dipole oscillator strengths of 1s22p-1s2nd (3 ≤ n ≤ 9) for Cr21+ ion are calculated. The fine structure splittings of 1s2nd (n ≤ 9) states for this ion are also calculated. In calculating energy, we have estimated the higher-order relativistic contribution under a hydrogenic approximation. The quantum defect of Rydberg series 1s2nd is determined according to the quantum defect theory. The results obtained in this paper excellently agree with the experimental data available in the literature. Combining the quantum defect theory with the discrete oscillator strengths, the discrete oscillator strengths for the transitions from initial state 1s22p to highly excited 1s2nd states (n ≥ 10) and the oscillator strength density corresponding to the bound-free transitions are obtained.

  3. Structure-function relationships of the Mycobacterium tuberculosis transcription factor WhiB1.

    Directory of Open Access Journals (Sweden)

    Laura J Smith

    Full Text Available BACKGROUND: Members of the WhiB-like (Wbl protein family possess iron-sulfur clusters and are implicated in the regulation of developmental processes in Actinomycetes. Mycobacterium tuberculosis possesses seven Wbl proteins. The [4Fe-4S] cluster of M. tuberculosis WhiB1 is relatively insensitive to O(2 but very sensitive to nitric oxide (NO. Nitric oxide nitrosylates the WhiB1 iron-sulfur cluster and promotes DNA-binding; the apo-forms of WhiB1 also bind DNA. However, the molecular requirements for iron-sulfur cluster acquisition and for DNA-binding by WhiB1 are poorly characterized. METHODS AND FINDINGS: WhiB1 variants were created by site-directed mutagenesis and the abilities of the corresponding proteins to acquire an iron-sulfur cluster and/or bind to whiB1 promoter DNA were assessed. All four Cys residues (Cys9, 37, 40, and 46 in the N-terminal region of WhiB1 were required for incorporation of a [4Fe-4S] cluster, whereas a possible alternative cluster ligand Asp13 (by analogy with M. smegmatis WhiB2 was not. The C-terminal region of WhiB1 is predicted to house the DNA-binding domain of the protein consisting of a predicted β-turn ((58GVWGG(62 followed by two amino acid motifs ((72KRRN(75 and (78TKAR(81 that are conserved in WhiB1 proteins. Gly residues (Gly58, 61 and 62 in the β-turn and positively-charged residues (Lys72, Arg73, Arg74, Lys79 and Arg81 in the downstream conserved regions were required for binding of WhiB1 DNA. CONCLUSIONS: Site-directed mutagenesis of M. tuberculosis whiB1 and characterization of the corresponding proteins has been used to explore structure-function relationships of the NO-responsive transcription factor WhiB1. This showed that all four conserved Cys residues in the N-terminal region are required for incorporation of iron-sulfur clusters but not for DNA-binding. Analysis of variants with amino acid substitutions in the C-terminal region revealed the crucial roles played by a predicted β-turn and two

  4. Phylogenetic and functional analysis of the bacteriophage P1 single-stranded DNA-binding protein

    DEFF Research Database (Denmark)

    Bendtsen, Jannick Dyrløv; Nilsson, A.S.; Lehnherr, H.

    2002-01-01

    Bacteriophage P1 encodes a single-stranded DNA-binding protein (SSB-P1), which shows 66% amino acid sequence identity to the SSB protein of the host bacterium Escherichia coli. A phylogenetic analysis indicated that the P1 ssb gene coexists with its E. coli counterpart as an independent unit...... phase. These results reconciled the observed evolutionary conservation with the seemingly redundant presence of ssb genes in many bacteriophages and conjugative plasmids....

  5. Possible origin of sequence divergence in the P1 cytadhesin gene of Mycoplasma pneumoniae.

    OpenAIRE

    Su, C J; Dallo, S F; Chavoya, A; Baseman, J B

    1993-01-01

    Specific regions of the P1 adhesin structural gene of Mycoplasma pneumoniae hybridize to various parts of the mycoplasma genome, indicating their multiple-copy nature. In addition, restriction fragment length polymorphisms and sequence divergence have been observed in the P1 gene, permitting the classification of clinical isolates of M. pneumoniae into two groups, I and II. These data suggest that the observed P1 gene diversity may be explained by homologous recombination between similar but ...

  6. Absolute frequency measurement of the magnesium intercombination transition $^1S_0 \\to ^3P_1$

    CERN Document Server

    Friebe, Jan; Riedmann, Matthias; Moldenhauer, Karsten; Mehlstäubler, Tanja; Rehbein, Nils; Lisdat, Christian; Rasel, Ernst M; Ertmer, Wolfgang; Schnatz, Harald; Lipphardt, Burghard; Grosche, Gesine

    2007-01-01

    We report on a frequency measurement of the $(3s^2)^1S_0\\to(3s3p)^3P_1$ clock transition of $^{24}$Mg on a thermal atomic beam. The intercombination transition has been referenced to a portable primary Cs frequency standard with the help of a femtosecond fiber laser frequency comb. The achieved uncertainty is $2.5\\times10^{-12}$ which corresponds to an increase in accuracy of six orders of magnitude compared to previous results. The measured frequency value permits the calculation of several other optical transitions from $^1S_0$ to the $^3P_J$-level system for $^{24}$Mg, $^{25}$Mg and $^{26}$Mg. We describe in detail the components of our optical frequency standard like the stabilized spectroscopy laser, the atomic beam apparatus used for Ramsey-Bord\\'e interferometry and the frequency comb generator and discuss the uncertainty contributions to our measurement including the first and second order Doppler effect. An upper limit of $3\\times10^{-13}$ in one second for the short term instability of our optical f...

  7. On the equation $p \\frac{\\Gamma(\\frac{n}{2}-\\frac{s}{p-1})\\Gamma(s+\\frac{s}{p-1})}{\\Gamma(\\frac{s}{p-1})\\Gamma(\\frac{n-2s}{2}-\\frac{s}{p-1})} =\\frac{\\Gamma(\\frac{n+2s}{4})^2}{\\Gamma(\\frac{n-2s}{4})^2}$

    OpenAIRE

    Luo, Senping; Wei, Juncheng; Zou, Wenming

    2016-01-01

    The note is aimed at giving a complete characterization of the following equation: $$\\displaystyle p\\frac{\\Gamma(\\frac{n}{2}-\\frac{s}{p-1})\\Gamma(s+\\frac{s}{p-1})}{\\Gamma(\\frac{s}{p-1})\\Gamma(\\frac{n-2s}{2}-\\frac{s}{p-1})} =\\frac{\\Gamma(\\frac{n+2s}{4})^2}{\\Gamma(\\frac{n-2s}{4})^2}.$$ The method is based on some key transformation and the properties of the Gamma function. Applications to fractional nonlinear Lane-Emden equations will be given.

  8. Inorganic polyphosphate essential for lytic growth of phages P1 and fd

    OpenAIRE

    LI Li; Rao, Narayana N.; Kornberg, Arthur

    2007-01-01

    Transduction frequency with phage P1 had been observed to be very low in Escherichia coli K-12 mutants lacking the operon (ppk1-ppx) responsible for the synthesis of inorganic polyphosphate (poly P). We now find that these mutants, for lack of poly P, are lysogenic for P1 and when infected with phage P1 produce only ≈1% the number of infective centers compared with the WT host. Both phage adsorption and release were unaffected. The host-encoded P1 late-gene transcriptional activator, SspA, fa...

  9. Spatiotemporal distribution of 1P1 antigen expression in the plexiform layers of developing chick retina

    Institute of Scientific and Technical Information of China (English)

    WANGHOUHUA; QIUBAOSONG; 等

    1993-01-01

    Changes in the distribution of 1P1-antigen in the developing chick retina have been examined by indriect immunofluorescence staining technique using the novel monoclonal antibody(MAb)1P1.Expression of the 1P1 antigen was found to be regulated in radial as well as in tangential dimension of the retina,being preferentially or exclusively located in the inner and outer plexiform layers of the neural retina depending on the stages of development ,With the onset of the formation of the inner plexiform layer 1P1 antigen becomes expressed in the retina.With progressing differentiation of the inner plexiform layer 1P1 immunofluorescence revealed 2 subbands at E9 and 6 subands at E18,At postnatal stages(after P3) immunoreactivity was reduced in an inside-outside sequence leading to the complete absence of the 1P1 antigen in adulthood.1P1 antigen expression in the outer plexiform layer was also subject to developmental regulation.The spation-temporal pattern of 1P1 antigen expression was correlated with the time course of histological differentation of chick retina,namely the synapse rich plexiform layers.Whether the 1P1 antigen was functionally involved in dendrite extension and synapse formation was discussed.

  10. Emergence of a new satellite RNA from cucumber mosaic virus isolate P1

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The cucumber mosaic virus (CMV) isolate P1 caused very mild symptoms on many plant species. After serial passages by mechanical inoculation over five years, CMV P1 caused severe symptoms on several tobacco cultivars and tomato. A specific band of approximately 0.3 kb in length was amplified by RT-PCR with primers synthesized based on reported CMV satellite RNA (satRNA) sequences. Sequence analysis showed there were two satRNAs (Sat-P1-1 and Sat-P1-2). Sat-P1-1 contained 335 nucleotides, and Sat-P1-2 contained 394 nucleotides. These two satRNAs shared 64% overall nucleotide sequence homology, and differences between the two satRNAs included mutations as well as deletions. Sat-P1-1 was identical to a satRNA (Z96099) reported in 1995 in CMV P1. Based on differences in the sequence and secondary structure between these two satRNAs, we conclude that Sat-P1-2 represents the emergence of a new satellite (necrotic satellite) from attenuated satRNA populations. The possible effect of the emergence of this new satRNA is discussed.

  11. Drug-drug interactions between rosuvastatin and oral antidiabetic drugs occurring at the level of oatp1b1s

    NARCIS (Netherlands)

    Steeg, E. van de; Greupink, R.; Schreurs, M.; Nooijen, I.H.G.; Verhoeck, K.C.M.; Hanemaaijer, R.; Ripken, D.; Monshouwer, M.; Vlaming, M.L.H.; DeGroot, J.; Verwei, M.; Russel, F.G.M.; Huisman, M.T.; Wortelboer, H.M.

    2013-01-01

    Organic anion-transporting polypeptide 1B1 (OATP1B1) is an important hepatic uptake transporter, of which the polymorphic variant OATP1B1*15 (Asn130Asp and Val174Ala) has been associated with decreased transport activity. Rosuvastatin is an OATP1B1 substrate and often concomitantly prescribed with o

  12. Host kinin B1 receptor plays a protective role against melanoma progression.

    Science.gov (United States)

    Maria, Andrea G; Dillenburg-Pilla, Patrícia; Reis, Rosana I; Floriano, Elaine M; Tefé-Silva, Cristiane; Ramos, Simone G; Pesquero, João B; Nahmias, Clara; Costa-Neto, Claudio M

    2016-01-01

    Melanoma is a very aggressive tumor that arises from melanocytes. Late stage and widely spread diseases do not respond to standard therapeutic approaches. The kallikrein-kinin system (KKS) participates in biological processes such as vasodilatation, pain and inflammatory response. However, the role of KKS in tumor formation and progression is not completely understood. The role of the host kinin B1 receptor in melanoma development was evaluated using a syngeneic melanoma model. Primary tumors and metastasis were respectively induced by injecting B16F10 melanoma cells, which are derived from C57BL/6 mice, subcutaneously or in the tail vein in wild type C57BL/6 and B1 receptor knockout mice (B1(-/-)). Tumors developed in B1(-/-) mice presented unfavorable prognostic factors such as increased incidence of ulceration, higher levels of IL-10, higher activation of proliferative pathways such as ERK1/2 and Akt, and increased mitotic index. Furthermore, in the metastasis model, B1(-/-) mice developed larger metastatic colonies in the lung and lower CD8(+)immune effector cells when compared with WT animals. Altogether, our results provide evidences that B1(-/-) animals developed primary tumors with multiple features associated with poor prognosis and unfavorable metastatic onset, indicating that the B1 receptor may contribute to improve the host response against melanoma progression. PMID:26898917

  13. Comparative Oral Bioavailability, Toxicokinetics, and Biotransformation of Enniatin B1 and Enniatin B in Broiler Chickens.

    Science.gov (United States)

    Fraeyman, Sophie; Devreese, Mathias; Antonissen, Gunther; De Baere, Siegrid; Rychlik, Michael; Croubels, Siska

    2016-09-28

    A toxicokinetic study of the Fusarium mycotoxins enniatin B1 (ENN B1) and enniatin B (ENN B) was performed in broiler chickens. Each animal received ENN B1 or B orally via an intracrop bolus and intravenously at a dose of 0.2 mg/kg body weight. Both enniatins were poorly absorbed after oral administration, with absolute oral bioavailabilities of 0.05 and 0.11 for ENNs B1 and B, respectively. Both enniatins were readily distributed to the tissues, with mean volumes of distribution of 25.09 and 33.91 L/kg for ENNs B1 and B, respectively. The mean total body clearance was rather high, namely, 6.63 and 7.10 L/h/kg for ENNs B1 and B, respectively. Finally, an UHPLC-HRMS targeted approach was used to investigate the phase I and II biotransformations of both mycotoxins. Oxygenation was the major phase I biotransformation pathway for both ENNs B1 and B. Neither glucuronide nor sulfate phase II metabolites were detected. PMID:27632250

  14. Determination of Aflatoxin B1 in Smokeless Tobacco Products by Use of UHPLC-MS/MS.

    Science.gov (United States)

    Zitomer, Nicholas; Rybak, Michael E; Li, Zhong; Walters, Matthew J; Holman, Matthew R

    2015-10-21

    This work developed a UHPLC-MS/MS method for the detection and quantitation of aflatoxins in smokeless tobacco products, which was then used to determine aflatoxin B1 concentrations in 32 smokeless tobacco products commercially available in the United States. Smokeless tobacco products were dried, milled, and amended with (13)C17-labeled internal standards, extracted in water/methanol solution in the presence of a surfactant, isolated through use of immunoaffinity column chromatography, and reconstituted in mobile phase prior to UHPLC-MS/MS analysis. The method was capable of baseline separation of aflatoxins B1, B2, G1, and G2 in a 2.5 min run by use of a fused core C18 column and a water/methanol gradient. MS/MS transition (m/z) 313.3 → 241.2 was used for aflatoxin B1 quantitation, with 313.3 → 285.1 used for confirmation. The limit of detection (LOD) for aflatoxin B1 was 0.007 parts per billion (ppb). Method imprecision for aflatoxin B1 (expressed as coefficient of variation) ranged from 5.5 to 9.4%. Spike recoveries were 105-111%. Aflatoxin B1 concentrations in the smokeless tobacco products analyzed ranged from snuffs and chews, whereas all moist snuff products tested were below LOD. The amounts of aflatoxin B1 detected were low relative to the 20 ppb regulatory limit established by the U.S. Food and Drug Administration for foods and feeds.

  15. Pathogenesis-Related Protein 1b1 (PR1b1) Is a Major Tomato Fruit Protein Responsive to Chilling Temperature and Upregulated in High Polyamine Transgenic Genotypes

    Science.gov (United States)

    Fatima, Tahira; Topuz, Muhamet; Bernadec, Anne; Sicher, Richard; Handa, Avtar K.; Mattoo, Autar K.

    2016-01-01

    Plants execute an array of mechanisms in response to stress which include upregulation of defense-related proteins and changes in specific metabolites. Polyamines – putrescine (Put), spermidine (Spd), and spermine (Spm) – are metabolites commonly found associated with abiotic stresses such as chilling stress. We have generated two transgenic tomato lines (556HO and 579HO) that express yeast S-adenosylmethionine decarboxylase and specifically accumulate Spd and Spm in fruits in comparison to fruits from control (556AZ) plants (Mehta et al., 2002). Tomato fruits undergo chilling injury at temperatures below 13°C. The high Spd and Spm tomato together with the control azygous line were utilized to address role(s) of polyamines in chilling-injury signaling. Exposure to chilling temperature (2°C) led to several-fold increase in the Put content in all the lines. Upon re-warming of the fruits at 20°C, the levels of Spd and Spm increased further in the fruit of the two transgenic lines, the higher levels remaining stable for 15 days after re-warming as compared to the fruit from the control line. Profiling their steady state proteins before and after re-warming highlighted a protein of ∼14 kD. Using proteomics approach, protein sequencing and immunoblotting, the ∼14-kD protein was identified as the pathogenesis related protein 1b1 (PR1b1). The PR1b1 protein accumulated transiently in the control fruit whose level was barely detectable at d 15 post-warming while in the fruit from both the 556HO and 579HO transgenic lines PR1b1 abundance increased and remained stable till d 15 post warming. PR1b1 gene transcripts were found low in the control fruit with a visible accumulation only on d 15 post warming; however, in both the transgenic lines it accumulated and increased soon after rewarming being several-fold higher on day 2 while in 556HO line this increase continued until d 6 than the control fruit. The chilling-induced increase in PR1b1 protein seems independent

  16. Sulforaphane induces glutathione S-transferase isozymes which detoxify aflatoxin B(1)-8,9-epoxide in AML 12 cells.

    Science.gov (United States)

    Gao, Shang Shang; Chen, Xiao Yan; Zhu, Ri Zhe; Choi, Byung-Min; Kim, Bok-Ryang

    2010-01-01

    The aflatoxin B(1)-8,9-epoxide (AFBO) is hepatocarcinogenic intermediate of aflatoxin B(1) (AFB(1)) and is detoxified by glutathione S-transferases (GSTs). In this study, we investigated whether sulforaphane (SFN) could increase the rate of conjugation between AFBO and glutathione (GSH) as well as which of the GST isozymes were involved in the conjugation reaction. The conjugation potential was inhibited dose dependently with curcumin, an inhibitor of GSTs. SFN induced the expression of GST A3, GST A4, GST M1, GST P1, and GST T1 in alpha mouse line (AML) 12 cells. The cells treated with SFN (10 microM) for 12 h showed a 35-fold increase in conjugation potential of AFBO with GSH compared with the vehicle-treated cell. The conjugation potential was blocked partially by transfection of cells with siRNAs against each of the GST isozymes. The activity of GST A3 had the strongest effect on the conjugation potential. SFN treatment also increased total GST activity detected with 1-chloro-2,4-dinitrobenzene (CDNB) up to 4.3-fold. The induction fold was much lower than that detected with AFBO. These results suggest that the chemopreventive effect of SFN on the decomposition of AFBO is related to the upregulation of several GST isozymes genes. The increase of GST activity by SFN was extremely specific toward the conjugation reaction of AFBO compared with CDNB. Therefore, this system for detecting GST activity seems to be an excellent method for screening chemopreventive compounds toward AFB(1) toxicity. PMID:20818711

  17. Aflatoxin B1 metabolism by 3-methylcholanthrene-induced hamster hepatic cytochrome P-450s.

    Science.gov (United States)

    Lai, T S; Chiang, J Y

    1990-01-01

    We have studied the activation of aflatoxin B1 by hamster liver microsomes and purified hamster cytochrome P-450 isozymes using a umu mutagen test. The hamster liver microsomes or S-9 fractions were much more active than rat liver microsomes or S-9 fractions in the activation of umu gene expression by aflatoxin B1 metabolites. 3-Methyl-cholanthrene treatment increased aflatoxin B1 activation by hamster liver microsomes. Two major 3-methylcholanthrene-inducible cytochrome P-450 isozymes, P-450 MC1 (IIA) and P-450 MC4 (IA2), were purified from 3-methylcholanthrene-treated hamster liver microsomes, and the metabolism of aflatoxin B1 by these two cytochromes was studied. In the reconstituted enzyme system, both P-450 MC1 and P-450 MC4 were highly active in the activation of aflatoxin B1, and antibodies against these P-450s specifically inhibited these activities. Antibody against P-450 MC1 inhibited the activation of aflatoxin B1 by 20% in the presence of 3-methyl-cholanthrene-treated hamster liver microsomes. In contrast, antibody against P-450 MC4 stimulated the activity by 175%. These results indicated that hamster P-450 MC1 might convert aflatoxin B1 to more toxic metabolite(s), whereas P-450 MC4 might convert aflatoxin B1 to less toxic metabolite(s), than aflatoxin B1 in liver microsomes. The metabolite(s) produced by both hamster cytochrome P-450 MC1 and MC4 were genotoxic in the umu mutagen test. PMID:2126562

  18. SF3B1 haploinsufficiency leads to formation of ring sideroblasts in myelodysplastic syndromes.

    Science.gov (United States)

    Visconte, Valeria; Rogers, Heesun J; Singh, Jarnail; Barnard, John; Bupathi, Manoj; Traina, Fabiola; McMahon, James; Makishima, Hideki; Szpurka, Hadrian; Jankowska, Anna; Jerez, Andres; Sekeres, Mikkael A; Saunthararajah, Yogen; Advani, Anjali S; Copelan, Edward; Koseki, Haruhiko; Isono, Kyoichi; Padgett, Richard A; Osman, Sami; Koide, Kazunori; O'Keefe, Christine; Maciejewski, Jaroslaw P; Tiu, Ramon V

    2012-10-18

    Whole exome/genome sequencing has been fundamental in the identification of somatic mutations in the spliceosome machinery in myelodysplastic syndromes (MDSs) and other hematologic disorders. SF3B1, splicing factor 3b subunit 1 is mutated in 60%-80% of refractory anemia with ring sideroblasts (RARS) and RARS associated with thrombocytosis (RARS-T), 2 distinct subtypes of MDS and MDS/myeloproliferative neoplasms (MDSs/MPNs). An idiosyncratic feature of RARS/RARS-T is the presence of abnormal sideroblasts characterized by iron overload in the mitochondria, called RS. Based on the high frequency of mutations of SF3B1 in RARS/RARS-T, we investigated the consequences of SF3B1 alterations. Ultrastructurally, SF3B1 mutants showed altered iron distribution characterized by coarse iron deposits compared with wild-type RARS patients by transmission electron microscopy. SF3B1 knockdown experiments in K562 cells resulted in down-regulation of U2-type intron-splicing by RT-PCR. RNA-sequencing analysis of SF3B1 mutants showed differentially used genes relevant in MDS pathogenesis, such as ASXL1, CBL, EZH, and RUNX families. A SF3B pharmacologic inhibitor, meayamycin, induced the formation of RS in healthy BM cells. Further, BM aspirates of Sf3b1 heterozygous knockout mice showed RS by Prussian blue. In conclusion, we report the first experimental evidence of the association between SF3B1 and RS phenotype. Our data suggest that SF3B1 haploinsufficiency leads to RS formation.

  19. SH2B1 regulation of energy balance, body weight, and glucose metabolism

    Institute of Scientific and Technical Information of China (English)

    Liangyou; Rui

    2014-01-01

    The Src homology 2B(SH2B)family members(SH2B1,SH2B2 and SH2B3)are adaptor signaling proteins containing characteristic SH2 and PH domains.SH2B1(also called SH2-B and PSM)and SH2B2(also called APS)are able to form homo-or hetero-dimers via their N-terminal dimerization domains.Their C-terminal SH2 domains bind to tyrosyl phosphorylated proteins,including Janus kinase 2(JAK2),TrkA,insulin receptors,insulin-like growth factor-1 receptors,insulin receptor substrate-1(IRS1),and IRS2.SH2B1 enhances leptin signaling by both stimulating JAK2 activity and assembling a JAK2/IRS1/2 signaling complex.SH2B1 promotes insulin signaling by both enhancing insulin receptor catalytic activity and protecting against dephosphorylation of IRS proteins.Accordingly,genetic deletion of SH2B1 results in severe leptin resistance,insulin resistance,hyperphagia,obesity,and type 2 diabetes in mice.Neuronspecific overexpression of SH2B1βtransgenes protects against diet-induced obesity and insulin resistance.SH2B1 in pancreaticβcells promotesβcell expansion and insulin secretion to counteract insulin resistance in obesity.Moreover,numerous SH2B1 mutations are genetically linked to leptin resistance,insulin resistance,obesity,and type 2 diabetes in humans.Unlike SH2B1,SH2B2 and SH2B3 are not required for the maintenance of normal energy and glucose homeostasis.The metabolic function of the SH2B family is conserved from insects to humans.

  20. The effect of doping on magnetic properties of (Fe1-xMnx)2P1-ySiy series

    Science.gov (United States)

    Goraus, Jerzy; Hawełek, Lukasz; Włodarczyk, Patryk

    2015-12-01

    In this paper we present results of ab initio calculations for the (Fe1-xMnx)2P1-ySiy series, where we investigate the effect of doping on magnetic properties of these materials. Such compounds, which belong to the Fe2 P class of magnetocaloric materials are now extensively studied, due to their potential applications in magnetic cooling. In the hexagonal Fe2 P-type structure, transition metals occupy two inequivalent Wyckoff positions: 3 f and 3 g. We have shown that the preference of occupation of one site by the particular transition metal leads to different dependence of magnetic properties with respect to the total doping effect.

  1. Search for eta_b(1S) in Inclusive Radiative Decays of the Upsilon(3S)

    CERN Document Server

    Mahmood, A H; Danko, I; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Bornheim, A; Lipeles, E; Pappas, S P; Shapiro, A; Sun, W M; Weinstein, A J; Mahapatra, R; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G T; Vogel, H; Adam, N E; Alexander, J P; Berkelman, K; Boisvert, V; Cassel, David G; Drell, P S; Duboscq, J E; Ecklund, K M; Ehrlich, R; Galik, R S; Gibbons, L; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Magerkurth, A; Mahlke-Krüger, H; Meyer, T O; Mistry, N B; Nordberg, E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Thayer, J G; Urner, D; Viehhauser, G; Warburton, A; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Potlia, V; Stöck, H; Yelton, J; Brandenburg, G; Kim, D Y J; Wilson, R; Benslama, K; Eisenstein, B I; Ernst, J; Gollin, G D; Hans, R M; Karliner, I; Lowrey, N; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Ammar, R; Besson, D; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; Li, S Z; Poling, R A; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z V; Seth, K K; Tomaradze, A G; Zweber, P; Ahmed, S; Alam, M S; Jian, L; Saleem, M; Wappler, F; Eckhart, E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Thayer, J B; Von Törne, E; Wilksen, T; Zoeller, M M; Muramatsu, H; Richichi, S J; Severini, H; Skubic, P L; Dytman, S A; Müller, J A; Nam, S; Savinov, V; Chen, S; Hinson, J W; Lee, J; Miller, D H; Pavlunin, V; Shibata, E I; Shipsey, I P J; Cronin-Hennessy, D; Lyon, A L; Park, C S; Park, W; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Maravin, Y; Stroynowski, R; Artuso, M; Boulahouache, C; Bukin, K; Dambasuren, E; Khroustalev, K; Mountain, R; Nandakumar, R; Skwarnicki, T; Stone, S; Wang, J C

    2002-01-01

    We have searched for the bottomonium eta_b(1S) via the hindered magnetic dipole (M1) photon transition Upsilon(3S) -> gamma eta_b(1S). No evidence for such a transition is found in the data sample of 4.7 x 10^6 Upsilon(3S)'s collected with the CLEO-III detector. We set upper limits on the branching ratio from 9.30 to 9.43 GeV/c^2 of eta_b(1S) masses. These upper limits rule out many previously published phenomenological estimates of the rate for this transition.

  2. Lipid Polymorphism Induced by Surfactant Peptide SP-B1-25

    OpenAIRE

    Farver, R. Suzanne; Mills, Frank D.; Antharam, Vijay C.; Chebukati, Janetricks N.; Fanucci, Gail E.; Long, Joanna R.

    2010-01-01

    Pulmonary surfactant protein B (SP-B) is an essential protein for lowering surface tension in the alveoli. SP-B1-25, a peptide comprised of the N-terminal 25 amino-acid residues of SP-B, is known to retain much of the biological activity of SP-B. Circular dichroism has shown that when SP-B1-25 interacts with negatively charged lipid vesicles, it contains significant helical structure for the lipid compositions and peptide/lipid ratios studied here. The effect of SP-B1-25 on lipid organization...

  3. Use of gamma irradiation to prevent aflatoxin B 1 production in smoked dried fish

    Science.gov (United States)

    Ogbadu, G. H.

    Smoked dried fish bought from the Nigerian market was inoculated with spores of barAspergillus flavus (U.I. 81) and irradiated with doses of 0.625, 1.25, 2.50 and 5.00 KGy gamma irradiation. The effect of aflatoxin B 1 production on subsequent incubation for 8 days as stationary cultures was measured. The amount of aflatoxin B 1 produced was found to decrease with increased gamma irradiation dose levels. While the non-irradiated control produced significantly (at 1% level) greater amounts of aflatoxin B 1 as compared to the treated cultures.

  4. The capsular polysaccharide Vi from Salmonella Typhi is a B1b antigen

    OpenAIRE

    Marshall, Jennifer L.; Flores-Langarica, Adriana; Kingsley, Robert A.; Hitchcock, Jessica R; Ross, Ewan A.; Lopez-Macias, Constantino; Lakey, Jeremy; Martin, Laura B; Toellner, Kai-michael; MacLennan, Calman A.; MacLennan, Ian C; Henderson, Ian R.; Dougan, Gordon; Cunningham, Adam F.

    2012-01-01

    Vaccination with purified capsular polysaccharide Vi antigen from Salmonella Typhi can protect against typhoid fever, although the mechanism for its efficacy is not clearly established. Here, we have characterised the B cell response to this vaccine in wild-type and T cell-deficient mice. We show that immunization with Typhim Vi rapidly induces proliferation in B1b peritoneal cells, but not in B1a cells or marginal zone (MZ) B cells. This induction of B1b proliferation is concomitant with the...

  5. MEMS Calculator

    Science.gov (United States)

    SRD 166 MEMS Calculator (Web, free access)   This MEMS Calculator determines the following thin film properties from data taken with an optical interferometer or comparable instrument: a) residual strain from fixed-fixed beams, b) strain gradient from cantilevers, c) step heights or thicknesses from step-height test structures, and d) in-plane lengths or deflections. Then, residual stress and stress gradient calculations can be made after an optical vibrometer or comparable instrument is used to obtain Young's modulus from resonating cantilevers or fixed-fixed beams. In addition, wafer bond strength is determined from micro-chevron test structures using a material test machine.

  6. A genome-wide regulatory framework identifies maize Pericarp Color1 (P1) controlled genes

    Science.gov (United States)

    P1 encodes an R2R3-MYB transcription factor responsible for the accumulation of insecticidal flavones in maize silks and red phlobaphene pigments in pericarps and other floral tissues. Using genome-wide expression analyses (RNA-Seq) in pericarps and silks of plants with contrasting P1 alleles combin...

  7. A note on non-amenability of B(\\ell_p) for p=1,2

    OpenAIRE

    Ozawa, Narutaka

    2004-01-01

    This is an expository note on non-amenabilty of the Banach algebra B(\\ell_p) for p=1,2. These were proved respectively by Connes (p=2) and Read (p=1) via very different methods. We give a single proof which reproves both.

  8. A Study of Perkins 2P1 Graduation Performance Rates at Virginia Western Community College

    Science.gov (United States)

    Archer, J. Andrew.

    2006-01-01

    "2P1" is the Carl Perkins label for an institution's graduation performance rate. Systems receiving Perkins funds, like Virginia's 23 community colleges, are expected to meet a federally approved 2P1 target rate. For the 3-year period 1999-2001 Virginia Western Community College (VWCC) was one of seven community colleges in the VCCS (Virginia…

  9. Reliability Calculations

    DEFF Research Database (Denmark)

    Petersen, Kurt Erling

    1986-01-01

    approaches have been introduced in some cases for the calculation of the reliability of structures or components. A new computer program has been developed based upon numerical integration in several variables. In systems reliability Monte Carlo simulation programs are used especially in analysis of very...... complex systems. In order to increase the applicability of the programs variance reduction techniques can be applied to speed up the calculation process. Variance reduction techniques have been studied and procedures for implementation of importance sampling are suggested....

