WorldWideScience

Sample records for cal yr bp

  1. Sedimentary Evidence for a Rapid Sea Level Rise at 7,600 cal yr BP from North-Central Cuba

    Science.gov (United States)

    Peros, M. C.; Agosta G'meiner, A. M.; Collins, S.

    2016-12-01

    A lack of high-resolution relative sea level (RSL) proxy data has meant that the pattern of early Holocene RSL change in the Caribbean is poorly understood. A RSL curve published by Toscano and Macintyre (2003) using inter-tidal mangrove peats and submerged corals suggests RSL underwent a relatively fast and `smooth' curvilinear increase during the Holocene. However, others, such as Blanchon and Shaw (1995), suggest that RSL increased rapidly at around 7600 cal yr BP, in response to the final stages of the melting of the Laurentide Ice Sheet (melt water pulse 1C or catastrophic rise event 3). We investigated this question using multi-proxy data from a flooded sinkhole (Cenote Jennifer) on the north coast of central Cuba. Cenote Jennifer is located 7 m above mean sea level and 2 km from the Bahamas Channel and appears to have a high degree of connectivity with the ocean through a network of underground caverns. The water depth is 13 m and the bottommost 5 m is anoxic. A sediment core collected from Cenote Jennifer was studied using loss-on-ignition, pollen analysis, high-resolution XRF core-scanning, and grain size analysis. An age-depth model was generated for the core by AMS dating. The results show that the bottommost stratigraphic unit ( 9000 to 7600 cal yr BP) is a fine-grained carbonate-rich mud (i.e., marl). This unit abruptly transitions into finely laminated organic-rich sediment from 7600 cal yr BP to the present. The pollen analysis shows that the sinkhole supported a cattail (Typha) community until 7600 cal yr BP, indicating low water levels ( 1 m). At 7600 cal yr BP, the cattail community disappeared and the vegetation of the surrounding bedrock became dominated by a thorny coastal scrubland. In addition, a 3 cm thick fining-upward siliciclastic unit is present immediately above the marl-organic contact, suggesting: 1) a marine sediment source given the limestone-dominated nature of the region, and 2) the presence of a short-duration, high

  2. Dietary shift after 3600 cal yr BP and its influencing factors in northwestern China: Evidence from stable isotopes

    Science.gov (United States)

    Ma, Minmin; Dong, Guanghui; Jia, Xin; Wang, Hui; Cui, Yifu; Chen, Fahu

    2017-04-01

    :Human diets rely on natural resource availability and can reflect social and cultural values. When environments, societies, and cultures change, diets may also shift. This study traced the extent of dietary change and the factors influencing such change. Through stable carbon and nitrogen isotopic analysis of late Neolithic and early Bronze Age human and animal bone collagen, we found that significant shifts in human diets were closely associated with intercontinental cultural exchanges in Eurasia and climate change in northwestern China. The isotopic evidence indicated that human diets mainly consisted of C4 foodstuffs (presumably millet and/or animals fed with C4 foods) around 4000 calibrated years before the present (cal yr BP), corresponding to the flourishing of millet agriculture in the context of the optimal climate conditions of the mid-Holocene. Subsequently, more C3 foods (probably wheat, barley, and animals fed with C3 foods) were added to human diets post-3600 cal yr BP when the climate became cooler and drier. Such dietary variation is also consistent with the increasing intensity of long-distance exchange after 4000 cal yr BP. While many factors can lead to human dietary shifts (e.g. climate change, population growth, cultural factors, and human migration), climate may have been a key factor in Gansu and Qinghai.

  3. Woody vegetation, fuel and fire track the melting of the Scandinavian ice-sheet before 9500 cal yr BP

    Science.gov (United States)

    Carcaillet, Christopher; Hörnberg, Greger; Zackrisson, Olle

    2012-11-01

    New studies indicate the presence of early Holocene ice-free areas far north in Scandinavia. Post-glacial fire and vegetation were investigated based on sedimentary charcoal and pollen from two small lakes in northern Sweden. Accumulation of organic sediment started around 10,900 and 9200 cal yr BP, showing that both lake valleys were ice-free extremely early given their northerly location. Fire events started after 9600 cal yr BP and became less common around the '8.2-ka event'. Woody vegetation provided fuel that contributed to fires. The first vegetation in our pollen record consisted of Hippophae, Dryas, grasses and sedges. Subsequently broadleaved trees (Betula, Salix) increased in abundance and later Pinus, Alnus, ferns and Lycopodium characterized the vegetation. Pollen from Larix, Picea and Malus were also found. The change in vegetation composition was synchronous with the decrease in lake-water pH in the region, indicating ecosystem-scale processes; this occurred during a period of net global and regional warming. The changes in fire frequency and vegetation appear independent of regional trends in precipitation. The reconstructed fire history and vegetation support the scenario of early ice-free areas far north in Scandinavia during early Holocene warming, creating favorable conditions for woody plants and wildfires.

  4. Potential climatic mechanisms associated with the mega drought at 4200 cal yr BP: linking proxy data with modern climate analogues

    Science.gov (United States)

    Carter, V.; Shinker, J. J.

    2017-12-01

    Roughly 4200 years ago, a 150-year long mega drought occurred in the central Rocky Mountains, as indicated by pollen evidence from lake sediments from Long Lake, south-eastern Wyoming. However, pollen evidence does not record the climate mechanisms that caused the drought; they only provide evidence that the drought occurred. A modern climate analogue technique using North American Regional Reanalysis data was applied to the sedimentary data in order to identify possible synoptic and dynamic patterns that may have caused the mega drought at 4200 cal yr BP. Our results suggest warm and dry conditions were a result of anomalously higher-than-normal geopotential heights that were centred over the Great Plains beginning in the spring and persisting through the fall. Drought conditions during the growing seasons was the result of the anomalous high-pressure ridge, which suppressed moisture transport via the low level jet from the Gulf of Mexico, as well as brought in dry continental air from in the interior region of North America. The conditions associated with modern analogues offer a potential climate mechanism that caused the mega drought 4200 years ago, and likely led to the changes in vegetation composition as evidenced by the pollen record from Long Lake, Wyoming.

  5. The late Holocene dry period: multiproxy evidence for an extended drought between 2800 and 1850 cal yr BP across the central Great Basin, USA

    Science.gov (United States)

    Mensing, Scott A.; Sharpe, Saxon E.; Tunno, Irene; Sada, Don W.; Thomas, Jim M.; Starratt, Scott W.; Smith, Jeremy

    2013-01-01

    Evidence of a multi-centennial scale dry period between ∼2800 and 1850 cal yr BP is documented by pollen, mollusks, diatoms, and sediment in spring sediments from Stonehouse Meadow in Spring Valley, eastern central Nevada, U.S. We refer to this period as the Late Holocene Dry Period. Based on sediment recovered, Stonehouse Meadow was either absent or severely restricted in size at ∼8000 cal yr BP. Beginning ∼7500 cal yr BP, the meadow became established and persisted to ∼3000 cal yr BP when it began to dry. Comparison of the timing of this late Holocene drought record to multiple records extending from the eastern Sierra Nevada across the central Great Basin to the Great Salt Lake support the interpretation that this dry period was regional. The beginning and ending dates vary among sites, but all sites record multiple centuries of dry climate between 2500 and 1900 cal yr BP. This duration makes it the longest persistent dry period within the late Holocene. In contrast, sites in the northern Great Basin record either no clear evidence of drought, or have wetter than average climate during this period, suggesting that the northern boundary between wet and dry climates may have been between about 40° and 42° N latitude. This dry in the southwest and wet in the northwest precipitation pattern across the Great Basin is supported by large-scale spatial climate pattern hypotheses involving ENSO, PDO, AMO, and the position of the Aleutian Low and North Pacific High, particularly during winter.

  6. Proximal stratigraphy and event sequence of the c. 5600 cal. yr BP Whakatane rhyolite eruption episode from Haroharo volcano, Okataina Volcanic Centre, New Zealand

    International Nuclear Information System (INIS)

    Kobayashi, T.; Nairn, I.; Smith, V.; Shane, P.

    2005-01-01

    The c. 5600 cal. yr BP Whakatane eruption episode consisted of a sequence of intracaldera rhyolite eruptions from at least five vents spread over 11 km of the Haroharo linear vent zone within Okataina Volcanic Centre. Initial vent-opening eruptions from the Haroharo vent produced coarse lithic clast 'blast beds' and pyroclastic density currents surges). These were immediately followed by eruption of very mobile pumiceous pyroclastic surges from the Makatiti vent 6 km to the southwest. Major plinian eruptions from the Makatiti vent then dispersed Whakatane Tephra pumice fall deposits (bulk volume c. 6 km 3 ) across the northeastern North Island while smaller explosive eruptions produced pyroclastic flows and falls from the Haroharo-Rotokohu vents and at the Pararoa vent on the caldera rim 11 km northeast from Makatiti. The pyroclastic eruptions at all vents were followed by the extrusion of lava flows and domes; extruded lava volumes ranged from 0.03 km 3 for the Pararoa dome to 7.5 km 3 for the Makatiti-Tapahoro lava flows and domes. Minor variations in whole rock and glass chemistry show that the three main vent areas each tapped a slightly different high-silica rhyolite magma. About 10 km 3 of M-type magma was erupted from the Makatiti-Tapahoro vents; c. 1.3 km 3 of H-type magma from the Haroharo-Rotokohu vents, and 0.04 km 3 of P-type magma from the Pararoa vent. There are no significant weathering or erosional breaks within the Whakatane eruptive sequence, which suggests that all Whakatane eruptions occurred within a short time interval. However, extrusion of the Haroharo dome within the Makatiti pyroclastic eruption sequence suggests a duration of c. 2 yr for the main pyroclastic eruption phase. Emplacement of the following voluminous (7.5 km 3 ) lavas from the Makatiti-Tapahoro vents would have occurred over >10 yr at the c. 10-20 m 3 /s inferred extrusion rates. (author). 19 refs., 16 figs., 7 tabs

  7. Marine04 marine radiocarbon age calibration, 0-26 cal kyr BP

    NARCIS (Netherlands)

    Hughen, Konrad A.; Baillie, Mike G.L.; Bard, Edouard; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, Richard L.; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Paula J.; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.

    2004-01-01

    New radiocarbon calibration curves, IntCal04 and Marine04, have been constructed and internationally ratified to replace the terrestrial and marine components of IntCal98. The new calibration data sets extend an additional 2000 yr, from 0–26 cal kyr BP (Before Present, 0 cal BP = AD 1950), and

  8. 884 Cal.BP and all that

    International Nuclear Information System (INIS)

    Switsur, Roy

    1986-01-01

    A history of the development of the technique of radiocarbon dating highlights the two problems with this method. The first is calibration; the radiocarbon calendar is not linear. However two independent experiments to provide high precision measurements in tree rings have resulted in a high precision calibration curve. The second is how to denote radiocarbon ages and calibrated dates, as this depends on how the dendrochronology time scale used in the calibration is transferred to the actual calendar. If the zero of the dendroscale is transferred from the origin of the Christian calendar to AD 1950, radiocarbon ages are designated CAL BP (BP = before present). There is an alternative method which results in CAL AD and CAL BC. A suggestion for a standard notation is made to avoid the confusion of two systems. (U.K.)

  9. IntCal04 terrestrial radiocarbon age calibration, 0-26 cal kyr BP

    NARCIS (Netherlands)

    Reimer, Paula J.; Baillie, Mike G.L.; Bard, Edouard; Bayliss, Alex; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, R. Lawrence; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Hogg, Alan G.; Hughen, Konrad A.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.

    2004-01-01

    A new calibration curve for the conversion of radiocarbon ages to calibrated (cal) ages has been constructed and internationally ratified to replace IntCal98, which extended from 0–24 cal kyr BP (Before Present, 0 cal BP = AD 1950). The new calibration data set for terrestrial samples extends from

  10. NotCal04 : Comparison/calibration C-14 records 26-50 cal kyr BP

    NARCIS (Netherlands)

    Plicht, J. van der; Beck, J.W.; Bard, E.; Baillie, M.G.L.; Blackwell, P.G.; Buck, C.E.; Friedrich, M.; Guilderson, T.P.; Hughen, K.A.; Kromer, B.; McCormac, F.G.; Bronk Ramsey, C.; Reimer, P.J.; Reimer, R.W.; Remmele, S.; Richards, D.A.; Southon, J.R.; Stuiver, M.; Weyhenmeyer, C.E.

    2004-01-01

    The radiocarbon calibration curve ImCal04 extends back to 26 cal kyr BP. While several high-resolution records exist beyond this limit, these data sets exhibit discrepancies of up, to several millennia. As a result, no calibration curve for the time range 26-50 cal kyr BP can be recommended as yet,

  11. 14C concentrations in the old woods at 6000yrBP and the variations of cosmic rays

    International Nuclear Information System (INIS)

    Sato, Taiichi; Sakurai, Hirohisa; Tokanai, Huyuki

    2008-01-01

    A large quantity of old woods was recently excavated with the Chuetsu-oki Earthquake in the bottom of the sea of near the Izumozaki-oki Nigata Prefecture. First of all, we have measured the radiocarbon ages for the three samples to identify the calendar ages of the woods. The radiocarbon ages were 5357±45 yrBP, 4573±52 yrBP, and 4812±52 yrBP, respectively. Using the OXCAL program, the calendar ages were calculated in the range from 6300 yrBP to 5100 yrBP. The IntCal04 data shows that the 14 C concentrations with the era are very variable with 20 per mille variations. We show a plan to investigate 14 C concentrations of the old tree rings around 6000 yrBP. (author)

  12. INTCAL09 AND MARINE09 RADIOCARBON AGE CALIBRATION CURVES, 0-50,000 YEARS CAL BP

    NARCIS (Netherlands)

    Reimer, P. J.; Baillie, M. G. L.; Bard, E.; Bayliss, A.; Beck, J. W.; Blackwell, P. G.; Ramsey, C. Bronk; Buck, C. E.; Burr, G. S.; Edwards, R. L.; Friedrich, M.; Grootes, P. M.; Guilderson, T. P.; Hajdas, I.; Heaton, T. J.; Hogg, A. G.; Hughen, K. A.; Kaiser, K. F.; Kromer, B.; McCormac, F. G.; Manning, S. W.; Reimer, R. W.; Richards, D. A.; Southon, J. R.; Talamo, S.; Turney, C. S. M.; van der Plicht, J.; Weyhenmeye, C. E.; Weyhenmeyer, C.E.