  10. Observation and Properties of L=1 B_1 and B_2* Mesons

    CERN Document Server

    Abazov, V M; Abolins, M; Acharya, B S; Adams, M; Adams, T; Aguiló, E; Ahn, S H; Ahsan, M; Alexeev, G D; Alkhazov, G; Alton, A; Alverson, G; Alves, G A; Anastasoaie, M; Ancu, L S; Andeen, T; Anderson, S; Andrieu, B; Anzelc, M S; Arnoud, Y; Arov, M; Arthaud, M; Askew, A; Åsman, B; Assis-Jesus, A C S; Atramentov, O; Autermann, C; Avila, C; Ay, C; Badaud, F; Baden, A; Bagby, L; Baldin, B; Bandurin, D V; Banerjee, S; Banerjee, P; Barberis, E; Barfuss, A F; Bargassa, P; Baringer, P; Barreto, J; Bartlett, J F; Bassler, U; Bauer, D; Beale, S; Bean, A; Begalli, M; Begel, M; Belanger-Champagne, C; Bellantoni, L; Bellavance, A; Benítez, J A; Beri, S B; Bernardi, G; Bernhard, R; Berntzon, L; Bertram, I; Besançon, M; Beuselinck, R; Bezzubov, V A; Bhat, P C; Bhatnagar, V; Biscarat, C; Blazey, G; Blekman, F; Blessing, S; Bloch, D; Bloom, K; Böhnlein, A; Boline, D; Bolton, T A; Borissov, G; Bos, K; Bose, T; Brandt, A; Brock, R; Brooijmans, G; Bross, A; Brown, D; Buchanan, N J; Buchholz, D; Bühler, M; Büscher, V; Burdin, S; Burke, S; Burnett, T H; Buszello, C P; Butler, J M; Calfayan, P; Calvet, S; Cammin, J; Caron, S; Carvalho, W; Casey, B C K; Cason, N M; Castilla-Valdez, H; Chakrabarti, S; Chakraborty, D; Chan, K M; Chan, K; Chandra, A; Charles, F; Cheu, E; Chevallier, F; Cho, D K; Choi, S; Choudhary, B; Christofek, L; Christoudias, T; Cihangir, S; Claes, D; Clément, C; Clement, B; Coadou, Y; Cooke, M; Cooper, W E; Corcoran, M; Couderc, F; Cousinou, M C; Crepe-Renaudin, S; Cutts, D; Cwiok, M; Da Motta, H; Das, A; Davies, G; De, K; De Jong, S J; de Jong, P; De La Cruz-Burelo, E; De Oliveira Martins, C; Degenhardt, J D; Déliot, F; Demarteau, M; Demina, R; Denisov, D; Denisov, S P; Desai, S; Diehl, H T; Diesburg, M; Dominguez, A; Dong, H; Dudko, L V; Duflot, L; Dugad, S R; Duggan, D; Duperrin, A; Dyer, J; Dyshkant, A; Eads, M; Edmunds, D; Ellison, J; Elvira, V D; Enari, Y; Eno, S; Ermolov, P; Evans, H; Evdokimov, A; Evdokimov, V N; Ferapontov, A V; Ferbel, T; Fiedler, F; Filthaut, F; Fisher, W; Fisk, H E; Ford, M; Fortner, M; Fox, H; Fu, S; Fuess, S; Gadfort, T; Galea, C F; Gallas, E; Galyaev, E; García, C; García-Bellido, A; Gavrilov, V; Gay, P; Geist, W; Gelé, D; Gerber, C E; Gershtein, Yu; Gillberg, D; Ginther, G; Gollub, N; Gómez, B; Goussiou, A; Grannis, P D; Greenlee, H; Greenwood, Z D; Gregores, E M; Grenier, G; Gris, P; Grivaz, J F; Grohsjean, A; Grünendahl, S; Grünewald, M W; Guo, J; Guo, F; Gutíerrez, P; Gutíerrez, G; Haas, A; Hadley, N J; Haefner, P; Hagopian, S; Haley, J; Hall, I; Hall, R E; Han, L; Hanagaki, K; Hansson, P; Harder, K; Harel, A; Harrington, R; Hauptman, J M; Hauser, R; Hays, J; Hebbeker, T; Hedin, D; Hegeman, J G; Heinmiller, J M; Heinson, A P; Heintz, U; Hensel, C; Herner, K; Hesketh, G; Hildreth, M D; Hirosky, R; Hobbs, J D; Hoeneisen, B; Hoeth, H; Hohlfeld, M; Hong, S J; Hooper, R; Hossain, S; Houben, P; Hu, Y; Hubacek, Z; Hynek, V; Iashvili, I; Illingworth, R; Ito, A S; Jabeen, S; Jaffré, M; Jain, S; Jakobs, K; Jarvis, C; Jesik, R; Johns, K; Johnson, C; Johnson, M; Jonckheere, A; Jonsson, P; Juste, A; Käfer, D; Kahn, S; Kajfasz, E; Kalinin, A M; Kalk, J R; Kalk, J M; Kappler, S; Karmanov, D; Kasper, J; Kasper, P; Katsanos, I; Kau, D; Kaur, R; Kaushik, V; Kehoe, R; Kermiche, S; Khalatyan, N; Khanov, A; Kharchilava, A I; Kharzheev, Yu M; Khatidze, D; Kim, H; Kim, T J; Kirby, M H; Kirsch, M; Klima, B; Kohli, J M; Konrath, J P; Kopal, M; Korablev, V M; Kothari, B; Kozelov, A V; Krop, D; Kryemadhi, A; Kühl, T; Kumar, A; Kunori, S; Kupco, A; Kurca, T; Kvita, J; Lacroix, F; Lam, D; Lammers, S; Landsberg, G L; Lazoflores, J; Lebrun, P; Lee, W M; Leflat, A; Lehner, F; Lellouch, J; Lesne, V; Lévêque, J; Lewis, P; Li, J; Li, Q Z; Li, L; Lietti, S M; Lima, J G R; Lincoln, D; Linnemann, J; Lipaev, V V; Lipton, R; Liu, Y; Liu, Z; Lobo, L; Lobodenko, A; Lokajícek, M; Lounis, A; Love, P; Lubatti, H J; Lyon, A L; Maciel, A K A; Mackin, D; Madaras, R J; Mättig, P; Magass, C; Magerkurth, A; Makovec, N; Mal, P K; Malbouisson, H B; Malik, S; Malyshev, V L; Mao, H S; Maravin, Y; Martin, B; McCarthy, R; Melnitchouk, A; Mendes, A; Mendoza, L; Mercadante, P G; Merkin, M; Merritt, K W; Meyer, J; Meyer, A; Michaut, M; Millet, T; Mitrevski, J; Molina, J; Mommsen, R K; Mondal, N K; Moore, R W; Moulik, T; Muanza, G S; Mulders, M; Mulhearn, M; Mundal, O; Mundim, L; Nagy, E; Naimuddin, M; Narain, M; Naumann, N A; Neal, H A; Negret, J P; Neustroev, P; Nilsen, H; Nomerotski, A; Novaes, S F; Nunnemann, T; O'Dell, V; O'Neil, D C; Obrant, G; Ochando, C; Onoprienko, D; Oshima, N; Osta, J; Otec, R; Oteroy-Garzon, G J; Owen, M; Padley, P; Pangilinan, M; Parashar, N; Park, S J; Park, S K; Parsons, J; Partridge, R; Parua, N; Patwa, A; Pawloski, G; Penning, B; Perea, P M; Peters, K; Peters, Y; Petroff, P; Petteni, M; Piegaia, R; Piper, J; Pleier, M A; Podesta-Lerma, P L M; Podstavkov, V M; Pogorelov, Y; Pol, M E; Polozov, P; Pompo, A; Pope, B G; Popov, A V; Potter, C; Prado da Silva, W L; Prosper, H B; Protopopescu, S D; Qian, J; Quadt, A; Quinn, B; Rakitine, A; Rangel, M S; Rani, K J; Ranjan, K; Ratoff, P N; Renkel, P; Reucroft, S; Rich, P; Rijssenbeek, M; Ripp-Baudot, I; Rizatdinova, F K; Robinson, S; Rodrigues, R F; Royon, C; Rubinov, P; Ruchti, R; Safronov, G; Sajot, G; Sánchez-Hernández, A; Sanders, M P; Santoro, A F S; Savage, G; Sawyer, L; Scanlon, T; Schaile, A D; Schamberger, R D; Scheglov, Y; Schellman, H; Schieferdecker, P; Schliephake, T; Schmitt, C; Schwanenberger, C; Schwartzman, A; Schwienhorst, R; Sekaric, J; Sen-Gupta, S; Severini, H; Shabalina, E; Shamim, M; Shary, V; Shchukin, A A; Shivpuri, R K; Shpakov, D; Siccardi, V; Simák, V; Sirotenko, V I; Skubic, P L; Slattery, P F; Smirnov, D; Smith, R P; Snow, J; Snow, G R; Snyder, S; Söldner-Rembold, S; Sonnenschein, L; Sopczak, A; Sosebee, M; Soustruznik, K; Souza, M; Spurlock, B; Stark, J; Steele, J; Stolin, V; Stone, A; Stoyanova, D A; Strandberg, J; Strandberg, S; Strang, M A; Strauss, M; Strauss, E; Ströhmer, R; Strom, D; Strovink, M; Stutte, L; Sumowidagdo, S; Svoisky, P; Sznajder, A; Talby, M; Tamburello, P; Tanasijczuk, A; Taylor, W; Telford, P; Temple, J; Tiller, B; Tissandier, F; Titov, M; Tokmenin, V V; Tomoto, M; Toole, T; Torchiani, I; Trefzger, T; Tsybychev, D; Tuchming, B; Tully, C; Tuts, P M; Unalan, R; Uvarov, S; Uvarov, L; Uzunyan, S; Vachon, B; Van den Berg, P J; van Eijk, B; Van Kooten, R; Van Leeuwen, W M; Varelas, N; Varnes, E W; Vartapetian, A H; Vasilyev, I A; Vaupel, M; Verdier, P; Vertogradov, L S; Verzocchi, M; Villeneuve-Séguier, F; Vint, P; Vokac, P; Von Törne, E; Voutilainen, M; Vreeswijk, M; Wagner, R; Wahl, H D; Wang, L; Wang, M H L; Warchol, J; Watts, G; Wayne, M; Weber, M; Weber, G; Weerts, H; Wenger, A; Wermes, N; Wetstein, M; White, A; Wicke, D; Wilson, G W; Williams, M R J; Wimpenny, S J; Wobisch, M; Wood, D R; Wyatt, T R; Xie, Y; Yacoob, S; Yamada, R; Yan, M; Yasuda, T; Yatsunenko, Y A; Yip, K; Yoo, H D; Youn, S W; Yu, J; Yu, C; Yurkewicz, A; Zatserklyaniy, A; Zeitnitz, C; Zhang, D; Zhao, T; Zhou, B; Zhu, J; Zielinski, M; Zieminska, D; Zieminski, A; Zivkovic, L; Zutshi, V; Zverev, E G

    2007-01-01

    Excited B mesons B_1 and B_2* are observed directly for the first time as two separate states in fully reconstructed decays to B+(*) pi-. The mass of B_1 is measured to be (5720.6 +- 2.4 +- 1.4) MeV/c^2 and the mass difference DeltaM between B_2* and B_1 is (26.2 +- 3.1 +- 0.9) MeV/c^2, giving the mass of the B_2* as (5746.8 +- 2.4 +- 1.7) MeV/c^2. The production rate for B_1 and B_2* mesons is determined to be a fraction (13.9 +- 1.9 +- 3.2)% of the production rate of the B+ meson.

  11. The impact of SF3B1 mutations in CLL on the DNA-damage response

    DEFF Research Database (Denmark)

    Te Raa, G D; Derks, I A M; Navrkalova, V;

    2015-01-01

    Mutations or deletions in TP53 or ATM are well-known determinants of poor prognosis in chronic lymphocytic leukemia (CLL), but only account for approximately 40% of chemo-resistant patients. Genome-wide sequencing has uncovered novel mutations in the splicing factor sf3b1, that were in part...... associated with ATM aberrations, suggesting functional synergy. We first performed detailed genetic analyses in a CLL cohort (n=110) containing ATM, SF3B1 and TP53 gene defects. Next, we applied a newly developed multiplex assay for p53/ATM target gene induction and measured apoptotic responses to DNA damage....... Interestingly, SF3B1 mutated samples without concurrent ATM and TP53 aberrations (sole SF3B1) displayed partially defective ATM/p53 transcriptional and apoptotic responses to various DNA-damaging regimens. In contrast, NOTCH1 or K/N-RAS mutated CLL displayed normal responses in p53/ATM target gene induction...

  12. Inclusive prompt χc,b(1++) production at the LHC

    International Nuclear Information System (INIS)

    We study the prompt production of the χc(1+) and χb(1+) mesons at high energies. Unlike χ(0+,2+) production, χ(1+) mesons cannot be created at LO via the fusion of two on-mass-shell gluons, that is, gg → χc,b(1+) are not allowed. However, the available experimental data show that the cross sections for χc(1+) and χc(2+) are comparable. We therefore investigate four other χ(1+) production mechanisms: namely, (i) the standard NLO process gg → χc,b(1+) + g, (ii) via gluon virtuality, (iii) via gluon reggeisation and, finally, (iv) the possibility to form χc,b(1+) by the fusion of three gluons, where one extra gluon comes from another parton cascade, as in the Double Parton Scattering processes. (orig.)

  13. An Overview of B-1 Cells as Antigen-Presenting Cells

    Science.gov (United States)

    Popi, Ana F.; Longo-Maugéri, Ieda M.; Mariano, Mario

    2016-01-01

    The role of B cells as antigen-presenting cells (APCs) has been extensively studied, mainly in relation to the activation of memory T cells. Considering the B cell subtypes, the role of B-1 cells as APCs is beginning to be explored. Initially, it was described that B-1 cells are activated preferentially by T-independent antigens. However, some reports demonstrated that these cells are also involved in a T-dependent response. The aim of this review is to summarize information about the ability of B-1 cells to play a role as APCs and to briefly discuss the role of the BCR and toll-like receptor signals in this process. Furthermore, some characteristics of B-1 cells, such as natural IgM production and phagocytic ability, could interfere in the participation of these cells in the onset of an adaptive response. PMID:27148259

  14. MISR Level 1B1 Local Mode Radiance Data V002

    Data.gov (United States)

    National Aeronautics and Space Administration — This is the Local Mode Level 1B1 Product containing the DNs radiometrically scaled to radiances with no geometric resampling (Suggested Usage: The MISR Instrument...

  15. Aflatoxin B1 induced upregulation of protein arginine methyltransferase 5 in human cell lines.

    Science.gov (United States)

    Ghufran, Md Sajid; Ghosh, Krishna; Kanade, Santosh R

    2016-09-01

    The exposure of naturally occurring mycotoxins affects human health and play a vital role in cancer initiation and progression. Aflatoxin B1 is a difuranocoumarin mycotoxin, classified as a group I carcinogen. The present study was conducted to assess the effect of aflatoxin B1 on epigenetic regulatory proteins. The protein arginine methyltransferase 5 expression was induced upon aflatoxin B1 treatment in a dose and time dependent manner. Further global arginine methylation was also increased in the same manner. This is the first report showing the induction of epigenetic regulatory protein, protein arginine methyltransferase 5 upon aflatoxin B1 treatment. Further study is required to establish the detailed pathway of PRMT5 induction. PMID:27242039

  16. Data of evolutionary structure change: 1CB4B-1FUNF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CB4B-1FUNF 1CB4 1FUN B F ATKAVCVLKGDGPVQGTIHFEAKG--DTVVVTGSITGLT...VIGIAK ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVT...E EEEEEEEE GGG EEEEE EEEEEEE EEEEE HHHH EEEEEEE EVID> 01FUN F 1FUNF FEQKESNGPVKV

  17. Inclusive prompt χ{sub c,b}(1{sup ++}) production at the LHC

    Energy Technology Data Exchange (ETDEWEB)

    Shuvaev, A. G. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, Gatchina, 188300, St. Petersburg (Russian Federation); Khoze, V. A. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, Gatchina, 188300, St. Petersburg (Russian Federation); Institute for Particle Physics Phenomenology, University of Durham, DH1 3LE, Durham (United Kingdom); Martin, A. D., E-mail: a.d.martin@durham.ac.uk [Institute for Particle Physics Phenomenology, University of Durham, DH1 3LE, Durham (United Kingdom); Ryskin, M. G. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, Gatchina, 188300, St. Petersburg (Russian Federation); Institute for Particle Physics Phenomenology, University of Durham, DH1 3LE, Durham (United Kingdom)

    2015-12-28

    We study the prompt production of the χ{sub c}(1{sup +}) and χ{sub b}(1{sup +}) mesons at high energies. Unlike χ(0{sup +},2{sup +}) production, χ(1{sup +}) mesons cannot be created at LO via the fusion of two on-mass-shell gluons, that is, gg→χ{sub c,b}(1{sup +}) are not allowed. However, the available experimental data show that the cross sections for χ{sub c}(1{sup +}) and χ{sub c}(2{sup +}) are comparable. We therefore investigate four other χ(1{sup +}) production mechanisms: namely, (i) the standard NLO process gg→χ{sub c,b}(1{sup +})+g, (ii) via gluon virtuality, (iii) via gluon reggeisation and, finally, (iv) the possibility to form χ{sub c,b}(1{sup +}) by the fusion of three gluons, where one extra gluon comes from another parton cascade, as in the Double Parton Scattering processes.

  18. Expression and tissue localization of collectin placenta 1 (CL-P1, SRCL) in human tissues

    DEFF Research Database (Denmark)

    Sellman, Lana; Skjødt, Karsten; Nielsen, Ole;

    2008-01-01

    Collectin placenta-1 (CL-P1), also known as scavenger receptor with C-type lectin (SRCL), is a type II membrane glycoprotein that shares structural features with both collectins and type A scavenger receptors. CL-P1 was originally cloned from the placenta and found to be associated with endothelial....... Three monoclonal antibodies were characterized and used in immunohistochemical analyses of a panel of cryo- and formalin-fixed sections. We find that CL-P1 mainly associates with cytotrophoblasts and syncytiotrophoblasts of the placenta, alveolar macrophages and to a less degree with macrophage......-like and stromal cells of the tonsils. By real-time RT-PCR we verified that the placenta is also the main organ of CL-P1 synthesis. The only source of endothelial cells whereto CL-P1 associates are umbilical cord vein endothelial cells (human umbilical vein endothelial cells, HUVEC). In vitro cultured HUVECs...

  19. On Room-Temperature Inversion of EPR Signals of P1 Centre in Synthetic Diamond

    Institute of Scientific and Technical Information of China (English)

    G. G. Fedoruk; O. N. Poklonskaya

    2009-01-01

    Room-temperature inversion of EPR absorption signals of P1 centre in synthetic diamond is studied by the tran-sient nutation technique. Use of the bichromatic field, consisting of a transverse microwave field and longitudinal radio frequency field, allows to investigate the dynamics of P1 centres in the same field configuration as in cw EPR spectrometers. It is shown that the annealing decreases the P1 centre concentration and, respectively, increases the spin-spin relaxation time. As a result, the periodic inversion (nutation) of the P1 centre absorption signal is observed longer. It is assumed that the P1 centre signal inversion, which was previously observed by cw EPR, might be caused by the Bloch-Siegert effect in the biehromatic field.

  20. On Room-Temperature Inversion of EPR Signals of P1 Centre in Synthetic Diamond

    International Nuclear Information System (INIS)

    Room-temperature inversion of EPR absorption signals of P1 centre in synthetic diamond is studied by the transient nutation technique. Use of the bichromatic field, consisting of a transverse microwave field and longitudinal radio frequency field, allows to investigate the dynamics of P1 centres in the same field configuration as in cw EPR spectrometers. It is shown that the annealing decreases the P1 centre concentration and, respectively, increases the spin-spin relaxation time. As a result, the periodic inversion (nutation) of the P1 centre absorption signal is observed longer. It is assumed that the P1 centre signal inversion, which was previously observed by cw EPR, might be caused by the Bloch–Siegert effect in the bichromatic field

  1. Plant compounds that induce polychlorinated biphenyl biodegradation by Arthrobacter sp. strain B1B.

    OpenAIRE

    Gilbert, E S; Crowley, D. E.

    1997-01-01

    Plant compounds that induced Arthrobacter sp. strain B1B to cometabolize polychlorinated biphenyls (PCBs) were identified by a screening assay based on the formation of a 4,4'-dichlorobiphenyl ring fission product. A chemical component of spearmint (Mentha spicata), l-carvone, induced Arthrobacter sp. strain B1B to cometabolize Aroclor 1242, resulting in significant degradation of 26 peaks in the mixture, including selected tetra- and pentachlorobiphenyls. Evidence for PCB biodegradation incl...

  2. Analysis of aflatoxins B1 and G1 in maize by quechers

    OpenAIRE

    Bursić Vojislava P.; Vuković Gorica Lj.; Jajić Igor M.; Lazić Sanja D.; Kara Magdalena H.; Čolović Radmilo R.; Vukmirović Đuro M.

    2013-01-01

    A reliable and easy method has been developed for the determination of aflatoxins B1 and G2 in maize samples. High performance liquid chromatography coupled with FLD (HPLC-FLD) with photochemical derivatization was used. Mycotoxins were extracted from maize using a QuEChERS-based extraction procedure. The optimized analytical conditions were evaluated in terms of recoveries, reproducibility, LOD, LOQ and linearity for aflatoxin B1 and aflatoxin G1 in maize. Extraction, chromatographic a...

  3. BIOCONTROL OF ASPERGILLUS FLAVUS AND AFLATOXIN B1 PRODUCTION IN CORN

    OpenAIRE

    A. Khanafari, H. Soudi, M. Miraboulfathi

    2007-01-01

    The potent mycotoxin aflatoxin B1 is a secondary metabolite of Aspergillus fungi that grow, on a variety of food and feed commodities at any stage during growth, harvest, storage and transportation. The occurrence of aflatoxin contamination is global, with severe problems especially prevalent in developing countries. In present study, corn samples were contaminated with aflatoxin B1 in the concentration of 240 µg/kg. Four trials were inoculated by Lactobacillus plantarum (PTCC 1058). Three co...

  4. The phospholipid flippase ATP8B1 mediates apical localization of the cystic fibrosis transmembrane regulator.

    Science.gov (United States)

    van der Mark, Vincent A; de Jonge, Hugo R; Chang, Jung-Chin; Ho-Mok, Kam S; Duijst, Suzanne; Vidović, Dragana; Carlon, Marianne S; Oude Elferink, Ronald P J; Paulusma, Coen C

    2016-09-01

    Progressive familial intrahepatic cholestasis type 1 (PFIC1) is caused by mutations in the gene encoding the phospholipid flippase ATP8B1. Apart from severe cholestatic liver disease, many PFIC1 patients develop extrahepatic symptoms characteristic of cystic fibrosis (CF), such as pulmonary infection, sweat gland dysfunction and failure to thrive. CF is caused by mutations in the cystic fibrosis transmembrane conductance regulator (CFTR), a chloride channel essential for epithelial fluid transport. Previously it was shown that CFTR transcript levels were strongly reduced in livers of PFIC1 patients. Here we have investigated the hypothesis that ATP8B1 is important for proper CFTR expression and function. We analyzed CFTR expression in ATP8B1-depleted intestinal and pulmonary epithelial cell lines and assessed CFTR function by measuring short-circuit currents across transwell-grown ATP8B1-depleted intestinal T84 cells and by a genetically-encoded fluorescent chloride sensor. In addition, we studied CFTR surface expression upon induction of CFTR transcription. We show that CFTR protein levels are strongly reduced in the apical membrane of human ATP8B1-depleted intestinal and pulmonary epithelial cell lines, a phenotype that coincided with reduced CFTR activity. Apical membrane insertion upon induction of ectopically-expressed CFTR was strongly impaired in ATP8B1-depleted cells. We conclude that ATP8B1 is essential for correct apical localization of CFTR in human intestinal and pulmonary epithelial cells, and that impaired CFTR localization underlies some of the extrahepatic phenotypes observed in ATP8B1 deficiency. PMID:27301931

  5. Distribution of [14C]-labelled aflatoxin B1 in mice

    International Nuclear Information System (INIS)

    The distribution of [14C]-labelled aflatoxin B1 has been studied in mice with the aid of whole-body autoradiography. In addition to the localisation of labelled aflatoxin B1 and/or its metabolites in the liver, bile, kidney, lung and urine an uptake of 14C in the pigment of the Harderian gland and the eye was observed. Uptake of radioactivity was also found in the eyes of the foetuses although their livers did not accumulate radioactivity. (author)

  6. Role of CYP1B1 in PAH-DNA adduct formation and breast cancer risk

    Energy Technology Data Exchange (ETDEWEB)

    Goth-Goldstein, Regine; Russell, Marion L.; Muller, A.P.; Caleffi, M.; Eschiletti, J.; Graudenz, M.; Sohn, Michael D.

    2010-04-01

    This study investigated the hypothesis that increased exposure to polycyclic aromatic hydrocarbons (PAHs) increases breast cancer risk. PAHs are products of incomplete burning of organic matter and are present in cigarette smoke, ambient air, drinking water, and diet. PAHs require metabolic transformation to bind to DNA, causing DNA adducts, which can lead to mutations and are thought to be an important pre-cancer marker. In breast tissue, PAHs appear to be metabolized to their cancer-causing form primarily by the cytochrome P450 enzyme CYP1B1. Because the genotoxic impact of PAH depends on their metabolism, we hypothesized that high CYP1B1 enzyme levels result in increased formation of PAH-DNA adducts in breast tissue, leading to increased development of breast cancer. We have investigated molecular mechanisms of the relationship between PAH exposure, CYP1B1 expression and breast cancer risk in a clinic-based case-control study. We collected histologically normal breast tissue from 56 women (43 cases and 13 controls) undergoing breast surgery and analyzed these specimens for CYP1B1 genotype, PAH-DNA adducts and CYP1B1 gene expression. We did not detect any difference in aromatic DNA adduct levels of cases and controls, only between smokers and non-smokers. CYP1B1 transcript levels were slightly lower in controls than cases, but the difference was not statistically significant. We found no correlation between the levels of CYP1B1 expression and DNA adducts. If CYP1B1 has any role in breast cancer etiology it might be through its metabolism of estrogen rather than its metabolism of PAHs. However, due to the lack of statistical power these results should be interpreted with caution.

  7. The direct measurement of the 3 3P0-3 3P1 fine-structure interval and the gJ-factor of atomic silicon by laser magnetic resonance

    Science.gov (United States)

    Evenson, K. M.; Beltran-Lopez, V.; Ley-Koo, E.; Inguscio, M.

    1984-01-01

    The J - 1 fine structure interval and the g-factor of the 3P1 state have been determined with high precision in the present laser magnetic resonance measurements of the ground 3p2 3P multiplet of atomic Si. Delta-E(3P1-3P0) = 2,311,755.6(7) MHz, and gJ(3P1) = 1.500830(70). Single-configuration calculations of gJ for 3P1 and 3P2 yield a value for the latter which, at 1.501095, is noted to differ by an unexpectedly large margin from the experimental value.

  8. Chronic Moderate Alcohol Intakes Accelerate SR-B1 Mediated Reverse Cholesterol Transport.

    Science.gov (United States)

    Li, Menghua; Diao, Yan; Liu, Ying; Huang, Hui; Li, Yanze; Tan, Peizhu; Liang, Huan; He, Qi; Nie, Junhui; Dong, Xingli; Wang, Yang; Zhou, Lingyun; Gao, Xu

    2016-01-01

    Cholesterol is essential for all animal life. However, a high level of cholesterol in the body is strongly associated with the progression of various severe diseases. In our study, the potential involvement of alcohol in the regulation of high density lipoprotein (HDL) receptor scavenger receptor class B and type I (SR-B1)-mediated reverse cholesterol transport was investigated. We separated male C57BL/6 mice into four diets: control, alcohol, Control + HC and alcohol + HC. The SR-B1 level and 1,1'-dioctadecyl-3,3,3',3'-tetramethylindocarbocyanine perchlorate- high- density lipoprotein (DiI-HDL) uptake were also measured in AML12 cells and HL7702 cells treated with alcohol. The control + HC diet led to increased hepatic triglyceride and cholesterol levels while alcohol + HC led no significant change. Compared with that of the control group, the SR-B1 mRNA level was elevated by 27.1% (P alcohol, control + HC and alcohol + HC groups, respectively. In AML12 and HL7702 cells, SR-B1 level and DiI-HDL uptake were repressed by SR-B1 siRNA or GW9662. However, these effects were reversed through alcohol treatment. These data suggest that a moderate amount of alcohol plays a novel role in reverse cholesterol transport, mainly mediated by PPARγ and SR-B1. PMID:27618957

  9. Plasma extravasation mediated by lipopolysaccharide-induction of kinin B1 receptors in rat tissues

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Wille

    2001-01-01

    Full Text Available The present study was performed to: (a evaluate the effects of kinin B1 (Sar{D-Phe8}-des-Arg9-BK; 10 nmol/kg and B2 (bradykinin (BK; 10 nmol/kg receptor agonists on plasma extravasation in selected rat tissues; (b determine the contribution of a lipopolysaccharide (LPS (100 μ g/kg to the effects triggered by B1 and B2 agonists; and (c characterize the selectivity of B1 ({Leu8}desArg9-BK; 10 nmol/kg and B2 (HOE 140; 10 nmol/kg antagonists as inhibitors of this kinin-induced phenomenon. B1 and B2 agonists were shown to increase plasma extravasation in the duodenum, ileum and also in the urinary bladder of the rat. LPS pretreatment enhanced the plasma extravasation mediated only by the B1 agonist in the duodenum, ileum, trachea, main and segmentar bronchi. These effects were prevented by the B1. but not the B2 antagonist. In normal rats, the B2 antagonist inhibited the effect of B2 agonist in all the tissues analyzed. However, in LPS-treated rats, the B2 antagonist was ineffective in the urinary bladder.

  10. Toxicity of aflatoxin B1 towards the vitamin D receptor (VDR).

    Science.gov (United States)

    Costanzo, Paola; Santini, Antonello; Fattore, Luigi; Novellino, Ettore; Ritieni, Alberto

    2015-02-01

    This research describes an unexpected toxicity of the aflatoxin B1 towards the vitamin D receptors. Rickets is a childhood disease, and calcium deficiency is the aetiological cause in Africa, being primarily associated with nutritional problems; in this research the contribution of aflatoxin B1 exposure during the early months of life is an interesting factor to deepen in order to prevent liver damages or the development of rickets. The results show that the expression of vitamin D receptor in osteosarcoma cell line SAOS-2 is significantly down-modulated by exposure to aflatoxin B1. This seems to suggest that Aflatoxin B1, toxic towards the vitamin D receptor, interferes with the actions of the vitamin D on calcium binding gene expression in the kidney and intestine. Experimental data indicate a 58% and 86% decrease if the cells are exposed to 5 ng/mL and 50 ng/mL of aflatoxin B1, respectively. These results seem to indicate that natural occurrence of the aflatoxin B1 and allelic variant of vitamin D receptor on (F allele) increase the risk of developing rickets of African children.

  11. Impaired cortical neurogenesis in plexin-B1 and -B2 double deletion mutant.

    Science.gov (United States)

    Daviaud, Nicolas; Chen, Karen; Huang, Yong; Friedel, Roland H; Zou, Hongyan

    2016-08-01

    Mammalian cortical expansion is tightly controlled by fine-tuning of proliferation and differentiation of neural progenitors in a region-specific manner. How extrinsic cues interface with cell-intrinsic programs to balance proliferative versus neurogenic decisions remains an unsolved question. We examined the function of Semaphorin receptors Plexin-B1 and -B2 in corticogenesis by generating double mutants, whereby Plexin-B2 was conditionally ablated in the developing brain in a Plexin-B1 null mutant background. Absence of both Plexin-Bs resulted in cortical thinning, particularly in the caudomedial cortex. Plexin-B1/B2 double, but not single, mutants exhibited a reduced neural progenitor pool, attributable to decreased proliferation and an altered division mode favoring cell cycle exit. This resulted in deficient production of neurons throughout the neurogenic period, proportionally affecting all cortical laminae. Consistent with the in vivo data, cultured neural progenitors lacking both Plexin-B1 and -B2 displayed decreased proliferative capacity and increased spontaneous differentiation. Our study therefore defines a novel function of Plexin-B1 and -B2 in transmitting extrinsic signals to maintain proliferative and undifferentiated states of neural progenitors. As single mutants displayed no apparent cortical defects, we conclude that Plexin-B1 and -B2 play redundant or compensatory roles during forebrain development to ensure proper neuronal production and neocortical expansion. © 2015 Wiley Periodicals, Inc. Develop Neurobiol 76: 882-899, 2016. PMID:26579598

  12. Potential construction of the B(1)1 Π state in KCs based on Fourier-Transform spectroscopy data

    International Nuclear Information System (INIS)

    The paper presents an empirical pointwise potential energy curve (PEC) of the extensively perturbed B(1)1Π state of the KCs molecule constructed by applying an Inverted Perturbation Approach routine. The experimental term values in the energy range E(v′,J′)∈[14071;15502]cm−1 involved in the fit were based on Fourier-Transform spectroscopy data obtained with 0.01 cm−1 accuracy from laser-induced B(1)1Π→X1Σ+ fluorescence spectra in the present work (654 term values) combined with 520 term values from Birzniece et al. (2012) . The data set included vibrational v′∈[0,35] and rotational J′∈[7,233] quantum numbers covering about 85% of the potential well. The present fit reproduces the data included in the fit with a standard deviation 0.94 cm−1. The empirical PEC contains an inflection at about R=4.1 Å that reflects the avoided crossing of two Ω=1 states corresponding to B(1)1Π and c(2)3Σ+ states as predicted by ab initio calculations. - Highlights: • An empirical potential for first singlet Pi state of the KCs molecule was constructed. • Fourier-Transform spectroscopy yielded term values with 0.01 cm−1 accuracy. • Data set included vibrational levels up to v = 35 covering 85% of the potential well. • The potential reproduces the fitted data with a standard deviation 0.94 cm−1. • The empirical potential contains an inflection that reflects the avoided crossing

  13. 茶叶中黄曲霉毒素B1的检测方法研究%Determination methods of aflatoxin B1 in tea

    Institute of Scientific and Technical Information of China (English)

    吴国华; 赵榕; 里南; 王雄

    2014-01-01

    Objectives To compare the three different methods for the determination of aflatoxin B1 in tea samples, including gold immune chromatography assay (GICA), high performance liquid chromatography (HPLC) and enzyme-linked immunosorbent assay (ELISA). Methods Method validation was done based on black tea, green tea and jasmine tea. And black tea, green tea, oolong tea, jasmine tea, extracted tea, medicinal health tea as representatives were detected with different methods. Results Both of optimized GICA and HPLC achieved high accuracy and precision. ELISA assay produced fake positive. Only one of eleven tested samples had aflatoxin B1 in random test.%目的:针对茶叶中黄曲霉毒素 B1的检测,对比胶体金免疫层析法、高效液相色谱、酶联免疫法的差异。方法以红茶、绿茶、花茶为基质,进行方法验证。并选取具有代表性的红茶、绿茶、乌龙茶、及花茶、萃取茶、药用保健茶分别用不同的方法检测。结果改良后的液相法和胶体金免疫层析法准确度和精密度较高,酶联免疫法存在假阳性。随机检测11种茶叶仅有一种检出黄曲霉毒素B1

  14. Analysis of CYP1B1 in pediatric and adult glaucoma and other ocular phenotypes

    Science.gov (United States)

    Reis, Linda M.; Tyler, Rebecca C.; Weh, Eric; Hendee, Kathryn E.; Kariminejad, Ariana; Abdul-Rahman, Omar; Ben-Omran, Tawfeg; Manning, Melanie A.; McCarty, Catherine A.; Kitchner, Terrie E.; Costakos, Deborah

    2016-01-01

    Purpose The CYP1B1 gene encodes an enzyme that is a member of the cytochrome P450 superfamily. Mutations in CYP1B1 have been mainly reported in recessive pediatric ocular phenotypes, such as primary congenital glaucoma (PCG) and congenital glaucoma with anterior segment dysgenesis (CG with ASD), with some likely pathogenic variants also identified in families affected with adult-onset primary open angle glaucoma (POAG). Methods We examined CYP1B1 in 158 pediatric patients affected with PCG (eight), CG with ASD (22), CG with other developmental ocular disorders (11), juvenile glaucoma with or without additional ocular anomalies (26), and ASD or other developmental ocular conditions without glaucoma (91); in addition, a large cohort of adult patients with POAG (193) and POAG-negative controls (288) was examined. Results Recessive pathogenic variants in CYP1B1 were identified in two PCG pedigrees, three cases with CG and ASD, and two families with CG and other ocular defects, such as sclerocornea in one patient and microphthalmia in another individual; neither sclerocornea nor microphthalmia has been previously associated with CYP1B1. Most of the identified causative mutations are new occurrences of previously reported pathogenic alleles with two novel variants identified: a c.1325delC, p.(Pro442Glnfs*15) frameshift allele in a family with PCG and a c.157G>A, p.(Gly53Ser) variant identified in a proband with CG, Peters anomaly, and microphthalmia. Analysis of the family history in the CYP1B1-positive families revealed POAG in confirmed or presumed heterozygous relatives in one family with PCG and two families with ASD/CG; POAG was associated with the c.1064_1076del, p.(Arg355Hisfs*69) allele in two of these pedigrees. Screening of an unrelated POAG cohort identified the same c.1064_1076del heterozygous allele in one individual with sporadic POAG but not in age- and ethnicity-matched POAG-negative individuals. Overall, there was no significant enrichment for mutant

  15. Expansion of B-1a Cells with Germline Heavy Chain Sequence in Lupus Mice

    Science.gov (United States)

    Holodick, Nichol E.; Zeumer, Leilani; Rothstein, Thomas L.; Morel, Laurence

    2016-01-01

    B6.Sle1.Sle2.Sle3 (B6.TC) lupus-prone mice carrying the NZB allele of Cdkn2c, encoding for the cyclin-dependent kinase inhibitor P18INK4, accumulate B-1a cells due to a higher rate of proliferative self-renewal. However, it is unclear whether this affects primarily early-appearing B-1a cells of fetal origin or later-appearing B-1a cells that emerge from bone marrow. B-1a cells are the major source of natural autoantibodies, and it has been shown that their protective nature is associated with a germline-like sequence, which is characterized by few N-nucleotide insertions and a repertoire skewed toward rearrangements predominated during fetal life, VH11 and VH12. To determine the nature of B-1a cells expanded in B6.TC mice, we amplified immunoglobulin genes by PCR from single cells in mice. Sequencing showed a significantly higher proportion of B-1a cell antibodies that display fewer N-additions in B6.TC mice than in B6 control mice. Following this lower number of N-insertions within the CDR-H3 region, the B6.TC B-1a cells display shorter CDR-H3 length than B6 B-1a cells. The absence of N-additions is a surrogate for fetal origin, as TdT expression starts after birth in mice. Therefore, our results suggest that the B-1a cell population is not only expanded in autoimmune B6.TC mice but also qualitatively different with the majority of cells from fetal origin. Accordingly, our sequencing results also demonstrated the overuse of VH11 and VH12 in autoimmune B6.TC mice as compared to B6 controls. These results suggest that the development of lupus autoantibodies in these mice is coupled with skewing of the B-1a cell repertoire and possible retention of protective natural antibodies. PMID:27047495

  16. Expansion of B-1a cells with germline heavy chain sequence in lupus mice

    Directory of Open Access Journals (Sweden)

    Nichol E Holodick

    2016-03-01

    Full Text Available B6.Sle1.Sle2.Sle3 (B6.TC lupus-prone mice carrying the NZB allele of Cdkn2c, encoding for the cyclin-dependent kinase inhibitor P18INK4, accumulate B-1a cells due to a higher rate of proliferative self-renewal. However, it is unclear whether this affects primarily early appearing B-1a cells of fetal origin or later appearing B-1a cells that emerge from bone marrow. B-1a cells are the major source of natural autoantibodies, and it has been shown that their protective nature is associated with a germline-like sequence, which is characterized by few N-nucleotide insertions and a repertoire skewed towards rearrangements predominated during fetal life, VH11 and VH12. To determine the nature of B-1a cells expanded in B6.TC mice, we amplified immunoglobulin genes by PCR from single cells in mice. Sequencing showed a significantly higher proportion of B-1a cell antibodies display fewer N-additions in B6.TC mice than in B6 control mice. Following this lower number of N-insertions within the CDR-H3 region, the B6.TC B-1a cells display shorter CDR-H3 length than B6 B-1a cells. The absence of N-additions is a surrogate for fetal origin, as TdT expression starts after birth in mice. Therefore, our results suggest that the B-1a cell population is not only expanded in autoimmune B6.TC mice but also qualitatively different with the majority of cells from fetal origin. Accordingly, our sequencing results also demonstrated overuse of VH11 and VH12 in autoimmune B6.TC mice as compared to B6 controls. These results suggest that the development of lupus autoantibodies in these mice is coupled with skewing of the B-1a cell repertoire and possible retention of protective natural antibodies.

  17. Isolation and Characterization of Pepper Genes Interacting with the CMV-P1 Helicase Domain.

    Directory of Open Access Journals (Sweden)

    Yoomi Choi

    Full Text Available Cucumber mosaic virus (CMV is a destructive pathogen affecting Capsicum annuum (pepper production. The pepper Cmr1 gene confers resistance to most CMV strains, but is overcome by CMV-P1 in a process dependent on the CMV-P1 RNA1 helicase domain (P1 helicase. Here, to identify host factors involved in CMV-P1 infection in pepper, a yeast two-hybrid library derived from a C. annuum 'Bukang' cDNA library was screened, producing a total of 76 potential clones interacting with the P1 helicase. Beta-galactosidase filter lift assay, PCR screening, and sequencing analysis narrowed the candidates to 10 genes putatively involved in virus infection. The candidate host genes were silenced in Nicotiana benthamiana plants that were then inoculated with CMV-P1 tagged with the green fluorescent protein (GFP. Plants silenced for seven of the genes showed development comparable to N. benthamiana wild type, whereas plants silenced for the other three genes showed developmental defects including stunting and severe distortion. Silencing formate dehydrogenase and calreticulin-3 precursor led to reduced virus accumulation. Formate dehydrogenase-silenced plants showed local infection in inoculated leaves, but not in upper (systemic leaves. In the calreticulin-3 precursor-silenced plants, infection was not observed in either the inoculated or the upper leaves. Our results demonstrate that formate dehydrogenase and calreticulin-3 precursor are required for CMV-P1 infection.

  18. Observation of the predissociated, quasilinear B(1A') state of CHF by optical-optical double resonance.

    Science.gov (United States)

    Tao, Chong; Reid, Scott A; Schmidt, Timothy W; Kable, Scott H

    2007-02-01

    We report the first observation of the predissociative B state of a halocarbene molecule. Rovibronic energy levels were measured in the B(1A') state of CHF by fluorescence dip detected optical-optical double resonance spectroscopy via the A state. The origin was found to lie 30 817.4 cm-1 above the zero point level of the X state. Rotational transitions within six purely bending states, and states involving one or two quanta of CF-stretch were observed, including the vibrational angular momentum components. Interpretation of the spectrum, with support of ab initio calculations, shows that CHF is quasilinear in the B state with a small (-200 cm-1) barrier to linearity which lies below the zero-point level. The rotational constant, B=1.04 to 1.09 cm-1, depending on vibrational state, again in good agreement with theory. All observed B state levels were predissociative, as evidenced by Lorentzian line broadening. Linewidths varied with initial state from 0.7-10.8 cm-1, corresponding to excited state lifetimes of 0.5-8 ps. PMID:17302466

  19. Polyketides with α-Glucosidase Inhibitory Activity from a Mangrove Endophytic Fungus, Penicillium sp. HN29-3B1.

    Science.gov (United States)

    Liu, Yayue; Yang, Qin; Xia, Guoping; Huang, Hongbo; Li, Hanxiang; Ma, Lin; Lu, Yongjun; He, Lei; Xia, Xuekui; She, Zhigang

    2015-08-28

    Five new compounds, pinazaphilones A and B (1, 2), two phenolic compounds (4, 5), and penicidone D (6), together with the known Sch 1385568 (3), (±)-penifupyrone (7), 3-O-methylfunicone (8), 5-methylbenzene-1,3-diol (9), and 2,4-dihydroxy-6-methylbenzoic acid (10) were obtained from the culture of the endophytic fungus Penicillium sp. HN29-3B1, which was isolated from a fresh branch of the mangrove plant Cerbera manghas collected from the South China Sea. Their structures were determined by analysis of 1D and 2D NMR and mass spectroscopic data. Structures of compounds 4 and 7 were further confirmed by a single-crystal X-ray diffraction experiment using Cu Kα radiation. The absolute configurations of compounds 1-3 were assigned by quantum chemical calculations of the electronic circular dichroic spectra. Compounds 2, 3, 5, and 7 inhibited α-glucosidase with IC50 values of 28.0, 16.6, 2.2, and 14.4 μM, respectively, and are thus more potent than the positive control, acarbose. PMID:26230970

  20. Incidência de fumonisina B1, aflatoxinas B1, B2, G1 e G2, ocratoxina A e zearalenona em produtos de milho Occurrence of fumonisin B1, aflatoxins B1, B2, G1, and G2, ochratoxin A and zearalenone in corn products

    Directory of Open Access Journals (Sweden)

    Luciane Mie Kawashima

    2006-09-01

    Full Text Available Levantamentos de ocorrência de micotoxinas em alimentos foram realizados nas últimas duas décadas nas regiões Sudeste e Sul do Brasil. Levantamentos em alimentos comercializados em outras regiões têm-se limitado a aflatoxinas em amendoim e castanhas do Brasil. O presente trabalho pesquisou a presença de fumonisina B1, aflatoxinas B1, B2, G1 e G2, ocratoxina A e zearalenona em 74 amostras de produtos a base de milho adquiridas no comércio da cidade de Recife, PE, durante o período de 1999 a 2001. Fumonisina B1 foi determinada por cromatografia líquida de alta eficiência com detecção por fluorescência e as demais toxinas foram determinadas por cromatografia em camada delgada. Fumonisina B1 foi encontrada em 94,6% das amostras em concentrações variando de 20 a 8600 µg/kg. Apenas 5 amostras continham aflatoxina B1 e o teor máximo encontrado foi 20 µg/kg. Duas amostras ultrapassaram o limite de 20 µg/kg para a somatória das aflatoxinas B1, B2, G1 e G2 (farinha de milho pré-cozida com 21,5 µg/kg e quirera (xerém com 23,3 µg/kg. As aflatoxinas G1 e G2, ocratoxina A e zearalenona não foram detectadas em nenhuma das amostras. Todas as amostras contaminadas com aflatoxinas também apresentaram fumonisina B1.Research concerning the presence of mycotoxin in food has been conducted in the Southwest and South regions of Brazil over the last two decades. Research in other regions has been limited to aflatoxin in peanuts and Brazil nuts. The aim of this work is to study the presence of fumonisin B1, aflatoxins B1, B2, G1, and G2, ochratoxin A and zearalenone in 74 samples of corn products acquired in shops and food markets in the city of Recife (PE from 1999 to 2001. Fumonisin B1 was determined by high performance liquid chromatography and fluorescence was detected. The other toxins were determined by thin layer chromatography. Fumonisin B1 was found in 94.6% of the samples in levels from 20 to 8600 µg/kg. Only 5 samples contained

  1. 黄曲霍毒素B1人工抗原的合成及鉴定%Synthesis and Identification of Aflatoxin B1 Artificial Antigen

    Institute of Scientific and Technical Information of China (English)

    伍鑫茹; 杨雪娇; 赵肃清; 张焜

    2013-01-01

    Carboxyl group was introduced to Aflatoxin B1 (aflatoxin B1, AFB1) by derivatization method to synthesis the hapten (AFB1 carboxymethyl activator). And the AFBiO was coupled with BSA by using N-hydroxy-succinimide method to prepare the complete antigen of AFB,. The results of ECI-MS and ultraviolet spectroscopy showed that the target hapten was successfully synthesized. Through combined with ultraviolet spectrophotometry and regression equation, the standard curves of the different concentration hapten and BSA were abtained as follow: y=0.1440x+0.0103 (R2 =0.9986) and y=0.0059x+0.0808 (R2 =0.9889) respectively. The concentrations of AFB1O and BSA in adduct were 186.32 μg/mlL and 6127.46 ng/mL respectively, and the molar ration was 5.13:1.%采用衍生化在黄曲霉毒素B1(aflatoxin B1,AFB1)上引入羧基合成AFB1羧甲基活化物,通过N-羟琥珀酰亚胺酯(N-hydroxy-succinimide NHS)法将AFB1O与牛血清白蛋白(BSA)偶联,制备黄曲霉毒素B1完全抗原AFB1-BSA.ECI-MS和紫外光谱法的鉴定结果表明目标半抗原合成成功.结合紫外分光光度法和回归方程,分别测得不同浓度的半抗原和蛋白质线性曲线为:Y=0.1440X+0.0103,R2=0.9986; Y=0.0059X+0.0808,R2=0.9889.偶联物中半抗原和蛋白质的浓度分别为186.32 μg/mL、6127.46 μg/mL,即求得抗原分子结合比为5.13∶1,从而为制备抗AFB1抗体奠定基础.

  2. Solutions of system of P1 equations without use of auxiliary differential equations coupled

    International Nuclear Information System (INIS)

    The system of P1 equations is composed by two equations coupled itself one for the neutron flux and other for the current. Usually this system is solved by definitions of two integrals parameters, which are named slowing down densities of the flux and the current. Hence, the system P1 can be change from integral to only two differential equations. However, there are two new differentials equations that may be solved with the initial system. The present work analyzes this procedure and studies a method, which solve the P1 equations directly, without definitions of slowing down densities. (author)

  3. STS-113 P1 Truss payload arrives at Launch Complex 39A

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- At Launch Complex 39A, the P1 Truss Segment arrives at the pad for transfer into the Payload Changeout Room. The P1 truss is the primary payload for Mission STS-113 to the International Space Station. It is the first port truss segment which will be attached to the Station'''s central truss segment, S0. Once delivered, the P1 truss will remain stowed until flight 12A.1. The mission will also deliver the Expedition 6 crew to the Station and return Expedition 5 to Earth. Space Shuttle Endeavour is scheduled to launch no earlier than Nov. 10 on the 11-day mission.

  4. Activation of the kinin B1 receptor attenuates melanoma tumor growth and metastasis.

    Directory of Open Access Journals (Sweden)

    Patricia Dillenburg-Pilla

    Full Text Available Melanoma is a very aggressive tumor that does not respond well to standard therapeutic approaches, such as radio- and chemotherapies. Furthermore, acquiring the ability to metastasize in melanoma and many other tumor types is directly related to incurable disease. The B1 kinin receptor participates in a variety of cancer-related pathophysiological events, such as inflammation and angiogenesis. Therefore, we investigated whether this G protein-coupled receptor plays a role in tumor progression. We used a murine melanoma cell line that expresses the kinin B1 receptor and does not express the kinin B2 receptor to investigate the precise contribution of activation of the B1 receptor in tumor progression and correlated events using various in vitro and in vivo approaches. Activation of the kinin B1 receptor in the absence of B2 receptor inhibits cell migration in vitro and decreases tumor formation in vivo. Moreover, tumors formed from cells stimulated with B1-specific agonist showed several features of decreased aggressiveness, such as smaller size and infiltration of inflammatory cells within the tumor area, higher levels of pro-inflammatory cytokines implicated in the host anti-tumor immune response, lower number of cells undergoing mitosis, a poorer vascular network, no signs of invasion of surrounding tissues or metastasis and increased animal survival. Our findings reveal that activation of the kinin B1 receptor has a host protective role during murine melanoma tumor progression, suggesting that the B1 receptor could be a new anti-tumor GPCR and provide new opportunities for therapeutic targeting.

  5. Ultrafine carbon particles down-regulate CYP1B1 expression in human monocytes

    Directory of Open Access Journals (Sweden)

    Ziegler-Heitbrock Loems

    2009-10-01

    Full Text Available Abstract Background Cytochrome P450 monoxygenases play an important role in the defence against inhaled toxic compounds and in metabolizing a wide range of xenobiotics and environmental contaminants. In ambient aerosol the ultrafine particle fraction which penetrates deeply into the lungs is considered to be a major factor for adverse health effects. The cells mainly affected by inhaled particles are lung epithelial cells and cells of the monocyte/macrophage lineage. Results In this study we have analyzed the effect of a mixture of fine TiO2 and ultrafine carbon black Printex 90 particles (P90 on the expression of cytochrome P450 1B1 (CYP1B1 in human monocytes, macrophages, bronchial epithelial cells and epithelial cell lines. CYP1B1 expression is strongly down-regulated by P90 in monocytes with a maximum after P90 treatment for 3 h while fine and ultrafine TiO2 had no effect. CYP1B1 was down-regulated up to 130-fold and in addition CYP1A1 mRNA was decreased 13-fold. In vitro generated monocyte-derived macrophages (MDM, epithelial cell lines, and primary bronchial epithelial cells also showed reduced CYP1B1 mRNA levels. Benzo[a]pyrene (BaP is inducing CYB1B1 but ultrafine P90 can still down-regulate gene expression at 0.1 μM of BaP. The P90-induced reduction of CYP1B1 was also demonstrated at the protein level using Western blot analysis. Conclusion These data suggest that the P90-induced reduction of CYP gene expression may interfere with the activation and/or detoxification capabilities of inhaled toxic compounds.

  6. Scavenger receptor B1 facilitates macrophage uptake of silver nanoparticles and cellular activation

    Energy Technology Data Exchange (ETDEWEB)

    Aldossari, Abdullah A.; Shannahan, Jonathan H. [The University of Colorado Anschutz Medical Campus, Department of Pharmaceutical Sciences, Skaggs School of Pharmacy and Pharmaceutical Sciences (United States); Podila, Ramakrishna [Clemson University, Department of Physics and Astronomy (United States); Brown, Jared M., E-mail: jared.brown@ucdenver.edu [The University of Colorado Anschutz Medical Campus, Department of Pharmaceutical Sciences, Skaggs School of Pharmacy and Pharmaceutical Sciences (United States)

    2015-07-15

    Due to increased use of silver nanoparticles (AgNPs) for their antimicrobial activity, concerns have risen regarding potential adverse human health effects. Scavenger receptor B1 (SR-B1), a major receptor for high-density lipoprotein (HDL), is expressed by macrophages and has also been reported to play a role in recognition of negatively charged particles. We, therefore, hypothesized that SR-B1 mediates macrophage uptake of AgNPs and inflammatory activation. To test this hypothesis, we exposed a mouse macrophage cell line RAW264.7 (RAW) and bone marrow-derived macrophages (BMDM) to 20 nm citrate-suspended AgNPs. To verify the role of the SR-B1 receptor, we utilized a SR-B1 inhibitor (Blt2). In vitro studies demonstrated uptake of AgNPs and HDL-coated AgNPs by macrophages which were significantly reduced following pretreatment with Blt2. Inflammatory cytokine arrays revealed that macrophages exposed to AgNPs up-regulated expression of Tnf-α, Oncostatin m (OSM), Ccl4, Il17f, Ccl7, and Ccl2, whereas Il16 was found to be down-regulated. Macrophage activation was observed following AgNP and HDL-coated AgNP exposure as measured by OSM protein production and increased surface expression of CD86. These markers of activation were reduced with Blt2 pretreatment. The in vitro findings were confirmed in vivo through pulmonary instillation of AgNPs in mice. Pulmonary instillation of AgNPs resulted in a recruitment of inflammatory cells that were reduced in SR-B1-deficient mice or following Blt2 pretreatment. This study suggests that SR-B1 plays a major role in cellular recognition of AgNPs and the induction of cell responses that could contribute to inflammation caused by AgNP exposure.

  7. Scavenger receptor B1 facilitates macrophage uptake of silver nanoparticles and cellular activation

    International Nuclear Information System (INIS)

    Due to increased use of silver nanoparticles (AgNPs) for their antimicrobial activity, concerns have risen regarding potential adverse human health effects. Scavenger receptor B1 (SR-B1), a major receptor for high-density lipoprotein (HDL), is expressed by macrophages and has also been reported to play a role in recognition of negatively charged particles. We, therefore, hypothesized that SR-B1 mediates macrophage uptake of AgNPs and inflammatory activation. To test this hypothesis, we exposed a mouse macrophage cell line RAW264.7 (RAW) and bone marrow-derived macrophages (BMDM) to 20 nm citrate-suspended AgNPs. To verify the role of the SR-B1 receptor, we utilized a SR-B1 inhibitor (Blt2). In vitro studies demonstrated uptake of AgNPs and HDL-coated AgNPs by macrophages which were significantly reduced following pretreatment with Blt2. Inflammatory cytokine arrays revealed that macrophages exposed to AgNPs up-regulated expression of Tnf-α, Oncostatin m (OSM), Ccl4, Il17f, Ccl7, and Ccl2, whereas Il16 was found to be down-regulated. Macrophage activation was observed following AgNP and HDL-coated AgNP exposure as measured by OSM protein production and increased surface expression of CD86. These markers of activation were reduced with Blt2 pretreatment. The in vitro findings were confirmed in vivo through pulmonary instillation of AgNPs in mice. Pulmonary instillation of AgNPs resulted in a recruitment of inflammatory cells that were reduced in SR-B1-deficient mice or following Blt2 pretreatment. This study suggests that SR-B1 plays a major role in cellular recognition of AgNPs and the induction of cell responses that could contribute to inflammation caused by AgNP exposure

  8. Influence of relaxation effects on probabilities of the 2s2p3 S2—2s2 2p2 3p1,2intercombination

    Institute of Scientific and Technical Information of China (English)

    袁萍; 刘欣生; 等

    2003-01-01

    Transition probabilities of the 2s2p3 5S2-2s2 2P2 3P1,2 intercombination transitions in NII have been calculated by using a large-scale multiconfiguration Dirac-Fock method.In the calculation themost important effects of relativity,correlation,and relaxation are considered.From the calculated transition probabilities,the lifetime of the s22p3 5S2 metastable state is derived.The result is in excellent agreement agreement with the latest experimental result.In the meantime the influence of anomalously strong relaxation effects on probabilities of the 2s2p3 5S2-2s2 2p2 3P1,2 lines in NII have been found.

  9. Noble-gas broadening rates for the 6s2S0→6s6p 1,3P1 resonance and intercombination lines of barium

    International Nuclear Information System (INIS)

    The collisional-broadening and -shift rate coefficients (kbr and kshift), for both helium and argon buffer gases, have been measured in the impact limit for the 6s21S0→6s6p 3P1 intercombination transition of barium. Detailed absorption line shapes were measured at three different ground-state number densities by monitoring the transmitted intensity of a weak cw probe laser as it was scanned over the transition. A single, density-independent line shape was then constructed and fit to a sum of Voigt functions (to account for hyperfine structure and isotope shifts) in order to determine the broadening and shift rates. By repeating the process for several buffer-gas pressures, kbr and kshift were determined from least-squares straight-line fits to the broadening and shift rates versus buffer-gas number density. Absolute normalization of the line-shape data was used to provide accurate ground-state column densities. Column-density information was then combined with measurements of white-light-absorption equivalent widths for the 6s21S0→6s6p 1P1 resonance transition to yield broadening rates for that transition. These values for the resonance line lie between previous literature values, which are widely discrepant. Finally we measured the absolute metastable 6s5d 3D2 column density under conditions of optical pumping through the 3P1 level, and determined that, in steady state, even with a weak cw pump laser, ∼20% of all barium atoms in the vapor could be found in the 3D2 level (with approximately 60% spread over the full 3DJ metastable manifold)

  10. Prenatal exposure to aflatoxin B1: developmental, behavioral, and reproductive alterations in male rats

    Science.gov (United States)

    Supriya, Ch.; Reddy, P. Sreenivasula

    2015-06-01

    Previous studies have shown that aflatoxin B1 (AfB1) inhibits androgen biosynthesis as a result of its ability to form a high-affinity complex with the steroidogenic acute regulatory protein. The results of the present study demonstrate the postnatal effects of in utero exposure to AfB1 in the rat. Pregnant Wistar rats were given 10, 20, or 50 μg AfB1/kg body weight daily from gestation day (GD) 12 to GD 19. At parturition, newborns were observed for clinical signs and survival. All animals were born alive and initially appeared to be active. Male pups from control and AfB1-exposed animals were weaned and maintained up to postnatal day (PD) 100. Litter size, birth weight, sex ratio, survival rate, and crown-rump length of the pups were significantly decreased in AfB1-exposed rats when compared to controls. Elapsed time (days) for testes to descend into the scrotal sac was significantly delayed in experimental pups when compared to control pups. Behavioral observations such as cliff avoidance, negative geotaxis, surface rightening activity, ascending wire mesh, open field behavior, and exploratory and locomotory activities were significantly impaired in experimental pups. Body weights and the indices of testis, cauda epididymis, prostate, seminal vesicles, and liver were significantly reduced on PD 100 in male rats exposed to AfB1 during embryonic development when compared with controls. Significant reduction in the testicular daily sperm production, epididymal sperm count, and number of viable, motile, and hypo-osmotic tail coiled sperm was observed in experimental rats. The levels of serum testosterone and activity levels of testicular hydroxysteroid dehydrogenases were significantly decreased in a dose-dependent manner with a significant increase in the serum follicle-stimulating hormone and luteinizing hormone in experimental rats. Deterioration in the testicular and cauda epididymal architecture was observed in experimental rats. The results of fertility

  11. Lipid polymorphism induced by surfactant peptide SP-B(1-25).

    Science.gov (United States)

    Farver, R Suzanne; Mills, Frank D; Antharam, Vijay C; Chebukati, Janetricks N; Fanucci, Gail E; Long, Joanna R

    2010-09-22

    Pulmonary surfactant protein B (SP-B) is an essential protein for lowering surface tension in the alveoli. SP-B(1-25), a peptide comprised of the N-terminal 25 amino-acid residues of SP-B, is known to retain much of the biological activity of SP-B. Circular dichroism has shown that when SP-B(1-25) interacts with negatively charged lipid vesicles, it contains significant helical structure for the lipid compositions and peptide/lipid ratios studied here. The effect of SP-B(1-25) on lipid organization and polymorphisms was investigated via DSC, dynamic light scattering, transmission electron microscopy, and solid-state NMR spectroscopy. At 1-3 mol% peptide and physiologic temperature, SP-B(1-25) partitions at the interface of negatively charged PC/PG lipid bilayers. In lipid mixtures containing 1-5 mol% peptide, the structure of SP-B(1-25) remains constant, but (2)H and (31)P NMR spectra show the presence of an isotropic lipid phase in exchange with the lamellar phase below the T(m) of the lipids. This behavior is observed for both DPPC/POPG and POPC/POPG lipid mixtures as well as for both the PC and PG components of the mixtures. For 1-3 mol% SP-B(1-25), a return to a single lamellar phase above the lipid mixture T(m) is observed, but for 5 mol% SP-B(1-25) a significant isotropic component is observed at physiologic temperatures for DPPC and exchange broadening is observed in (2)H and (31)P NMR spectra of the other lipid components in the two mixtures. DLS and TEM rule out the formation of micellar structures and suggest that SP-B(1-25) promotes the formation of a fluid isotropic phase. The ability of SP-B(1-25) to fuse lipid lamellae via this mechanism, particularly those enriched in DPPC, suggests a specific role for the highly conserved N-terminus of SP-B in the packing of lipid lamellae into surfactant lamellar bodies or in stabilizing multilayer structures at the air-liquid interface. Importantly, this behavior has not been seen for the other SP-B fragments of

  12. Construction of DNA Vaccine for FMDV P1 Gene and Immunization Experiment%FMDV P1基因DNA疫苗构建及免疫实验

    Institute of Scientific and Technical Information of China (English)

    史秋梅; 高桂生; 张艳英; 高光平; 张东林

    2013-01-01

    [目的]构建口蹄疫DNA疫苗[方法]构建以PRV为载体的表达FMDV P1基因的质粒pIESZP1和pUTK3CP1,免疫小鼠并检测了免疫后小鼠的抗体水平.将构建的2个真核表达质粒分别转染Vero细胞,通过PCR、IFA、Western-blot等方法检测目的基因的转录和表达.将正确表达目的基因的DNA质粒肌肉接种3周龄的Balb/C小鼠,采用ELISA和SN方法检测了免疫小鼠体内的抗体水平.[结果]携带有FMDV衣壳蛋白P1基因的DNA质粒能引起小鼠产生特异性的体液免疫反应,两重组质粒诱导小鼠产生抗FMDV的抗体水平无差异.[结论]该研究为含有FMDV P1基因重组PRV以及重组病毒的动物免疫试验以评价基因工程疫苗的免疫效果奠定了基础.

  13. CASCADIC MULTIGRID METHOD FOR THE MORTAR ELEMENT METHOD FOR P1 NONCONFORMING ELEMENT

    Institute of Scientific and Technical Information of China (English)

    Chun-jia Bi; Dan-hui Hong

    2005-01-01

    In this paper, we consider the cascadic multigrid method for the mortar P1 nonconforming element which is used to solve the Poisson equation and prove that the cascadic conjugate gradient method is accurate with optimal complexity.

  14. Northwestern Hawaiian Islands (NWHI) photo-quadrat monitoring data table : Site number MID P1a

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This spreadsheet summarizes the number of corals photographed along a 26-meter transect line at Underwater Site P1-A at Midway Atoll in the Northwestern Hawaiian...