    2009-01-01

    The IntCal04 and Marine04 radiocarbon calibration curves have been updated from 12 cal kBP (cal kBP is here defined as thousands of calibrated years before AD 1950), and extended to 50 cal kBP, utilizing newly available data sets that meet the IntCal Working Group criteria for pristine corals and

  13. Tasmaloum, Vanuatu Fossil Coral SST Reconstruction for 4200 YrBP

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Vanuatu Fossil Coral SST Reconstruction, 4200 YrBP. Paleobathymetry estimated at 10-15 m. SST reconstruction is based on the analysis of Sr/Ca and U/Ca ratios in...

  14. High resolution stable isotopes and elemental analysis on benthic foraminifera: a 4000 yr BP record from the ria de Muros (NW Spain)

    Science.gov (United States)

    Pena, L. D.; Francés, G.; Diz, P.; Nombela, M. A.; Alejo, I.

    2003-04-01

    Carbon and oxygen stable isotopes and ICP-OES elemental ratio concentrations (Mg/Ca, Sr/Ca, Ba/Ca) from core EUGC-3B (42 45.10'N; 9 02.23'W, at 38 m.b.s.l. and 410 cm length) were measured over monospecific benthic foraminiferal samples (Nonion fabum) ranging over the last 4500 yr BP. From the oldest analysed sample (289 cm) to the core top, stable isotopes signal shows that the whole record can be separated into 4 intervals lasting each of them about 1000 yr. The lowermost interval (4300-3000 yr BP) is characterized by relatively stable delta 18O values (mean 1.77 per mil). Delta 13C is relatively low except for a maximum around 3300 cal BP (-1.50 per mil). An abrupt decrease down to the minimum value in delta 13C (-4.41 per mil) is accomplished in approximately 200 yr. Mg/Ca and Ba/Ca match perfectly this event, both of them showing the respective maxima values. Sr/Ca has a very similar behaviour to that of delta 13C but with smoother fluctuations. We attribute high values of delta 13C, Sr/Ca and Ba/Ca to periods of enhanced coastal productivity, probably due to reinforced upwelling events in the region. According to Mg/Ca signal this reinforcement took place during a relatively warmer period. The most remarkable feature during the two next periods (3000-1900 yr BP and 1900-1000 yr BP) consists of a stepwise increase of delta 13C values punctuated by a sharp decrease at the end of each interval. All the remaining proxies exhibit a nearly constant trend over these intervals. Each period can be interpreted as a weak enhance of marine productivity that the system does not hold up and finally aborts. The most recent interval represents the establishment of current conditions in the coastal system. The most conspicuous event from this interval consists of an abrupt decrease of the delta 18O that lasted for 300 yr. This event could be correlated with the well recognized warm climatic event known as the Medieval Warm Period. However the Mg/Ca ratio does not show high

  15. Environmental change in the Limfjord, Denmark (ca 7500-1500 cal yrs BP): a multiproxy study

    Science.gov (United States)

    Lewis, Jonathan P.; Ryves, David B.; Rasmussen, Peter; Knudsen, Karen L.; Petersen, Kaj S.; Olsen, Jesper; Leng, Melanie J.; Kristensen, Peter; McGowan, Suzanne; Philippsen, Bente

    2013-10-01

    The Limfjord region of northern Jutland, Denmark, supports a rich archaeological record dating back to the Mesolithic, which documents long-term change in human practices and utilisation of marine resources since approximately 7500 BP. The presence and availability of marine resources in the Limfjord is sensitively regulated by environmental parameters such as salinity, sedimentary regime, nutrient status and primary productivity, but long-term changes in these parameters are currently poorly understood. In this study a multiproxy approach (including sedimentary parameters, diatoms, molluscs, foraminifera, sedimentary pigments, C and O stable isotopes and plant macrofossils) has been adopted to assess environmental change over the period ca 7500-1500 cal yrs BP at Kilen, a coastal fjord (before AD 1856) situated in the Western Limfjord. A diatom-based salinity transfer function based on a pan-Baltic training set has been applied to the fossil diatom dataset for quantitative assessment of salinity change over the study period. This study demonstrates that large-scale shifts in salinity are a common feature of the Limfjord's long-term history and are driven by the level of connection with the North Sea and the Skagerrak respectively, which in turn is likely driven by the complex interplay between climate, sea-level change, current velocity and rates of erosion/sedimentary accretion. Three shifts in state at Kilen are identified over the study period: a deep, periodically stratified fjord with medium-high salinity (and high productivity) between ca 7500-5000 BP, followed by a gradual transition to a shallow benthic system with more oceanic conditions (i.e. higher salinity, lower productivity, slower sedimentary accumulation rate and poorer fossil preservation) after ca 5000 BP and no stratification after ca 4400 BP, and lastly, within this shallow phase, an abrupt shift to brackish conditions around 2000 BP. Environmental-societal interactions are discussed on the

  16. Wood Usage and Fire Veneration in the Pamir, Xinjiang, 2500 yr BP.

    Directory of Open Access Journals (Sweden)

    Hui Shen

    Full Text Available Located on the Pamir Plateau in Xinjiang Province, China, the Ji'erzankale Necropolis dates back to 2500 yr BP. Many materials that have been unearthed in this cemetery, including shoo konghou (musical instrument, bronze mirrors and glass beads, suggest cultural transference between East and West. Furthermore, small-sized and rounded fire altars made from sweet-scented Sabina were found for the first time and regarded as implements for fire veneration. We identified 70 wooden objects from 25 tombs within the Necropolis, and found that each object had been made from one of seven tree species. Analysis revealed that the inhabitants of the region mainly used the most widely available types of wood, namely Betula and Populus. People also specifically chose inflammable Populus wood to make hearth boards and hand drills (both are used for making fire by drilling, rigid Betula wood to craft wooden plates. Salix was used for fashioning wooden sticks, while sweet-scented Sabina was the preferred choice for making fire altars. Lonicera was selected for arrow shaft manufacture and Fraxinus syriaca, which has a beautiful grain, was chosen for making musical instruments. Conscious selection of different types of wood indicates that people of the Pamir Plateau were aware of the properties of various types of timbers, and were able to exploit these properties to the full. In turn, this demonstrates their wisdom and their ability to survive in, and adapt to, their local environment.

  17. Relative Sea-Level Stability in Natuna Island, Indonesia, since 6400 yr BP

    Science.gov (United States)

    Wan, J. X. W.; Meltzner, A. J.; Switzer, A.; Horton, B.; Ke, L.; Wang, X.; Bradley, S.; Natawidjaja, D.; Suwargadi, B. W.

    2017-12-01

    In order to understand the regional variability of relative sea level (RSL) due to glacio-isostatic adjustment (GIA) and other natural influences, high-precision records of Holocene RSL on the Sunda Shelf are required. Accurate estimates of past RSL at a variety of locations allow us to validate geophysical and climate models, and provide context for understanding modern RSL change in the face of global climate change. For the aforementioned purposes, we surveyed and dated coral microatoll colonies, which are precise RSL proxy archives, from Natuna Island in Indonesia. Our analysis of 11 coral microatoll elevations from a total of four sites on Natuna Island is constrained in time by a minimum of one radiocarbon date and one U-Th age on each microatoll. The distribution of ages and elevations indicates that RSL was relatively stable from 6400 to 1400 yr BP at 0.3-0.6 m higher than present, before a more recent fall to current levels. The radiocarbon and U-Th ages are consistent with one another, with preliminary estimates of ΔR ≈ 0 for our entire data set. Our data are roughly compatible with predictions of a recently developed GIA model for the Southeast Asia region (Bradley et al., 2016, Quat. Sci. Rev.). This new dataset is part of larger project with more than 25 sites in Malaysia and Indonesia. Our new constraints on past RSL on the Sunda Shelf will allow for validation and calibration of GIA models in the tropics, where RSL data are presently insufficient.

  18. Evidence of a prolonged drought ca. 4200 yr BP correlated with prehistoric settlement abandonment from the Gueldaman GLD1 Cave, N-Algeria

    Science.gov (United States)

    Ruan, J.; Kherbouche, F.; Genty, D.; Blamart, D.; Cheng, H.; Dewilde, F.; Hachi, S.; Edwards, L. R.; Régnier, E.; Michelot, J.-L.

    2015-07-01

    Middle Holocene cultures have been widely studied round the E-Mediterranean basin in the last 30 years and past cultural activities have been commonly linked with regional climate changes. However, in many cases such linkage is equivocal, in part due to existing climatic evidence that has been derived from areas outside the distribution of ancient settlements, leading to uncertainty from complex spatial heterogeneity in both climate and demography. A few high-resolution well-dated paleoclimate records were recently established using speleothems in the Central and E-Mediterranean basin, however, the scarcity of such records in the western part of the Mediterranean prevents us from correlating past climate evolutions across the basin and deciphering climate-culture relation at fine time scales. Here we report the first decadal-resolved Mid-Holocene climate proxy records from the W-Mediterranean basin based on the stable carbon and oxygen isotopes analyses of two U/Th dated stalagmites from the Gueldaman GLD1 Cave in N-Algeria. Comparison of our records with those from Italy and Israel reveals synchronous (multi) centennial dry phases centered at ca. 5600, ca. 5200 and ca. 4200 yr BP across the Mediterranean basin. New calibrated radiocarbon dating constrains reasonably well the age of rich anthropogenic deposits (e.g., faunal remains, pottery, charcoal) excavated inside the cave, which allows the comparison between in situ evidence of human occupation and of climate change. This approach shows that the timing of a prolonged drought at ca. 4400-3800 yr BP blankets the onset of cave abandonment shortly after ca. 4403 cal yr BP, supporting the hypothesis that a climate anomaly may have played a role in this cultural disruption.

  19. Evidence of a prolonged drought ca. 4200 yr BP correlated with prehistoric settlement abandonment from the Gueldaman GLD1 Cave, Northern Algeria

    Science.gov (United States)

    Ruan, J.; Kherbouche, F.; Genty, D.; Blamart, D.; Cheng, H.; Dewilde, F.; Hachi, S.; Edwards, R. L.; Régnier, E.; Michelot, J.-L.

    2016-01-01

    Middle Holocene cultures have been widely studied around the Eastern-Mediterranean basin in the last 30 years and past cultural activities have been commonly linked with regional climate changes. However, in many cases such linkage is equivocal, in part due to existing climatic evidence that has been derived from areas outside the distribution of ancient settlements, leading to uncertainty from complex spatial heterogeneity in both climate and demography. A few high-resolution well-dated paleoclimate records were recently established using speleothems in the Central and Eastern-Mediterranean basin, however, the scarcity of such records in the western part of the Mediterranean prevents us from correlating past climate evolutions across the basin and deciphering climate-culture relation at fine timescales. Here we report the first decadal-resolved Mid-Holocene climate proxy records from the Western-Mediterranean basin based on the stable carbon and oxygen isotopes analyses of two U/Th dated stalagmites from the Gueldaman GLD1 Cave in Northern Algeria. Comparison of our records with those from Italy and Israel reveals synchronous (multi) centennial dry phases centered at ca. 5600, ca. 5200 and ca. 4200 yr BP across the Mediterranean basin. New calibrated radiocarbon dating constrains reasonably well the age of rich anthropogenic deposits (e.g., faunal remains, pottery, charcoal) excavated inside the cave, which allows the comparison between in situ evidence of human occupation and of climate change. This approach shows that the timing of a prolonged drought at ca. 4400-3800 yr BP blankets the onset of cave abandonment shortly after ca. 4403 cal yr BP, supporting the hypothesis that a climate anomaly may have played a role in this cultural disruption.

  20. The 3000-4000 cal. BP anthropogenic shift in fire regime in the French Pyrenees.

    Science.gov (United States)

    Rius, D.; Vannière, B.; Galop, D.; Richard, H.

    2009-04-01

    Fire is a key disturbing agent in a wide range of ecosystems: boreal biome (Pitkanen, 2000), Mediterranean area (Colombaroli et al., 2008) as well as temperate European mountain zones (Tinner et al., 1999). During the Holocene, climate may control fire regime by both ignition and fire spread-favouring conditions (i.e. composition, structure and moisture of biomass) whereas man may change charcoal accumulation patterns through type and intensity of agro-pastoral activities. In western and Mediterranean Europe, single sites charcoal analysis recorded the anthropogenic forcing over fire regime broadly between the mid and the late-Holocene. Turner et al (2008) showed that climate and fire had been disconnected since 1700 cal. BP in Turkey. In central Swiss, Mean Fire Interval decreased by two times 2000 years ago due to increasing human impact (Stahli et al., 2006). In Italy, climate and man have had a combined influence on fire-hazard since ca 4000 cal. BP (Vannière et al., 2008). In the Pyrenees Mountains, the linkage between agro-pastoral practices and fire could be dated back to ca 4000-3000 cal. BP with a clear succession of a clearance phase (high fire frequency) followed by a quite linear trend throughout Middle Ages and Modern times corresponding to a change in fire use (Vanniere et al., 2001; Galop et al., 2002, Rius et al., in press). The quantification of fire regimes parameters such as frequency with robust methodological tools (Inferred Fire Frequency, Mean Fire Interval) is needed to understand and characterise such shifts. Here we present two sequences from the Lourdes basin (col d'Ech peat bog) and from the occidental Pyrenees (Gabarn peat bog), which cover the last 9000 years with high temporal resolution. The main goals of this study were to (1) assess control factors of fire regime throughout the lateglacial and Holocene (climate and/or man) on the local scale, (2) evidence the local/regional significance of these control factors , (3) discuss the

  1. IntCal13 and Marine13 Radiocarbon Age Calibration Curves 0–50,000 Years cal BP

    NARCIS (Netherlands)

    Reimer, Paula J.; Bard, Edouard; Bayliss, Alex; Beck, J. Warren; Blackwell, Paul G.; Bronk Ramsey, Christopher; Buck, Caitlin E.; Cheng, Hai; Edwards, R. Lawrence; Friedrich, Michael; Grootes, Pieter M.; Guilderson, Thomas P.; Haflidason, Haflidi; Hajdas, Irka; Hatté, Christine; Heaton, Timothy J.; Hoffmann, Dirk L.; Hogg, Alan G.; Hughen, Konrad A.; Kaiser, K. Felix; Kromer, Bernd; Manning, Sturt W.; Niu, Mu; Reimer, Ron W.; Richards, David A.; Scott, E. Marian; Southon, John R.; Staff, Richard A.; Turney, Christian S.M.; Plicht, Johannes van der; Reimer, Paula J.

    2013-01-01

    The IntCal09 and Marine09 radiocarbon calibration curves have been revised utilizing newly available and updated data sets from C-14 measurements on tree rings, plant macrofossils, speleothems, corals, and foraminifera. The calibration curves were derived from the data using the random walk model

  2. Improved precision radiocarbon measurements and natural 14C variations around 10.000 cal BP

    International Nuclear Information System (INIS)

    Goslar, T.

    1990-01-01

    The subject of present work, natural radiocarbon variations in the past, is one of the most significant methodological questions of radiocarbon chronology. In the first three chapters, the author discusses problems connected with calibration of conventional radiocarbon dates, and consequences of monitoring the 14 C variations for the research of the changes of geomagnetic field, solar activity and global carbon cycle. Dendrochronological dating, which, in connection with 14 C measurements enables us to reconstruct the radiocarbon variations in the past, is also widely described. Fourth chapter concerns the technical problems of detection 14 C β-activity, especially accounting for proportional counters technique. In the next chapter the author describes results of his own dendrochonological research. Sixth chapter comprises frame discussion of the system for improved precision radiocarbon dating, together with short presentation of equipment, its calibration and analysis of errors. The last chapter gives the reconstruction of the pattern of atmospheric 14 C variations in 300-year period around 10.000 cal BP. It was found that in the last 10.000 years similar pattern repeats periodically. In the end, the author discusses the meaning of negative correlation between 14 C variations and changes of annual tree-ring widths in the oak trunk from Lublinek, for searching the connection between solar activity and climate. (author)

  3. Pollen-based biome reconstruction for southern Europe and Africa 18,000 yr BP

    NARCIS (Netherlands)

    Elenga, H; Peyron, O; Bonnefille, R; Jolly, D; Cheddadi, R; Guiot, J; Andrieu, [No Value; Bottema, S; Buchet, G; de Beaulieu, JL; Hamilton, AC; Maley, J; Marchant, R; Perez-Obiol, R; Reille, M; Riollet, G; Scott, L; Straka, H; Taylor, D; Van Campo, E; Vincens, A; Laarif, F; Jonson, H

    Pollen data from 18,000 C-14 yr sp were compiled in order to reconstruct biome distributions at the last glacial maximum in southern Europe and Africa. Biome reconstructions were made using the objective biomization method applied to pollen counts using a complete list of dryland taxa wherever

  4. Environmental change in the Limfjord, Denmark (ca 7500-1500 cal yrs BP): A multiproxy study

    DEFF Research Database (Denmark)

    Lewis, J. P.; Ryves, D.B.; Rasmussen, P.

    2013-01-01

    (and high productivity) between ca 7500–5000 BP, followed by a gradual transition to a shallow benthic system with more oceanic conditions (i.e. higher salinity, lower productivity, slower sedimentary accumulation rate and poorer fossil preservation) after ca 5000 BP and no stratification after ca 4400...

  5. The palynology and sedimentology of a coastal swamp at Awana, Great Barrier Island, New Zealand, from c. 7000 yr B.P. to present

    International Nuclear Information System (INIS)

    Horrocks, M.; Ogden, J.; Nichol, S.L.; Alloway, B.V.; Sutton, D.G.

    1999-01-01

    Pollen and sediment analysis of two Holocene cores from Awana, Great Barrier Island, shows that at 7000 calibrated yr B.P. the local swamp was an estuarine salt marsh dominated by Restionaceae. By c. 6000 yr B.P. the water table was lower, and a fresh water swamp (Gleichenia-Leptospermum) had replaced the salt marsh. Regional conifer-hardwood forest c. 7000 yr B.P. was initially co-dominated by Libocedrus and Dacrydium cupressinum. Libocedrus declined from c. 6000 yr B.P. During the period c. 6000-c. 2500 yr B.P., relatively stable environmental conditions ensued with little change in local or regional vegetation. Around 2500 yr B.P., the swamp surface became drier and was invaded by Dacrycarpus and Laurelia swamp forest. This forest was subsequently repeatedly disturbed (not by fire), indicating climatic change to drier and windier conditions. Ascarina lucida was periodically a major component of swamp forest. Disturbance is also recorded in the clastic (mineral) sediments, where beds of sand within finer-grained sediment and peat are interpreted as wind blown material derived from partly devegetated dunes to seaward. The presence of the Kaharoa Tephra allows the timing of major Polynesian deforestation at Awana to be reliably dated to c. 600 calibrated yr B.P. In contrast, we see no evidence in the clastic sediment record of disturbance at Awana since Kaharoa time. We attribute this to the maintenance of stable dunes by a herb/scrub cover despite nearby fires, or to the presence of scrub or forest buffering the swamp from ablating dunes. (author). 45 refs., 4 figs., 1 tab

  6. Vegetation stability in the Southeastern Brazilian coastal area from 5500 to 1400 14C yr BP deduced from charcoal analysis.

    Science.gov (United States)

    Scheel-Ybert

    2000-06-01

    Charcoal analysis of six shell mounds showed that no major changes of the mainland vegetation ecosystem have taken place along the southeastern Brazilian coast (22 degrees 53'-22 degrees 57'S, 42 degrees 03'-42 degrees 33'W) from 5500 to 1400 14C yr BP. These shell mounds have been occupied by sedentary fisher-gatherer-hunters. Charcoal fragments retrieved from vertical profiles in the archaeological sites were examined; taxonomic determinations were based on a reference collection of charred woods and a program for computer-aided identification. Charcoal assemblages of all the studied sites present taxa from various restinga vegetation types, mangroves, xeromorphic coastal forest, and inland Atlantic Forest. The restinga ecosystem, characteristic of the Brazilian coast, is associated with sandy beach ridges; the restinga forest was much more abundant during the studied period than nowadays. The charcoal assemblages represent mainly the local vegetation; a regional reconstruction depends on the study of numerous sites. In the Cabo Frio region, open restinga taxa are more abundant in the Sambaqui do Forte, while forest elements are more important in the Sambaquis Salinas Peroano and Boca da Barra. The sites studied in the Arraial do Cabo (Sambaqui da Ponta da Cabeça) and in the Saquarema regions (Sambaquis da Pontinha and da Beirada) show that open restinga formations were locally predominant. A comparison of multivariate analysis applied to both charcoal assemblages and to phytosociological data of the extant vegetation showed a good correspondence between the charcoal spectra and the present vegetation. The high taxonomic diversity of archaeological charcoal samples and numerous fragments showing traces of decay before charring suggests that aleatory gathering of dead wood constituted the main source of firewood for fisher-gatherer-hunters populations. Condalia sp. was probably selected for cultural reasons.The only significant fluctuations on the charcoal

  7. Continuous Lake-Sediment Records of Glaciation in the Sierra Nevada between 52,600 and 12,500 14C yr B.P

    Science.gov (United States)

    Benson, Larry V.; May, Howard M.; Antweiler, Ronald C.; Brinton, Terry I.; Kashgarian, Michaele; Smoot, Joseph P.; Lund, Steve P.

    1998-09-01

    The chemistry of the carbonate-free clay-size fraction of Owens Lake sediments supports the use of total organic carbon and magnetic susceptibility as indicators of stadial-interstadial oscillations. Owens Lake records of total organic carbon, magnetic susceptibility, and chemical composition of the carbonate-free, clay-size fraction indicate that Tioga glaciation began ˜24,500 and ended by ˜13,600 14C yr B.P. Many of the components of glacial rock flour (e.g., TiO 2, MnO, BaO) found in Owens Lake sediments achieved maximum values during the Tioga glaciation when valley glaciers reached their greatest extent. Total organic carbon and SiO 2(amorphous) concentrations reached minimum values during Tioga glaciation, resulting from decreases in productivity that accompanied the introduction of rock flour into the surface waters of Owens Lake. At least 20 stadial-interstadial oscillations occurred in the Sierra Nevada between 52,600 and 14,000 14C yr B.P. Total organic carbon data from a Pyramid Lake sediment core also indicate oscillations in glacier activity between >39,500 and ˜13,600 14C yr B.P. Alpine glacier oscillations occurred on a frequency of ≤1900 yr in both basins, suggesting that millennial-scale oscillations occurred in California and Nevada during most of the past 52,600 yr.

  8. Climatic Oscillations 10,000-155,000 yr B.P. at Owens Lake, California Reflected in Glacial Rock Flour Abundance and Lake Salinity in Core OL-92

    Science.gov (United States)

    Bischoff, J.L.; Menking, K.M.; Fitts, J.P.; Fitzpatrick, J.A.

    1997-01-01

    Chemical analyses of the acid-soluble and clay-size fractions of sediment samples (1500-yr resolution) reveal oscillations of lake salinity and of glacial advances in core OL-92 back to 155,000 yr B.P. Relatively saline conditions are indicated by the abundance of carbonate and smectite (both pedogenic and authigenic), reflected by Ca, Sr, and Mg in the acid-soluble suite, and by Cs2O, excess MgO, and LOI (loss on ignition) in the clay-size fraction. Rock flour produced during glacial advances is represented by the abundance of detrital plagioclase and biotite in the clay-size fraction, the ratio of which remains essentially constant over the entire time span. These phases are quantitatively represented by Na2O, TiO2, Ba, and Mn in the clay fraction. The rock-flour record indicates two major ice-advances during the penultimate glacial cycle corresponding to marine isotope stage (MIS) 6, no major advances during the last interglaciation (entire MIS 5), and three major advances during the last glacial cycle (MIS 2, 3, and 4). The ages of the latter three correspond rather well to 36Cl dates reported for Sierra Nevada moraines. The onset of the last interglaciation is shown by abrupt increases in authigenic CaCO3 and an abrupt decrease in rock flour, at about 118,000 yr B.P. according to our time scale. In contrast, the boundary appears to be gradual in the ??18O record in which the change from light to heavy values begins at about 140,000 yrs B.P. The exact position of the termination, therefore, may be proxy-dependent. Conditions of high carbonate and low rock flour prevailed during the entire period from 118,000 yr B.P. until the glacial advance at 53,000 yr B.P. signaled the end of this long interglaciation. ?? 1997 University of Washington.

  9. Climatic Oscillations 10,000-155,000 yr B.P. at Owens Lake, California Reflected in Glacial Rock Flour Abundance and Lake Salinity in Core OL-92

    Science.gov (United States)

    Bischoff, James L.; Menking, Kirsten M.; Fitts, Jeffrey P.; Fitzpatrick, John A.

    1997-11-01

    Chemical analyses of the acid-soluble and clay-size fractions of sediment samples (1500-yr resolution) reveal oscillations of lake salinity and of glacial advances in core OL-92 back to 155,000 yr B.P. Relatively saline conditions are indicated by the abundance of carbonate and smectite (both pedogenic and authigenic), reflected by Ca, Sr, and Mg in the acid-soluble suite, and by Cs 2O, excess MgO, and LOI (loss on ignition) in the clay-size fraction. Rock flour produced during glacial advances is represented by the abundance of detrital plagioclase and biotite in the clay-size fraction, the ratio of which remains essentially constant over the entire time span. These phases are quantitatively represented by Na 2O, TiO 2, Ba, and Mn in the clay fraction. The rock-flour record indicates two major ice-advances during the penultimate glacial cycle corresponding to marine isotope stage (MIS) 6, no major advances during the last interglaciation (entire MIS 5), and three major advances during the last glacial cycle (MIS 2, 3, and 4). The ages of the latter three correspond rather well to 36Cl dates reported for Sierra Nevada moraines. The onset of the last interglaciation is shown by abrupt increases in authigenic CaCO 3and an abrupt decrease in rock flour, at about 118,000 yr B.P. according to our time scale. In contrast, the boundary appears to be gradual in the δ 18O record in which the change from light to heavy values begins at about 140,000 yrs B.P. The exact position of the termination, therefore, may be proxy-dependent. Conditions of high carbonate and low rock flour prevailed during the entire period from 118,000 yr B.P. until the glacial advance at 53,000 yr B.P. signaled the end of this long interglaciation.

  10. Impact of climate variability on terrestrial environment in Western Europe between 45 and 9 kyr cal. BP: vegetation dynamics recorded by the Bergsee Lake (Black Forest, Germany).