  15. Determination of Vitamin B1 in Pharmaceutical Preparations by Flow-injection Analysis with Biamperometric Detection

    Institute of Scientific and Technical Information of China (English)

    LI Li-jun; CHENG Hao; ZHAO Chuan; HU Xiao-ge

    2005-01-01

    A new electrochemical method for the on-line determination of vitamin B1 is presented. Based on dead-stop endpoint biamperometry by using two platinum foil electrodes with an applied potential difference of 150 mV, vitamin B1can be oxidized by hexacyanoferrate ( Ⅲ ) in a sodium hydroxide medium via a reversible indicating couple Fe( CN)64-/Fe(CN)63-. The cell current is linear with the concentration of vitamin B1 in the concentration range of 4.0×10-6-1.0 × 10-3 mol/L with a detection limit of 8.0×10-7 mol/L(0. 27 μg/mL). Most familiar excipients,ions and vitamins do not interfere with the determination of vitamin B1. The method displays the advantages of simplicity, high efficiency( 180 samples/h), and high selectivity, and is suitable for the determination of vitamin B1 in pharmaceutical preparations.

  16. Bancroftian filariasis: circulating B-1 cells decreased in microfilaria carriers and correlate with immunoglobulin M levels.

    Science.gov (United States)

    Mishra, R; Sahoo, P K; Mishra, S; Achary, K G; Dwibedi, B; Kar, S K; Satapathy, A K

    2014-05-01

    B-1 cells play an important role in the outcome of infection in schistosomiasis, pneumonia and experimental filariasis. However, no information exists regarding status of B-1 cells in clinical manifestations of human filariasis. We investigated the levels of B-1 cells from the total B cells by flow cytometry. Significantly low levels of B-1 cells and IgM antibodies were detected against a wide variety of autoantigens in microfilariae carriers as compared to endemic controls and patients with chronic pathology. A positive correlation was found between IgM antibodies to actin and ss-DNA. Absorption of plasma with soluble actin, myosin and lipopolysaccharides (LPS) resulted in significant removal of antifilarial antibodies. Affinity-purified anti-ss-DNA antibodies were found to be reactive to filarial antigens and various autoantigens. Further, a positive correlation was found between polyreactive antibodies and B-1 cells in filarial-infected human subjects. After antifilarial treatment, levels of IgM antibodies to ss-DNA, actin, LPS and filarial antigen increased significantly indicating a role of polyreactive naturally occurring antibodies in filarial infection. Our findings add to the existing evidence that the B-cell defect in BALB.Xid mice account for susceptibility to murine filarial infection and indicate an important role for these antibodies in providing host protection against filarial infection.

  17. Evidence for the eta(b)(1S) meson in radiative Upsilon(2S) decay.

    Science.gov (United States)

    Aubert, B; Bona, M; Karyotakis, Y; Lees, J P; Poireau, V; Prencipe, E; Prudent, X; Tisserand, V; Garra Tico, J; Grauges, E; Lopez, L; Palano, A; Pappagallo, M; Eigen, G; Stugu, B; Sun, L; Battaglia, M; Brown, D N; Kerth, L T; Kolomensky, Yu G; Lynch, G; Osipenkov, I L; Tackmann, K; Tanabe, T; Hawkes, C M; Soni, N; Watson, A T; Koch, H; Schroeder, T; Asgeirsson, D J; Fulsom, B G; Hearty, C; Mattison, T S; McKenna, J A; Barrett, M; Khan, A; Randle-Conde, A; Blinov, V E; Bukin, A D; Buzykaev, A R; Druzhinin, V P; Golubev, V B; Onuchin, A P; Serednyakov, S I; Skovpen, Yu I; Solodov, E P; Todyshev, K Yu; Bondioli, M; Curry, S; Eschrich, I; Kirkby, D; Lankford, A J; Lund, P; Mandelkern, M; Martin, E C; Stoker, D P; Abachi, S; Buchanan, C; Atmacan, H; Gary, J W; Liu, F; Long, O; Vitug, G M; Yasin, Z; Zhang, L; Sharma, V; Campagnari, C; Hong, T M; Kovalskyi, D; Mazur, M A; Richman, J D; Beck, T W; Eisner, A M; Heusch, C A; Kroseberg, J; Lockman, W S; Martinez, A J; Schalk, T; Schumm, B A; Seiden, A; Winstrom, L O; Cheng, C H; Doll, D A; Echenard, B; Fang, F; Hitlin, D G; Narsky, I; Piatenko, T; Porter, F C; Andreassen, R; Mancinelli, G; Meadows, B T; Mishra, K; Sokoloff, M D; Bloom, P C; Ford, W T; Gaz, A; Hirschauer, J F; Nagel, M; Nauenberg, U; Smith, J G; Wagner, S R; Ayad, R; Soffer, A; Toki, W H; Wilson, R J; Feltresi, E; Hauke, A; Jasper, H; Karbach, M; Merkel, J; Petzold, A; Spaan, B; Wacker, K; Kobel, M J; Nogowski, R; Schubert, K R; Schwierz, R; Volk, A; Bernard, D; Bonneaud, G R; Latour, E; Verderi, M; Clark, P J; Playfer, S; Watson, J E; Andreotti, M; Bettoni, D; Bozzi, C; Calabrese, R; Cecchi, A; Cibinetto, G; Franchini, P; Luppi, E; Negrini, M; Petrella, A; Piemontese, L; Santoro, V; Baldini-Ferroli, R; Calcaterra, A; de Sangro, R; Finocchiaro, G; Pacetti, S; Patteri, P; Peruzzi, I M; Piccolo, M; Rama, M; Zallo, A; Contri, R; Lo Vetere, M; Monge, M R; Passaggio, S; Patrignani, C; Robutti, E; Tosi, S; Chaisanguanthum, K S; Morii, M; Adametz, A; Marks, J; Schenk, S; Uwer, U; Bernlochner, F U; Klose, V; Lacker, H M; Bard, D J; Dauncey, P D; Tibbetts, M; Behera, P K; Chai, X; Charles, M J; Mallik, U; Cochran, J; Crawley, H B; Dong, L; Meyer, W T; Prell, S; Rosenberg, E I; Rubin, A E; Gao, Y Y; Gritsan, A V; Guo, Z J; Arnaud, N; Béquilleux, J; D'Orazio, A; Davier, M; Firmino da Costa, J; Grosdidier, G; Le Diberder, F; Lepeltier, V; Lutz, A M; Pruvot, S; Roudeau, P; Schune, M H; Serrano, J; Sordini, V; Stocchi, A; Wormser, G; Lange, D J; Wright, D M; Bingham, I; Burke, J P; Chavez, C A; Fry, J R; Gabathuler, E; Gamet, R; Hutchcroft, D E; Payne, D J; Touramanis, C; Bevan, A J; Clarke, C K; Di Lodovico, F; Sacco, R; Sigamani, M; Cowan, G; Paramesvaran, S; Wren, A C; Brown, D N; Davis, C L; Denig, A G; Fritsch, M; Gradl, W; Alwyn, K E; Bailey, D; Barlow, R J; Jackson, G; Lafferty, G D; West, T J; Yi, J I; Anderson, J; Chen, C; Jawahery, A; Roberts, D A; Simi, G; Tuggle, J M; Dallapiccola, C; Salvati, E; Saremi, S; Cowan, R; Dujmic, D; Fisher, P H; Henderson, S W; Sciolla, G; Spitznagel, M; Taylor, F; Yamamoto, R K; Zhao, M; Patel, P M; Robertson, S H; Lazzaro, A; Lombardo, V; Palombo, F; Bauer, J M; Cremaldi, L; Godang, R; Kroeger, R; Summers, D J; Zhao, H W; Simard, M; Taras, P; Nicholson, H; De Nardo, G; Lista, L; Monorchio, D; Onorato, G; Sciacca, C; Raven, G; Snoek, H L; Jessop, C P; Knoepfel, K J; Losecco, J M; Wang, W F; Corwin, L A; Honscheid, K; Kagan, H; Kass, R; Morris, J P; Rahimi, A M; Regensburger, J J; Sekula, S J; Wong, Q K; Blount, N L; Brau, J; Frey, R; Igonkina, O; Kolb, J A; Lu, M; Rahmat, R; Sinev, N B; Strom, D; Strube, J; Torrence, E; Castelli, G; Gagliardi, N; Margoni, M; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Voci, C; Del Amo Sanchez, P; Ben-Haim, E; Briand, H; Chauveau, J; Hamon, O; Leruste, Ph; Ocariz, J; Perez, A; Prendki, J; Sitt, S; Gladney, L; Biasini, M; Manoni, E; Angelini, C; Batignani, G; Bettarini, S; Calderini, G; Carpinelli, M; Cervelli, A; Forti, F; Giorgi, M A; Lusiani, A; Marchiori, G; Morganti, M; Neri, N; Paoloni, E; Rizzo, G; Walsh, J J; Lopes Pegna, D; Lu, C; Olsen, J; Smith, A J S; Telnov, A V; Anulli, F; Baracchini, E; Cavoto, G; Faccini, R; Ferrarotto, F; Ferroni, F; Gaspero, M; Jackson, P D; Li Gioi, L; Mazzoni, M A; Morganti, S; Piredda, G; Renga, F; Voena, C; Ebert, M; Hartmann, T; Schröder, H; Waldi, R; Adye, T; Franek, B; Olaiya, E O; Wilson, F F; Emery, S; Esteve, L; Hamel de Monchenault, G; Kozanecki, W; Vasseur, G; Yèche, Ch; Zito, M; Chen, X R; Liu, H; Park, W; Purohit, M V; White, R M; Wilson, J R; Allen, M T; Aston, D; Bartoldus, R; Benitez, J F; Cenci, R; Coleman, J P; Convery, M R; Dingfelder, J C; Dorfan, J; Dubois-Felsmann, G P; Dunwoodie, W; Field, R C; Gabareen, A M; Graham, M T; Grenier, P; Hast, C; Innes, W R; Kaminski, J; Kelsey, M H; Kim, H; Kim, P; Kocian, M L; Leith, D W G S; Li, S; Lindquist, B

    2009-10-16

    We have performed a search for the eta_{b}(1S) meson in the radiative decay of the Upsilon(2S) resonance using a sample of 91.6x10(6) Upsilon(2S) events recorded with the BABAR detector at the PEP-II B factory at the SLAC National Accelerator Laboratory. We observe a peak in the photon energy spectrum at Egamma=609.3(-4.5)(+4.6)(stat)+/-1.9(syst) MeV, corresponding to an eta(b)(1S) mass of 9394.2(-4.9)(+4.8)(stat)+/-2.0(syst) MeV/c2. The branching fraction for the decay Upsilon(2S)-->gamma(eta)b(1S) is determined to be [3.9+/-1.1(stat)-0.9+1.1(syst)]x10(-4). We find the ratio of branching fractions B[Upsilon(2S)-->gamma(eta)b(1S)]/B[Upsilon(3S)-->gamma(eta)b(1S)]=0.82+/-0.24(stat)(-0.19)(+0.20)(syst).

  18. Evidence for the ηb(1S) Meson in Radiative Υ(2S) Decay

    Science.gov (United States)

    Aubert, B.; Bona, M.; Karyotakis, Y.; Lees, J. P.; Poireau, V.; Prencipe, E.; Prudent, X.; Tisserand, V.; Garra Tico, J.; Grauges, E.; Lopez, L.; Palano, A.; Pappagallo, M.; Eigen, G.; Stugu, B.; Sun, L.; Battaglia, M.; Brown, D. N.; Kerth, L. T.; Kolomensky, Yu. G.; Lynch, G.; Osipenkov, I. L.; Tackmann, K.; Tanabe, T.; Hawkes, C. M.; Soni, N.; Watson, A. T.; Koch, H.; Schroeder, T.; Asgeirsson, D. J.; Fulsom, B. G.; Hearty, C.; Mattison, T. S.; McKenna, J. A.; Barrett, M.; Khan, A.; Randle-Conde, A.; Blinov, V. E.; Bukin, A. D.; Buzykaev, A. R.; Druzhinin, V. P.; Golubev, V. B.; Onuchin, A. P.; Serednyakov, S. I.; Skovpen, Yu. I.; Solodov, E. P.; Todyshev, K. Yu.; Bondioli, M.; Curry, S.; Eschrich, I.; Kirkby, D.; Lankford, A. J.; Lund, P.; Mandelkern, M.; Martin, E. C.; Stoker, D. P.; Abachi, S.; Buchanan, C.; Atmacan, H.; Gary, J. W.; Liu, F.; Long, O.; Vitug, G. M.; Yasin, Z.; Zhang, L.; Sharma, V.; Campagnari, C.; Hong, T. M.; Kovalskyi, D.; Mazur, M. A.; Richman, J. D.; Beck, T. W.; Eisner, A. M.; Heusch, C. A.; Kroseberg, J.; Lockman, W. S.; Martinez, A. J.; Schalk, T.; Schumm, B. A.; Seiden, A.; Winstrom, L. O.; Cheng, C. H.; Doll, D. A.; Echenard, B.; Fang, F.; Hitlin, D. G.; Narsky, I.; Piatenko, T.; Porter, F. C.; Andreassen, R.; Mancinelli, G.; Meadows, B. T.; Mishra, K.; Sokoloff, M. D.; Bloom, P. C.; Ford, W. T.; Gaz, A.; Hirschauer, J. F.; Nagel, M.; Nauenberg, U.; Smith, J. G.; Wagner, S. R.; Ayad, R.; Soffer, A.; Toki, W. H.; Wilson, R. J.; Feltresi, E.; Hauke, A.; Jasper, H.; Karbach, M.; Merkel, J.; Petzold, A.; Spaan, B.; Wacker, K.; Kobel, M. J.; Nogowski, R.; Schubert, K. R.; Schwierz, R.; Volk, A.; Bernard, D.; Bonneaud, G. R.; Latour, E.; Verderi, M.; Clark, P. J.; Playfer, S.; Watson, J. E.; Andreotti, M.; Bettoni, D.; Bozzi, C.; Calabrese, R.; Cecchi, A.; Cibinetto, G.; Franchini, P.; Luppi, E.; Negrini, M.; Petrella, A.; Piemontese, L.; Santoro, V.; Baldini-Ferroli, R.; Calcaterra, A.; de Sangro, R.; Finocchiaro, G.; Pacetti, S.; Patteri, P.; Peruzzi, I. M.; Piccolo, M.; Rama, M.; Zallo, A.; Contri, R.; Lo Vetere, M.; Monge, M. R.; Passaggio, S.; Patrignani, C.; Robutti, E.; Tosi, S.; Chaisanguanthum, K. S.; Morii, M.; Adametz, A.; Marks, J.; Schenk, S.; Uwer, U.; Bernlochner, F. U.; Klose, V.; Lacker, H. M.; Bard, D. J.; Dauncey, P. D.; Tibbetts, M.; Behera, P. K.; Chai, X.; Charles, M. J.; Mallik, U.; Cochran, J.; Crawley, H. B.; Dong, L.; Meyer, W. T.; Prell, S.; Rosenberg, E. I.; Rubin, A. E.; Gao, Y. Y.; Gritsan, A. V.; Guo, Z. J.; Arnaud, N.; Béquilleux, J.; D'Orazio, A.; Davier, M.; Firmino da Costa, J.; Grosdidier, G.; Le Diberder, F.; Lepeltier, V.; Lutz, A. M.; Pruvot, S.; Roudeau, P.; Schune, M. H.; Serrano, J.; Sordini, V.; Stocchi, A.; Wormser, G.; Lange, D. J.; Wright, D. M.; Bingham, I.; Burke, J. P.; Chavez, C. A.; Fry, J. R.; Gabathuler, E.; Gamet, R.; Hutchcroft, D. E.; Payne, D. J.; Touramanis, C.; Bevan, A. J.; Clarke, C. K.; di Lodovico, F.; Sacco, R.; Sigamani, M.; Cowan, G.; Paramesvaran, S.; Wren, A. C.; Brown, D. N.; Davis, C. L.; Denig, A. G.; Fritsch, M.; Gradl, W.; Alwyn, K. E.; Bailey, D.; Barlow, R. J.; Jackson, G.; Lafferty, G. D.; West, T. J.; Yi, J. I.; Anderson, J.; Chen, C.; Jawahery, A.; Roberts, D. A.; Simi, G.; Tuggle, J. M.; Dallapiccola, C.; Salvati, E.; Saremi, S.; Cowan, R.; Dujmic, D.; Fisher, P. H.; Henderson, S. W.; Sciolla, G.; Spitznagel, M.; Taylor, F.; Yamamoto, R. K.; Zhao, M.; Patel, P. M.; Robertson, S. H.; Lazzaro, A.; Lombardo, V.; Palombo, F.; Bauer, J. M.; Cremaldi, L.; Godang, R.; Kroeger, R.; Summers, D. J.; Zhao, H. W.; Simard, M.; Taras, P.; Nicholson, H.; de Nardo, G.; Lista, L.; Monorchio, D.; Onorato, G.; Sciacca, C.; Raven, G.; Snoek, H. L.; Jessop, C. P.; Knoepfel, K. J.; Losecco, J. M.; Wang, W. F.; Corwin, L. A.; Honscheid, K.; Kagan, H.; Kass, R.; Morris, J. P.; Rahimi, A. M.; Regensburger, J. J.; Sekula, S. J.; Wong, Q. K.; Blount, N. L.; Brau, J.; Frey, R.; Igonkina, O.; Kolb, J. A.; Lu, M.; Rahmat, R.; Sinev, N. B.; Strom, D.; Strube, J.; Torrence, E.; Castelli, G.; Gagliardi, N.; Margoni, M.; Morandin, M.; Posocco, M.; Rotondo, M.; Simonetto, F.; Stroili, R.; Voci, C.; Del Amo Sanchez, P.; Ben-Haim, E.; Briand, H.; Chauveau, J.; Hamon, O.; Leruste, Ph.; Ocariz, J.; Perez, A.; Prendki, J.; Sitt, S.; Gladney, L.; Biasini, M.; Manoni, E.; Angelini, C.; Batignani, G.; Bettarini, S.; Calderini, G.; Carpinelli, M.; Cervelli, A.; Forti, F.; Giorgi, M. A.; Lusiani, A.; Marchiori, G.; Morganti, M.; Neri, N.; Paoloni, E.; Rizzo, G.; Walsh, J. J.; Lopes Pegna, D.; Lu, C.; Olsen, J.; Smith, A. J. S.; Telnov, A. V.; Anulli, F.; Baracchini, E.; Cavoto, G.; Faccini, R.; Ferrarotto, F.; Ferroni, F.; Gaspero, M.; Jackson, P. D.; Li Gioi, L.; Mazzoni, M. A.; Morganti, S.; Piredda, G.; Renga, F.; Voena, C.; Ebert, M.

    2009-10-01

    We have performed a search for the ηb(1S) meson in the radiative decay of the Υ(2S) resonance using a sample of 91.6×106 Υ(2S) events recorded with the BABAR detector at the PEP-II B factory at the SLAC National Accelerator Laboratory. We observe a peak in the photon energy spectrum at Eγ=609.3-4.5+4.6(stat)±1.9(syst)MeV, corresponding to an ηb(1S) mass of 9394.2-4.9+4.8(stat)±2.0(syst)MeV/c2. The branching fraction for the decay Υ(2S)→γηb(1S) is determined to be [3.9±1.1(stat)-0.9+1.1(syst)]×10-4. We find the ratio of branching fractions B[Υ(2S)→γηb(1S)]/B[Υ(3S)→γηb(1S)]=0.82±0.24(stat)-0.19+0.20(syst).

  19. The aflatoxin B1 isolating potential of two lactic acid bacteria

    Institute of Scientific and Technical Information of China (English)

    Adel Hamidi; Reza Mirnejad; Emad Yahaghi; Vahid Behnod; Ali Mirhosseini; Sajad Amani; Sara Sattari; Ebrahim Khodaverdi Darian

    2013-01-01

    Objective:To determine lactic acid bacteria’s capability to enhance the process of binding and isolating aflatoxin B1 and to utilize such lactic acid bacteria as a food supplement or probiotic products for preventing absorption of aflatoxin B1 in human and animal bodies. Methods: In the present research, the bacteria were isolated from five different sources. For surveying the capability of the bacteria in isolating aflatoxin B1, ELISA method was implemented, and for identifying the resultant strains through 16S rRNA sequencing method, universal primers were applied. Results: Among the strains which were isolated, two strains of Lactobacillus pentosus and Lactobacillus beveris exhibited the capability of absorbing and isolating aflatoxin B1 by respectively absorbing and discharging 17.4%and 34.7%of the aforementioned toxin existing in the experiment solution. Conclusions:Strains of Lactobacillus pentosus and Lactobacillus beveris were isolated from human feces and local milk samples, respectively. And both strains has the ability to isolate or bind with aflatoxin B1.

  20. Herschel Observations of a Potential Core Forming Clump: Perseus B1-E

    CERN Document Server

    Sadavoy, S I; Andre, Ph; Pezzuto, S; Bernard, J -P; Bontemps, S; Bressert, E; Chitsazzadeh, S; Fallscheer, C; Hennemann, M; Hill, T; Martin, P; Motte, F; Luong, Q Nguyen; Peretto, N; Reid, M; Schneider, N; Testi, L; White, G J; Wilson, C

    2011-01-01

    We present continuum observations of the Perseus B1-E region from the Herschel Gould Belt Survey. These Herschel data reveal a loose grouping of substructures at 160 - 500 micron not seen in previous submillimetre observations. We measure temperature and column density from these data and select the nine densest and coolest substructures for follow-up spectral line observations with the Green Bank Telescope. We find that the B1-E clump has a mass of ~ 100 solar masses and appears to be gravitationally bound. Furthermore, of the nine substructures examined here, one substructure (B1-E2) appears to be itself bound. The substructures are typically less than a Jeans length from their nearest neighbour and thus, may interact on a timescale of ~ 1 Myr. We propose that B1-E may be forming a first generation of dense cores, which could provide important constraints on the initial conditions of prestellar core formation. Our results suggest that B1-E may be influenced by a strong, localized magnetic field, but further...

  1. Herschel observations of a potential core-forming clump: Perseus B1-E

    Science.gov (United States)

    Sadavoy, S. I.; di Francesco, J.; André, Ph.; Pezzuto, S.; Bernard, J.-P.; Bontemps, S.; Bressert, E.; Chitsazzadeh, S.; Fallscheer, C.; Hennemann, M.; Hill, T.; Martin, P.; Motte, F.; Nguyen Luong, Q.; Peretto, N.; Reid, M.; Schneider, N.; Testi, L.; White, G. J.; Wilson, C.

    2012-04-01

    We present continuum observations of the Perseus B1-E region from the Herschel Gould Belt Survey. These Herschel data reveal a loose grouping of substructures at 160-500 μm not seen in previous submillimetre observations. We measure temperature and column density from these data and select the nine densest and coolest substructures for follow-up spectral line observations with the Green Bank Telescope. We find that the B1-E clump has a mass of ~100 M⊙ and appears to be gravitationally bound. Furthermore, of the nine substructures examined here, one substructure (B1-E2) appears to be itself bound. The substructures are typically less than a Jeans length from their nearest neighbour and thus, may interact on a timescale of ~1 Myr. We propose that B1-E may be forming a first generation of dense cores, which could provide important constraints on the initial conditions of prestellar core formation. Our results suggest that B1-E may be influenced by a strong, localized magnetic field, but further observations are still required.

  2. The SH2B1 obesity locus and abnormal glucose homeostasis

    DEFF Research Database (Denmark)

    Prudente, S; Copetti, M; Morini, E;

    2013-01-01

    The development of type 2 diabetes (T2D) is influenced both by environmental and by genetic determinants. Obesity is an important risk factor for T2D, mostly mediated by obesity-related insulin resistance. Obesity and insulin resistance are also modulated by the genetic milieu; thus, genes...... affecting risk of obesity and insulin resistance might also modulate risk of T2D. Recently, 32 loci have been associated with body mass index (BMI) by genome-wide studies, including one locus on chromosome 16p11 containing the SH2B1 gene. Animal studies have suggested that SH2B1 is a physiological enhancer...... of the insulin receptor and humans with rare deletions or mutations at SH2B1 are obese with a disproportionately high insulin resistance. Thus, the role of SH2B1 in both obesity and insulin resistance makes it a strong candidate for T2D. However, published data on the role of SH2B1 variability on the risk for T2...

  3. Rapid pretreatment and detection of trace aflatoxin B1 in traditional soybean sauce.

    Science.gov (United States)

    Xie, Fang; Lai, WeiHua; Saini, Jasdeep; Shan, Shan; Cui, Xi; Liu, DaoFeng

    2014-05-01

    Soybean sauce, a traditional fermented food in China, has different levels of aflatoxin B1 pollution. Two kinds of direct and indirect immunomagnetic bead methods for the pretreatment of aflatoxin B1 were evaluated in this work. A method was established to detect aflatoxin B1 in soybean sauce using an immunomagnetic bead system for pretreatment and ELISA for quantification. The pretreatment method of immunomagnetic beads performed better compared with the conventional extraction and immunoaffinity column method. ELISA exhibited a good linear relationship at an aflatoxin B1 concentration of 0.05-0.3μg/kg (r(2)=0.9842). The average recoveries across spike levels varied from 0.5 to 7μg/kg were 83.6-104% with a relative standard deviation between 4.2% and 11.7%. With the advantages of rapid detection, easy operation, simple equipment, sensitivity, accuracy, and high recovery; this method can be well applied in the trace determination of aflatoxin B1 in soybean sauce samples. PMID:24360425

  4. The capsular polysaccharide Vi from Salmonella Typhi is a B1b antigen

    Science.gov (United States)

    Marshall, Jennifer L.; Flores-Langarica, Adriana; Kingsley, Robert A.; Hitchcock, Jessica R.; Ross, Ewan A.; Lopez-Macias, Constantino; Lakey, Jeremy; Martin, Laura B.; Toellner, Kai-Michael; MacLennan, Calman A.; MacLennan, Ian C; Henderson, Ian R.; Dougan, Gordon; Cunningham, Adam F.

    2012-01-01

    Vaccination with purified capsular polysaccharide Vi antigen from Salmonella Typhi can protect against typhoid fever, although the mechanism for its efficacy is not clearly established. Here, we have characterised the B cell response to this vaccine in wild-type and T cell-deficient mice. We show that immunization with Typhim Vi rapidly induces proliferation in B1b peritoneal cells, but not in B1a cells or marginal zone (MZ) B cells. This induction of B1b proliferation is concomitant with the detection of splenic Vi-specific antibody secreting cells and protective antibody and Rag1-deficient B1b cell chimeras generated by adoptive transfer induced specific antibody after Vi immunization. Furthermore, antibody derived from peritoneal B cells is sufficient to confer protection against Salmonella that express Vi antigen. Expression of Vi by Salmonella during infection did not inhibit the development of early antibody responses to non-Vi antigens. Despite this, the protection conferred by immunization of mice with porin proteins from Salmonella, which induce antibody-mediated protection, was reduced after infection with Vi-expressing Salmonella, although protection was not totally abrogated. This work therefore suggests that in mice, B1b cells contribute to the protection induced by Vi antigen and targeting non-Vi antigens as sub-unit vaccines may offer an attractive strategy to augment current Vi-based vaccine strategies. PMID:23162127

  5. The capsular polysaccharide Vi from Salmonella typhi is a B1b antigen.

    Science.gov (United States)

    Marshall, Jennifer L; Flores-Langarica, Adriana; Kingsley, Robert A; Hitchcock, Jessica R; Ross, Ewan A; López-Macías, Constantino; Lakey, Jeremy; Martin, Laura B; Toellner, Kai-Michael; MacLennan, Calman A; MacLennan, Ian C; Henderson, Ian R; Dougan, Gordon; Cunningham, Adam F

    2012-12-15

    Vaccination with purified capsular polysaccharide Vi Ag from Salmonella typhi can protect against typhoid fever, although the mechanism for its efficacy is not clearly established. In this study, we have characterized the B cell response to this vaccine in wild-type and T cell-deficient mice. We show that immunization with typhoid Vi polysaccharide vaccine rapidly induces proliferation in B1b peritoneal cells, but not in B1a cells or marginal zone B cells. This induction of B1b proliferation is concomitant with the detection of splenic Vi-specific Ab-secreting cells and protective Ab in Rag1-deficient B1b cell chimeras generated by adoptive transfer-induced specific Ab after Vi immunization. Furthermore, Ab derived from peritoneal B cells is sufficient to confer protection against Salmonella that express Vi Ag. Expression of Vi by Salmonella during infection did not inhibit the development of early Ab responses to non-Vi Ags. Despite this, the protection conferred by immunization of mice with porin proteins from Salmonella, which induce Ab-mediated protection, was reduced postinfection with Vi-expressing Salmonella, although protection was not totally abrogated. This work therefore suggests that, in mice, B1b cells contribute to the protection induced by Vi Ag, and targeting non-Vi Ags as subunit vaccines may offer an attractive strategy to augment current Vi-based vaccine strategies.

  6. The Invalidation of HspB1 Gene in Mouse Alters the Ultrastructural Phenotype of Muscles.

    Science.gov (United States)

    Kammoun, Malek; Picard, Brigitte; Astruc, Thierry; Gagaoua, Mohammed; Aubert, Denise; Bonnet, Muriel; Blanquet, Véronique; Cassar-Malek, Isabelle

    2016-01-01

    Even though abundance of Hsp27 is the highest in skeletal muscle, the relationships between the expression of HspB1 (encoding Hsp27) and muscle characteristics are not fully understood. In this study, we have analysed the effect of Hsp27 inactivation on mouse development and phenotype. We generated a mouse strain devoid of Hsp27 protein by homologous recombination of the HspB1 gene. The HspB1-/- mouse was viable and fertile, showing neither apparent morphological nor anatomical alterations. We detected a gender dimorphism with marked effects in males, a lower body weight (P optical microscopy and transmission electron microscopy. Not any differences in the characteristics of muscle fibres (contractile and metabolic type, shape, perimeter, cross-sectional area) were detected except a trend for a higher proportion of small fibres. Different myosin heavy chains electrophoretic profiles were observed in the HspB1-/- mouse especially the presence of an additional isoform. Electron microscopy revealed ultrastructural abnormalities in the myofibrillar structure of the HspB1-/- mouse mutant mice (e.g. destructured myofibrils and higher gaps between myofibrils) especially in the m. Soleus. Combined with our previous data, these findings suggest that Hsp27 could directly impact the organization of muscle cytoskeleton at the molecular and ultrastructural levels. PMID:27512988

  7. Temperature dependent expression of cdc2 and cyclin B1 in spermatogenic cells during spermatogenesis

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    p34cdc2 and Cyclin Bi are key components of cell cycle controlling machine and are believed to play a fundamental role in gametogenesis. It is also well known that, in scrotal mammals, spermatogenesis depends greatly on the maintenance of comparatively low temperature in the scrotum. To investigate whether the expression of cdc2 and cyclin B1 in spermatogenic cells during spermatogenesis is actually a temperature dependent event, in situ hybridization, Western blotting and immunohistochemistry analysis were used to study the expression of cdc2 and cyclin B1 in normal and cryptorchid testis. Results showed that the abdominal temperature had no significant influence on the transcription of cdc2 and cyclin B1 in the spermatogonia and pachytene/diplotene primary spermatocytes, but it blocked the translation of them. Due to the deficiency of p34cdc2 and Cyclin B1, the spermatogonia and pachytene/diplotene primary spermatocytes were unable to form MPF, hence, they couldn't undergo karyokinesis. The development of primary spermato cytes was arrested at the G2 to M phase transition. We also found that testosterone could regulate the Cyclin B1 expression in spermatogenic cells. Muscular injection of testosterone could recover spermatogenesis in the unilateral scrotal testis which was influenced by the contralateral cryptorchid testis, but it could not salvage the spermatogenesis block in the cryptorchid testis.

  8. STS-113 Mission Specialist Michael Lopez-Alegria looks over the P1 Truss

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- STS-113 Mission Specialist Michael Lopez-Alegria looks over the P1 Integrated Truss Structure, the primary payload for the mission. The P1 truss will be attached to the central truss segment, S0 Truss, during spacewalks. The payload also includes the Crew and Equipment Translation Aid (CETA) Cart B that can be used by spacewalkers to move along the truss with equipment. STS-113 is scheduled to launch Oct. 6, 2002.