    Science.gov (United States)

    Duprat-Oualid, Fanny; Begeot, Carole; Rius, Damien; Millet, Laurent; Magny, Michel

    2016-04-01

    Between 9 and 45 kyr cal. BP, two great transitions lead the global climate system to evolve from the Last-Glacial period (115-14.7 kyr cal. BP), to two successive warmer periods, the Late-Glacial Interstadial (14.7-11.7 kyr cal. BP) and the Holocene (11.7-0 kyr cal. BP). δ18O variations recorded in Greenland ice cores (GRIP & NGRIP) revealed high frequency climate variability within the Last Glacial. These reference isotopic records highlighted a succession of centennial-to-millennial warm/cold events, the so-called Greenland Interstadials (GI) and Greenland Stadials (GS). The number continental records about the period 14.7-0 kyr cal. BP is substantial. This allowed to understand the vegetation dynamics in response to climate changes this period at the North-Atlantic scale. However, sequences covering the glacial period (beyond 20 kyr cal.BP) remain rare, because of hiatuses mostly due to local glaciers. Therefore, sedimentary continuous records of vegetation dynamics are still needed to better understand climate changes during the Last Glacial in Western Europe (Heiri et al. 2014). Here we present a new high-resolution pollen record from Lake Bergsee (47°34'20''N, 7°56'11''E, 382 m a.s.l). This lake is located south of Black Forest and north of the Alps, beyond the zone of glaciers maximal extension. Therefore it could have recorded the whole last climatic cycle, i.e. 120-0 kyr cal. BP. In 2013, a 29 m long core was extracted from the Bergsee. According to the depth-age model based on 14C AMS dating and the Laacher See Tephra (LST), the record spans continuously at least the last 45 kyrs. The first series of pollen analysis, focused on the 45-9 kyr cal. BP time window, allows us to reconstruct a precise, faithful and continuous vegetation history at the centennial scale. This high temporal resolution enabled to assess the response of vegetation to secular climate events (e.g. GI-4 = 200 yrs). First, our results show that vegetation responded to climate

  11. Multistep food plant processing at Grotta Paglicci (Southern Italy) around 32,600 cal B.P.

    Science.gov (United States)

    Mariotti Lippi, Marta; Foggi, Bruno; Aranguren, Biancamaria; Ronchitelli, Annamaria; Revedin, Anna

    2015-09-29

    Residue analyses on a grinding tool recovered at Grotta Paglicci sublayer 23A [32,614 ± 429 calibrated (cal) B.P.], Southern Italy, have demonstrated that early modern humans collected and processed various plants. The recording of starch grains attributable to Avena (oat) caryopses expands our information about the food plants used for producing flour in Europe during the Paleolithic and about the origins of a food tradition persisting up to the present in the Mediterranean basin. The quantitative distribution of the starch grains on the surface of the grinding stone furnished information about the tool handling, confirming its use as a pestle-grinder, as suggested by the wear-trace analysis. The particular state of preservation of the starch grains suggests the use of a thermal treatment before grinding, possibly to accelerate drying of the plants, making the following process easier and faster. The study clearly indicates that the exploitation of plant resources was very important for hunter-gatherer populations, to the point that the Early Gravettian inhabitants of Paglicci were able to process food plants and already possessed a wealth of knowledge that was to become widespread after the dawn of agriculture.

  12. The abrupt climate change near 4,400 yr BP on the cultural transition in Yuchisi, China and its global linkage.

    Science.gov (United States)

    Wang, Jianjun; Sun, Liguang; Chen, Liqi; Xu, Libin; Wang, Yuhong; Wang, Xinming

    2016-06-10

    Extreme climatic events have profound impacts on human society. Here we present the results of a study of organic biomarkers within a sedimentary section at the archaeological site of Yuchisi, eastern China, in order to reconstruct climatic variability during the Dawenkou (5,050-4,400 yr BP) and Longshan (4,400-4,000 yr BP) cultures. At ~4,400 yr BP, within the cultural transition horizon, abrupt changes in biomarkers, such as the fatty acid ratio C18:2/C18:0, 2C31/(C27 + C29), n-C18-ol and n-C30-ol, indicate the occurrence of local climate changes over the course of a few decades. These changes occurred during the transition from the Holocene warm period to a subsequent cold period which lasted for the following 600 years. This climatic shift has been recorded at numerous sites worldwide, and it is likely to have been the main cause of the widespread collapse of many isolated cultures at that time. The palaeoclimatic and archaeological data from the Yuchisi sediments may provide new insights into the relationship between climate change and prehistoric cultural transitions.

  13. Deep water ventilation in the northwestern North Pacific during the last deglaciation and the early Holocene (15-5 cal. kyr B.P.) based on AMS 14C dating

    International Nuclear Information System (INIS)

    Minoshima, Kayo; Kawahata, Hodaka; Irino, Tomohisa; Ikehara, Ken; Aoki, Kaori; Uchida, Masao; Yoneda, Minoru; Shibata, Yasuyuki

    2007-01-01

    The difference between benthic and planktonic foraminifera radiocarbon (B-P 14 C) age differences in core PC6 (40 o 23.89' N, 143 o 29.87' E) retrieved from the northwestern North Pacific provide a clue to the reconstruction of deep water circulation during the last deglaciation and the early Holocene (15-5 cal. kyr B.P.). The observed B-P 14 C age differences ranged from 1030 to 1630 years, which are comparable to the present-day apparent ventilation age. It suggested that the ventilation generally remained similar during 15-5 cal. kyr B.P. However, B-P 14 C age difference slightly reduced at 14.6 cal. kyr B.P., indicating that the higher ventilation temporality could have occurred in the northwestern North Pacific (∼2200 m water depth)

  14. Eruption dynamics and explosive-effusive transitions during the 1400 cal BP eruption of Opala volcano, Kamchatka, Russia

    Science.gov (United States)

    Andrews, Benjamin J.; Dufek, Josef; Ponomareva, Vera

    2018-05-01

    Deposits and pumice from the 1400 cal BP eruption of Opala volcano record activity that occurred at the explosive-effusive transition, resulting in intermittent, or stop-start, behavior, where explosive activity resumed following a pause. The eruption deposited distinctive, biotite-bearing rhyolite tephra across much of Kamchatka, and its stratigraphy consists of a lithic-rich pumice fall, overlain by pumice falls and pyroclastic density deposits, with the proportion of the latter increasing with height. This sequence repeats such that the middle of the total deposit is marked by a lithic-rich fall with abundant obsidian clasts. Notably, the eruptive pumice are poorly vesiculated, with vesicle textures that record fragmentation of a partially collapsed magmatic foam. The eruption vent, Baranii Amphitheater is filled with obsidian lavas of the same composition as the rhyolite tephra. Based upon the stratigraphic and compositional relations, we divide the eruption into four phases. Phase I initiated with eruption of a lithic-rich pumice fall, followed by eruption of Plinian falls and pyroclastic density currents. During Phase II, the eruption paused for at least 5-6 h; in this time, microlites nucleated and began to grow in the magma. Phase III essentially repeated the Phase I sequence. Obsidian lavas were emplaced during Phase IV. The pumice textures suggest that the magma ascended very near the threshold decompression rate for the transition between explosive (fast) and effusive (slow) behavior. The pause during Phase II likely occurred as decompression slowed enough for the magma to develop sufficient permeability for gas to escape resulting in collapse of the magmatic foam, stopping the eruption and temporarily sealing the conduit. After about 5-6 h, eruption resumed with, once again, magma decompressing very near the explosive-effusive transition. Phase III ended when the decompression rate slowed and lava dome emplacement began. Distributions of pumice and

  15. The 21,700 yr b.p. Lower Toluca Pumice Plinian Eruption of Nevado de Toluca Volcano (Mexico): Evidences of Magma Mixing Process as Triggering Mechanism.

    Science.gov (United States)

    Capra, L.; Arce, J.; Macias, J.

    2006-05-01

    Approximately 21,700 yr B.P., after a period of quiescence of 4800 yr, Nevado de Toluca volcano erupted, producing the Lower Toluca Pumice deposit. The activity generated a 24-km-high Plinian column that lasted ~11 h and dispersed 2.3 km3 (0.8 km3 dense rock equivalent) of tephra toward the NE, blanketing the Lerma basin, an area occupied today by the city of Toluca, with up to 5 cm of ash. Subsequent eruptive pulses were sub-Plinian in style, accompanied by phreatomagmatic explosions that emplaced surge deposits. Finally, the column collapsed toward the NE with the emplacement of a pumice flow deposit. The high vesicularity of the pumice from the basal Plinian layer, up to 83% by volume, indicates that exsolution was dominantly magmatic, and that pressurization of the magma chamber was probably due to a magma mixing process. Evidence for this includes the compositional range of juvenile products (from 55 to 65 wt% SiO2), as well as the presence of two types of plagioclase, one in equilibrium and the other one with disequilibrium textures and reverse zoning. This suggests input of an andesitic liquid into the dacitic magma chamber. Based on the eruptive record, the most likely future eruptive activity at Nevado de Toluca volcano will be Plinian. Although quiet for more than 3250 yr, Plinian activity could occur after a long period of quiescence, and it could represent a hazard for the entire Toluca basin, where more than one million people live today.

  16. Magmatic controls on eruption dynamics of the 1950 yr B.P. eruption of San Antonio Volcano, Tacaná Volcanic Complex, Mexico-Guatemala

    Science.gov (United States)

    Mora, Juan Carlos; Gardner, James Edward; Macías, José Luis; Meriggi, Lorenzo; Santo, Alba Patrizia

    2013-07-01

    San Antonio Volcano, in the Tacaná Volcanic Complex, erupted ~ 1950 yr. B.P., with a Pelean type eruption that produced andesitic pyroclastic surges and block-and-ash flows destroying part of the volcano summit and producing a horse-shoe shaped crater open to the SW. Between 1950 and 800 yr B.P. the eruption continued with effusive andesites followed by a dacite lava flow and a summit dome, all from a single magma batch. All products consist of phenocrysts and microphenocrysts of zoned plagioclase, amphibole, pyroxene, magnetite ± ilmenite, set in partially crystallized groundmass of glass and microlites of the same mineral phases, except for the lack of amphibole. Included in the andesitic blocks of the block-and-ash flow deposit are basaltic andesite enclaves with elongated and ellipsoidal forms and chilled margins. The enclaves have intersertal textures with brown glass between microphenocrysts of plagioclase, hornblende, pyroxene, and olivine, and minor proportions of phenocrysts of plagioclase, hornblende, and pyroxene. A compositional range obtained of blocks and enclaves resulted from mixing between andesite (866 °C ± 22) and basaltic andesite (enclaves, 932 °C ± 22), which may have triggered the explosive Pelean eruption. Vestiges of that mixing are preserved as complex compositional zones in plagioclase and clinopyroxene-rich reaction rims in amphibole in the andesite. Whole-rock chemistry, geothermometry, experimental petrology and modeling results suggest that after the mixing event the eruption tapped hybrid andesitic magma (≤ 900 °C) and ended with effusive dacitic magma (~ 825 °C), all of which were stored at ~ 200 MPa water pressure. A complex open-system evolution that involved crustal end-members best explains the generation of effusive dacite from the hybrid andesite. Amphibole in the dacite is rimmed by reaction products of plagioclase, orthopyroxene, and Fe-Ti oxides produced by decompression during ascent. Amphibole in the andesite

  17. Spatial variation in pollen and charcoal records in relation to the 665 yr BP Kaharoa tephra at Harataonga Bay, Great Barrier Island, northern New Zealand : preliminary results

    International Nuclear Information System (INIS)

    Horrocks, M.; Nichol, S.L.; Jones, M.D.; Shane, P.A.; Sutton, D.G.

    2001-01-01

    We present preliminary results of a pollen study examining spatial variability using the 665 14 C yr BP Kaharoa tephra as the key stratigraphic marker. Our aim is to highlight potential differences in pollen and charcoal profiles from adjacent sites, and to point out the implications of these differences for the interpretation of pollen records. Three sediment cores were taken from swampy ground behind foredunes at Harataonga Bay, a small catchment on Great Barrier Island. Core 1 provides a c. 5000 14 C yr record of the swamp and is typical of northern New Zealand pollen profiles in that the deforestation signal appears immediately after Kaharoa tephra. Cores 2 and 3, however, show this signal at least 1 m below the tephra layer. Also, artefact pollen of gourd Lagenaria, an introduced Polynesian cultigen, was found 80 cm below the tephra layer in Core 2. This apparent difference in the timing of the human signal may be explained by the occurrence of small-scale, highly localised fires that are not recorded at adjacent sites. This has implications for inferring date of human presence in extensive areas, such as regions or large catchments, from a small number of pollen cores taken from within those areas. An alternative explanation is that sediments in cores 2 and 3 have been reworked to a much greater extent than those in Core 1. This has implications for the use of tephra as critical data for events, particularly when using recent tephra such as Kaharoa for dating human presence when the necessary resolution is to decades or centuries rather than millenia. (author). 18 refs., 6 figs., 2 tabs

  18. Chronostratigraphy in karst records from the Epipaleolithic to the Mid/Early Neolithic (c. 13.0-6.0 cal ka BP) in the Catalan Coastal Ranges of NE Iberia: environmental changes, sedimentary processes and human activity

    Science.gov (United States)

    Bergadà, M. Mercè; Cervelló, Josep M.; Edo, Manel; Cebrià, Artur; Oms, F. Xavier; Martínez, Pablo; Antolín, Ferran; Morales, Juan Ignacio; Pedro, Mireia

    2018-03-01

    The stratigraphic, sedimentary and palaeoenvironmental features reflected in cavities in the Catalan Coastal Ranges of NE Iberia (Can Sadurní and Guineu caves) characterize the periods of pronounced climatic and human complexity that occurred c. 13.0-6.0 cal ka BP. This includes the stages of the Younger Dryas and Mid/Early Holocene, the latter being one of the periods of so-called Rapid Climatic Changes (RCCs). These caves, like others in Mediterranean contexts, are the result of an old duct originating in the saturated zone of the karst system and open to the outside; recording a succession of different detrital and anthropic episodes of the Epipaleolithic, Mesolithic and Neolithic communities. From this study it can be seen that paleoclimatic events do not always present clear signals in the karst records, especially c. 12.7-7.4 cal ka BP, corresponding to the Epipaleolithic and Mesolithic. It is characterized by a stratigraphic discontinuity in which there are phases with predominantly detrital sedimentation alternating with hiatus intervals. Detrital sedimentation formed by fine material colluvium with gravitational movements or solifluction processes in fresh and humid conditions. It appears in the following chronological intervals: 12.7-12.2 cal ka BP, 11.5/11.1-10.7/10.4 cal ka BP and 8.2-8.0 cal ka BP (less humid). Hiatus phases are represented in the rest of the sequence up to c. 7.4 cal ka BP. From the sedimentary point of view these stages of hiatus are indicative of phases of stability or lack of episodes with seasonal contrasts; a fact that would cause interruptions to detrital deposition in the interior of the caves. In contrast, in the period c. 7.4 to 6.0 cal ka BP, attributed to the Middle and Early Neolithic, there is a certain stratigraphic continuity. From the sedimentary point of view it is distinguished by a variability of processes that responds to accumulative episodes of short duration characteristic of morphogenesis of the slopes in an

  19. Bayesian chronological analyses consistent with synchronous age of 12,835–12,735 Cal B.P. for Younger Dryas boundary on four continents

    Science.gov (United States)

    Kennett, James P.; Kennett, Douglas J.; Culleton, Brendan J.; Aura Tortosa, J. Emili; Bischoff, James L.; Bunch, Ted E.; Daniel, I. Randolph; Erlandson, Jon M.; Ferraro, David; Firestone, Richard B.; Goodyear, Albert C.; Israde-Alcántara, Isabel; Johnson, John R.; Jordá Pardo, Jesús F.; Kimbel, David R.; LeCompte, Malcolm A.; Lopinot, Neal H.; Mahaney, William C.; Moore, Andrew M. T.; Moore, Christopher R.; Ray, Jack H.; Stafford, Thomas W.; Tankersley, Kenneth Barnett; Wittke, James H.; Wolbach, Wendy S.; West, Allen

    2015-01-01

    The Younger Dryas impact hypothesis posits that a cosmic impact across much of the Northern Hemisphere deposited the Younger Dryas boundary (YDB) layer, containing peak abundances in a variable assemblage of proxies, including magnetic and glassy impact-related spherules, high-temperature minerals and melt glass, nanodiamonds, carbon spherules, aciniform carbon, platinum, and osmium. Bayesian chronological modeling was applied to 354 dates from 23 stratigraphic sections in 12 countries on four continents to establish a modeled YDB age range for this event of 12,835–12,735 Cal B.P. at 95% probability. This range overlaps that of a peak in extraterrestrial platinum in the Greenland Ice Sheet and of the earliest age of the Younger Dryas climate episode in six proxy records, suggesting a causal connection between the YDB impact event and the Younger Dryas. Two statistical tests indicate that both modeled and unmodeled ages in the 30 records are consistent with synchronous deposition of the YDB layer within the limits of dating uncertainty (∼100 y). The widespread distribution of the YDB layer suggests that it may serve as a datum layer. PMID:26216981

  20. Bayesian chronological analyses consistent with synchronous age of 12,835-12,735 Cal B.P. for Younger Dryas boundary on four continents.