  9. STS-113 Mission Specialists review data on the P1 Truss

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- STS-113 Mission Specialists John Herrington (left) and Michael Lopez-Alegria (right) look over the P1 Integrated Truss Structure, the primary payload for the mission. The P1 truss will be attached to the central truss segment, S0 Truss, during spacewalks. The payload also includes the Crew and Equipment Translation Aid (CETA) Cart B that can be used by spacewalkers to move along the truss with equipment. STS-113 is scheduled to launch Oct. 6, 2002

  10. Identification of benzoxazole analogs as novel, S1P(3) sparing S1P(1) agonists.

    Science.gov (United States)

    Deng, Guanghui; Meng, Qinghua; Liu, Qian; Xu, Xuesong; Xu, Qiongfeng; Ren, Feng; Guo, Taylor B; Lu, Hongtao; Xiang, Jia-Ning; Elliott, John D; Lin, Xichen

    2012-06-15

    A novel series of benzoxazole-derived S1P(1) agonists were designed based on scaffold hopping molecular design strategy combined with computational approaches. Extensive SAR studies led to the discovery of compound 17d as a selective S1P(1) agonist (over S1P(3)) with high CNS penetration and favorable DMPK properties. 17d also demonstrated in vivo pharmacological efficacy to reduce blood lymphocyte in mice after oral administration.

  11. Participation of the lytic replicon in bacteriophage P1 plasmid maintenance.

    OpenAIRE

    Yarmolinsky, M B; Hansen, E B; Jafri, S; Chattoraj, D K

    1989-01-01

    P1 bacteriophage carries at least two replicons: a plasmid replicon and a viral lytic replicon. Since the isolated plasmid replicon can maintain itself stably at the low copy number characteristic of intact P1 prophage, it has been assumed that this replicon is responsible for driving prophage replication. We provide evidence that when replication from the plasmid replicon is prevented, prophage replication continues, albeit at a reduced rate. The residual plasmid replication is due to incomp...

  12. Detection of Mycoplasma pneumoniae adhesin (P1) in the nonhemadsorbing population of virulent Mycoplasma pneumoniae.

    OpenAIRE

    Kahane, I; Tucker, S.; Baseman, J B

    1985-01-01

    Mycoplasma pneumoniae organisms possessing a hemadsorbing-negative (HA-) phenotype comprise more than 50% of the population of virulent M. pneumoniae cultures. Monoclonal antibody to P1, the major adhesin of M. pneumoniae reacts with this HA- mycoplasma fraction based upon radioimmunoprecipitation and immunoblotting. Demonstration of P1 in the entire mycoplasma population suggests that topological organization of this adhesin in the membrane or the physiological state of the mycoplasmas may d...

  13. Burnout calculation

    International Nuclear Information System (INIS)

    Reviewed is the effect of heat flux of different system parameters on critical density in order to give an initial view on the value of several parameters. A thorough analysis of different equations is carried out to calculate burnout is steam-water flows in uniformly heated tubes, annular, and rectangular channels and rod bundles. Effect of heat flux density distribution and flux twisting on burnout and storage determination according to burnout are commended

  14. Identification of a hemerythrin-like domain in a P1B-type transport ATPase†

    Science.gov (United States)

    Traverso, Matthew E.; Subramanian, Poorna; Davydov, Roman; Hoffman, Brian M.; Stemmler, Timothy L.; Rosenzweig, Amy C.

    2010-01-01

    The P1B-type ATPases couple the energy of ATP hydrolysis to metal ion translocation across cell membranes. Important for prokaryotic metal resistance and essential metal distribution in eukaryotes, P1B-ATPases are divided into subclasses on the basis of their metal substrate specificities. Sequence analysis of putative P1B-5-ATPases, for which the substrate has not been identified, led to the discovery of a C-terminal soluble domain homologous to hemerythrin (Hr) proteins and domains. The Hr domain from the Acidothermus cellulolyticus P1B-5-ATPase was cloned, expressed, and purified (P1B-5-Hr). P1B-5-Hr binds two iron ions per monomer and adopts a predominantly helical fold. Optical absorption features of the iron-loaded and azide-treated protein are consistent with features observed for other Hr proteins. Autooxidation to the met form is very rapid, as reported for other prokaryotic Hr domains. The presence of a diiron center was confirmed by electron paramagnetic resonance (EPR) and X-ray absorption spectroscopic (XAS) data. The occurrence of a Hr-like domain in a P-type ATPase is unprecedented and suggests new regulatory mechanisms as well as an expanded function for Hr proteins in biology. PMID:20672819

  15. Emergence of a new satellite RNA from cucumber mosaic virus isolate P1

    Institute of Scientific and Technical Information of China (English)

    SandraPérezAlvarez; 薛朝阳; 周雪平

    2003-01-01

    The cucumber mosaic virus (CMV) isolate P1 caused very mild symptoms on many plant species.After serial passages by mechanical inoculation over five years, CMV P1 caused severe symptoms on several tobacco cultivars and tomato. A specific band of approximately 0.3 kb in length was amplified by RT-PCR with primers synthesized based on reported CMV satellite RNA (satRNA) sequences. Sequence analysis showed there were two satRNAs (Sat-Pl-1 and Sat-P1-2). Sat-Pl-1 contained 335 nucleotides, and Sat-P1-2 contained 394 nucleotides. These two satRNAs shared 64% overall nucleotide sequence homology, and differences between the two satRNAs included mutations as well as deletions. Sat-Pl-1 was identical to a satRNA (Z96099) reported in 1995 in CMV P1. Based on differences in the sequence and secondary structure between these two satRNAs, we conclude that Sat-P1-2 represents the emergence of a new satellite ( necrotic satellite) from attenuated satRNA populations. The possible effect of the emergence of this new satRNA is discussed.

  16. Intramuscular electroporation of a P1A-encoding plasmid vaccine delays P815 mastocytoma growth.

    Science.gov (United States)

    Vandermeulen, Gaëlle; Uyttenhove, Catherine; De Plaen, Etienne; Van den Eynde, Benoît J; Préat, Véronique

    2014-12-01

    This study aimed to construct DNA vaccines encoding the mouse P1A tumor antigen and to generate a protective immune response against the P815 mastocytoma, as a model for vaccines against human MAGE-type tumor antigens. DNA vaccines were constructed and delivered to mice by intramuscular electroporation before tumor challenge. Immunization with a plasmid coding for the full-length P1A significantly delayed tumor growth and mice survived at least 10 days longer than untreated controls. 10% of the mice completely rejected the P815 tumors while 50% of them showed a regression phase followed by tumor regrowth. Mice immunized by electroporation of a P1A(35-43) minigene-encoding plasmid failed to reject tumor and even delay tumor growth. The P1A(35-43)-encoding plasmid was modified and helper epitope sequences were inserted. However, these modified plasmids were not able to improve the response against P815 mastocytoma. Consistent with these results, a 12-fold higher CTL activity was observed when the plasmid coding for full-length P1A was delivered as compared to the plasmid encoding the P1A(35-43) epitope. Our results demonstrated that electroporation is an efficient method to deliver DNA vaccines against P815 and suggested the superiority of full-length as compared to minigene constructs for DNA vaccines.

  17. The GABAB1a isoform mediates heterosynaptic depression at hippocampal mossy fiber synapses

    DEFF Research Database (Denmark)

    Guetg, Nicole; Seddik, Riad; Vigot, Réjan;

    2009-01-01

    GABA(B) receptor subtypes are based on the subunit isoforms GABA(B1a) and GABA(B1b), which associate with GABA(B2) subunits to form pharmacologically indistinguishable GABA(B(1a,2)) and GABA(B(1b,2)) receptors. Studies with mice selectively expressing GABA(B1a) or GABA(B1b) subunits revealed...... baclofen. Here, we used a combination of genetic, ultrastructural and electrophysiological approaches to analyze to what extent GABA(B(1a,2)) and GABA(B(1b,2)) receptors inhibit glutamate release in response to physiological activation. We first show that at hippocampal mossy fiber (MF)-CA3 pyramidal...

  18. High-precision spectroscopy of the forbidden 2 3S1 - 2 1P1 transition in quantum degenerate metastable helium

    CERN Document Server

    Notermans, Remy

    2014-01-01

    We have measured the forbidden 2 3S1 - 2 1P1 transition at 887 nm in a quantum degenerate gas of metastable He-4 atoms confined in an optical dipole trap. The determined transition frequency is 338 133 594.4 (0.5) MHz, from which we obtain an ionization energy of the 2 1P1 state of 814 709 148.6 (0.5) MHz. This ionization energy is in disagreement by > 3 sigma with the most accurate quantum electrodynamics (QED) calculations available. Our measurements also provide a new determination of the lifetime of the 2 1P1 state of 0.551 (0.004)stat (+ 0.013,- 0.000)syst ns, which is the most accurate determination to date and in excellent agreement with theory.

  19. Extraction of aflatoxin B1 by ultrasonic radiation%应用超声波法提取大米中黄曲霉毒素B1

    Institute of Scientific and Technical Information of China (English)

    孙秀兰; 张银志

    2007-01-01

    目的:建立一种超声波快速提取大米中黄曲霉毒素B1的方法,并对提取方法的回收率和准确度进行评价.方法:采用ELISA方法,研究和评价了超声波提取大米中黄曲霉素B1的提取效率.结果:与普通振荡处理相比,采用超声波处理明显增大了提取效率,缩短了提取时间,超声波处理10 min时达到最大提取率,振荡处理30 min才能达到,而且超声波最大提取浓度比振荡处理提高了30.5%.在针对0.1、1和10μg/kg这3个浓度水平做加标回收试验,回收率达到83.0%~95.2%,比振荡处理提高10%左右.结论:超声频率20 KHz,时间为10 min,为提取黄曲霉毒素B1的最佳条件,而且不同超声频率对结果产生的影响不显著.

  20. Studies on Non-potentiometric Piezoelectric Sensor System for Determination of Vitamin B1

    Institute of Scientific and Technical Information of China (English)

    YUAN Jin-bin; NIE Li-hua; YAO Shou-zhuo

    2003-01-01

    A piezoelectric sensor responsive to vitamin B1 was fabricated based on the vitamin B1-tetraphenylborate ion pair. The general performance characteristics of the sensor are presented here. The proposed sensor showed a wide working pH range, a good sensitivity and selectivity. The response range is between 1.0×10-7-4.9×10-5 mol/L with a detection limit of 8×10-8 mol/L at pH 4.0. The selectivity should be attributed to the preferential adsorption of the component ion on the membrane/solution interface. The adsorption behavior of vitamin B1 on the crystal surface was investigated with a quartz crystal impedance(QCI) system.

  1. L1157-B1: Water and ammonia as diagnostics of shock temperature

    CERN Document Server

    Viti, S; Yates, J A; Codella, C; Vasta, M; Caselli, P; Lefloch, B; Ceccarelli, C

    2011-01-01

    We investigate the origin and nature of the profiles of water and ammonia observ ed toward the L1157-B1 clump as part of the HIFI CHESS survey (Ceccarelli et al. 2010) using a new code coupling a gas-grain chemical model with a parametric shock model. Fir st results from the unbiased survey (Lefloch et al. 2010, Codella et al. 2010) reveal different molecular components at different excitation conditions coexisting in the B1 bow shock structure, with NH$_3$, H$_2$CO and CH$_3$OH emitting only at relatively low outflow velocities whereas H$_2$O shows bright emission at high velocities. Our model suggests that these differences are purely chemical and can be explained by the presence of a C-type shock whose maximum temperature must be close to 4000 K along the B1 clump.

  2. Inhibition effects of Chinese cabbage powder on aflatoxin B1-induced liver cancer.

    Science.gov (United States)

    Wang, Tuoyi; Li, Chunyan; Liu, Yang; Li, Tiezhu; Zhang, Jie; Sun, Yonghai

    2015-11-01

    In this study, 0.25 μg/ml aflatoxin B1 was used to establish a liver cancer model for assessing the potential anticancer ability of Chinese cabbage powder, which is a complex water-soluble extract from Chinese cabbage by spray-drying at an outlet temperature of 130 °C. We found at least 11 potential anticancer substances in Chinese cabbage powder. A 90-d animal experiment demonstrated that 10% of Chinese cabbage powder in drinking water could improve the plasma micronutrient status, inhibit the formation of aflatoxin B1-DNA adducts in liver cells, and effectively reduce the incidence of liver tumor induced by aflatoxin B1 from 6.67% to 0%. The dose effect experiment revealed that 10% may be the minimal effective dose to prevent the occurrence of early liver tumors. This study will help elucidate the basis of epidemiological observations of dietary cancer prevention in humans, as well as explore related mechanisms.

  3. Oligomerization of Vibrio cholerae Hemolysin Induces CXCR3 Upregulation and Activation of B-1a Cell

    Institute of Scientific and Technical Information of China (English)

    Gayatri Mukherjee; Kalyan K Banerjee; Tapas Biswas

    2008-01-01

    The hemolysin oligomer promotes the proliferation of B-1a cells and the expression of CD25, which is indicative of cell activation, on B-1a cells. The upregulation of CD86 induced by the oligomer showed its selective bias for the B7-2 member of B7 family while the monomer failed to induce these effects. The oligomer induced the expression of CXCR3, associated with B cell activation, while the monomer induced the expression of CXCL4, a powerful angiostatic chemokine. In conclusion, we found that B-1a cells responded to the apoptogenic monomer by expressing CXCL4, whereas oligomerization of the immunogen induced CXCR3 to shift the response towards activation. Cellular & Molecular Immunology. 2008;5(3):231-234.

  4. L1157-B1: WATER AND AMMONIA AS DIAGNOSTICS OF SHOCK TEMPERATURE

    International Nuclear Information System (INIS)

    We investigate the origin and nature of the profiles of water and ammonia observed toward the L1157-B1 clump as part of the HIFI CHESS survey using a new code coupling a gas-grain chemical model with a parametric shock model. First results from the unbiased survey reveal different molecular components at different excitation conditions coexisting in the B1 bow shock structure, with NH3, H2CO, and CH3OH emitting only at relatively low outflow velocities whereas H2O shows bright emission at high velocities. Our model suggests that these differences are purely chemical and can be explained by the presence of a C-type shock whose maximum temperature must be close to 4000 K along the B1 clump.

  5. Intrinsic fluorescence spectra characteristics of vitamin B1, B2, and B6

    Science.gov (United States)

    Yang, Hui; Xiao, Xue; Zhao, Xuesong; Hu, Lan; Lv, Caofang; Yin, Zhangkun

    2015-11-01

    This paper presents the intrinsic fluorescence characteristics of vitamin B1, B2 and B6 measured with 3D fluorescence Spectrophotometer. Three strong fluorescence areas of vitamin B2 locate at λex/λem=270/525nm, 370/525nm and 450/525nm, one fluorescence areas of vitamin B1 locates at λex/λem=370/460nm, two fluorescence areas of vitamin B6 locates at λex/λem=250/370nm and 325/370nm were found. The influence of pH of solution to the fluorescence profile was also discussed. Using the PARAFAC algorithm, 10 vitamin B1, B2 and B6 mixed solutions were successfully decomposed, and the emission profiles, excitation profiles, central wavelengths and the concentration of the three components were retrieved precisely through about 5 iteration times.

  6. Extracellular roles of high-mobility-group B1%高迁移率族蛋白B1的细胞核外作用

    Institute of Scientific and Technical Information of China (English)

    王忠堂; 姚咏明; 盛志勇

    2004-01-01

    High-mobility-group B1 (HMGB1), an abundant, highly conserved cellular protein, is widely known as a nuclear DNA - binding protein that stabilizes nucleosome formation, and facilitates gene transcription. Recent studies suggested that HMGBI could be overexpressed and released from cellular nucleosome upon endotoxin and cytokine stimulation, or other stress challenge including bums, shock, as well as infection.Therefore, extracellular HMGB1 might be involved in the pathogenesis of sepsis and subsequent multiple organ dysfunction syndrome. Moreover, experimental data showedextracellular HMGB1 might play vital roles in nerves development, tumor metastasis, atherosclerosis and restenosis after vascular damage.

  7. Secondary side cracking at Saint-Laurent unit B1: investigations, operating chemistry and corrosion tests

    International Nuclear Information System (INIS)

    Among the similar steam generators (SG) in EDF plants (equipped with mill annealed Alloy 600, drilled tube-support plates TSP), one of the SG of SAINT-LAURENT B1 was found particularly affected by cracking at TSP level. Eddy current indications lead to pull one tube after 30 000 h of operation: investigations revealed that corrosion was involved. In 1991, after 58 000 h, numerous indications with axial probe were beyond the recording threshold. A few heats were concerned, the examination of 11 pulled tubes evidenced an important axial intergranular stress corrosion cracking (IGSCC), with bands of intergranular attack (IGA) in front of the edge of TSPs. This investigation has qualified a new probe (STL 10). A new plugging criterion was also defined. In the same time, the results from hideout return tests and the operating chemistry were examined. They did not provide a satisfactory explanation of the observed damage. The degradations have affected only one out of three SG and the pH-calculations using MULTEQ code have shown that the environment in restricted-flow areas has not always been strongly alkaline (pH270: 5.7 to 10.2). Moreover, pH-values were decreasing after successive hideout return shutdowns. Corrosion tests were then performed in laboratory conditions (sodium hydroxide, 350 deg C) in order to study the sensitivity of the pulled tubes. They demonstrated the greatest sensitivity to cracking of these tubes, among various mill-annealed tubes in Alloy 600. The worst behaviour in caustic environment of SAINT-LAURENT tubes is apparently not connected with their metallurgical structure; moreover, they are not sensitized (no intergranular chromium depletion). The sensitivity in caustic environment seems to be in accordance with a low value of the yield stress. Studies are still in progress in order to examine if it is the right explanation for the sensitivity of Saint-Laurent tubes (the composition at the grain boundaries is also investigated...). The knowledge

  8. Identification of a novel antagonist of the ErbB1 receptor capable of inhibiting migration of human glioblastoma cells

    DEFF Research Database (Denmark)

    Staberg, Mikkel; Riemer, Christian; Xu, Ruodan;

    2013-01-01

    processing. RESULTS: The present study shows that Herfin-1 functions as an ErbB1 antagonist. It binds to the extracellular domain of ErbB1 with a KD value of 361 nM. In U87 and U118 cells, both expressing high levels of ErbB1, Herfin-1 inhibits EGF-induced ErbB1 phosphorylation and cell migration...

  9. Moulds identification and detection of aflatoxin B1 on commercial codiments fermented of shrimp

    Directory of Open Access Journals (Sweden)

    NOOR SOESANTI HANDAJANI

    2006-07-01

    Full Text Available Indonesian tropical climate have an opportunity for fungi growth as Aspergillus flavus Link which can produce aflatoxin within foodstuffs, include condiment of fermented shrimp. Aflatoxin B1 is the dangerous agent having roles as carcinogenic, mutagenic and teratogenic. The aims of this research were known kinds of moulds and detection of aflatoxin B1 on commercial condiments fermented of shrimp. Two brands of commercial condiments fermented of shrimp were taken from traditional markets and supermarkets in Surakarta. Isolation was done by made suspension of sample in aquadets. Suspension on appropriate dilutions was grown on CDA (Czapek’s Dox Agar media with surface spread. The grown colonies were separated and grown on PDA (Potato Dextrose Agar slant media. Furthermore, isolates were cultured on CDA and MEA (Malt Extract Agar media. The grown colonies were microscopes and microscopes examined and identified. Existence of aflatoxin B1 was known by Commercial RIDA Screen ELISA Kit that could detect qualitatively and quantitatively with detection sensitive < 1.7 ppb. Moulds that could be isolated from condiments fermented of shrimp were: Aspergillus flavus Link, Aspergillus niger van Tieghem, Aspergillus wentii Wehmer, Aspergillus PU1 or Aspergillus PU2 and Penicillium citrinum Thom. There was aflatoxin B1 contaminated to 2 brands of commercial condiments fermented of shrimp that were examined. Traditional markets’ commercial condiments fermented of shrimp contained higher aflatoxin B1 than supermarkets’. The brands of commercial condiment of fermented shrimp which had better inner package quality contained lower aflatoxin B1 than the worst inner package quality of commercial condiments of fermented of shrimp.

  10. The induction of neoplastic lesions by aflatoxin-B1 in the Egyptian toad (Bufo regularis).

    Science.gov (United States)

    el-Mofty, M M; Sakr, S A

    1988-01-01

    The carcinogenic activity of aflatoxin-B1, the metabolic product of the mold Aspergillus flavus (a commonly occurring contaminant of groundnuts and other foodstuffs), was tested using the Egyptian toad (Bufo regularis). Injecting the toads with aflatoxin-B1 at a dose level of 0.01 mg/50 g body wt in 1 ml corn oil once a week for 15 weeks induced hepatocellular carcinomas in 19% of the experimental toads. Four toads developed tumors in the kidney due to metastases from the primary hepatocellular carcinomas.

  11. Microwave assisted convenient synthesis of quino[2,3-b][1,5]benzoxazepines

    Institute of Scientific and Technical Information of China (English)

    Swapnil S.Sonar; Sandip A.Sadaphal; Shivaji S.Pawar; Bapurao B.Shingate; Murlidhar S.Shingare

    2009-01-01

    A convenient synthesis of quino[2,3-b][1,5]benzoxazepines from substituted 2-chloroquinoline-3-carbaldehyde and 2-hydroxy-aniline by using stable,non-toxic and inexpensive catalyst 1,8-diazabicyclo-undecan-7-ene (DBU)/silica gel is described.This method affords the quino[2,3-b][1,5]benzoxazepines under the influence of microwave irradiation (360 W) in solvent-free conditions within short reaction times (2-3 min),giving high yields of products (93-96%).

  12. Kinin B1 receptors contributes to acute pain following minor surgery in humans

    Directory of Open Access Journals (Sweden)

    Brahim Jaime S

    2010-02-01

    Full Text Available Abstract Background Kinins play an important role in regulation of pain and hyperalgesia after tissue injury and inflammation by activating two types of G-protein-coupled receptors, the kinin B1 and B2 receptors. It is generally accepted that the B2 receptor is constitutively expressed, whereas the B1 receptor is induced in response to inflammation. However, little is known about the regulatory effects of kinin receptors on the onset of acute inflammation and inflammatory pain in humans. The present study investigated the changes in gene expression of kinin receptors and the levels of their endogenous ligands at an early time point following tissue injury and their relation to clinical pain, as well as the effect of COX-inhibition on their expression levels. Results Tissue injury resulted in a significant up-regulation in the gene expression of B1 and B2 receptors at 3 hours post-surgery, the onset of acute inflammatory pain. Interestingly, the up-regulation in the gene expression of B1 and B2 receptors was positively correlated to pain intensity only after ketorolac treatment, signifying an interaction between prostaglandins and kinins in the inflammatory pain process. Further, the gene expression of both B1 and B2 receptors were correlated. Following tissue injury, B1 ligands des-Arg9-BK and des-Arg10-KD were significantly lower at the third hour compared to the first 2 hours in both the placebo and the ketorolac treatment groups but did not differ significantly between groups. Tissue injury also resulted in the down-regulation of TRPV1 gene expression at 3 hours post-surgery with no significant effect by ketorolac treatment. Interestingly, the change in gene expression of TRPV1 was correlated to the change in gene expression of B1 receptor but not B2 receptor. Conclusions These results provide evidence at the transcriptional level in a clinical model of tissue injury that up-regulation of kinin receptors are involved in the development of the

  13. Sampling and Analysis Instruction for Borehole Sampling at 118-B-1 Burial Ground

    Energy Technology Data Exchange (ETDEWEB)

    W. S. Thompson

    2007-04-02

    The Washington Closure Hanford (WCH) Field Remediation Project has removed all of the disposed materials and contaminated soil from the 118-B-1 Burial Ground with the exception of tritium-contaminated soil that is believed to extend from the bottom of the present excavation to groundwater and is believed to contribute to tritium contamination observed at down-gradient monitoring Well 199-B8-6. This sampling and analysis instruction (SAI) provides the requirements for sample collection and laboratory analysis for characterization of the vertical distribution of tritium contamination in the vadose zone soil below the 118-B-1 Burial Ground remedial action excavation.

  14. Biotechnological Fluorescent Ligands of the Bradykinin B1 Receptor: Protein Ligands for a Peptide Receptor.

    Directory of Open Access Journals (Sweden)

    Xavier Charest-Morin

    Full Text Available The bradykinin (BK B1 receptor (B1R is a peculiar G protein coupled receptor that is strongly regulated to the point of being inducible in immunopathology. Limited clinical evidence suggests that its expression in peripheral blood mononuclear cells is a biomarker of active inflammatory states. In an effort to develop a novel imaging/diagnostic tool, we report the rational design and testing of a fusion protein that is a ligand of the human B1R but not likely to label peptidases. This ligand is composed of a fluorescent protein (FP (enhanced green FP [EGFP] or mCherry prolonged at its N-terminus by a spacer peptide and a classical peptide agonist or antagonist (des-Arg9-BK, [Leu8]des-Arg9-BK, respectively. The design of the spacer-ligand joint peptide was validated by a competition assay for [3H]Lys-des-Arg9-BK binding to the human B1R applied to 4 synthetic peptides of 18 or 19 residues. The labeling of B1R-expressing cells with EGFP or mCherry fused with 7 of such peptides was performed in parallel (microscopy. Both assays indicated that the best design was FP-(Asn-Glyn-Lys-des-Arg9-BK; n = 15 was superior to n = 5, suggesting benefits from minimizing steric hindrance between the FP and the receptor. Cell labeling concerned mostly plasma membranes and was inhibited by a B1R antagonist. EGFP-(Asn-Gly15-Lys-des-Arg9-BK competed for the binding of [3H]Lys-des-Arg9-BK to human recombinant B1R, being only 10-fold less potent than the unlabeled form of Lys-des-Arg9-BK to do so. The fusion protein did not label HEK 293a cells expressing recombinant human BK B2 receptors or angiotensin converting enzyme. This study identifies a modular C-terminal sequence that can be adapted to protein cargoes, conferring high affinity for the BK B1R, with possible applications in diagnostic cytofluorometry, histology and drug delivery (e.g., in oncology.

  15. 26 CFR 301.6103(p)(2)(B)-1 - Disclosure of returns and return information by other agencies.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Disclosure of returns and return information by other agencies. 301.6103(p)(2)(B)-1 Section 301.6103(p)(2)(B)-1 Internal Revenue INTERNAL REVENUE... Information and Returns Returns and Records § 301.6103(p)(2)(B)-1 Disclosure of returns and return...

  16. 26 CFR 301.6222(b)-1 - Notification to the Internal Revenue Service when partnership items are treated inconsistently.

    Science.gov (United States)

    2010-04-01

    ..., see § 301.6222(b)-1T contained in 26 CFR part 1, revised April 1, 2001. ... when partnership items are treated inconsistently. 301.6222(b)-1 Section 301.6222(b)-1 Internal Revenue... partnership items are treated inconsistently. (a) In general. The statement identifying an...

  17. A novel porcine circovirus-like agent P1 is associated with wasting syndromes in pigs.

    Directory of Open Access Journals (Sweden)

    Libin Wen

    Full Text Available A novel porcine pathogen tentatively named P1, which was obtained from the sera of the pigs exhibiting clinical signs of postweaning multisystemic wasting syndrome (PMWS experimentally caused the classical clinic signs and pathologic lesions of the disease in pigs by direct in vivo injection with P1 DNA plasmids. Twenty colostrum-fed (CF pigs that were free of PCV2 and P1 at 1 month of age were randomly designated equally to two groups. Group 1 pigs were each injected with 400 µg of the cloned P1 plasmid DNA into the superficial inguinal lymph nodes and Group 2 were injected with same amount of the empty pSK vector DNA and served as controls. Viremias were positively detected in 8 of 10 P1 infected pigs from 14-21 days post-inoculation (dpi. The 8 infected animals showed pallor of skin and diarrhea. Gross lesions in the pigs euthanized on 35 dpi were similarly characterized by encephalemia, haemorrhage of the bladder mucosa, haemorrhage of the superficial inguinal lymph nodes, lung atrophy and haemorrhage. Histopathological lesions were arteriectasis and telangiectasia of the cavitas subarachnoidealis, interstitial pneumonia, mild atrophy of the cardiac muscle cells, histiocytic hyperplasia of the follicles in the tonsils, and haemorrhage of the inguinal lymph nodes. P1 DNA and antigens were confirmed by PCR and immunohistochemistry in the tissues and organs of the infected pigs, including the pancreas, bladders, testicles/ovaries, brains, lungs and liver. There were no obvious clinical signs and pathological lesions in the control pigs. This study demonstrated that P1 infection is one of the important pathologic agents on pig farms.

  18. Measurement of the scalar polarizability of the indium $6p_{1/2}$ state using two-step atomic-beam spectroscopy

    CERN Document Server

    Augenbraun, Benjamin L; Rupasinghe, P M; Majumder, P K

    2016-01-01

    We have completed a measurement of the Stark shift within the $^{115}$In $6s_{1/2} \\rightarrow 6p_{1/2}$ excited-state transition using two-step laser spectroscopy in an indium atomic beam. Combining this measurement with recent experimental results we determine the scalar polarizability, $\\alpha_{0}$, of the $6p_{1/2}$ state to be $7683 \\pm43 \\,a_{0}^{3}$ in atomic units, a result which agrees very well with recent theoretical calculations. In this experiment, one laser, stabilized to the $5p_{1/2} \\rightarrow 6s_{1/2}$ 410~nm transition, was directed transversely to the atomic beam, while a second, overlapping laser was scanned across the 1343~nm $6s_{1/2} \\rightarrow 6p_{1/2}$ transition. We utilized two-tone frequency-modulation spectroscopy of the infrared laser beam to measure the second-step absorption in the interaction region, where the optical depth is less than 10$^{-3}$. In the course of our experimental work we also determined the hyperfine splitting within the $6p_{1/2}$ state, improving upon th...

  19. Cytotoxic assessment of the regulated, co-existing mycotoxins aflatoxin B1, fumonisin B1 and ochratoxin, in single, binary and tertiary mixtures.

    Science.gov (United States)

    Clarke, Rachel; Connolly, Lisa; Frizzell, Caroline; Elliott, Christopher T

    2014-11-01

    Aflatoxin B1 (AFB1), ochratoxin A (OTA) and fumonisin B1 (FB1) are contaminants which have been shown to regularly co-occur in a range of foods. However, only a small number of studies have evaluated the interactive effect of binary and tertiary mycotoxins. The present study evaluated the effects of low levels of each mycotoxin in combination at their EU regulatory limits. Toxic effect with respect to cell viability was measured by MTT and neutral red assays, assessing mitochondria and lysosome integrities respectively. Individual toxicity showed that OTA (10 μg/ml) was the most cytotoxic mycotoxin in all three cell lines studied (caco-2, MDBK and raw 264.7). Binary combinations were cytotoxic to the MDBK cell line in the order [OTA/FB1] > [AFB1/FB1] > [AFB1/OTA], whilst all effects observed were classified as being additive. Tertiary combinations of AFB1, FB1 and OTA at the EU regulatory limits were tested and not found to exhibit measurable cytotoxicity in MDBK, caco-2 or raw 264.7 cells. However by increasing these concentrations above the legal limits to OTA (3 μg/ml), FB1 (8 μg/ml) and AFB1 (1.28 μg/ml), cytotoxicity was observed with up to 26% reduction in cell viability and synergistic effects were evident with regard to mitochondrial integrity.

  20. Calculator calculus

    CERN Document Server

    McCarty, George

    1982-01-01

    How THIS BOOK DIFFERS This book is about the calculus. What distinguishes it, however, from other books is that it uses the pocket calculator to illustrate the theory. A computation that requires hours of labor when done by hand with tables is quite inappropriate as an example or exercise in a beginning calculus course. But that same computation can become a delicate illustration of the theory when the student does it in seconds on his calculator. t Furthermore, the student's own personal involvement and easy accomplishment give hi~ reassurance and en­ couragement. The machine is like a microscope, and its magnification is a hundred millionfold. We shall be interested in limits, and no stage of numerical approximation proves anything about the limit. However, the derivative of fex) = 67.SgX, for instance, acquires real meaning when a student first appreciates its values as numbers, as limits of 10 100 1000 t A quick example is 1.1 , 1.01 , 1.001 , •••• Another example is t = 0.1, 0.01, in the functio...

  1. Reliability calculations

    International Nuclear Information System (INIS)

    Risk and reliability analysis is increasingly being used in evaluations of plant safety and plant reliability. The analysis can be performed either during the design process or during the operation time, with the purpose to improve the safety or the reliability. Due to plant complexity and safety and availability requirements, sophisticated tools, which are flexible and efficient, are needed. Such tools have been developed in the last 20 years and they have to be continuously refined to meet the growing requirements. Two different areas of application were analysed. In structural reliability probabilistic approaches have been introduced in some cases for the calculation of the reliability of structures or components. A new computer program has been developed based upon numerical integration in several variables. In systems reliability Monte Carlo simulation programs are used especially in analysis of very complex systems. In order to increase the applicability of the programs variance reduction techniques can be applied to speed up the calculation process. Variance reduction techniques have been studied and procedures for implementation of importance sampling are suggested. (author)

  2. p=-1的Hardy型不等式的最佳常数%The Best Constants of Hardy Type Inequalities for P=-1

    Institute of Scientific and Technical Information of China (English)

    文家金; 高朝邦

    2008-01-01

    For p>1,many improved or generalized results of the well-known Hardy's inequality have been established.In this paper,by means of the weight coefficient method,we establish the following Hardy type inequality for P=-1:n∑i=1(1/ii∑j=1aj)-1<2n∑i=1(1-π2-9/3i)ai-1,Cn such that the inequality ∑ni=1(1/i∑ij=1 aj)-1≤Cn∑ni=1ai-1 holds.Moreover,by means of the Mathematica software,we give some examples.

  3. ALARM-P1: a computer program for pressurized water reactor blowdown analysis

    International Nuclear Information System (INIS)

    The computer program ALARM-P1 written in FORTRAN-IV for FACOM 230-75 is a part of the code series for evaluation of performance of the emergency core cooling system (ECCS) in pressurized water reactors according to the safety evaluation guidelines provided by the Atomic Energy Commission of Japan. ALARM-P1 is for analyzing the thermo-hydraulic phenomena during blowdown following a large break in the primary coolant system. ALARM-P1 models the PWR system fluid conditions including flow, pressure, mass inventory, fluid quality and heat transfer. It solves integral forms of fluid conservation and state equations for user-defined volumes treated as one-dimensional homogeneous, thermal-equilibrium elements with interconnecting flow paths and also finite difference forms of the one-dimensional heat conduction equations describing temperature profiles within solid material and the fluid-solid interface conditions. In addition, the ALARM-P1 provides the initial conditions for analysis of the last portion of the LOCA transient, a reflood phase, and the information for core heat-up analysis during the whole LOCA. This report describes the state-of-art methods and models of ALARM-P1 in June 1978 and gives information for users. (author)

  4. Expression and Purification of Enterovirus Type 71 Polyprotein P1 using Pichia pastoris system

    Institute of Scientific and Technical Information of China (English)

    Xue Han; Xiaoling Ying; Hao Huang; Shili Zhou; Qi Huang

    2012-01-01

    Enterovirus type 71(EV71) causes severe hand-foot-and-mouth disease(HFMD) resulting in hundreds of deaths of children every year; However,currently,there is no effective treatment for EV71.In this study,the EV71 poly-protein(EV71-P1 protein) gene was processed and cloned into the eukaryotic expression vector pPIC9k and then expressed in Pichia pastoris strain GS115.The EV71 P1 pretein with a molecular weight of 100 kD was produced and secreted into the medium.The soluble EV71 P1 protein was purified by column chromatography with a recovery efficiency of 70%.The result of the immunological analysis showed that the EV71 P1 protein had excellent immunogenicity and could stimulate the production of EV71-VP1 IgG antibody in injected rabbits.We suggest that EV71-P1 protein is an ideal candidate for an EV71 vaccine to prevent EV71 infection.

  5. House dust mite Der p 1 downregulates defenses of the lung by inactivating elastase inhibitors.

    Science.gov (United States)

    Brown, Alan; Farmer, Kinley; MacDonald, Louise; Kalsheker, Noor; Pritchard, Dave; Haslett, Chris; Lamb, Jonathan; Sallenave, J-M

    2003-09-01

    House dust mites (HDM) are the most common source of aeroallergens and in genetic susceptible individuals can cause symptoms ranging from atopic dermatitis to bronchial asthma. Der p 1, a major target of the human immune responses to HDM, through its enzymatic properties can modulate the adaptive immune system by the cleavage of CD23 and CD25. The consequences of this would be to promote allergic inflammatory responses. Furthermore, by disrupting epithelial tight junctions Der p 1 facilitates the transport of allergen across the epithelium. Here, we report that Der p 1 has additional effects on the innate defense mechanisms of the lung, by inactivating in vitro and ex vivo the elastase inhibitors human (h) alpha1-proteinase inhibitor (h-A1-Pi), mouse (m-), (but not human [h])-SLPI and h-elafin. We confirm that Der p 1 contain both cysteine and serine proteinases, and extend this finding to demonstrate for the first time that h-elafin is particularly sensitive to the biological activity of the latter. Because these elastase inhibitors have antimicrobial, as well as antielastase activity, our results suggest that inactivation of these innate components of the lung defense system by Der p 1 may increase the susceptibility of patients with allergic inflammation to infection. PMID:12689923

  6. P1 Ref Endonuclease: A Molecular Mechanism for Phage-Enhanced Antibiotic Lethality.

    Science.gov (United States)

    Ronayne, Erin A; Wan, Y C Serena; Boudreau, Beth A; Landick, Robert; Cox, Michael M

    2016-01-01

    Ref is an HNH superfamily endonuclease that only cleaves DNA to which RecA protein is bound. The enigmatic physiological function of this unusual enzyme is defined here. Lysogenization by bacteriophage P1 renders E. coli more sensitive to the DNA-damaging antibiotic ciprofloxacin, an example of a phenomenon termed phage-antibiotic synergy (PAS). The complementary effect of phage P1 is uniquely traced to the P1-encoded gene ref. Ref is a P1 function that amplifies the lytic cycle under conditions when the bacterial SOS response is induced due to DNA damage. The effect of Ref is multifaceted. DNA binding by Ref interferes with normal DNA metabolism, and the nuclease activity of Ref enhances genome degradation. Ref also inhibits cell division independently of the SOS response. Ref gene expression is toxic to E. coli in the absence of other P1 functions, both alone and in combination with antibiotics. The RecA proteins of human pathogens Neisseria gonorrhoeae and Staphylococcus aureus serve as cofactors for Ref-mediated DNA cleavage. Ref is especially toxic during the bacterial SOS response and the limited growth of stationary phase cultures, targeting aspects of bacterial physiology that are closely associated with the development of bacterial pathogen persistence.

  7. P1 Ref Endonuclease: A Molecular Mechanism for Phage-Enhanced Antibiotic Lethality.

    Science.gov (United States)

    Ronayne, Erin A; Wan, Y C Serena; Boudreau, Beth A; Landick, Robert; Cox, Michael M

    2016-01-01

    Ref is an HNH superfamily endonuclease that only cleaves DNA to which RecA protein is bound. The enigmatic physiological function of this unusual enzyme is defined here. Lysogenization by bacteriophage P1 renders E. coli more sensitive to the DNA-damaging antibiotic ciprofloxacin, an example of a phenomenon termed phage-antibiotic synergy (PAS). The complementary effect of phage P1 is uniquely traced to the P1-encoded gene ref. Ref is a P1 function that amplifies the lytic cycle under conditions when the bacterial SOS response is induced due to DNA damage. The effect of Ref is multifaceted. DNA binding by Ref interferes with normal DNA metabolism, and the nuclease activity of Ref enhances genome degradation. Ref also inhibits cell division independently of the SOS response. Ref gene expression is toxic to E. coli in the absence of other P1 functions, both alone and in combination with antibiotics. The RecA proteins of human pathogens Neisseria gonorrhoeae and Staphylococcus aureus serve as cofactors for Ref-mediated DNA cleavage. Ref is especially toxic during the bacterial SOS response and the limited growth of stationary phase cultures, targeting aspects of bacterial physiology that are closely associated with the development of bacterial pathogen persistence. PMID:26765929

  8. P1 Ref Endonuclease: A Molecular Mechanism for Phage-Enhanced Antibiotic Lethality.

    Directory of Open Access Journals (Sweden)

    Erin A Ronayne

    2016-01-01

    Full Text Available Ref is an HNH superfamily endonuclease that only cleaves DNA to which RecA protein is bound. The enigmatic physiological function of this unusual enzyme is defined here. Lysogenization by bacteriophage P1 renders E. coli more sensitive to the DNA-damaging antibiotic ciprofloxacin, an example of a phenomenon termed phage-antibiotic synergy (PAS. The complementary effect of phage P1 is uniquely traced to the P1-encoded gene ref. Ref is a P1 function that amplifies the lytic cycle under conditions when the bacterial SOS response is induced due to DNA damage. The effect of Ref is multifaceted. DNA binding by Ref interferes with normal DNA metabolism, and the nuclease activity of Ref enhances genome degradation. Ref also inhibits cell division independently of the SOS response. Ref gene expression is toxic to E. coli in the absence of other P1 functions, both alone and in combination with antibiotics. The RecA proteins of human pathogens Neisseria gonorrhoeae and Staphylococcus aureus serve as cofactors for Ref-mediated DNA cleavage. Ref is especially toxic during the bacterial SOS response and the limited growth of stationary phase cultures, targeting aspects of bacterial physiology that are closely associated with the development of bacterial pathogen persistence.

  9. FoxP1 orchestration of ASD-relevant signaling pathways in the striatum

    Science.gov (United States)

    Araujo, Daniel J.; Anderson, Ashley G.; Berto, Stefano; Runnels, Wesley; Harper, Matthew; Ammanuel, Simon; Rieger, Michael A.; Huang, Hung-Chung; Rajkovich, Kacey; Loerwald, Kristofer W.; Dekker, Joseph D.; Tucker, Haley O.; Dougherty, Joseph D.; Gibson, Jay R.; Konopka, Genevieve

    2015-01-01

    Mutations in the transcription factor Forkhead box p1 (FOXP1) are causative for neurodevelopmental disorders such as autism. However, the function of FOXP1 within the brain remains largely uncharacterized. Here, we identify the gene expression program regulated by FoxP1 in both human neural cells and patient-relevant heterozygous Foxp1 mouse brains. We demonstrate a role for FoxP1 in the transcriptional regulation of autism-related pathways as well as genes involved in neuronal activity. We show that Foxp1 regulates the excitability of striatal medium spiny neurons and that reduction of Foxp1 correlates with defects in ultrasonic vocalizations. Finally, we demonstrate that FoxP1 has an evolutionarily conserved role in regulating pathways involved in striatal neuron identity through gene expression studies in human neural progenitors with altered FOXP1 levels. These data support an integral role for FoxP1 in regulating signaling pathways vulnerable in autism and the specific regulation of striatal pathways important for vocal communication. PMID:26494785

  10. Chemical and Toxicological Fate of Fumonisin B1 during Extrusion Processing of Corn Grits

    Science.gov (United States)

    Two batches of flaking corn grits were prepared by growing Fusarium verticillioides to contain low and high levels of fumonisin B1 (FB1), Batch-1 at 9.7 ppm and Batch-2 at 50 ppm FB1 as determined by HPLC. These two batches were extruded (Batch-1E; Batch-2E) or extruded with 10% w/w glucose supplem...

  11. ATP8B1-mediated spatial organization of Cdc42 signaling maintains singularity during enterocyte polarization

    Science.gov (United States)

    Bruurs, Lucas J.M.; Donker, Lisa; Zwakenberg, Susan; Zwartkruis, Fried J.; Begthel, Harry; Knisely, A.S.; Posthuma, George; van de Graaf, Stan F.J.; Paulusma, Coen C.

    2015-01-01

    During yeast cell polarization localization of the small GTPase, cell division control protein 42 homologue (Cdc42) is clustered to ensure the formation of a single bud. Here we show that the disease-associated flippase ATPase class I type 8b member 1 (ATP8B1) enables Cdc42 clustering during enterocyte polarization. Loss of this regulation results in increased apical membrane size with scattered apical recycling endosomes and permits the formation of more than one apical domain, resembling the singularity defect observed in yeast. Mechanistically, we show that to become apically clustered, Cdc42 requires the interaction between its polybasic region and negatively charged membrane lipids provided by ATP8B1. Disturbing this interaction, either by ATP8B1 depletion or by introduction of a Cdc42 mutant defective in lipid binding, increases Cdc42 mobility and results in apical membrane enlargement. Re-establishing Cdc42 clustering, by tethering it to the apical membrane or lowering its diffusion, restores normal apical membrane size in ATP8B1-depleted cells. We therefore conclude that singularity regulation by Cdc42 is conserved between yeast and human and that this regulation is required to maintain healthy tissue architecture. PMID:26416959

  12. A patient with a rare leukodystrophy related to lamin B1 duplication.

    LENUS (Irish Health Repository)

    Molloy, A

    2012-06-01

    The hereditary leukodystrophies are rare disorders caused by molecular abnormalities leading to destruction of or failure of development of central white matter. For almost 30 years there has been increasing recognition of later onset Autosomal Dominant Leukodystrophy (ADLD). We report the first genetically confirmed case of lamin B1 duplication causing ADLD from Ireland.

  13. Mineralogy and Petrology of EK-459-5-1, A Type B1 CAI from Allende

    Science.gov (United States)

    Jeffcoat, C. R.; Kerekgyarto, A. G.; Lapen, T. J.; Andreasen, R.; Righter, M.; Ross, D. K.

    2015-01-01

    Calcium-aluminum-rich inclusions (CAIs) are a type of coarse-grained clast composed of Ca-, Al-, and Mg-rich silicates and oxides found in chondrite meteorites. Type B (CAIs) are exclusively found in the CV chondrite meteorites and are the most well studied type of inclusion found in chondritic meteorites. Type B1 CAIs are distinguished by a nearly monomineralic rim of melilite that surrounds an interior predominantly composed of melilite, fassaite (Ti and Al-rich clinopyroxene), anorthite, and spinel with varying amounts of other minor primary and secondary phases. The formation of Type B CAIs has received considerable attention in the course of CAI research and quantitative models, experimental results and observations from Type B inclusions remain largely in disagreement. Recent experimental results and quantitative models have shown that the formation of B1 mantles could have occurred by the evaporative loss of Si and Mg during the crystallization of these objects. However, comparative studies suggest that the lower bulk SiO2 compositions in B1s result in more prior melilite crystallization before the onset of fassaite and anorthite crystallization leading to the formation of thick melilite rich rims in B1 inclusions. Detailed petrographic and cosmochemical studies of these inclusions will further our understanding of these complex objects.

  14. Regulation of CYP27B1 mRNA Expression in Primary Human Osteoblasts.

    Science.gov (United States)

    van der Meijden, K; van Essen, H W; Bloemers, F W; Schulten, E A J M; Lips, P; Bravenboer, N

    2016-08-01

    The enzyme 1α-hydroxylase (gene CYP27B1) catalyzes the synthesis of 1,25(OH)2D in both renal and bone cells. While renal 1α-hydroxylase is tightly regulated by hormones and 1,25(OH)2D itself, the regulation of 1α-hydroxylase in bone cells is poorly understood. The aim of this study was to investigate in a primary human osteoblast culture whether parathyroid hormone (PTH), fibroblast growth factor 23 (FGF23), calcitonin, calcium, phosphate, or MEPE affect mRNA levels of CYP27B1. Our results show that primary human osteoblasts in the presence of high calcium concentrations increase their CYP27B1 mRNA levels by 1.3-fold. CYP27B1 mRNA levels were not affected by PTH1-34, rhFGF23, calcitonin, phosphate, and rhMEPE. Our results suggest that the regulation of bone 1α-hydroxylase is different from renal 1α-hydroxylase. High calcium concentrations in bone may result in an increased local synthesis of 1,25(OH)2D leading to an enhanced matrix mineralization. In this way, the local synthesis of 1,25(OH)2D may contribute to the stimulatory effect of calcium on matrix mineralization. PMID:27016371

  15. Design and verification of the Risø-B1 airfoil family for wind turbines

    DEFF Research Database (Denmark)

    Fuglsang, P.; Bak, C.; Gaunaa, M.;

    2004-01-01

    This paper presents the design and experimental verification of the Risø-B1 airfoil family for MW-size wind turbines with variable speed and pitch control. Seven airfoils were designed with thickness-to-chord ratios between 15% and 53% to cover the entire span of a wind turbine blade. The airfoil...

  16. Genetic variation of Aflatoxin B(1) aldehyde reductase genes (AFAR) in human tumour cells

    DEFF Research Database (Denmark)

    Praml, Christian; Schulz, Wolfgang; Claas, Andreas;

    2008-01-01

    AFAR genes play a key role in the detoxification of the carcinogen Aflatoxin B(1) (AFB(1)). In the rat, Afar1 induction can prevent AFB(1)-induced liver cancer. It has been proposed that AFAR enzymes can metabolise endogenous diketones and dialdehydes that may be cytotoxic and/or genotoxic...

  17. Inhibition of apoptic cell death induced by Pseudomonas syringae pv. Tabaci and mycotoxin fumonisin B1

    NARCIS (Netherlands)

    Iakimova, E.T.; Batchvorova, R.; Kapchina, V.; Popov, T.; Atanassov, A.; Woltering, E.J.

    2004-01-01

    The impact of programmed cell death (PCD) inhibitors on lesion formation and biochemical events in transgenic (ttr line) and non-transgenic (Nevrokop 1164) tobacco infected with Pseudomonas syringae pv. tabaci was tested. Programmed cell death in tomato cell culture was induced by Fumonisin B1 (FUM)

  18. Organic anion transporting polypeptide-1B1 haplotypes in Chinese patients

    Institute of Scientific and Technical Information of China (English)

    Lin-yong XU; Hong-hao ZHOU; Zhen-qiu SUN; Yi-jing HE; Wei ZHANG; Sheng Deng; Qing LI; Wei-xia ZHANG; Zhao-qian LIU; Dan WANG; Yuan-fei HUANG

    2007-01-01

    Aim: To detect 388G>A and 521T>C variant alleles in the organic anion transporting polypeptide- 1B 1 (OATP 1B 1, encoding gene SLCOIB1) gene. Methods:One hundred and eleven healthy volunteers were screened for OATPIB 1 alleles in our study. PCR-restriction fragment length polymorphism was used to identify the 388G>A polymorphism and a 1-step tetra-primer method was developed for the determination of 521T>C mutation. Results: The frequencies of the 388G>A and 521T>C variant alleles in the Chinese population were 73.4%and 14.0%,respectively. The frequencies of the SLCO1BI*lb and *15 haplotypes were 59.9% and 14.0%, respectively. Conclusion: The SLCO1B1*1b and SLCO1B1*15 variants are relatively common in the Chinese population. Their frequencies are similar to that in the Japanese, but significantly different from that in Caucasians and blacks.

  19. Data of evolutionary structure change: 1AO5B-1ELCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-1ELCA 1AO5 1ELC B A VVGGFNCEKNSQPWQVAVYYQ----KEHICGGVLLDRNW...TPTWQKPDDLQCVFITLLPNENCAKV--YLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICD----GILQGTTSYGPV-PCGKPGVPAIYTNLIKFNSWIKDTMMKNA TRP CA 491 1ELC A 1ELCA...hain> 1ELC A 1ELCA PLHCLVNGQYAVHG... PRO CA 225 1ELC A 1ELCA

  20. The vitamin B1 metabolism of Staphylococcus aureus is controlled at enzymatic and transcriptional levels

    NARCIS (Netherlands)

    Müller, Ingrid B; Bergmann, Bärbel; Groves, Matthew R; Couto, Isabel; Amaral, Leonard; Begley, Tadhg P; Walter, Rolf D; Wrenger, Carsten

    2009-01-01

    Vitamin B1 is in its active form thiamine pyrophosphate (TPP), an essential cofactor for several key enzymes in the carbohydrate metabolism. Mammals must salvage this crucial nutrient from their diet in order to complement the deficiency of de novo synthesis. In the human pathogenic bacterium Staphy

  1. 26 CFR 49.4262(b)-1 - Exclusion of certain travel.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Exclusion of certain travel. 49.4262(b)-1... Exclusion of certain travel. (a) In general. Under section 4262(b) taxable transportation does not include... computing tax on travel not excluded. (1) Where a payment is made for transportation which...

  2. 26 CFR 11.401(b)-1 - Certain retroactive changes in plan.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) INCOME TAX (CONTINUED) TEMPORARY INCOME TAX REGULATIONS UNDER THE EMPLOYEE RETIREMENT INCOME SECURITY ACT OF 1974 § 11.401(b)-1 Certain retroactive changes in plan. (a) General rule. (1) Under section... provision of— (1) A plan as adopted, (2) A plan amendment, or (3) The Employee Income Security Act of...

  3. Data of evolutionary structure change: 1B1GA-1AK8A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available entryIDChain>1B1GA KEGDP-NQLSK > - EEE...> A 1AK8A FDKDGDGTITT H ...A LFEEL---DKNGD >HHHHH--- ...entryIDChain>1AK8A LQDMINEVDADGN ...>HHHHH > ATOM 722 CA LEU A 48 3.325 7.917 -3.325 1.00 0

  4. Periprosthetic Vancouver type B1 and C fractures treated by locking-plate osteosynthesis

    DEFF Research Database (Denmark)

    Froberg, Lonnie; Troelsen, Anders; Brix, Michael

    2012-01-01

    internal fixation, and the introduction of locking-plate osteosynthesis may lead to improved outcome. We evaluated the outcome of Vancouver type B1 and C PFFs treated by locking-plate osteosynthesis, by assessing rates of fracture union and reoperations and by analyzing failure cases....

  5. BIOCONTROL OF ASPERGILLUS FLAVUS AND AFLATOXIN B1 PRODUCTION IN CORN

    Directory of Open Access Journals (Sweden)

    A. Khanafari, H. Soudi, M. Miraboulfathi

    2007-07-01

    Full Text Available The potent mycotoxin aflatoxin B1 is a secondary metabolite of Aspergillus fungi that grow, on a variety of food and feed commodities at any stage during growth, harvest, storage and transportation. The occurrence of aflatoxin contamination is global, with severe problems especially prevalent in developing countries. In present study, corn samples were contaminated with aflatoxin B1 in the concentration of 240 µg/kg. Four trials were inoculated by Lactobacillus plantarum (PTCC 1058. Three control assays were analysed in the same conditions. All the assays were kneaded and incubated for 4-7 days at 37°C. Aflatoxin B1 was determined after extraction by HPLC. Results showed a drastic removal of the mycotoxin with a reduction of 77 % for Aflatoxin B1 by Lactobacillus plantarum. In the Inoculated corns, spore germination of A. flavus was totally inhibited. Results in inoculated spikes showed a high percentage of reduction of aflatoxin after incubation by Lb. plantarum. Gram staining of a sample from inoculated corns and microscopic observation demonstrated that the growth of A. flavus spores was totally inhibited by Lb. plantarum. Fungal spores were surrounded by Lactobacillus plantarum and spores were degraded.

  6. Analysis of aflatoxins B1 and G1 in maize by quechers

    Directory of Open Access Journals (Sweden)

    Bursić Vojislava P.

    2013-01-01

    Full Text Available A reliable and easy method has been developed for the determination of aflatoxins B1 and G2 in maize samples. High performance liquid chromatography coupled with FLD (HPLC-FLD with photochemical derivatization was used. Mycotoxins were extracted from maize using a QuEChERS-based extraction procedure. The optimized analytical conditions were evaluated in terms of recoveries, reproducibility, LOD, LOQ and linearity for aflatoxin B1 and aflatoxin G1 in maize. Extraction, chromatographic and detection conditions were optimized in order to increase sample sensitivity. The linearity was analyzed in the range of 0.4-20 μg/kg and the correlation coefficients (R2 were higher than 0.99 for aflatoxins B1 and G1. Blank samples were spiked at 1.0, 2.0 and 4.0 μg/kg, and the average recovery for aflatoxin G1 was 96.96±1.72% and for aflatoxin B1 it was 86.80±1.24%. RSDs were lower than 25% for both mycotoxins. LOD for both aflatoxins was 0.5 μg/kg and LOQ was 1.0 μg/kg, respectively.

  7. 26 CFR 1.669(b)-1A - Tax on distribution.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) INCOME TAXES Treatment of Excess Distributions of Trusts Applicable to Taxable Years Beginning... distribution is paid, credited, or required to be distributed to him, (a) With the inclusion in gross income of... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Tax on distribution. 1.669(b)-1A Section...

  8. 17 CFR 270.34b-1 - Sales literature deemed to be misleading.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales literature deemed to be... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.34b-1 Sales literature deemed to be misleading. Any advertisement, pamphlet, circular, form letter, or other sales literature addressed to...

  9. Effect of fungicide on Fusarium verticillioides mycelial morphology and fumonisin B 1 production

    Science.gov (United States)

    Miguel, Tatiana de Á.; Bordini, Jaqueline G.; Saito, Gervásio H.; Andrade, Célia G.T. de J.; Ono, Mario A.; Hirooka, Elisa Y.; Vizoni, Édio; Ono, Elisabete Y.S.

    2015-01-01

    The effect of fludioxonil + metalaxyl-M on the mycelial morphology, sporulation and fumonisin B 1 production by Fusarium verticillioides 103 F was evaluated. Scanning electron microscopy analysis showed that the fungicide caused inhibition of hyphal growth and defects on hyphae morphology such as cell wall disruption, withered hyphae, and excessive septation. In addition, extracellular material around the hyphae was rarely observed in the presence of fludioxonil + metalaxyl-M. While promoting the reduction of mycelial growth, the fungicide increased sporulation of F. verticillioides compared to the control, and the highest production occurred on the 14 th day in the treatments and on the 10 th day in the control cultures. Fumonisin B 1 production in the culture media containing the fungicide (treatment) was detected from the 7 th day incubation, whereas in cultures without fungicide (control) it was detected on the 10 th day. The highest fumonisin B 1 production occurred on the 14 th day, both for the control and for the treatment. Fludioxonil + metalaxyl - M can interfere in F. verticillioides mycelial morphology and sporulation and increase fumonisin B 1 levels. These data indicate the importance of understanding the effects of fungicide to minimize the occurrence of toxigenic fungi and fumonisins. PMID:26221120

  10. A novel role for adipose ephrin-B1 in inflammatory response.

    Directory of Open Access Journals (Sweden)

    Takuya Mori

    Full Text Available AIMS: Ephrin-B1 (EfnB1 was selected among genes of unknown function in adipocytes or adipose tissue and subjected to thorough analysis to understand its role in the development of obesity. METHODS AND RESULTS: EfnB1 mRNA and protein levels were significantly decreased in adipose tissues of obese mice and such reduction was mainly observed in mature adipocytes. Exposure of 3T3-L1 adipocytes to tumor necrosis factor-α (TNF-α and their culture with RAW264.7 cells reduced EFNB1 levels. Knockdown of adipose EFNB1 increased monocyte chemoattractant protein-1 (Mcp-1 mRNA level and augmented the TNF-α-mediated THP-1 monocyte adhesion to adipocytes. Adenovirus-mediated adipose EFNB1-overexpression significantly reduced the increase in Mcp-1 mRNA level induced by coculture of 3T3-L1 adipocytes with RAW264.7 cells. Monocyte adherent assay showed that adipose EfnB1-overexpression significantly decreased the increase of monocyte adhesion by coculture with RAW264.7 cells. TNF-α-induced activation of extracellular signal-regulated kinase 1/2 (ERK1/2 was reduced by EFNB1-overexpression. CONCLUSIONS: EFNB1 contributes to the suppression of adipose inflammatory response. In obesity, reduction of adipose EFNB1 may accelerate the vicious cycle involved in adipose tissue inflammation.

  11. ATP8B1 deficiency; Pathophysiology and treatment of a cholestatic syndrome with extrahepatic symptoms

    NARCIS (Netherlands)

    Stapelbroek, J.M.

    2009-01-01

    ATP8B1 deficiency is a severe and clinically highly variable hereditary disorder that is primarily characterized by intrahepatic cholestasis. It generally presents as a permanent disorder, progressive familial intrahepatic cholestasis type 1 (PFIC1), or with intermittent cholestasis (benign recurren

  12. 26 CFR 41.4482(b)-1 - Definition of taxable gross weight.

    Science.gov (United States)

    2010-04-01

    ... oilfield machinery, etc.) mounted on the vehicle for use on construction jobs, in oilfield operations, etc...) MISCELLANEOUS EXCISE TAXES EXCISE TAX ON USE OF CERTAIN HIGHWAY MOTOR VEHICLES Tax on Use of Certain Highway Motor Vehicles § 41.4482(b)-1 Definition of taxable gross weight. (a) Actual unloaded weight—(1)...

  13. Data of evolutionary structure change: 1BT8B-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BT8B-1UNFX 1BT8 1UNF B X ---AVYTLPELPYDYSALEPYISGEIMELHHDKHHKAYV...EEEEEEEEEGGG EEEEEEE EEE EEE HHHH HHHHHHHHHH EEHHHHHHHHHHHHHH EVID> 1UNF X 1UNFX VN...d>2.942183017730713 5.374790191650391 ...> TRP CA 395 ASP CA 318 ASP CA 362 1UNF

  14. A NEW CELL CLONE DERIVED FROM TRICHOPLUSIA NI TN5B1-4 CELLS

    Institute of Scientific and Technical Information of China (English)

    Jian-xiaoTian; Chang-youLi; Gui-lingZheng; Guo-xunLi; PingWang; Granados

    2004-01-01

    The characteristics of a cultured cell line do not always remain stable and may change upon continuous passage. Most continuous cell lines, even after cloning, possess several genotypes that are constantly changing. There are numerous selective and adaptive culture processes, in addition to genetic instability, that may improve phenotypic change in cell growth, virus susceptibility, gene expression, and production of virus. Similar detrimental effects of long term passaging of insect cells have also been reported for continuous cell lines, for example, Tn5B 1-4 cells, which are the most widely used for the baculovirus expression vector system (BEVS), provide superior production of recombinant proteins,however, this high productivity may be more evident in low passage cells. In this paper, we describe the isolation of a cell clone, Tn5B-40, from low passage Tn5B 1-4 cells. The growth characteristics,productions of virus, and high level of recombinant protein productions were determined. The results showed the susceptibility of both clone and Tn5B 1-4 cells to wild-type AcNPV was approximately the same rate with over 95% of infection; when the cloned cells were infected with recombinant baculoviruses expressing β-galactosidase and secreted alkaline phosphatase (SEAP), expression of the recombinant proteins from the cloned cells exceeded that from the parental Tn5B 1-4 cells.

  15. Comparison of antibody production against aflatoxin B1 in goats and rabbits.

    OpenAIRE

    Gaur, P K; El-Nakib, O; Chu, F. S.

    1980-01-01

    Antibody production against aflatoxin B1 was compared in three rabbits and one goat. Titers obtained were 20 times higher in the rabbits than in the goat. The goat antiserum appeared to have a higher degree of cross-reactivity for other aflatoxins and related metabolites than did the rabbit antiserum.

  16. Genome sequence of the Bacteroides fragilis phage ATCC 51477-B1

    OpenAIRE

    Hawkins Shawn A; Layton Alice C; Ripp Steven; Williams Dan; Sayler Gary S

    2008-01-01

    Abstract The genome of a fecal pollution indicator phage, Bacteroides fragilis ATCC 51477-B1, was sequenced and consisted of 44,929 bases with a G+C content of 38.7%. Forty-six putative open reading frames were identified and genes were organized into functional clusters for host specificity, lysis, replication and regulation, and packaging and structural proteins.

  17. Genome sequence of the Bacteroides fragilis phage ATCC 51477-B1

    OpenAIRE

    Hawkins, Shawn A; Layton, Alice C.; Ripp, Steven; Williams, Dan; Sayler, Gary S.

    2008-01-01

    The genome of a fecal pollution indicator phage, Bacteroides fragilis ATCC 51477-B1, was sequenced and consisted of 44,929 bases with a G+C content of 38.7%. Forty-six putative open reading frames were identified and genes were organized into functional clusters for host specificity, lysis, replication and regulation, and packaging and structural proteins.

  18. Gene expression profile in liver of hB1F transgenic mice

    Institute of Scientific and Technical Information of China (English)

    Shui-Liang Wang; Hua Yang; You-Hua Xie; Yuan Wang; Jian-Zhong Li; Long Wang; Zhu-Gang Wang; Ji-Liang Fu

    2004-01-01

    AIM: To analyze the tissue morphologic phenotype and liver gene expression profile of hB1F transgenic mice.METHODS: Transgene expression was analyzed with RTPCR and Western blotting. For one of the transgenic mouse lines, tissue expression pattern of the transgene was also examined with immunochemical methods. Pathological analysis was used to examine the tissue morphologic phenotype of established transgenic mice. The liver gene expression profile of transgenic mice was analyzed with microchip, and some of the differentially expressed genes were verified with RT-PCR.RESULTS: The expressions of hB1F were shown in livers from 6 of 7 transgenic mouse lines. The overexpression of hB1F transgene did not cause pathological changes. Expressions of three genes were up-regulated, while down-regulation was observed for 25 genes.CONCLUSION: The overexpression of hB1F transgene may cause changes of gene expression profiles in the liver of transgenic mice.