    Science.gov (United States)

    Kennett, James P; Kennett, Douglas J; Culleton, Brendan J; Aura Tortosa, J Emili; Bischoff, James L; Bunch, Ted E; Daniel, I Randolph; Erlandson, Jon M; Ferraro, David; Firestone, Richard B; Goodyear, Albert C; Israde-Alcántara, Isabel; Johnson, John R; Jordá Pardo, Jesús F; Kimbel, David R; LeCompte, Malcolm A; Lopinot, Neal H; Mahaney, William C; Moore, Andrew M T; Moore, Christopher R; Ray, Jack H; Stafford, Thomas W; Tankersley, Kenneth Barnett; Wittke, James H; Wolbach, Wendy S; West, Allen

    2015-08-11

    The Younger Dryas impact hypothesis posits that a cosmic impact across much of the Northern Hemisphere deposited the Younger Dryas boundary (YDB) layer, containing peak abundances in a variable assemblage of proxies, including magnetic and glassy impact-related spherules, high-temperature minerals and melt glass, nanodiamonds, carbon spherules, aciniform carbon, platinum, and osmium. Bayesian chronological modeling was applied to 354 dates from 23 stratigraphic sections in 12 countries on four continents to establish a modeled YDB age range for this event of 12,835-12,735 Cal B.P. at 95% probability. This range overlaps that of a peak in extraterrestrial platinum in the Greenland Ice Sheet and of the earliest age of the Younger Dryas climate episode in six proxy records, suggesting a causal connection between the YDB impact event and the Younger Dryas. Two statistical tests indicate that both modeled and unmodeled ages in the 30 records are consistent with synchronous deposition of the YDB layer within the limits of dating uncertainty (∼ 100 y). The widespread distribution of the YDB layer suggests that it may serve as a datum layer.

  1. Wisconsin Glaciation of the Sierra Nevada (79,000-15,000 yr B.P.) as Recorded by Rock Flour in Sediments of Owens Lake, California

    Science.gov (United States)

    Bischoff, James L.; Cummins, Kathleen

    2001-01-01

    Chemical analyses of the clay-sized fractions of 564 continuous sediment samples (200-yr resolution) from composite core OL90/92 allow quantification of an abundance of glacial rock flour. Rock flour produced during glacier advances is represented by clay-sized plagioclase, K-feldspar, and biotite in homogeneous internal composition. The abundance of rock flour is deemed proportional to the intensity of glacies advances. Age control for the composite section is provided by combining previously published radiocarbon dates on organics, U/Th dates on ostracode shells, and U/Th dates on saline minerals from nearby Searles Lake correlated to OL92 by pollen. The rock flour record displays three levels of variability: (1) a dominant one of about 20,000 yr related to summer insolation and precipitation; (2) an intermediate one of 3000-5000 yr, perhaps related to North Atlantic Heinrich events; and (3) a minor one of 1000-2000 yr, perhaps related to North Atlantic thermohaline-driven air-temperature variation.

  2. Climatically-controlled siliceous productivity in the eastern Gulf of Guinea during the last 40 000 yr

    Directory of Open Access Journals (Sweden)

    X. Crosta

    2012-03-01

    Full Text Available Opal content and diatom assemblages were analysed in core GeoB4905-4 to reconstruct siliceous productivity changes in the eastern Gulf of Guinea during the last 40 000 yr. Opal and total diatom accumulation rates presented low values over the considered period, except during the Last Glacial Maximum and between 15 000 calendar years Before Present (15 cal. ka BP and 5.5 cal. ka BP, the so-called African Humid Period, when accumulation rates of brackish and freshwater diatoms at the core site were highest. Conversely, accumulation rates of windblown diatoms exhibited an opposite pattern with higher values before and after the African Humid Period and greatest values during Heinrich Events, the Younger Dryas and since 5.5 cal. ka BP.

    Our results demonstrate that siliceous productivity in the eastern Gulf of Guinea was directly driven by the nutrient load from local rivers, whose discharges were forced by precipitation changes over western Equatorial Africa and/or modification of the fluvio-deltaic systems forced by sea level changes. Precipitation in this region is controlled by the West African monsoon which is, in turn, partly dependent on the presence and intensity of the Atlantic Cold Tongue (ACT. Our results therefore suggest that the ACT was weakened, warmer trade winds were less vigorous, and cloud convection and precipitation were greater during the AHP though centennial-to-millennial timescale dry events were observed at ∼10 cal. ka BP, ∼8.5 cal. ka BP and ∼6 cal. ka BP. Conversely, the ACT was more intense, trade winds were more vigorous and African climate was more arid during H1, the Younger Dryas and after 5.5 cal. ka BP into the present.

  3. Precipitation variability in the winter rainfall zone of South Africa during the last 1400 yr linked to the austral westerlies

    Directory of Open Access Journals (Sweden)

    J. C. Stager

    2012-05-01

    Full Text Available The austral westerlies strongly influence precipitation and ocean circulation in the southern temperate zone, with important consequences for cultures and ecosystems. Global climate models anticipate poleward retreat of the austral westerlies with future warming, but the available paleoclimate records that might test these models have been limited to South America and New Zealand, are not fully consistent with each other and may be complicated by influences from other climatic factors. Here we present the first high-resolution diatom and sedimentological records from the winter rainfall region of South Africa, representing precipitation in the equatorward margin of the westerly wind belt during the last 1400 yr. Inferred rainfall was relatively high ∼1400–1200 cal yr BP, decreased until ∼950 cal yr BP, and rose notably through the Little Ice Age with pulses centred on ∼600, 530, 470, 330, 200, 90, and 20 cal yr BP. Synchronous fluctuations in Antarctic ice core chemistry strongly suggest that these variations were linked to changes in the westerlies. Equatorward drift of the westerlies during the wet periods may have influenced Atlantic meridional overturning circulation by restricting marine flow around the tip of Africa. Apparent inconsistencies among some aspects of records from South America, New Zealand and South Africa warn against the simplistic application of single records to the Southern Hemisphere as a whole. Nonetheless, these findings in general do support model projections of increasing aridity in the austral winter rainfall zones with future warming.

  4. The Southern Hemisphere between 30 and 11 cal. kyr B.P.: a comparison between continental records from Africa, South America and Australia

    Science.gov (United States)

    Sylvestre, F.; Williams, M. A.; Gasse, F.; Chalie, F.; Vincens, A.; David, W.

    2006-12-01

    The timing and amplitude of climate changes during the Last Glacial Maximum (LGM) and Termination I have led to considerable debate around the mechanisms driving the reorganisation of the global climate system and its regional expression. The LGM over the southern tropics and subtropics is still poorly understood and the interpretation of different proxies sometimes appears controversial. Here, we summarise the best, well-dated continental records spanning the interval 30-11 cal. kyr, from Africa south of the equator, Australia and South America. Due to the scarcity of the usable records, we had to decipher several proxies (pollen-inferred vegetation, diatom-inferred lake level, isotopes, sea-surface temperatures SST- in the surrounding oceans) and to consider all existing types of archives (wetlands, lakes, speleothems, (peri)glacial deposits, dunes and aeolian dusts), to characterize as completely as possible, the major features of the climate variability over the three continents. Regional similarities and divergences are pointed out, especially East-West asymmetry linked with oceanic currents and topography. The processes driving the observed temperature and hydrological changes are discussed focusing on the following questions: -How did monsoonal climates in the southern tropics respond to orbital forcing versus other glacial boundary conditions, e.g., sea-surface conditions, during the LGM? Example: several tropical lakes from southern Africa were low during the LGM probably in response to low SST. -How did the convergence zones (e.g. the Intertropical Convergence Zone ITCZ) have migrated through time and why? Example: in South America, LGM dryness in Amazonia has been associated with a southward migration of the ITCZ. -How did the extratropical, winter rainfall domain expand/retreat in response to meridian shifts of the Subtropical Westerly Jet and of the oceanic Subtropical Front, and to latitudinal thermal gradient in the Southern Ocean? Example: in

  5. Paleopathological description and diagnosis of metastatic carcinoma in an Early Bronze Age (4588+34 Cal. BP forager from the Cis-Baikal region of Eastern Siberia.

    Directory of Open Access Journals (Sweden)

    Angela R Lieverse

    Full Text Available Extensive osteolytic and osteoblastic lesions were observed on the skeletal remains of an adult male excavated from an Early Bronze Age cemetery dated to 4556+32 years BP, located in the Cis-Baikal region of Siberia (Russian Federation. Lytic lesions ranged in size from several mm to over 60 mm in diameter and had irregular, moth-eaten borders. Many of these lesions destroyed trabecular bone, though a hollowed shell of cortical bone often remained observable. Radiographic analysis revealed numerous lytic lesions within trabecular bone that had not yet affected the cortex. Blastic lesions were identified as spiculated lines, bands, or nodules of mostly immature (woven bone formed at irregular intervals. Anatomical elements with the greatest involvement included those of the axial skeleton (skull, vertebrae, sacrum, ribs, and sternum as well as proximal appendicular elements (ossa coxae, proximal femora, clavicles, scapulae, and proximal humeri. Osteocoalescence of destructive foci was observed on the ilium and frontal bone, with the largest lesion found on the right ilium. Differential diagnoses include metastatic carcinoma, mycotic infections, tuberculosis, Langerhan's cell histiocytosis, and multiple myeloma. Based on lesion appearance and distribution, age and sex of the individual, as well as pathogen endemism, the most likely diagnostic option for this set of lesions is metastatic carcinoma. The age and sex of this individual and appearance of the lesions may reflect carcinoma of the lung or, possibly, prostate. This represents one of the earliest cases of metastatic carcinoma worldwide and the oldest case documented thus far from Northeast Asia.

  6. Climate variability in the SW Indian Ocean from an 8000-yr long multi-proxy record in the Mauritian lowlands shows a middle to late Holocene shift from negative IOD-state to ENSO-state

    NARCIS (Netherlands)

    de Boer, E.J.; Tjallingii, R.; Vélez, M.I.; Rijsdijk, K.F.; Vlug, A.; Reichart, G.J.; Prendergast, A.L.; de Louw, P.G.B.; Vincent Florens, F.B.; Baider, C.; Hooghiemstra, H.

    2014-01-01

    A multi-proxy reconstruction of a sediment core from the Tatos basin in the Mauritian lowlands reveals a dynamic environmental history during the last 8000 years. Under influence of sea level rise, the basin progressed from a wetland to a shallow lake between 8000 and 2500 cal yr BP and it slowly

  7. Climate variability in the SW Indian Ocean from an 8000-yr long multi-proxy record in the Mauritian lowlands shows a middle to late Holocene shift from negative IOD-state to ENSO-state

    NARCIS (Netherlands)

    De Boer, Erik J.; Tjallingii, Rik; Vélez, Maria I.; Rijsdijk, Kenneth F.; Vlug, Anouk; Reichart, Gert-Jan; Prendergast, Amy L.; de Louw, Perry G B; Florens, F. B Vincent; Baider, Cláudia; Hooghiemstra, Henry

    2014-01-01

    A multi-proxy reconstruction of a sediment core from the Tatos basin in the Mauritian lowlands reveals a dynamic environmental history during the last 8000 years. Under influence of sea level rise, the basin progressed from a wetland to a shallow lake between 8000 and 2500cal yr BP and it slowly

  8. A 3500 14C yr High-Resolution Record of Water-Level Changes in Lake Titicaca, Bolivia/Peru

    Science.gov (United States)

    Abbott, Mark B.; Binford, Michael W.; Brenner, Mark; Kelts, Kerry R.

    1997-03-01

    Sediment cores collected from the southern basin of Lake Titicaca (Bolivia/Peru) on a transect from 4.6 m above overflow level to 15.1 m below overflow level are used to identify a new century-scale chronology of Holocene lake-level variations. The results indicate that lithologic and geochemical analyses on a transect of cores can be used to identify and date century-scale lake-level changes. Detailed sedimentary analyses of subfacies and radiocarbon dating were conducted on four representative cores. A chronology based on 60 accelerator mass spectrometer radiocarbon measurements constrains the timing of water-level fluctuations. Two methods were used to estimate the 14C reservoir age. Both indicate that it has remained nearly constant at ˜250 14C yr during the late Holocene. Core studies based on lithology and geochemistry establish the timing and magnitude of five periods of low lake level, implying negative moisture balance for the northern Andean altiplano over the last 3500 cal yr. Between 3500 and 3350 cal yr B.P., a transition from massive, inorganic-clay facies to laminated organic-matter-rich silts in each of the four cores signals a water-level rise after a prolonged mid-Holocene dry phase. Evidence of other significant low lake levels occurs 2900-2800, 2400-2200, 2000-1700, and 900-500 cal yr B.P. Several of the low lake levels coincided with cultural changes in the region, including the collapse of the Tiwanaku civilization.