  19. Genetic variation in the HSD17B1 gene and risk of prostate cancer.

    Directory of Open Access Journals (Sweden)

    Peter Kraft

    2005-11-01

    Full Text Available Steroid hormones are believed to play an important role in prostate carcinogenesis, but epidemiological evidence linking prostate cancer and steroid hormone genes has been inconclusive, in part due to small sample sizes or incomplete characterization of genetic variation at the locus of interest. Here we report on the results of a comprehensive study of the association between HSD17B1 and prostate cancer by the Breast and Prostate Cancer Cohort Consortium, a large collaborative study. HSD17B1 encodes 17beta-hydroxysteroid dehydrogenase 1, an enzyme that converts dihydroepiandrosterone to the testosterone precursor Delta5-androsterone-3beta,17beta-diol and converts estrone to estradiol. The Breast and Prostate Cancer Cohort Consortium researchers systematically characterized variation in HSD17B1 by targeted resequencing and dense genotyping; selected haplotype-tagging single nucleotide polymorphisms (htSNPs that efficiently predict common variants in U.S. and European whites, Latinos, Japanese Americans, and Native Hawaiians; and genotyped these htSNPs in 8,290 prostate cancer cases and 9,367 study-, age-, and ethnicity-matched controls. We found no evidence that HSD17B1 htSNPs (including the nonsynonymous coding SNP S312G or htSNP haplotypes were associated with risk of prostate cancer or tumor stage in the pooled multiethnic sample or in U.S. and European whites. Analyses stratified by age, body mass index, and family history of disease found no subgroup-specific associations between these HSD17B1 htSNPs and prostate cancer. We found significant evidence of heterogeneity in associations between HSD17B1 haplotypes and prostate cancer across ethnicity: one haplotype had a significant (p < 0.002 inverse association with risk of prostate cancer in Latinos and Japanese Americans but showed no evidence of association in African Americans, Native Hawaiians, or whites. However, the smaller numbers of Latinos and Japanese Americans in this study makes

  20. Expression of HER2 and bradykinin B1 receptors in precursor lesions of gallbladder carcinoma

    Institute of Scientific and Technical Information of China (English)

    Cesar Toledo; Carola E Matus; Ximena Barraza; Pamela Arroyo; Pamela Ehrenfeld; Carlos D Figueroa; Kanti D Bhoola; Maeva del Pozo; Maria T Poblete

    2012-01-01

    AIM:TO determine the expression of HER2 and bradykinin B1 receptors (B1R) in the two pathogenic models of gallbladder cancer:the metaplasia-dysplasia-carcinoma and the adenoma-carcinoma pathways.METHODS:Receptor proteins were visualized by immunohistochemistry on 5-μm sections of paraffin-embedded tissue.Expression of both receptors was studied in biopsy samples from 92 patients (6 males and 86 females; age ranging from 28 to 86 years,mean 56 years).High HER2 expression in specimens was additionally investigated by fluorescence in situ hybridization.Cell proliferation in each sample was assessed by using the Ki-67 proliferation marker.RESULTS:HER2 receptor protein was absent in adenomas and in normal gallbladder epithelium.On the contrary,there was intense staining for HER2 on the basolateral membrane of epithelial cells of intestinal metaplasia (22/24; 91.7%) and carcinoma in situ (9/10;90%),the lesions that displayed a significantly high proliferation index.Protein up-regulation of HER2 in the epithelium with metaplasia or carcinoma in situ was not accompanied by HER2 gene amplification.A similar result was observed in invasive carcinomas (0/12).The B1R distribution pattern mirrored that of HER2 except that B1R was additionally observed in the adenomas.The B1R appeared either as cytoplasmic dots or labelingon the apical cell membrane of the cells composing the epithelia with intestinal metaplasia (24/24; 100%) and carcinoma in situ (10/10; 100%) and in the epithelial cells of adenomas.In contrast,both HER2 (4/12; 33%)and B1R (1/12; 8.3%) showed a low expression in invasive gallbladder carcinomas.CONCLUSION:The up-regulation of HER2 and B1R in precursor lesions of gallbladder carcinoma suggests cross-talk between these two receptors that may be of importance in the modulation of cell proliferation in gallbladder carcinogenesis.

  1. Genetic variation in the HSD17B1 gene and risk of prostate cancer.

    Science.gov (United States)

    Kraft, Peter; Pharoah, Paul; Chanock, Stephen J; Albanes, Demetrius; Kolonel, Laurence N; Hayes, Richard B; Altshuler, David; Andriole, Gerald; Berg, Christine; Boeing, Heiner; Burtt, Noel P; Bueno-de-Mesquita, Bas; Calle, Eugenia E; Cann, Howard; Canzian, Federico; Chen, Yen-Ching; Crawford, David E; Dunning, Alison M; Feigelson, Heather S; Freedman, Matthew L; Gaziano, John M; Giovannucci, Ed; Gonzalez, Carlos Alberto; Haiman, Christopher A; Hallmans, Goran; Henderson, Brian E; Hirschhorn, Joel N; Hunter, David J; Kaaks, Rudolf; Key, Timothy; Le Marchand, Loic; Ma, Jing; Overvad, Kim; Palli, Domenico; Pike, Malcolm C; Riboli, Elio; Rodriguez, Carmen; Setiawan, Wendy V; Stampfer, Meir J; Stram, Daniel O; Thomas, Gilles; Thun, Michael J; Travis, Ruth; Trichopoulou, Antonia; Virtamo, Jarmo; Wacholder, Sholom

    2005-11-01

    Steroid hormones are believed to play an important role in prostate carcinogenesis, but epidemiological evidence linking prostate cancer and steroid hormone genes has been inconclusive, in part due to small sample sizes or incomplete characterization of genetic variation at the locus of interest. Here we report on the results of a comprehensive study of the association between HSD17B1 and prostate cancer by the Breast and Prostate Cancer Cohort Consortium, a large collaborative study. HSD17B1 encodes 17beta-hydroxysteroid dehydrogenase 1, an enzyme that converts dihydroepiandrosterone to the testosterone precursor Delta5-androsterone-3beta,17beta-diol and converts estrone to estradiol. The Breast and Prostate Cancer Cohort Consortium researchers systematically characterized variation in HSD17B1 by targeted resequencing and dense genotyping; selected haplotype-tagging single nucleotide polymorphisms (htSNPs) that efficiently predict common variants in U.S. and European whites, Latinos, Japanese Americans, and Native Hawaiians; and genotyped these htSNPs in 8,290 prostate cancer cases and 9,367 study-, age-, and ethnicity-matched controls. We found no evidence that HSD17B1 htSNPs (including the nonsynonymous coding SNP S312G) or htSNP haplotypes were associated with risk of prostate cancer or tumor stage in the pooled multiethnic sample or in U.S. and European whites. Analyses stratified by age, body mass index, and family history of disease found no subgroup-specific associations between these HSD17B1 htSNPs and prostate cancer. We found significant evidence of heterogeneity in associations between HSD17B1 haplotypes and prostate cancer across ethnicity: one haplotype had a significant (p < 0.002) inverse association with risk of prostate cancer in Latinos and Japanese Americans but showed no evidence of association in African Americans, Native Hawaiians, or whites. However, the smaller numbers of Latinos and Japanese Americans in this study makes these subgroup

  2. B1a lymphocytes in the rectal mucosa of ulcerative colitis patients

    Institute of Scientific and Technical Information of China (English)

    Lino Polese; Stefano Merigliano; Riccardo Boetto; Giuseppe De Franchis; Imerio Angriman; Andrea Porzionato; Lorenzo Norberto; Giacomo Carlo Sturniolo; Veronica Macchi; Raffaele De Caro

    2012-01-01

    AIM: To assess B1a cell expression in the rectal mucosa of ulcerative colitis (UC) patients in comparison with healthy controls. METHODS: Rectal mucosa biopsies were collected from 15 UC patients and 17 healthy controls. CD5+ B cells were analysed by three colour flow cytometry from rectal mucosal samples after mechanical disaggregation by Medimachine?. Immunohistochemical analysis of B and T lymphocytes was also performed. Correlations between, on the one hand, rectal B1a cell concentrations and, on the other, erythrocyte sedimentation rate and C-reactive protein levels and clinical, endoscopic and histological disease activity indices were evaluated.RESULTS: Rectal B-lymphocyte (CD19+/CD45+) rate and concentration were higher in UC patients compared with those in healthy controls (47.85% ± 3.12% vs 26.10% ± 3.40%, P = 0.001 and 501 ± 91 cells/ mm2 vs 117 ± 18 cells/mm2, P < 0.001); Rectal B1a cell density (CD5+CD19+) was higher in UC patients than in healthy controls (85 ± 15 cells/mm2 vs 31 ± 6.7 cells/mm2, P = 0.009). Rectal B1a cell (CD5/CD19+) rate correlated inversely with endoscopic classification (Rs = -0.637, P < 0.05). CONCLUSION: B1a lymphocytes seem to be involved in the pathogenesis of UC, however, the role they play in its early phases and in disease activity, have yet to be defined.

  3. Acute toxicity of aflatoxin B1 and rubratoxin B in dogs.

    Science.gov (United States)

    Hayes, A W; Williams, W L

    1978-01-01

    The effect of ip administrated aflatoxin B1 and rubratoxin B, singly and in combination, on dogs was determined by serum tests, by observations of clinical signs and survival times, and by evaluation of gross and microscopic lesions. The dog is sensitive to the toxic effects of both mycotoxins. Glutamic-oxaloacetic transaminase, lactic dehydrogenase and alkaline phosphatase activities and survival time varied in relation to dose and to the mycotoxin(s) administered. All three plasma enzymes were elevated regardless of dose with the combination of aflatoxin B1/rubratoxin B at 24 hr after dosing, except LDH, which was within the normal range but only at the lowest dose level. Several serum constituents including BUN, cholesterol, uric acid, and total bilirubin were elevated, whereas serum glucose was depressed in dogs treated with the multiple-toxin regimen; these changes were not seen in dogs given only aflatoxin B1 but were characteristic in rubratoxin-treated animals. In general, gross findings at necropsy were similar in all dogs regardless of the dose regimen. A striking similarity existed in the histologic changes observed between lesions experimentally induced by the mycotoxin combination and those lesions reported for dogs fed toxic feed in laboratory studies or in natural cases of hepatitis X. Of particular similarity were the severe kidney lesions observed in dogs exposed to the mycotoxin combination and kidney lesions reported in natural outbreaks of hepatitis X. There can be little doubt of an association between hepatitis X and aflatoxin B1, although it is apparent that the disease probably involves more than a single toxic factor. Our results suggest that hepatitis X in dogs includes aflatoxin B1 as a primary etiological factor but that rubratoxin B also may be involved. PMID:581496

  4. Fumonisin B(1) is hepatotoxic and nephrotoxic in milk-fed calves.

    Science.gov (United States)

    Mathur, S; Constable, P D; Eppley, R M; Waggoner, A L; Tumbleson, M E; Haschek, W M

    2001-04-01

    Fumonisins are a group of mycotoxins that alter sphingolipid biosynthesis and induce leukoencephalomalacia in horses and pulmonary edema in pigs. Experimental administration of fumonisin induces hepatotoxicity in all species, including cattle, as well as nephrotoxicity in rats, rabbits, and sheep. We investigated the hepatotoxicity and nephrotoxicity of fumonisin B(1) to calves. Ten milk-fed male Holstein calves aged 7 to 14 days were instrumented to obtain blood and urine. Treated calves (n = 5) were administered fumonisin B(1) at 1 mg/kg, iv, daily and controls (n = 5) 10 ml 0.9% NaCl, iv, daily until euthanized on day 7. Fumonisin B(1)-treated calves were lethargic and had decreased appetite from day 4 onward, serum biochemical evidence of severe liver and bile duct injury, and impaired hepatic function. Treated calves also had biochemical evidence of renal injury that functionally involved the proximal convoluted tubules. Sphinganine and sphingosine concentrations in liver, kidney, lung, heart, and skeletal muscle were increased in treated calves. Sphinganine, but not sphingosine, concentration was increased in brains of treated calves. In fumonisin B(1)-treated calves, hepatic lesions were characterized by disorganized hepatic cords, varying severity of hepatocyte apoptosis, hepatocyte proliferation, and proliferation of bile ductular cells. Renal lesions in treated calves consisted of vacuolar change, apoptosis, karyomegaly, and proliferation of proximal renal tubular cells, as well as dilation of proximal renal tubules, which contained cellular debris and protein. This is the first report of fumonisin B(1)-induced renal injury and organ sphingolipid alterations in cattle.

  5. miR-379 regulates cyclin B1 expression and is decreased in breast cancer.

    Directory of Open Access Journals (Sweden)

    Sonja Khan

    Full Text Available MicroRNAs are small non-coding RNA molecules that control gene expression post-transcriptionally, and are known to be altered in many diseases including breast cancer. The aim of this study was to determine the relevance of miR-379 in breast cancer. miR-379 expression was quantified in clinical samples including tissues from breast cancer patients (n=103, healthy controls (n=30 and patients with benign breast disease (n=35. The level of miR-379 and its putative target Cyclin B1 were investigated on all breast tissue specimens by RQ-PCR. Potential relationships with gene expression and patient clinicopathological details were also determined. The effect of miR-379 on Cyclin B1 protein expression and function was investigated using western blot, immunohistochemistry and proliferation assays respectively. Finally, the levels of circulating miR-379 were determined in whole blood from patients with breast cancer (n=40 and healthy controls (n=34. The level of miR-379 expression was significantly decreased in breast cancer (Mean(SEM 1.9 (0.09 Log10 Relative Quantity (RQ compared to normal breast tissues (2.6 (0.16 Log10 RQ, p<0.01. miR-379 was also found to decrease significantly with increasing tumour stage. A significant negative correlation was determined between miR-379 and Cyclin B1 (r=-0.31, p<0.001. Functional assays revealed reduced proliferation (p<0.05 and decreased Cyclin B1 protein levels following transfection of breast cancer cells with miR-379. Circulating miR-379 was not significantly dysregulated in patients with breast cancer compared to healthy controls (p=0.42. This data presents miR-379 as a novel regulator of Cyclin B1 expression, with significant loss of the miRNA observed in breast tumours.

  6. SLCO1B1 Variants and Angiotensin Converting Enzyme Inhibitor (Enalapril) -Induced Cough: a Pharmacogenetic Study

    Science.gov (United States)

    Luo, Jian-Quan; He, Fa-Zhong; Wang, Zhen-Min; Sun, Ning-Ling; Wang, Lu-Yan; Tang, Gen-Fu; Liu, Mou-Ze; Li, Qing; Chen, Xiao-Ping; Liu, Zhao-Qian; Zhou, Hong-Hao; Zhang, Wei

    2015-01-01

    Clinical observations suggest that incidence of cough in Chinese taking angiotensin converting enzyme inhibitors is much higher than other racial groups. Cough is the most common adverse reaction of enalapril. We investigate whether SLCO1B1 genetic polymorphisms, previously reported to be important determinants of inter-individual variability in enalapril pharmacokinetics, are associated with the enalapril-induced cough. A cohort of 450 patients with essential hypertension taking 10 mg enalapril maleate were genotyped for the functional SLCO1B1 variants, 388A > G (Asn130Asp, rs2306283) and 521T > C (Val174Ala, rs4149056). The primary endpoint was cough, which was recorded when participants were bothered by cough and respiratory symptoms during enalapril treatment without an identifiable cause. SLCO1B1 521C allele conferred a 2-fold relative risk of enalapril-induced cough (95% confidence interval [CI] = 1.34–3.04, P = 6.2 × 10−4), and haplotype analysis suggested the relative risk of cough was 6.94-fold (95% CI = 1.30–37.07, P = 0.020) in SLCO1B1*15/*15 carriers. Furthermore, there was strong evidence for a gene-dose effect (percent with cough in those with 0, 1, or 2 copy of the 521C allele: 28.2%, 42.5%, and 71.4%, trend P = 6.6 × 10−4). Our study highlights, for the first time, SLCO1B1 variants are strongly associated with an increased risk of enalapril-induced cough. The findings will be useful to provide pharmacogenetic markers for enalapril treatment. PMID:26607661

  7. 奥林巴斯E-P1试用报告

    Institute of Scientific and Technical Information of China (English)

    海盗

    2009-01-01

    2009年6月,奥林巴斯首款Micro4/3系统数码相机E—P1终于揭开了神秘的面纱。自从去年Photokina上E—P1的机身模型惊艳亮相后,摄影爱好者、4/3系统拥趸对E—P1的思念随着松下G1和GH1两款Micro4/3系统数码相机的相继问世而与日俱增。

  8. Visualization of bacteriophage P1 infection by cryo-electron tomography of tiny Escherichia coli

    International Nuclear Information System (INIS)

    Bacteriophage P1 has a contractile tail that targets the conserved lipopolysaccharide on the outer membrane surface of the host for initial adsorption. The mechanism by which P1 DNA enters the host cell is not well understood, mainly because the transient molecular interactions between bacteriophage and bacteria have been difficult to study by conventional approaches. Here, we engineered tiny E. coli host cells so that the initial stages of P1-host interactions could be captured in unprecedented detail by cryo-electron tomography. Analysis of three-dimensional reconstructions of frozen-hydrated specimens revealed three predominant configurations: an extended tail stage with DNA present in the phage head, a contracted tail stage with DNA, and a contracted tail stage without DNA. Comparative analysis of various conformations indicated that there is uniform penetration of the inner tail tube into the E. coli periplasm and a significant movement of the baseplate away from the outer membrane during tail contraction.

  9. NEW FIXED POINT THEOREMS FOR P1-COMPACT MAPPINGS IN BANACH SPACES

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    F.E. Browder and W. V. Petryshyn[1] defined the topological degree for Aproper mappings and then W. V. Petryshyn[2] studied a class of A-proper mappings, namely,P1-compact mappings and obtained a number of important fixed point theorems by virtue of the topological degree theory. In this paper, following W. V. Petryshyn[2], we continue to study P1-compact mappings and investigate the boundary condition, under which many new fixed point theorems of P1-compact mappings are obtained. On the other hand, this class of A-proper mappings with the boundedness property includes completely continuous operators and so, certain interesting new fixed point theorems for completely continuous operators are obtained immediately. As a result of it, our results generalize several famous theorems such as Leray-Schauder's theorem, Rothe's theorem, Altman's theorem,Petryshyn's theorem, etc.

  10. P1 and N170 components distinguish human-like and animal-like makeup stimuli.

    Science.gov (United States)

    Luo, Shuwei; Luo, Wenbo; He, Weiqi; Chen, Xu; Luo, Yuejia

    2013-06-19

    This study used event-related potentials to investigate the sensitivity of P1 and N170 components to human-like and animal-like makeup stimuli, which were derived from pictures of Peking opera characters. As predicted, human-like makeup stimuli elicited larger P1 and N170 amplitudes than did animal-like makeup stimuli. Interestingly, a right hemisphere advantage was observed for human-like but not for animal-like makeup stimuli. Dipole source analyses of 130-200-ms window showed that the bilateral fusiform face area may contribute to the differential sensitivity of the N170 component in response to human-like and animal-like makeup stimuli. The present study suggests that the amplitudes of both the P1 and the N170 are sensitive for the mouth component of face-like stimuli.

  11. Sharp weak type estimates for weights in the class $A_{p_1, p_2}$

    CERN Document Server

    Reznikov, Alexander

    2011-01-01

    We get sharp estimates for the distribution function of nonnegative weights, which satisfy so called $A_{p_1, p_2}$ condition. For particular choices of parameters $p_1$, $p_2$ this condition becomes an $A_p$-condition or Reverse H\\"{o}lder condition. We also get maximizers for these sharp estimates. We use the Bellman technique and try to carefully present and motivate our tactics. As an illustration of how these results can be used, we deduce the following result: if a weight $w$ is in $A_2$ then it self-improves to a weight, which satisfies a Reverse H\\"{o}lder condition.

  12. Uranium (VI) adsorption on synthesized 4A and P1 zeolites: Equilibrium, kinetic, and thermodynamic studies

    International Nuclear Information System (INIS)

    The present work deals with the investigation of the use of synthesized 4A and P1 zeolites in the adsorption of uranium (VI) ions from liquid effluents (with initial concentrations of 100, 85 and 80 mgL-1). Batch experiments were performed and the effects of temperature, solid-liquid ratio, pH and initial UO22+ ion concentration were studied, and the optimal parameters were determined. The kinetic and thermodynamic aspects of the process as well as the diffusion mechanism have been studied. The obtained results showed that 4A and P1 zeolites are very effective adsorbents. (authors)

  13. Capitulation in Abelian extensions of some fields ℚ (√{p1p2q , }i )

    Science.gov (United States)

    Azizi, Abdelmalek; Zekhnini, Abdelkader; Taous, Mohammed

    2016-02-01

    We study the capitulation of the 2-ideal classes of an infinite family of imaginary biquadratic number fields consisting of fields k =ℚ (√{p1p2q , }i ), where i =√{-1 } and p1 ≡ p2 ≡ -q ≡ 1 (mod 4) are different primes. For each of the three quadratic extensions K /k inside the absolute genus field k(*) of k , we compute the capitulation kernel of K /k . Then we deduce that each strongly ambiguous class of k /ℚ (i ) capitulates already in k(*), which is smaller than the relative genus field (k/ℚ (i )) *.

  14. Picard groups of higher real $K$-theory spectra at height $p-1$

    OpenAIRE

    Heard, Drew; Mathew, Akhil; Stojanoska, Vesna

    2015-01-01

    Using the descent spectral sequence for a Galois extension of ring spectra, we compute the Picard group of the higher real $K$-theory spectra of Hopkins and Miller at height $n=p-1$, for $p$ an odd prime. More generally, we determine the Picard groups of the homotopy fixed points spectra $E_n^{hG}$, where $E_n$ is Lubin-Tate $E$-theory at the prime $p$ and height $n=p-1$, and $G$ is any finite subgroup of the extended Morava stabilizer group. We find that these Picard groups are always cyclic...

  15. ON THE P1 POWELL-SABIN DIVERGENCE-FREE FINITE ELEMENT FOR THE STOKES EQUATIONS

    Institute of Scientific and Technical Information of China (English)

    Shangyou Zhang

    2008-01-01

    The stability of the P1-P0 mixed-element is established on general Powell-Sabin triangular grids. The piecewise linear finite element solution approximating the velocity is divergence-free pointwise for the Stokes equations. The finite element solution approximating the pressure in the Stokes equations can be obtained as a byproduct if an iterative method is adopted for solving the discrete linear system of equations. Numerical tests are presented confirming the theory on the stability and the optimal order of convergence for the P1 Powell-Sabin divergence-free finite element method.

  16. An enzyme-free catalytic DNA circuit for amplified detection of aflatoxin B1 using gold nanoparticles as colorimetric indicators

    Science.gov (United States)

    Chen, Junhua; Wen, Junlin; Zhuang, Li; Zhou, Shungui

    2016-05-01

    An enzyme-free biosensor for the amplified detection of aflatoxin B1 has been constructed based on a catalytic DNA circuit. Three biotinylated hairpin DNA probes (H1, H2, and H3) were designed as the assembly components to construct the sensing system (triplex H1-H2-H3 product). Cascaded signal amplification capability was obtained through toehold-mediated strand displacement reactions to open the hairpins and recycle the trigger DNA. By the use of streptavidin-functionalized gold nanoparticles as the signal indicators, the colorimetric readout can be observed by the naked eye. In the presence of a target, the individual nanoparticles (red) aggregate into a cross-linked network of nanoparticles (blue) via biotin-streptavidin coupling. The colorimetric assay is ultrasensitive, enabling the visual detection of trace levels of aflatoxin B1 (AFB1) as low as 10 pM without instrumentation. The calculated limit of detection (LOD) is 2 pM in terms of 3 times standard deviation over the blank response. The sensor is robust and works even when challenged with complex sample matrices such as rice samples. Our sensing platform is simple and convenient in operation, requiring only the mixing of several solutions at room temperature to achieve visible and intuitive results, and holds great promise for the point-of-use monitoring of AFB1 in environmental and food samples.An enzyme-free biosensor for the amplified detection of aflatoxin B1 has been constructed based on a catalytic DNA circuit. Three biotinylated hairpin DNA probes (H1, H2, and H3) were designed as the assembly components to construct the sensing system (triplex H1-H2-H3 product). Cascaded signal amplification capability was obtained through toehold-mediated strand displacement reactions to open the hairpins and recycle the trigger DNA. By the use of streptavidin-functionalized gold nanoparticles as the signal indicators, the colorimetric readout can be observed by the naked eye. In the presence of a target, the

  17. Parâmetros hematológicos de frangos de corte alimentados com ração contendo aflatoxina B1 e fumonisina B1

    Directory of Open Access Journals (Sweden)

    Tessari Eliana Neire Castiglioni

    2006-01-01

    Full Text Available O objetivo deste trabalho foi avaliar os efeitos da aflatoxina B1 (AFB1 e da fumonisina B1 (FB1 sobre o hemograma e o leucograma de frangos alimentados com ração contendo as toxinas isoladamente e em associação, nos níveis de 0, 50 e 200mig de AFB1/kg, e/ou 0, 50 e 200mg de FB1/kg. O delineamento experimental foi inteiramente casualizado, em esquema fatorial 3x3, com 9 tratamentos e 12 repetições, totalizando 108 aves. Os frangos foram alimentados com as rações contaminadas do 8degrees até o 41degrees dia de vida. As aves de todos os grupos alimentados com micotoxinas apresentaram redução (P<0,05 nos valores de hematócrito, hemoglobina e número de hemácias, caracterizando um quadro de anemia, sendo que os grupos mais afetados foram os que receberam as maiores concentrações das toxinas em associação. Observou-se um menor (P<0,05 número de leucócitos em todos os tratamentos, porém esta redução foi mais intensa nos grupos tratados com 200mig/kg de AFB1, com ou sem FB1. Conclui-se que a AFB1 e a FB1, isoladas ou em associação, nos níveis utilizados no estudo, podem afetar negativamente os parâmetros hematológicos de frangos de corte.

  18. Panax ginseng extract modulates oxidative stress, DNA fragmentation and up-regulate gene expression in rats sub chronically treated with aflatoxin B1 and fumonisin B 1.

    Science.gov (United States)

    Hassan, Aziza M; Abdel-Aziem, Sekena H; El-Nekeety, Aziza A; Abdel-Wahhab, Mosaad A

    2015-10-01

    Aflatoxins and fumonisins are important food-borne mycotoxins implicated in human health and have cytotoxic effects. The aims of the current study were to evaluate the protective role of Panax ginseng extract (PGE) against the synergistic effect of subchronic administration of aflatoxin B1 (AFB1) and fumonisin B1 (FB1) on DNA and gene expression in rat. Female Sprague-Dawley rats were divided into eight groups (ten rats/group) and treated for 12 weeks including the control group, the group having received AFB1 (80 µg/kg bw), the group having received FB1 (100 µg/kg bw), the group having received AFB1 plus FB1 and the groups having received PGE (20 mg/kg bw) alone or with AFB1 and/or FB1. At the end of experiment, liver and kidney were collected for the determination of DNA fragmentation, lipid peroxidation (LP), glutathione (GSH) contents and alterations in gene expression. The results indicated that these mycotoxins increased DNA fragmentation, LP and decreased GSH content in liver and kidney and down-regulated gene expression of antioxidants enzymes. The combined treatments with AFB1 and/or FB1 plus PGE suppressed DNA fragmentation only in the liver, normalized LP and increased GSH in the liver and kidney as well as up-regulated the expression of GPx, SOD1 and CAT mRNA. It could be concluded that AFB1 and FB1 have synergistic genotoxic effects. PGE induced protective effects against their oxidative stress and genotoxicity through its antioxidant properties. PMID:24748134

  19. Compressibility and structural stability of CeN from experiment and theory. The B1–B2 transition

    DEFF Research Database (Denmark)

    Staun Olsen, J.; Jørgensen, J.-E.; Gerward, L.;

    2012-01-01

    The high-pressure structural stability of CeN is investigated by experiment and theory. Experiments are carried out by energy-dispersive X-ray diffraction and synchrotron radiation, using a diamond anvil cell, to a maximum pressure of 77GPa. The experimental results are in remarkably good agreement...... with ab initio calculations using the full-potential linear muffin-tin orbital method within the generalized gradient approximation (GGA). The experimental zero pressure bulk modulus is B0=156(3)GPa, the pressure derivative being constrained to B0′=4.00. The corresponding calculated data are B0=158.1GPa...... and B0′=3.3. We report here the first experimental observation of the transformation of CeN from the ambient B1 type crystal structure to the B2 type. The onset of the transition is in the range 65–70GPa, and the relative volume change at the transition is ΔV/V=−10.9(3)%. These data compare well...

  20. Maro Reef Site P1 9/15/2002 32-33M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Maro Reef, site P1 (25.357 N, 170.495 W), between 32 and 33 meters along a permanent transect.

  1. French Frigate Shoals Site P1A 11/1/2002 7-8M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P1A (23.854N, 166.323 W), between 7 and 8 meters along a permanent transect.

  2. French Frigate Shoals Site P1 7/14/2001 36-37M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P1 (23.855N, 166.323W), between 36 and 37 meters along a permanent transect.

  3. Maro Reef Site P1 9/15/2002 23-24M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Maro Reef, site P1 (25.357 N, 170.495 W), between 23 and 24 meters along a permanent transect.

  4. Maro Reef Site P1 9/15/2002 2-3M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Maro Reef, site P1 (25.357 N, 170.495 W), between 2 and 3 meters along a permanent transect.

  5. Inhibition of human glutathione S-transferase P1-1 by the flavonoid quercetin

    NARCIS (Netherlands)

    Zanden, J.J. van; Hamman, O.B.; Iersel, M.L.P.S. van; Boeren, S.; Cnubben, N.H.P.; Lo Bello, M.; Vervoort, J.; Bladeren, P.J. van; Rietjens, I.M.C.M.

    2003-01-01

    In the present study, the inhibition of human glutathione S-transferase P1-1 (GSTP1-1) by the flavonoid quercetin has been investigated. The results show a time- and concentration-dependent inhibition of GSTP1-1 by quercetin. GSTP1-1 activity is completely inhibited upon 1 h incubation with 100 μM q

  6. Necker Island Site P1 9/10/2002 54-55M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Necker Island, site P1 23.575N , 164.705W, between 54 and 55 meters along a permanent transect.

  7. French Frigate Shoals Site P1 7/14/2001 2-3M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P1 23.855N, 166.323W, between 2 and 3 meters along a permanent transect.

  8. Nihoa island Site P1 9/9/2002 12-13M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Nihoa island, site P1 (23.062N, 161.929W), between 12 and 13 meters along a permanent transect.

  9. Effect of E8010-P1 electrode composition on the weld metal properties

    International Nuclear Information System (INIS)

    Different manufactures produce E8010-P1 electrode with different chemical compositions due to the relatively wide range of permissible alloying elements in the composition of this electrode. Four groups of E8010-P1 electrodes, with different compositions, were selected and effect of electrode composition on the microstructure and mechanical properties of weld meal were examined. Microstructural studies revealed that presence of the Mn, Mo and Ni in the weld metal influences significantly on the morphology of ferrite in the weld metal zone. Large amount of Mn (around 1%) in the weld metal leads to the formation of fine acicular ferrite in the weld metal. Furthermore, presence of Mo (around 0.4%) in the weld metal prevents formation of continuous grain boundary ferrite in the weld zone. Mechanical properties investigations reveal that the more acicular ferrite in the weld metal, the higher strength and ductility of this zone. -- Highlights: • Mn and Mo resulted in formation of acicular ferrite in the weld metal. • Composition of E8010-P1 has significant effect on the structural and mechanical properties of weld area. • Optimal chemical composition of pipe line E8010-P1 was determined

  10. Maro Reef Site P1 9/15/2002 21-22M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Maro Reef, site P1 (25.357 N, 170.495 W), between 21 and 22 meters along a permanent transect.

  11. French Frigate Shoals Site P1A 9/13/2002 38-39M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P1A (23.854N, 166.323 W), between 38 and 39 meters along a permanent transect.

  12. P1-NONCONFORMING QUADRILATERAL FINITE VOLUME ELEMENT METHOD AND ITS CASCADIC MULTIGRID ALGORITHM FOR ELLIPTIC PROBLEMS

    Institute of Scientific and Technical Information of China (English)

    Hong-ying Man; Zhong-ci Shi

    2006-01-01

    In this paper, we discuss the finite volume element method of P1-nonconforming quadrilateral element for elliptic problems and obtain optimal error estimates for general quadrilateral partition. An optimal cascadic multigrid algorithm is proposed to solve the nonsymmetric large-scale system resulting from such discretization. Numerical experiments are reported to support our theoretical results.

  13. Pearl & Hermes Atoll Site P1 6/13/2000 75-76M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Pearl Hermes Atoll, site P1 27.831N, 175.751 W, between 75 and 76 meters along a permanent transect.

  14. French Frigate Shoals Site P1 7/14/2001 10-11M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P1 23.855N, 166.323W, between 10 and 11 meters along a permanent transect.

  15. Nihoa island Site P1 9/9/2002 7-8M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Nihoa island, site P1 (23.062N, 161.929W), between 7 and 8 meters along a permanent transect.

  16. Laysan Island Site P1 9/17/2002 37-38M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Laysan Island, site P1 (25.774 N, 171.743 W), between 37 and 38 meters along a permanent transect.

  17. Maro Reef Site P1 9/15/2002 27-28M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Maro Reef, site P1 (25.357 N, 170.495 W), between 27 and 28 meters along a permanent transect.

  18. Laysan Island Site P1 9/17/2002 44-45M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Laysan Island, site P1 (25.774 N, 171.743 W), between 44 and 45 meters along a permanent transect.

  19. French Frigate Shoals Site P1A 9/13/2002 50-51M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P1A (23.854N, 166.323 W), between 50 and 51 meters along a permanent transect.

  20. Maro Reef Site P1 9/15/2002 22-23M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Maro Reef, site P1 25.357 N, 170.495 W, between 22 and 23 meters along a permanent transect.

  1. French Frigate Shoals Site P1A 11/1/2002 10-11M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P1A (23.854N, 166.323 W), between 10 and 11 meters along a permanent transect.

  2. Choline Modulation of the Aβ P1-40 Channel Reconstituted into a Model Lipid Membrane

    Directory of Open Access Journals (Sweden)

    Daniela Meleleo

    2010-01-01

    Full Text Available Nicotinic acetylcholine receptors (AChRs, implicated in memory and learning, in subjects affected by Alzheimer's disease result altered. Stimulation of α7-nAChRs inhibits amyloid plaques and increases ACh release. β-amyloid peptide (AβP forms ion channels in the cell and model phospholipid membranes that are retained responsible in Alzheimer disease. We tested if choline, precursor of ACh, could affect the AβP1-40 channels in oxidized cholesterol (OxCh and in palmitoyl-oleoyl-phosphatidylcholine (POPC:Ch lipid bilayers. Choline concentrations of 5 × 10−11 M–1.5 × 10−8 M added to the cis- or trans-side of membrane quickly increased AβP1-40 ion channel frequency (events/min and ion conductance in OxCh membranes, but not in POPC:Ch membranes. Circular Dichroism (CD spectroscopy shows that after 24 and 48 hours of incubation with AβP1-40, choline stabilizes the random coil conformation of the peptide, making it less prone to fibrillate. These actions seem to be specific in that ACh is ineffective either in solution or on AβP1-40 channel incorporated into PLMs.

  3. Maro Reef Site P1 9/15/2002 4-5M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Maro Reef, site P1 (25.357 N, 170.495 W), between 4 and 5 meters along a permanent transect.

  4. Nihoa island Site P1 9/9/2002 45-46M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Nihoa island, site P1 23.062N, 161.929W, between 45 and 46 meters along a permanent transect.

  5. Pearl & Hermes Atoll Site P1 6/13/2000 76-77M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Pearl Hermes Atoll, site P1 27.831N, 175.751 W, between 76 and 77 meters along a permanent transect.

  6. Orbits and photometry of Pluto's satellites: Charon, S/2005 P1 and S/2005 P2

    CERN Document Server

    Buie, M W; Young, E F; Young, L A; Stern, S A

    2005-01-01

    We present new astrometry of Pluto's three satellites from images taken of the Pluto system during 2002-3 with the High Resolution Camera (HRC) mode of the Advanced Camera for Surveys (ACS) instrument on the Hubble Space Telescope. The observations were designed to produce an albedo map of Pluto but they also contain images of Charon and the two recently discovered satellites, S/2005 P1 and S/2005 P2. Orbits fitted to all three satellites are co-planar and, for Charon and P2, have eccentricities consistent with zero. The orbit of the outermost satellite, P1, has a significant eccentricity of 0.0052 +/- 0.0011. Orbital periods of P1, P2, and Charon are 38.2065 +/- 0.0014, 24.8562 +/- 00013, and 6.3872304 +/- 0.0000011 days, respectively. The total system mass based on Charon's orbit is 1.4570 +/- 0.0009 x 10^22 kg. We confirm previous results that orbital periods are close to the ratio of 6:4:1 (P1:P2:Charon) indiciative of mean-motion resonances, but our results formally preclude precise integer period ratios...

  7. Fermionic expressions for the characters of c{sub p,1} logarithmic conformal field theories

    Energy Technology Data Exchange (ETDEWEB)

    Flohr, Michael [Institut fuer Theoretische Physik, Leibniz-Universitaet Hannover, Appelstrasse 2, D-30167 Hannover (Germany)]. E-mail: flohr@itp.uni-hannover.de; Grabow, Carsten [Institut fuer Theoretische Physik, Leibniz-Universitaet Hannover, Appelstrasse 2, D-30167 Hannover (Germany)]. E-mail: grabow@itp.uni-hannover.de; Koehn, Michael [Institut fuer Theoretische Physik, Leibniz-Universitaet Hannover, Appelstrasse 2, D-30167 Hannover (Germany)]. E-mail: koehn@itp.uni-hannover.de

    2007-04-23

    We present fermionic quasi-particle sum representations consisting of a single fundamental fermionic form for all characters of the logarithmic conformal field theory models with central charge c{sub p,1}, p>=2, and suggest a physical interpretation. We also show that it is possible to correctly extract dilogarithm identities.

  8. Necker Island Site P1 9/10/2002 37-38M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Necker Island, site P1 (23.575N , 164.705W), between 37 and 38 meters along a permanent transect.

  9. Absence of Mycoplasma pneumoniae cytadsorption protein P1 in Mycoplasma genitalium and Mycoplasma gallisepticum.

    OpenAIRE

    Baseman, J B; Drouillard, D L; Leith, D K; Tully, J. G.

    1984-01-01

    Polyclonal and monoclonal antibodies to Mycoplasma pneumoniae protein P1 were nonreactive with whole-cell or soluble preparations of M. genitalium and M. gallisepticum. However, radioimmunoprecipitation performed with hyperimmune rabbit sera raised against each mycoplasma species indicated antigenic cross-reactivity between M. pneumoniae and M. genitalium.

  10. Maro Reef Site P1 9/15/2002 9-10M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Maro Reef, site P1 (25.357 N, 170.495 W), between 9 and 10 meters along a permanent transect.

  11. French Frigate Shoals Site P1A 11/1/2002 28-29M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at French Frigate Shoals, site P1A 23.854N, 166.323 W, between 28 and 29 meters along a permanent transect.

  12. French Frigate Shoals Site P1 7/14/2001 11-12M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at French Frigate Shoals, site P1 (23.855N, 166.323W), between 11 and 12 meters along a permanent transect.

  13. Factors that contribute to the mycoparasitism stimulus in Trichoderma atroviride strain P1

    Institute of Scientific and Technical Information of China (English)

    Woo S L; Lorito M; Formisano E; Fogliano V; Cosenza C; Mauro A; Turrà D; Soriente I; Ferraioli S; Scala F

    2004-01-01

    @@ Trichoderma atroviride strain P1 has been used extensively to study the mycoparasitic mechanisms in the interaction between plant pathogenic host and beneficial antagonistic fungi. Mutants of P1 containing the green fluorescent protein (gfp) or glucose oxidase (gox) reporter systems and different inducible promoters (from the exochitinase nag1 gene, or the endochitinase ech42 gene of P1) were used to determine the factors that activate the biocontrol gene expression cascade in the antagonist. The following compounds were tested singly and in various combinations: purified Trichoderma P1 enzymes (endochitinase, exochitinase, chitobiosidase,glucanase); antagonist culture filtrates (T. atroviride P1 wild-type and relative knock-out mutants, T.harzianum, T. reesei); pathogen culture filtrates (Botrytis, Pythium, Rhizoctonia); purified fungal cell walls (CWs) from Trichoderma , Botrytis, Pythium, Rhizoctonia; colloidal crab shell chitin; and plant extracts from cucumber leaves, stems or roots. Strong induction of mycoparasitism was found with the various digestion products produced by treating fungal CWs and colloidal chitin with purified enzymes or fungal culture filtrates. Filtrates from chitinase knock-out mutants, as well as CWs from Oomycetes fungi, were less active in producing the stimulus for mycoparasitism. The host CW digestion products were separated by molecular weight (MW) to determine which compounds were able to activate Trichoderma. Micromolecules of MW less than 3 kDa were found to trigger mycoparasitism gene expression before physical contact with the host pathogen. These compounds stimulated mycelial growth and spore germination of the antagonist. Purification of these host-derived compounds was conducted by HPLC and in vivo assay. The obtained inducers were able to stimulate both the production of endochitinase and exochitinase enzymes, even under repressing conditions in the presence of glucose. Inducers stimulated the biocontrol effect of P1 in

  14. Energy distribution in CF 2( 1B 1) from the triplet-triplet annihilation of CF 2( 3B 1) and from the vacuum ultraviolet photolysis of C 2F 4

    Science.gov (United States)

    Koda, Seiichiro

    1980-02-01

    Spectral analysis of the CF 2( 1B 1) → CF 2( 1A 1) transition showed that the energy distribution found in the v2 bending vibration ( v'2 ⩽ 3) of CF 2( 1B 1) produced from the triplet-triplet annihilation of CF 2( 3B 1) and from the vacuum ultraviolet photolysis of C 2F 4 are approximately statistical and closely related to each other.

  15. [Biofilm Formation by the Nonflagellated flhB1 Mutant of Azospirillum brasilense Sp245].

    Science.gov (United States)

    Shelud'ko, A V; Filip'echeva, Yu A; Shumiliva, E M; Khlebtsov, B N; Burov, A M; Petrova, L P; Katsy, E I

    2015-01-01

    Azospirillum brasilense Sp245 with mixed flagellation are able to form biofilms on various surfaces. A nonflagellated mutant of this strain with inactivated chromosomal copy of the flhB gene (flhB1) was shown to exhibit specific traits at the later stages of biofilm formation on a hydrophilic (glass) surface. Mature biofilms of the flhB1::Omegon-Km mutant Sp245.1063 were considerably thinner than those of the parent strain Sp245. The biofilms of the mutant were more susceptible to the forces of hydrodynamic shear. A. brasilense Sp245 cells in biofilms were not found to possess lateral flagella. Cells with polar flagella were, however, revealed by atomic force microscopy of mature native biofilms of strain Sp245. Preservation of a polar flagellum (probably nonmotile) on the cells of A. brasilense Sp245 may enhance the biofilm stability.

  16. FDC-B1: a new monoclonal antibody directed against bovine follicular dendritic cells.

    Science.gov (United States)

    Mélot, F; Defaweux, V; Jolois, O; Collard, A; Robert, B; Heinen, E; Antoine, N

    2004-01-01

    Follicular dendritic cells (FDCs) are a unique population of accessory cells located in the light zone of the germinal centres of lymphoid follicles. Their involvement in the generation of humoral immune responses implies a potential role for these cells in many disorders. Indeed, in prion diseases, FDCs seem to be the major sites of extraneuronal cellular prion protein expression and the principal sites of the infectious agent accumulation in lymphoid organs. The identification of FDC is useful for the analysis of their distribution in reactive lymphoid tissue as well as in pathological conditions. The production and characterisation of a new mouse monoclonal antibody directed against bovine follicular dendritic cells (FDC-B1) is reported. The antigen detected by FDC-B1 is expressed exclusively on the surface of FDCs in ruminant lymphoid organs. The antigen has an approximate molecular weight of 28 kDa. PMID:14700533

  17. Emericella astellata, a new producer of aflatoxin B-1, B-2 and sterigmatocystin

    DEFF Research Database (Denmark)

    Frisvad, Jens Christian; Samson, R.A.; Smedsgaard, Jørn

    2004-01-01

    To report on aflatoxin B-1 and B-2 production from a species of Emericella. Methods and Results: Aflatoxins and sterigmatocystin were determined by high-pressure liquid chromatography (HPLC) with diode array detection and confirmed by HPLC with mass spectrometry detection. Among 30 known species...... of Emericella only one species produced aflatoxin. Strains originating from the same geographical source material had different patterns of aflatoxin and sterigmatocystin production on different media, indicating that epigenetic factors may be involved in the regulation of aflatoxin production. However, two...... cultures from the same original genet were very similar. Conclusions: Emericella astellata can produce small amounts of sterigmatocystin and aflatoxin B-1 and B-2. Significance and Impact of the Study: Emericella has been used extensively in genetic studies and therefore the isolates producing aflatoxin...

  18. Vitamin B1 and B6 in the malaria parasite: requisite or dispensable?

    Directory of Open Access Journals (Sweden)

    C. Wrenger

    2008-02-01

    Full Text Available Vitamins are essential compounds mainly involved in acting as enzyme co-factors or in response to oxidative stress. In the last two years it became apparent that apicomplexan parasites are able to generate B vitamers such as vitamin B1 and B6 de novo. The biosynthesis pathways responsible for vitamin generation are considered as drug targets, since both provide a high degree of selectivity due to their absence in the human host. This report updates the current knowledge about vitamin B1 and B6 biosynthesis in malaria and other apicomplexan parasites. Owing to the urgent need for novel antimalarials, the significance of the biosynthesis and salvage of these vitamins is critically discussed in terms of parasite survival and their exploitation for drug development.

  19. ESTIMATION OF AFLATOXIN B1 IN FEED INGREDIENTS AND COMPOUND POULTRY FEEDS

    Directory of Open Access Journals (Sweden)

    Bashir Mahmood Bhatti, Tanzeela Talat and Rozina Sardar

    2001-02-01

    Full Text Available A total of 3230 samples of feed ingredients of vegetable and animal origin and commercially available compound poultry feed received over a period of 5 years at Feed Testing Laboratory of the Institute were tested for Aflatoxin B1 contents (ppb . In all feed ingredients and compound feed stuffs, minimum level of aflatoxin B1 was 13 ppb and maximum level was found to be 78 ppb. No correlation of aflatoxin levels with month of collection of the year which are subject to variation in temperature and humidity could be detected. Mean values of aflatoxin concentration in feed stuffs such as rice, rice polish, wheat bran, wheat bread, maize, fish meal, blood meal, bone meal, guar meal, corn gluten 30%, corn gluten 60%, sun flower meal, soyabean meal and cotton seed meal were found to be higher than safe level of 20 ppb recommended by FDA.

  20. The influence of alloying elements in aluminium on the grain refinement with ALTI5B1

    Directory of Open Access Journals (Sweden)

    Naglič I.

    2009-07-01

    Full Text Available This work deals with the influence of alloying elements in aluminium on the grain refinement with various additions of AlTi5B1. Grain-refinement tests were made at a cooling rate of 15 °C/s. The results revealed that in both aluminium and an Al-Fe alloy the grain size decreases with increasing additions of the AlTi5B1 grain refiner. We found that for the same boron content the grain size was smaller in the case of the Al-Fe alloy. The difference in the grain sizes for the same content of boron was approximately 15 μm; this is considerably smaller than the difference between the grain sizes in samples with the same difference of growth-restricting factor made at slower cooling rates.

  1. Human infections caused by Brevibacterium casei, formerly CDC groups B-1 and B-3.

    OpenAIRE

    Gruner, E; Steigerwalt, A G; Hollis, D G; Weyant, R S; Weaver, R E; Moss, C W; M Daneshvar; J. M. Brown; Brenner, D J

    1994-01-01

    Forty-one clinical strains of CDC coryneform groups B-1 and B-3 were compared biochemically, by analysis of cell wall sugars, amino acids, and cellular fatty acids, and by DNA relatedness to the type strains of Brevibacterium casei, Brevibacterium epidermidis, and Brevibacterium linens. Twenty-two strains were shown to be B. casei, while five other strains formed a phenotypically inseparable genomospecies in the same genus. The remaining isolates were genetically heterogeneous, and most are p...

  2. Hidden Color and the b1 Structure Function of the Deuteron

    International Nuclear Information System (INIS)

    The b1 structure function is an observable feature of a spin-1 system sensitive to non-nucleonic components of the target nuclear wave function. A simple model for hidden-color, six-quark configurations is proposed and found to give substantial contributions for values of x > 0.2. Good agreement with Hermes data is obtained. Predictions are made for an upcoming JLab experiment. (author)

  3. Emericella venezuelensis, a new species with stellate ascospores producing sterigmatocystin and aflatoxin B-1

    DEFF Research Database (Denmark)

    Frisvad, Jens Christian; Samson, R.A.

    2004-01-01

    media. The three species also differ in their profiles of extrolites (secondary metabolites). Emericella venezuelensis produces aflatoxin B-1, sterigmatocystin, and terrein and compounds with chromophores of the shamixanthone, emerin and desertorin type of compounds. F. variecolor produces asteltoxin......, variecoxanthone A, B, C, isoemericellin, kojic acid, varitriol, varioxiran, dihydroterrein, 7-hydroxyemodin, avariquinone and stromemycin. E. pluriseminata produces several unknown specific extrolites. E. venezuelensis is the first organism of marine origin reported to produce aflatoxin. Aflatoxin production by E...

  4. ATP8B1 deficiency; Pathophysiology and treatment of a cholestatic syndrome with extrahepatic symptoms

    OpenAIRE

    Stapelbroek, J.M.

    2009-01-01

    ATP8B1 deficiency is a severe and clinically highly variable hereditary disorder that is primarily characterized by intrahepatic cholestasis. It generally presents as a permanent disorder, progressive familial intrahepatic cholestasis type 1 (PFIC1), or with intermittent cholestasis (benign recurrent intrahepatic cholestasis type 1 (BRIC1)). Currently there is no effective medical therapy, and most patients need invasive surgery such as partial biliary drainage (PBD) or liver transplantation....

  5. Aflatoxin B1-producing Aspergillus in sun-dried medicinal plant materials

    OpenAIRE

    Chinaputi, A.; Lim, S; Petcharat, V.; Chuenchit, S.; Pathanadech, A.

    2001-01-01

    Fifty sun-dried medicinal plants were obtained from fraditional drug stores in Songkhla Province, Thailand, and examined for Aspergillus and aflatoxin B1. 288 isolates of Aspergillus were obtaines by standard blotter plate and 25 species were identified. The most common species were A. niger with 99 isolates, A. Flavus 84 isolates, A. terreus 33 isolates, A. oryzae 25 isolates, A.nidulans (Emericella nidulans) 10 isolates, A fumigatus 9 isolates and A. chevalieri (Eurotium chevalieri) 8 isola...

  6. Occurrence of B1 Aflatoxin in diet and M1 Aflatoxin in bovine milk

    OpenAIRE

    Adriana Frizzarin; Thiago Pereira Motta; Thamires Martins; Livia Castelani; Heloisa Solda de Azevedo; Cláudia Rodrigues Pozzi

    2012-01-01

    Ensuring food quality is one of the principles of food safety. Food for dairy cattle may be contaminated by fungi of the genus Aspergillus, which produce aflatoxins. The B1 aflatoxin, when ingested by animals, is biotransformed in liver in several other toxic metabolites, including M1 aflatoxin which is excreted in milk. M1 aflatoxin has a carcinogenic effect, which the presence in milk poses a serious risk to public health because milk and dairy products are consumed mainly by children, preg...

  7. Indirect determination of aflatoxin B1 in beer by a multicommuted optical sensor

    OpenAIRE

    Molina García, Lucía Molina; Fernández De Córdova, M. Luisa; Ruiz Medina, Antonio

    2012-01-01

    Abstract This manuscript reports the determination of Aflatoxin B1 (AFB1), mycotoxin which is considered one of the most carcinogenic substances known. A multicommuted flow injection-solid phase spectroscopy (FI-SPS) system combined with photochemically-induced fluorescence (PIF) is developed, for the first time, for its determination with quantitative purposes. A strongly fluorescent degradation product is obtained on-line by irradiation with ultraviolet light. The determination i...

  8. Effect of phenolic antioxidants on the mutagenicity of aflatoxin B1.

    OpenAIRE

    Shelef, L. A.; Chin, B

    1980-01-01

    The Ames assay employing Salmonella typhimurium TA100 and TA98 was used to investigate potential interactions between aflatoxin B1 (AFB1) and the phenolic antioxidants butylated hydroxytoluene, butylated hydroxyanisole, and propyl gallate. AFB1 doses were within the linear response range, and the antioxidants were used at levels of 0 to 50 micrograms per plate. All three antioxidants were nonmutagenic in either bacterial tester strain, with or without the hepatic S-9 enzyme preparation; toxic...

  9. Stratigraphic structure of the B1 Tertiary tectonostratigraphic unit in eastern Slovenia

    OpenAIRE

    Bogomir Jelen; Helena Rifelj

    2002-01-01

    High inconsistency and incoherence in the stratigraphy of the Slovenian upper Paleogene and lower Miocene have remained unsolved in the past 150 years. To solve the problem, we tried to rigorously conduct the authentic Galilei’s scientific method. Steps of logical and empirical verification confirmed the existence of the posited B1 Tertiary tectonostratigraphic unit, and a general chronostratigraphic model of new positional relationships of lithologic units resulted from rather good biochrono...

  10. Effect of gamma radiation on the inactivation of aflatoxin B1 in food and feed crops

    International Nuclear Information System (INIS)

    Samples of food crops (peanut, peeled pistachio, unpeeled pistachio, rice, and corn) and feed (barley, bran, corn) were sterilized then inoculated with 106 of spore suspension of an isolate of Aspergillus flavus fungus known to produce aflatoxin B1 . Food and feed samples were irradiated with gamma radiation at the doses 4, 6, and 10 kGy. Results indicated that degradation of Aflatoxin B1 was positively correlated with the increase in the applied dose of gamma ray for each tested sample. For example, at a dose of 4 KGy. Percentages of aflatoxin B1 degradation were 8.4, 9.7, 16.6 and 23.5, and 43.97% for peanuts, peeled pistachios, unpeeled pistachios, corn and rice, consecutively . Whereas, at a dose of 10 KGy percentages of aflatoxin degradation reached highest values at 58.6, 68.8, 84.6, 81.1 and 87.8% for peanuts, peeled pistachios, unpeeled pistachios, corn and rice, consecutively In feed samples percentages of aflatoxin degradation were 45, 66, and 90% in barley, 47, 75, and 86% in bran, and 31, 72, and 84% in corn for the doses of 4, 6, and 10 KGy, consecutively. Aflatoxin degradation in food samples correlated negatively with oil content in irradiated samples. Thus, in peanuts, which contained the highest oil content, percentage of aflatoxin degradation at 10 KGy was not more than 56.6%, whereas, the corresponding value in corn, which contained the highest oil content, reached as high as 80%. The above results indicate the possibility of using gamma irradiation as a means of degradation of aflatoxin B1 in food and feed crops to lower than the maximum allowed levels using a maximum dose of radiation of 10 KGy which represents the permitted dose of radiation for such type of crops.(author)

  11. Genome sequence of the Bacteroides fragilis phage ATCC 51477-B1

    Directory of Open Access Journals (Sweden)

    Hawkins Shawn A

    2008-08-01

    Full Text Available Abstract The genome of a fecal pollution indicator phage, Bacteroides fragilis ATCC 51477-B1, was sequenced and consisted of 44,929 bases with a G+C content of 38.7%. Forty-six putative open reading frames were identified and genes were organized into functional clusters for host specificity, lysis, replication and regulation, and packaging and structural proteins.

  12. Exercices de grammaire B1 du cadre européen

    CERN Document Server

    Beaulieu, Christian

    2007-01-01

    Ce cahier d'exercices s'adresse à des apprenants en français. Il présente des activités d'entraînement correspondant au niveau B1 du Cadre Européen commun de référence pour les langues. Ce cahier peut être utilisé en classe ou en autonomie.

  13. Androgen regulation of CYP4B1 responsible for mutagenic activation of bladder carcinogens in the rat bladder: detection of CYP4B1 mRNA by competitive reverse transcription-polymerase chain reaction.

    Science.gov (United States)

    Imaoka, S; Yoneda, Y; Sugimoto, T; Ikemoto, S; Hiroi, T; Yamamoto, K; Nakatani, T; Funae, Y

    2001-05-26

    Significant sex differences exist among cases of bladder cancer in humans as well as in experimental animals such as rats. Aromatic amines such as benzidine and 2-naphthylamine are known to induce bladder cancer. These carcinogenic amines are activated to genotoxic substances by cytochrome P 450 CYP4B1, which is present in bladder mucosa. In this study, regulation of CYP4B1 was investigated to elucidate sex difference in bladder carcinogenesis. Competitive reverse transcription-polymerase chain reaction was used to investigate the expression of rat CYP4B1 mRNA occurring in small amounts of tissue such as bladder tissue. Expression of CYP4B1 in the bladder of male rats increased with development but not in that of female rats. Moreover, mature male rats exhibited higher expression of CYP4B1 in the bladder than did mature female rats. Castration of male rats decreased CYP4B1 levels and treatment with testosterone led to a partial recovery of CYP4B1 levels. These results indicate that CYP4B1 levels in the rat bladder are partly regulated by androgens. Furthermore, the present findings suggest that the sex difference observed in bladder carcinogenesis was due to sex-different expression of CYP4B1 in bladder tissue. PMID:11311483

  14. Overgroups of D1(F) in B1(F) and its pronor-madity%D1(F)在B1(F)中的扩群及其泛正规性

    Institute of Scientific and Technical Information of China (English)

    金永容

    2001-01-01

    域F上D1(1≥4)型Chevalley群D1(F)可自然地嵌入到B1(F)中去.当Chr F≠2,且F=F2时,本文定出了D1(F)在(B1(F)中的所有扩群,由此获得了B1(F)的一类极大子群.进而证明了D1(F)是B1(F)的泛正规子群.

  15. Transcription from the P1 promoters of Micromonospora echinospora in the absence of native upstream DNA sequences.

    OpenAIRE

    Baum, E Z; Buttner, M J; Lin, L S; Rothstein, D. M.

    1989-01-01

    We demonstrated previously that the 0.4-kilobase DNA fragment from Micromonospora echinospora contains multiple tandem promoters, P1a, P1b, P1c, and P2, which are also functional when cloned into Streptomyces lividans. We now show by in vitro transcription with Streptomyces RNA polymerase that each of these promoters is an authentic initiation site, rather than a processing site for transcripts which initiate further upstream. The DNA sequence requirements for the closely spaced promoters P1a...

  16. Calcium Homeostasis and Muscle Energy Metabolism Are Modified in HspB1-Null Mice

    Directory of Open Access Journals (Sweden)

    Brigitte Picard

    2016-05-01

    Full Text Available Hsp27—encoded by HspB1—is a member of the small heat shock proteins (sHsp, 12–43 kDa (kilodalton family. This protein is constitutively present in a wide variety of tissues and in many cell lines. The abundance of Hsp27 is highest in skeletal muscle, indicating a crucial role for muscle physiology. The protein identified as a beef tenderness biomarker was found at a crucial hub in a functional network involved in beef tenderness. The aim of this study was to analyze the proteins impacted by the targeted invalidation of HspB1 in the Tibialis anterior muscle of the mouse. Comparative proteomics using two-dimensional gel electrophoresis revealed 22 spots that were differentially abundant between HspB1-null mice and their controls that could be identified by mass spectrometry. Eighteen spots were more abundant in the muscle of the mutant mice, and four were less abundant. The proteins impacted by the absence of Hsp27 belonged mainly to calcium homeostasis (Srl and Calsq1, contraction (TnnT3, energy metabolism (Tpi1, Mdh1, PdhB, Ckm, Pygm, ApoA1 and the Hsp proteins family (HspA9. These data suggest a crucial role for these proteins in meat tenderization. The information gained by this study could also be helpful to predict the side effects of Hsp27 depletion in muscle development and pathologies linked to small Hsps.

  17. Variant alleles of the CYP1B1 gene are associated with colorectal cancer susceptibility

    International Nuclear Information System (INIS)

    CYP1B1 is a P450 enzyme which is involved in the activation of pro-carcinogens to carcinogens as well as sex hormone metabolism. Because differences in the activity of the enzyme have been correlated with variant alleles of single nucleotide polymorphisms (SNPs), it represents an attractive candidate gene for studies into colorectal cancer susceptibility. We genotyped 597 cancer patients and 597controls for three CYP1B1 SNPs, which have previously been shown to be associated with altered enzymatic activity. Using the three SNPs, eight different haplotypes were constructed. The haplotype frequencies were estimated in cases and controls and then compared. The odds ratio for each tumour type, associated with each haplotype was estimated, with reference to the most common haplotype observed in the controls. The three SNPs rs10012, rs1056827 and rs1056836 alone did not provide any significant evidence of association with colorectal cancer risk. Haplotypes of rs1056827 and rs10012 or rs1056827 and rs1056836 revealed an association with colorectal cancer which was significantly stronger in the homozygous carriers. One haplotype was under represented in the colorectal cancer patient group compared to the control population suggesting a protective effect. Genetic variants within the CYP1B1 that are associated with altered function appear to influence susceptibility to a colorectal cancer in Poland. Three haplotypes were associated with altered cancer risk; one conferred protection and two were associated with an increased risk of disease. These observations should be confirmed in other populations

  18. Stratigraphic structure of the B1 Tertiary tectonostratigraphic unit in eastern Slovenia

    Directory of Open Access Journals (Sweden)

    Bogomir Jelen

    2002-06-01

    Full Text Available High inconsistency and incoherence in the stratigraphy of the Slovenian upper Paleogene and lower Miocene have remained unsolved in the past 150 years. To solve the problem, we tried to rigorously conduct the authentic Galilei’s scientific method. Steps of logical and empirical verification confirmed the existence of the posited B1 Tertiary tectonostratigraphic unit, and a general chronostratigraphic model of new positional relationships of lithologic units resulted from rather good biochronostratigraphic resolution achieved by nannoplankton and planktonic foraminifera biostratigraphy. The application of principles of newly developed fields in science helped us to avoid errors in transmission of messages (to reduce noise from the source (rock to the concept formation,which had been done previously. This in turn has strongly reduced inconsistency andincoherence (high information entropy = uncertainty. The released amount of information enabled us to answer also questions that reached beyond the original difficulty, e.g.: is the tectonostratigraphic structure of eastern Slovenia a manifestation of plate tectonics processes, and of which ones, are theories of continental escape in the Alps and associated dissection and offset of the formerly uniform Slovenian-Hungarian Paleogene basin tenableor not, are then there in the B1 stratigraphic equivalents of the Hungarian Paleogene basin formations, where are the important Eocene / Oligocene, Paleogene / Neogene, Rupelian / Chattian and Kiscellian / Egerian boundaries in Slovenia, and is there acontinuation of the B1 in Croatia and in the Mid-Hungarian tectonic zone?

  19. Facile synthesis of cyclopentenone B1- and L1-type Phytoprostanes

    Directory of Open Access Journals (Sweden)

    Alexandre eGuy

    2015-07-01

    Full Text Available Phytoprostanes (PhytoPs represent non-enzymatic metabolites of α-linolenic acid (ALA, the essential omega-3 polyunsaturated fatty acid (PUFA derived from plants. PhytoPs are present in the plant kingdom and represent endogenous mediators capable of protecting cells from oxidative stress damages in plants. Recently, it was found that such metabolites are present in cooking oil in high quantities, and also that B1-PhytoPs protect immature neurons from oxidant injury and promote differentiation of oligodendrocyte progenitors through PPAR-γ activation. We report a novel and facile synthesis of natural 2,3-substituted cyclopentenone PhytoPs, 16-B1-PhytoP and 9-L1-PhytoP. Our strategy is based on reductive alkylation at the 2-position of 1,3-cyclopentanedione using a recent protocol developed by Ramachary et al., and on a cross-coupling metathesis to access conjugate dienone system. In conclusion, this strategy permitted access to B1- and L1-PhytoPs in a relative short sequence process, and afford the possibility to easily develop analogs of PhytoPs.

  20. Alfalfa mosaic virus replicase proteins P1 and P2 interact and colocalize at the vacuolar membrane

    NARCIS (Netherlands)

    Heijden, van der M.W.; Carette, J.E.; Reinhoud, P.J.; Haegi, A.; Bol, J.F.

    2001-01-01

    Replication of Alfalfa mosaic virus (AMV) RNAs depends on the virus-encoded proteins P1 and P2. P1 contains methyltransferase- and helicase-like domains, and P2 contains a polymerase-like domain. Coimmunoprecipitation experiments revealed an interaction between in vitro translated-P1 and P2 and show