  9. Northward advection of Atlantic water in the eastern Nordic Seas over the last 3000 yr

    Directory of Open Access Journals (Sweden)

    C. V. Dylmer

    2013-07-01

    Full Text Available Three marine sediment cores distributed along the Norwegian (MD95-2011, Barents Sea (JM09-KA11-GC, and Svalbard (HH11-134-BC continental margins have been investigated in order to reconstruct changes in the poleward flow of Atlantic waters (AW and in the nature of upper surface water masses within the eastern Nordic Seas over the last 3000 yr. These reconstructions are based on a limited set of coccolith proxies: the abundance ratio between Emiliania huxleyi and Coccolithus pelagicus, an index of Atlantic vs. Polar/Arctic surface water masses; and Gephyrocapsa muellerae, a drifted coccolith species from the temperate North Atlantic, whose abundance changes are related to variations in the strength of the North Atlantic Current. The entire investigated area, from 66 to 77° N, was affected by an overall increase in AW flow from 3000 cal yr BP (before present to the present. The long-term modulation of westerlies' strength and location, which are essentially driven by the dominant mode of the North Atlantic Oscillation (NAO, is thought to explain the observed dynamics of poleward AW flow. The same mechanism also reconciles the recorded opposite zonal shifts in the location of the Arctic front between the area off western Norway and the western Barents Sea–eastern Fram Strait region. The Little Ice Age (LIA was governed by deteriorating conditions, with Arctic/Polar waters dominating in the surface off western Svalbard and western Barents Sea, possibly associated with both severe sea ice conditions and a strongly reduced AW strength. A sudden short pulse of resumed high WSC (West Spitsbergen Current flow interrupted this cold spell in eastern Fram Strait from 330 to 410 cal yr BP. Our dataset not only confirms the high amplitude warming of surface waters at the turn of the 19th century off western Svalbard, it also shows that such a warming was primarily induced by an excess flow of AW which stands as unprecedented over the last 3000 yr.

  10. Consolidating BPR with CALS

    DEFF Research Database (Denmark)

    Larsen, Michael Holm; Leinsdorff, Torben; Madsen, Claus

    1999-01-01

    For almost a decade, Business Process Reengineering (BPR) has met a high degree of criticism as project implementations have failed to succeed in industry and public organisations. A vast majority of the reengineering literature recommends that information technology (IT) should enhance the effic......For almost a decade, Business Process Reengineering (BPR) has met a high degree of criticism as project implementations have failed to succeed in industry and public organisations. A vast majority of the reengineering literature recommends that information technology (IT) should enhance...... the likelihood of BPR success. Firstly, CALS contributes to process orientation and process organising in a BPR project. This is partly because CALS satisfies the increased information need of the process team members and partly because CALS breaks down information-based barriers. Secondly, CALS contributes...

  11. Hydroclimate variability in the low-elevation Atacama Desert over the last 2500 yr

    Science.gov (United States)

    Gayo, E. M.; Latorre, C.; Santoro, C. M.; Maldonado, A.; de Pol-Holz, R.

    2012-02-01

    Paleoclimate reconstructions reveal that Earth system has experienced sub-millennial scale climate changes over the past two millennia in response to internal/external forcing. Although sub-millennial hydroclimate fluctuations have been detected in the central Andes during this interval, the timing, magnitude, extent and direction of change of these events remain poorly defined. Here, we present a reconstruction of hydroclimate variations on the Pacific slope of the central Andes based on exceptionally well-preserved plant macrofossils and associated archaeological remains from a hyperarid drainage (Quebrada Maní, ∼21° S, 1000 m a.s.l.) in the Atacama Desert. During the late Holocene, riparian ecosystems and farming social groups flourished in the hyperarid Atacama core as surface water availability increased throughout this presently sterile landscape. Twenty-six radiocarbon dates indicate that these events occurred between 1050-680, 1615-1350 and 2500-2040 cal yr BP. Regional comparisons with rodent middens and other records suggest that these events were synchronous with pluvial stages detected at higher-elevations in the central Andes over the last 2500 yr. These hydroclimate changes also coincide with periods of pronounced SST gradients in the Tropical Pacific (La Niña-like mode), conditions that are conducive to significantly increased rainfall in the central Andean highlands and flood events in the low-elevation watersheds at inter-annual timescales. Our findings indicate that the positive anomalies in the hyperarid Atacama over the past 2500 yr represent a regional response of the central Andean climate system to changes in the global hydrological cycle at centennial timescales. Furthermore, our results provide support for the role of tropical Pacific sea surface temperature gradient changes as the primary mechanism responsible for climate fluctuations in the central Andes. Finally, our results constitute independent evidence for comprehending the

  12. Solar CalPoly

    Energy Technology Data Exchange (ETDEWEB)

    Stannard, Sandra [California Polytechnic State Univ., San Luis Obispo, CA (United States)

    2016-06-15

    The target budget of INhouse was about $650,000 for all materials and student expenses of the Solar Decathlon competition. In order to reach our goal, Cal Poly students and faculty worked with the College of Architecture and Environmental Design’s External Relations office to actively fundraise for INhouse. Students connected with Cal Poly alumni through phone calls, postal mail, email, and live presentations to reach as many alumni in the state of California as possible. Before construction begun, students and faculty met on a weekly basis to determine what brands of materials for the home to use and who would be responsible for reaching out to the company to seek a donation. Our College of Architecture and Environmental Design’s administration was essential in helping us fundraise. For some time, the college was hoping to depend on about half of our fundraising expenses to be covered through the sale of INhouse. However, plans to sell the home fell through during the design development phase; the college turned to the sale of a different asset in to help us meet our goal. If we were to do this project again, completing the design concept and securing a future location of our home sooner would have enhanced our fundraising activities.

  13. BP volume reduction equipment

    International Nuclear Information System (INIS)

    Kitamura, Yoshinori; Muroo, Yoji; Hamanaka, Isao

    2003-01-01

    A new type of burnable poison (BP) volume reduction system is currently being developed. Many BP rods, a subcomponent of spent fuel assemblies are discharged from nuclear power reactors. This new system reduces the overall volume of BP rods. The main system consists of BP rod cutting equipment, equipment for the recovery of BP cut pieces, and special transport equipment for the cut rods. The equipment is all operated by hydraulic press cylinders in water to reduce operator exposure to radioactivity. (author)

  14. CalNex Observational Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — Observations made during the 2010 CalNex measurement campaign. This dataset is associated with the following publication: Woody , M., K. Baker , P. Hayes, J....

  15. CalCOFI Egg Counts

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish egg counts and standardized counts for eggs captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets], and...

  16. BP's emissions trading system

    International Nuclear Information System (INIS)

    Victor, David G.; House, Joshua C.

    2006-01-01

    Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate

  17. Climatic reconstruction in Europe for 18,000 yr B.P. from pollen data

    NARCIS (Netherlands)

    Peyron, O; Guiot, J; Cheddadi, R; Tarasov, P; Reille, M; de Beaulieu, JL; Bottema, S; Andrieu, [No Value

    An improved concept of the best analogs method is used to reconstruct the climate of the last glacial maximum from pollen data in Europe. In order to deal with the lack of perfect analogs of fossil assemblages and therefore to obtain a more accurate climate reconstruction, we used a combination of

  18. Atmospheric radiocarbon calibration to 45,000 yr BP: Late glacial fluctuations and cosmogenic isotope production

    NARCIS (Netherlands)

    Kitagawa, H.; van der Plicht, J.

    1998-01-01

    More than 250 carbon-14 accelerator mass spectrometry dates of terrestrial macrofossils from annually laminated sediments from Lake Suigetsu (Japan) provide a first atmospheric calibration for almost the total range of the radiocarbon method (45,000 years before the present), The results confirm the

  19. FDG goes BP

    International Nuclear Information System (INIS)

    Chan, J.G.

    2000-01-01

    Full text: A monograph for Fluorodeoxyglucose F-18 Injection (FDG) was first released in Supplement 1 of the United States Pharmacopoeia 1990 (USP 90) on 1 November 1989 to become effective on 1 January 1990. As this was the only monograph available until recently it served as the applicable standard to be followed. The Therapeutic Goods Act states that the British Pharmacopoeia (BP) is the precedent to be followed in Australia and implies that if a monograph exists for a finished product then this needs to be applied to achieve a certain standard of quality. If the monograph does not exist in the BP then other pharmacopoeia monographs can be sourced starting with the European Pharmacopoeia (Ph Eur) then the USP. A monograph for FDG first appeared in the Ph Eur in a 1999 Supplement (effective 1 January 1999 and now included in the Ph Eur 2000) and then in the BP 1999 (effective 1 December 1999). The Commonwealth Government Gazette (Notice 48, 1/12/99) published that the BP 99 was adopted on the 1st December 1999. Since then manufacturers have been required to comply with the monograph for FDG in the BP 99. This presentation looks at the content of the BP 99 monograph and compares it with that in the USP. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc

  20. CALS - What are the Potentials for SMEs ?

    DEFF Research Database (Denmark)

    Bilberg, Arne; Larsen, Michael holm; Langer, Gilad

    1996-01-01

    The Danish CALS Center initiative, aims at making CALS operational in Danish industry. The center consists of three Danish companies, Bang & Olufsen, Odense Steel Shipyard, Nilfisk besides from the Technical University of Denmark and the Danish Technological Institute. The objective is to demonst...

  1. The Pace of CalWORKs Implementation

    National Research Council Canada - National Science Library

    Klerman, Jacob

    2000-01-01

    ...) and Greater Avenues to Independence (GAIN) with the California Work Responsibility to Kids (CalWORKs) program. Following an open and competitive bidding process, the California Department of Social Services...

  2. The Pace of CalWORKS Implementation

    National Research Council Canada - National Science Library

    Klerman, Jacob

    1999-01-01

    ...) and Greater Avenues to Independence (GAIN) with the California Work Responsibility to Kids (CalWORKs) program. Following an open and competitive bidding process, the California Department of Social Services...

  3. Views of a Cal/OSHA Inspector.

    Science.gov (United States)

    Oudiz, Jack

    2009-01-01

    Retiring CAL/OSHA Industrial Hygienist and Senior Safety Engineer Jack Oudiz offers his thoughts in the nature of a voluntary "exit interview" on his years working for the agency and its performance in its mission.

  4. CalCOFI Egg Counts Positive Tows

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish egg counts and standardized counts for eggs captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets], and...

  5. CalCOFI Larvae Counts Positive Tows

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for eggs captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  6. Atmospheric radiocarbon calibration beyond 11,900 cal BP from Lake Suigetsu laminated sediments

    NARCIS (Netherlands)

    Kitagawa, H; van der Plicht, J

    2000-01-01

    This paper presents an updated atmospheric radiocarbon calibration from annually laminated (varved) sediments from Lake Suigetsu (LS). central Japan. As presented earlier, the LS varved sediments can be used to extend the radiocarbon time scale beyond the tree ring calibration range that reaches

  7. Developmental evolution of flowering plant pollen tube cell walls: callose synthase (CalS gene expression patterns

    Directory of Open Access Journals (Sweden)

    Abercrombie Jason M

    2011-07-01

    Full Text Available Abstract Background A number of innovations underlie the origin of rapid reproductive cycles in angiosperms. A critical early step involved the modification of an ancestrally short and slow-growing pollen tube for faster and longer distance transport of sperm to egg. Associated with this shift are the predominantly callose (1,3-β-glucan walls and septae (callose plugs of angiosperm pollen tubes. Callose synthesis is mediated by callose synthase (CalS. Of 12 CalS gene family members in Arabidopsis, only one (CalS5 has been directly linked to pollen tube callose. CalS5 orthologues are present in several monocot and eudicot genomes, but little is known about the evolutionary origin of CalS5 or what its ancestral function may have been. Results We investigated expression of CalS in pollen and pollen tubes of selected non-flowering seed plants (gymnosperms and angiosperms within lineages that diverged below the monocot/eudicot node. First, we determined the nearly full length coding sequence of a CalS5 orthologue from Cabomba caroliniana (CcCalS5 (Nymphaeales. Semi-quantitative RT-PCR demonstrated low CcCalS5 expression within several vegetative tissues, but strong expression in mature pollen. CalS transcripts were detected in pollen tubes of several species within Nymphaeales and Austrobaileyales, and comparative analyses with a phylogenetically diverse group of sequenced genomes indicated homology to CalS5. We also report in silico evidence of a putative CalS5 orthologue from Amborella. Among gymnosperms, CalS5 transcripts were recovered from germinating pollen of Gnetum and Ginkgo, but a novel CalS paralog was instead amplified from germinating pollen of Pinus taeda. Conclusion The finding that CalS5 is the predominant callose synthase in pollen tubes of both early-diverging and model system angiosperms is an indicator of the homology of their novel callosic pollen tube walls and callose plugs. The data suggest that CalS5 had transient expression

  8. LumiCal alignment system - Status report

    CERN Document Server

    Daniluk, W.; Lesiak, T.; Moszczyński, A.; Pawlik, B.; Wojtoń, T.; Zawiejski, L.

    2015-01-01

    The paper describes the status of the laser-based alignment-system for the luminosity detector, LumiCal, taking into considerations the conditions of the International Large Detector in the International Linear Collider project. The design of the system comprises two parts: the first one containing semi-transparent silicon sensors used to deliver simultaneous position measurements in the X,Y directions of the monitored object, and the second one in which the interferometric technique, i.e. the Frequency Scanning Interferometry (FSI), is proposed. Two laboratory prototypes for both components of the system were built and the preliminary measurements of the DUT displacements demonstrated their utility in the design of the final alignment system. The alignment of the LumiCal detector will allow us to monitor the detector displacements and possible deformations in its internal structure. Lack of information of the displacements will introduce a systematic effect which will have an impact on the accuracy of the fi...

  9. AMS measurement of C-14 concentration in a single-year ring of a 2500-yr-old tree

    International Nuclear Information System (INIS)

    Sakurai, H.; Gandou, T.; Kato, W.; Sawaki, Y.; Matsumoto, T.; Aoki, T.; Matsuzaki, H.; Gunji, S.; Tokanai, F.

    2004-01-01

    The 14 C concentration in rings of an old tree that date back approximately 2500 yr has been measured at single-year intervals with a highly accurate liquid scintillation counter (LSC) (0.2%) to investigate the 11-yr periodicity of solar activity. To investigate the applicability of AMS to accurate 14 C measurement, 16 graphite samples produced from the cellulose of a single-year tree ring of a 2500-yr-old cedar were measured with the micro analysis laboratory tandem (MALT) accelerator, at The University of Tokyo, and the results were compared with the 14 C age determined using LSC. The average 14 C age of the single-year tree ring calculated from 16 measurements was 2496 ± 23 yr BP, corresponding to the statistical accuracy of 0.26%. This was consistent with the age of 2514 ± 23 yr BP determined using LSC within the acceptable error range, which indicates that accelerator mass spectrometry (AMS) is applicable for accurate 14 C measurement using multi-graphite for the same single-year tree ring

  10. Atmospheric radiocarbon calibration to 45,000 yr B.P.: late glacial fluctuations and cosmogenic isotope production

    Science.gov (United States)

    Kitagawa; van der Plicht J

    1998-02-20

    More than 250 carbon-14 accelerator mass spectrometry dates of terrestrial macrofossils from annually laminated sediments from Lake Suigetsu (Japan) provide a first atmospheric calibration for almost the total range of the radiocarbon method (45,000 years before the present). The results confirm the (recently revised) floating German pine chronology and are consistent with data from European and marine varved sediments, and combined uranium-thorium and carbon-14 dating of corals up to the Last Glacial Maximum. The data during the Glacial show large fluctuations in the atmospheric carbon-14 content, related to changes in global environment and in cosmogenic isotope production.

  11. A 5-yr change in Norwegian 9-yr-olds' objectively assessed physical activity level

    DEFF Research Database (Denmark)

    Kolle, Elin; Steene-Johannessen, Jostein; Klasson-Heggebø, Lena

    2009-01-01

    = 0.02 and girls and boys. Interactions were found between change in physical activity and SES. Although the mean physical activity level and moderate-to-vigorous physical activity (MVPA) among children from low-SES groups showed no change...... over time, an increase was seen among children from middle-SES groups. Moreover, in high-SES groups, an increase was observed for mean physical activity level (girls only) between study periods, whereas no change was seen for MVPA participation. CONCLUSIONS: Nine-year-old children living in Oslo......PURPOSE: To describe changes in objectively assessed physical activity by socioeconomic status (SES) between 1999-2000 and 2005 in 9-yr-old children living in Oslo, Norway. METHODS: Two cross-sectional studies were conducted in 1999-2000 and 2005. The participation rate was 70.9% in 1999...

  12. DOSAR/CalLab Operations Manual

    International Nuclear Information System (INIS)

    Bogard, J.S.

    2000-01-01

    The Life Sciences Division (LSD) of Oak Ridge National Laboratory (ORNL) has a long record of radiation dosimetry research, primarily using the Health Physics Research Reactor (HPRR) and the Dosimetry Applications Research (DOSAR) Program Calibration Laboratory (CalLab), referred to formerly as the Radiation Calibration Laboratory. These facilities have been used by a broad segment of the research community to perform a variety of experiments in areas including, but not limited to, radiobiology, radiation dosimeter and instrumentation development and calibration, and the testing of materials in a variety of radiation environments

  13. TileCal TDAQ/DCS communication

    CERN Document Server

    Solans, C; Arabidze, G; Carneiro Ferreira, B; Sotto-Maior Peralva, B

    2007-01-01

    This document describes the communication between the TDAQ and DCS systems of the Hadronic Tile Calorimeter detector of the ATLAS experiment, currently under commissioning phase at CERN. It is a further step on the TDAQ and DCS communication for TileCal operation. The aim of the implementation is to increase the robustness and understanding of the detector from the two systems involved. The basic principle observed is that the two systems operate independently in parallel. Hence, the knowledge of the status of the whole detector from each of the two systems is required for further analysis of the archived data.

  14. Finished Genome Sequence of Collimonas arenae Cal35

    NARCIS (Netherlands)

    Wu, Je-Jia; de Jager, Victor; Deng, Wen-ling; Leveau, Johan

    2015-01-01

    We announce the finished genome sequence of soil forest isolate Collimonas arenae Cal35, which comprises a 5.6-Mbp chromosome and 41-kb plasmid. The Cal35 genome is the second one published for the bacterial genus Collimonas and represents the first opportunity for high-resolution comparison of

  15. An Interaction of Screen Colour and Lesson Task in CAL

    Science.gov (United States)

    Clariana, Roy B.

    2004-01-01

    Colour is a common feature in computer-aided learning (CAL), though the instructional effects of screen colour are not well understood. This investigation considers the effects of different CAL study tasks with feedback on posttest performance and on posttest memory of the lesson colour scheme. Graduate students (n=68) completed a computer-based…

  16. Geology, Surficial - MO 2012 Springfield 100Yr Flood Sinkholes (SHP)

    Data.gov (United States)

    NSGIC State | GIS Inventory — The layer "100 Yr Flood Sinkholes" is an shapefile feature showing the location of many of the sinkholes found in the Springfield Missouri area. Each of the polygons...

  17. Beam Tests of a Multilayer LumiCal Prototype

    CERN Document Server

    Borysov, O

    2018-01-01

    LumiCal is a sampling electromagnetic calorimeter designed for the precise measurement of in- tegrated luminosity in electron positron linear collider experiments. The present report contains a description and results of the first beam test of a multilayer LumiCal prototype with four sili- con detector planes. A 5 GeV electron beam from the CERN PS T9 facility was used to study the performance of the LumiCal prototype. Presented results are mainly focused on the trans- verse structure of the observed electromagnetic shower and the Molière radius measurement. A comparison with MC simulation is also discussed.

  18. Relatiivinen solmisaatio käyrätorven alkeisopinnoissa

    OpenAIRE

    Laine, Aino

    2009-01-01

    Tämän työn aiheena on relatiivisen solmisaation hyödyntäminen käyrätorven alkeisopinnoissa. Työn tarkoituksena on selvittää, miten relatiivista solmisaatiota voidaan käyttää aloittelevien 8-9-vuotiaiden soitto-oppilaiden opetuksessa ensimmäisen vuoden aikana. Työssä pohditaan, miten Colourwinds-menetelmän periaatteita voidaan soveltaa käyrätorven alkeisopetuksessa. Colourwinds-soitinkouluja verrataan Hulda Horns första spelbok -alkeissoittovihkoon. Solmisaatiolle pohjautuvaa suomenkielist...

  19. Human Response to Potential Robust Climate Change around 5500 cal BP in the Territory of Bohemia (the Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Dreslerová, Dagmar

    2012-01-01

    Roč. 3, č. 1 (2012), s. 43-55 ISSN 1804-848X Institutional support: RVO:67985912 Keywords : Holocene * Neolithic * environment * climate Subject RIV: AC - Archeology, Anthropology, Ethnology http://www.iansa.eu/papers/IANSA-2012-01-dreslerova.pdf

  20. CalCOFI Larvae Counts, Scientific Names CI to CO

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  1. CalCOFI Larvae Counts, Scientific Names DH to EC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  2. CalCOFI Larvae Counts, Scientific Names TF to U

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  3. CalCOFI Larvae Counts, Scientific Names HJ to ID

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  4. CalCOFI Larvae Counts, Scientific Names AN to AR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  5. CalCOFI Larvae Counts, Scientific Names SJ to ST

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  6. CalCOFI Larvae Counts, Scientific Names CP to DE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  7. CalCOFI Larvae Counts, Scientific Names C to CE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  8. CalCOFI Larvae Counts, Scientific Names EV to GN

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  9. CalCOFI Larvae Counts, Scientific Names V to Z

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  10. CalCOFI Larvae Counts, Scientific Names ED to EU

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  11. CalCOFI Larvae Counts, Scientific Names SD to SI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  12. California Cooperative Oceanic Fisheries Investigations (CalCOFI)Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This database contains icthyoplankton data collected as part of the California Cooperative Oceanic Fisheries Investigations (CalCOFI) program and other cruises...

  13. CalCOFI Larvae Counts, Scientific Names MB to MO

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  14. CalCOFI Larvae Counts, Scientific Names LJ to MA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  15. CalCOFI Larvae Counts, Scientific Names AS to BA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  16. CalCOFI Larvae Counts, Scientific Names SB to SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  17. CalCOFI Larvae Counts, Scientific Names MP to NA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  18. CalCOFI Larvae Counts, Scientific Names SU to TE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  19. CalCOFI Larvae Counts, Scientific Names PL to PO

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  20. CalCOFI Larvae Counts, Scientific Names IE to LA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  1. CalCOFI Larvae Counts, Scientific Names A to AM

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  2. CalCOFI Larvae Counts, Scientific Names HB to HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  3. CalCOFI Larvae Counts, Scientific Names OM to OX

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  4. CalCOFI Larvae Counts, Scientific Names Q to SA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  5. CalCOFI Larvae Counts, Scientific Names PP to PZ

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  6. CalCOFI Larvae Counts, Scientific Names GO to HA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  7. CalCOFI Larvae Counts, Scientific Names NB to OL

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  8. CalCOFI Larvae Counts, Scientific Names LB to LI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  9. CalCOFI Larvae Counts, Scientific Names BCE to BZ

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  10. CalCOFI Larvae Counts, Scientific Names CD to CH

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  11. ' "~w.ith ~a'~nd"Atypz'cal Features

    African Journals Online (AJOL)

    2006-09-11

    }? While there have been reports of ' this syndrome from ' Ibadan,' the exact incidence 1\\_Iigeria is It probably rare but it is alsoylikely that 'some. cases are missed in chm', 'cal due to poor awareness -and constraints' '.

  12. CalCOFI Larvae Counts, Scientific Names OY to PI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  13. On the correspondence between CAL and lagged cohort life expectancy

    Directory of Open Access Journals (Sweden)

    Michel Guillot

    2011-04-01

    Full Text Available It has been established that under certain mortality assumptions, the current value of the Cross-sectional Average length of Life (CAL is equal to the life expectancy for the cohort currently reaching its life expectancy. This correspondence is important, because the life expectancy for the cohort currently reaching its life expectancy, or lagged cohort life expectancy (LCLE, has been discussed in the tempo literature as a summary mortality measure of substantive interest. In this paper, we build on previous work by evaluating the extent to which the correspondence holds in actual populations. We also discuss the implications of the CAL-LCLE correspondence (or lack thereof for using CAL as a measure of cohort life expectancy, and for understanding the connection between CAL, LCLE, and underlying period mortality conditions.

  14. Cal Poly Apparel Manufacturing Demonstration - Year 3 Final Technical Report

    National Research Council Canada - National Science Library

    2000-01-01

    .... Since the Southern California apparel industry is primarily small businesses producing low volume fashion products, the Cal Poly Demo factory needed to reflect the size and capability of its customer...

  15. A pollen-based record of late glacial-Holocene climatic variability in the southern lake district, Chile

    NARCIS (Netherlands)

    Vargas-Ramirez, L.; Roche, E.; Gerrienne, P.; Hooghiemstra, H.

    2008-01-01

    A pollen record from Puyehue area (40°S; 72°W) in the southern Lake District, Chile, indicates that prior to 13,410 14C yr BP (ca. 16,500-15,200 cal yr BP), cold resistant and hygrophilous vegetation, particularly Nothofagus forest and myricaceous vegetation, covered the area. From ca. 15,000 cal yr

  16. Yr10 gene polymorphism in bread wheat varieties | Temel | African ...

    African Journals Online (AJOL)

    Yellow rust resistance locus Yr10 located on chromosome 1B in Moro and originated from the Turkish line PI178383 was investigated in terms of polymorphism in seven winter type bread wheat cvs. (Triticum aestivum ssp. Aestivum) Altay2000, zgi2001, Sönmez2001 (yellow rust resistant), Aytýn98, ES14, Harmankaya99 ...

  17. Yr10 gene polymorphism in bread wheat varieties

    African Journals Online (AJOL)

    STORAGESEVER

    2008-07-18

    Jul 18, 2008 ... Yellow rust resistance locus Yr10 located on chromosome 1B in Moro and originated from the Turkish line PI178383 was investigated ... analysis proved that there has been single nucleotide changes especially in the second exon. The most ..... Successes in breeding for and managing durable resistance ...

  18. BP report of the business year 1979

    Energy Technology Data Exchange (ETDEWEB)

    1980-01-01

    The paper presents a survey about the development of the energy- and petroleum market during the year 1979. A commentary of the German BP A.G. and its activities is given here: personnel- and management policy, exploration, supply, refining and distribution, investigation, and development. After a survey about the business situation of the German BP A.G. the detailed annual balance sheets of 1979 of the German BP and of the whole enterprise are given.

  19. BP - bisnis põhjas? / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2010-01-01

    Seoses Mehhiko lahe naftareostusega ootab BP-d kuni 21 mld. dollari suurune trahv, kahjude hüvitamiseks peab BP müüma osa oma varast. Ekspertide hinnangul tähendavad Mehhiko lahe sündmused suuri muutusi kogu naftaäris

  20. Progress Report on an Ultra-compact LumiCal

    CERN Document Server

    Borysov, O

    2018-01-01

    A new design of a detector module of submillimeter thickness for an electromagnetic calorimeter is presented. It is aimed to be used in the luminometers LumiCal and BeamCal in future linear e+e− collider experiments. The module prototypes were produced utilizing novel connectivity schemes technologies. They are installed in a compact prototype of the calorimeter and tested at DESY with an electron beam of 1 GeV – 6 GeV. The performance of eight detector modules and the possibility of electron and photon identification is studied.

  1. BP Investment Exceeds $4 Bln in china

    Institute of Scientific and Technical Information of China (English)

    Wang Ping

    2008-01-01

    @@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.

  2. BP teatas harvast edusammust / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2010-01-01

    Naftakompanii BP teatas, et suudab Mehhiko lahest päevas kinni püüda sinna lekkinud 10 000 barrelit naftat. Tegu on ajutise lahendusega, lõplikult peaks naftavoo peatama merepõhja puuritavad nn. asenduskaevud

  3. CALS - what are the potentials for SME’s ?

    DEFF Research Database (Denmark)

    Bilberg, Arne; Thomsen, Finn Tang; Larsen, Michael Holm

    1997-01-01

    the potentials for improvingbusiness processes by effective information management. The threecompanies involved will demonstrate practical and innovativeapplications of CALS solutions, that will serve as examples for awide variety of SMEs. The paper will focus on the industrial results and the CALSengineering...

  4. Impact of CALS on Electronic Publishing Systems and Users.

    Science.gov (United States)

    Beazley, William G.

    1990-01-01

    The U.S. Department of Defense has begun using its buying power to enforce standards on the vendors and contractors of automatic data processing hardware and software. An example of this, the Computer-Aided Acquisition and Logistic Support (CALS) program, is described, and how it will affect electronic publishing systems is discussed. (five…

  5. ATLAS TileCal Read Out Driver production

    International Nuclear Information System (INIS)

    Valero, A; Abdallah, J; Castillo, V; Cuenca, C; Ferrer, A; Fullana, E; Gonzalez, V; Higon, E; Poveda, J; Ruiz-MartInez, A; Saez, M A; Salvachua, B; SanchIs, E; Solans, C; Valls, J A

    2007-01-01

    The production tests of the 38 ATLAS TileCal Read Out Drivers (RODs) are presented in this paper. The hardware specifications and firmware functionality of the RODs modules, the test-bench and the test procedure to qualify the boards are described. Finally the performance results, the temperature studies and high rate tests are shown and discussed

  6. Dijk- en oeverval aan den cal. Willem Annapolder (Gem. Kapelle)

    NARCIS (Netherlands)

    Verhagen, H.J.

    1936-01-01

    Foto's van de aanleg van de dijk- en oeverval aan den cal. Willem Annapolder (Gem. Kapelle) 3. Linkerhelft dijkval Willem Annapolder. 30 Dec. 1936 4. Rechtehelft dijkval Willem Annapolder. 30 Dec. 1936 5. Overzicht dijkval Willem Annaolder. 30 Dec. 1936 6. Kleikisting binnendijks aangebacht. 14/15

  7. Remapping of the stripe rust resistance gene Yr10 in common wheat.

    Science.gov (United States)

    Yuan, Cuiling; Wu, Jingzheng; Yan, Baiqiang; Hao, Qunqun; Zhang, Chaozhong; Lyu, Bo; Ni, Fei; Caplan, Allan; Wu, Jiajie; Fu, Daolin

    2018-02-23

    Yr10 is an important gene to control wheat stripe rust, and the search for Yr10 needs to be continued. Wheat stripe rust or yellow rust is a devastating fungal disease caused by Puccinia striiformis f. sp. tritici (Pst). Host disease resistance offers a primary source for controlling wheat stripe rust. The stripe rust resistance gene Yr10 confers the race-specific resistance to most tested Pst races in China including CYR29. Early studies proposed that Yr10 was a nucleotide-binding site, leucine-rich repeat gene archived as GenBank accession AF149112 (hereafter designated the Yr10 candidate gene or Yr10 CG ). In this study, we revealed that 15 Chinese wheat cultivars positive for Yr10 CG are susceptible to CYR29. We then expressed the Yr10 CG cDNA in the common wheat 'Bobwhite'. The Yr10 CG -cDNA positive transgenic plants were also susceptible to CYR29. Thus, it is highly unlikely that Yr10 CG corresponds to the Yr10 resistance gene. Using the Yr10 donor 'Moro' and the Pst-susceptible wheat 'Huixianhong', we generated two F 3 populations that displayed a single Mendelian segregation on the Yr10 gene, and used them to remap the Yr10 gene. Six markers were placed in the Yr10 region, with the Yr10 CG gene now mapping about 1.2-cM proximal to the Yr10 locus and the Xsdauw79 marker is completely linked to the Yr10 locus. Apparently, the Yr10 gene has not yet been identified. Fine mapping and positional cloning of Yr10 is important for gene pyramiding for stripe rust resistance in wheat.

  8. CALS Baseline Architecture Analysis of Weapons System. Technical Information: Army, Draft. Volume 8

    Science.gov (United States)

    1989-09-01

    This effort was performed to provide a common framework for analysis and planning of CALS initiatives across the military services, leading eventually to the development of a common DoD-wide architecture for CALS. This study addresses Army technical ...

  9. Mitotic protein kinase CDK1 phosphorylation of mRNA translation regulator 4E-BP1 Ser83 may contribute to cell transformation

    Energy Technology Data Exchange (ETDEWEB)

    Velasquez, Celestino; Cheng, Erdong; Shuda, Masahiro; Lee-Oesterreich, Paula J.; Pogge von Strandmann, Lisa; Gritsenko, Marina A.; Jacobs, Jon M.; Moore, Patrick S.; Chang, Yuan

    2016-07-11

    mTOR-directed 4E-BP1 phosphorylation promotes cap-dependent translation and tumorigen-esis. During mitosis, CDK1 substitutes for mTOR and fully phosphorylates 4E-BP1 at canoni-cal as well a non-canonical S83 site resulting in a mitosis-specific hyperphosphorylated δ isoform. Colocalization studies with a phospho-S83 specific antibody indicate that 4E-BP1 S83 phosphorylation accumulates at centrosomes during prophase, peaks at metaphase, and decreases through telophase. While S83 phosphorylation of 4E-BP1 does not affect in vitro cap-dependent translation, nor eIF4G/4E-BP1 cap-binding, expression of an alanine substitution mutant 4E-BP1.S83A partially reverses rodent cell transformation induced by Merkel cell polyomavirus (MCV) small T (sT) antigen viral oncoprotein. In contrast to inhibitory mTOR 4E-BP1 phosphorylation, these findings suggest that mitotic CDK1-directed phosphorylation of δ-4E-BP1 may yield a gain-of-function, distinct from translation regulation, that may be important in tumorigenesis and mitotic centrosome function.

  10. A Late Quaternary palynological and sedimentological record from two coastal swamps at southern Kaitoke, Great Barrier Island, New Zealand

    International Nuclear Information System (INIS)

    Horrocks, M.; Ogden, J.; Nichol, S.L.; Alloway, B.V.; Sutton, D.G.

    2000-01-01

    Pollen and sediment analyses of two cores from southern Kaitoke (Forsythes' Paddock and Blackwells' Bush), Great Barrier Island, show that at c. 7500 cal. yr BP, the area was an estuary with tidal flats and Avicennia. By c. 3000 cal. yr BP, a Restionaceae (Leptocarpus) salt marsh had developed in the estuary as marine influences lessened. By c. cal. 2550 yr BP, fresh water swamp (Cyperacceae-Gleichenia-Leptspermum) had replaced the salt marsh. Conifer-hardwood forest surrounding the southern Kaitoke sites from c. 7500-c. 2800 cal. yr BP was dominated by Daceydium, Metrosideros and Libocedrus. After c. 2800 cal. yr BP Metrosideros was replaced by Agathis, Phyllocladus and Prumnopitys taxifolia, suggesting climatic change to more variable conditions. The presence of the Kaharoa Tephra suggests that major Polynesian deforestation at southern Kaitoke began c. 600 cal. yr BP Minor pre-Kaharoa fire disturbance is evident c. 1750 cal. yr BP and c. 1290-970 cal. yr BP (author). 52 refs., 4 figs., 2 tabs

  11. Windows Calorimeter Control (WinCal) program computer software design description

    International Nuclear Information System (INIS)

    Pertzborn, N.F.

    1997-01-01

    The Windows Calorimeter Control (WinCal) Program System Design Description contains a discussion of the design details for the WinCal product. Information in this document will assist a developer in maintaining the WinCal system. The content of this document follows the guidance in WHC-CM-3-10, Software Engineering Standards, Standard for Software User Documentation

  12. Eastern Andean environmental and climate synthesis for the last 2000 years BP from terrestrial pollen and charcoal records of Patagonia

    Science.gov (United States)

    Sottile, G. D.; Echeverria, M. E.; Mancini, M. V.; Bianchi, M. M.; Marcos, M. A.; Bamonte, F. P.

    2015-06-01

    The Southern Hemisphere Westerly Winds (SWW) constitute an important zonal circulation system that dominates the dynamics of Southern Hemisphere mid-latitude climate. Little is known about climatic changes in the Southern South America in comparison to the Northern Hemisphere due to the low density of proxy records, and adequate chronology and sampling resolution to address environmental changes of the last 2000 years. Since 2009, new pollen and charcoal records from bog and lakes in northern and southern Patagonia at the east side of the Andes have been published with an adequate calibration of pollen assemblages related to modern vegetation and ecological behaviour. In this work we improve the chronological control of some eastern Andean previously published sequences and integrate pollen and charcoal dataset available east of the Andes to interpret possible environmental and SWW variability at centennial time scales. Through the analysis of modern and past hydric balance dynamics we compare these scenarios with other western Andean SWW sensitive proxy records for the last 2000 years. Due to the distinct precipitation regimes that exist between Northern (40-45° S) and Southern Patagonia (48-52° S) pollen sites locations, shifts on latitudinal and strength of the SWW results in large changes on hydric availability on forest and steppe communities. Therefore, we can interpret fossil pollen dataset as changes on paleohydric balance at every single site by the construction of paleohydric indices and comparison to charcoal records during the last 2000 cal yrs BP. Our composite pollen-based Northern and Southern Patagonia indices can be interpreted as changes in latitudinal variation and intensity of the SWW respectively. Dataset integration suggest poleward SWW between 2000 and 750 cal yrs BP and northward-weaker SWW during the Little Ice Age (750-200 cal yrs BP). These SWW variations are synchronous to Patagonian fire activity major shifts. We found an in phase

  13. Laser measurement of the LumiCal detector displacement

    International Nuclear Information System (INIS)

    Blocki, J.; Daniluk, W.; Gil, M.; Karbowiak, M.; Moszczynski, A.; Oliwa, K.; Pawlik, B.; Wierba, W.; Zawiejski, L.; Slominski, W.; Suszycki, L.

    2006-12-01

    The silicon-tungsten calorimeter LumiCal, located in very forward region of the future detector at the International Linear Collider, is proposed for precisely luminosity measurement. One of the requirements to fulfil this task is available information on the actual position of the calorimeter relative to the beam interaction area which should be known with accuracy of a few micrometers. In this paper we discuss the possible solutions for the positioning of the LumiCal electron detector by optical method. The results of the displacement measurement using a laser beam and a CCD camera are described. The measurements were performed on a proof-of-principle basis and achieved the accuracy of about ± 1 μm in x, y and ± μm in z direction. (author)

  14. Diferencias y similitudes entre morteros de cal hidráulica y morteros mixtos de cal área y cemento portland

    OpenAIRE

    Peñaranda García, Pilar

    2012-01-01

    En el presente trabajo se estudian el mortero de cal hidráulica y el mortero mixto de cal aérea y cemento Portland, siendo este último el más utilizado en la actualidad, ya que la cal ha pasado a un segundo plano en la construcción debido a los grandes avances en la producción de cemento a lo largo del siglo XX. Estos avances han desplazado a la cal, un material utilizado desde hace milenios, olvidando su alta resistencia al paso del tiempo, cuya prueba es el gran volumen de ...

  15. ARCHAEOLOGICAL AND ENVIRONMENTAL CHANGES BETWEEN 9500 BP AND 4500 BP: A CONTRIBUTION FROM THE SAHARA TO UNDERSTAND EXPANDING DROUGHTS IN THE “GREAT MEDITERRANEAN”

    Directory of Open Access Journals (Sweden)

    E. A.A. Garcea

    2013-03-01

    Full Text Available The Sahara is more connected to the Mediterranean than often assumed and palynology, in particular, has provided evidence of past interrelations between the Mediterranean and the Sahara with pollen spectra from prehistoric Saharan deposits including Mediterranean taxa. In order to show human-environment relationships and populations’ strategies in response to changing environments, this paper presents a case study from the southern Sahara. This region offered a natural laboratory for the study of human/climate interaction as the range of environmental change extended from flood to drought, forcing people to cope with periodic environmental instability. When the tropical rainfall belt migrated northward, watertable outcropped in interdunal depressions and formed permanent lakes, which alternated with severe arid spells. As a case study, this paper presents the results of interdisciplinary investigations on climate changes, human adaptations and subsistence strategies at Gobero, in the southern Sahara of Niger. Gobero is a restricted archaeological area comprising 8 sites that surround the shores of a palaeolake. It was intermittently occupied between about 9500 cal years BP and 4500 BP. Due to alternating environmental conditions it could only be occupied at the beginning and at the end of the most humid periods.

  16. Based on BP Neural Network Stock Prediction

    Science.gov (United States)

    Liu, Xiangwei; Ma, Xin

    2012-01-01

    The stock market has a high profit and high risk features, on the stock market analysis and prediction research has been paid attention to by people. Stock price trend is a complex nonlinear function, so the price has certain predictability. This article mainly with improved BP neural network (BPNN) to set up the stock market prediction model, and…

  17. Annual carbon balance of a peatland 10 yr following restoration

    Directory of Open Access Journals (Sweden)

    M. Strack

    2013-05-01

    Full Text Available Undisturbed peatlands represent long-term net sinks of carbon; however, peat extraction converts these systems into large and persistent sources of greenhouse gases. Although rewetting and restoration following peat extraction have taken place over the last several decades, very few studies have investigated the longer term impact of this restoration on peatland carbon balance. We determined the annual carbon balance of a former horticulturally-extracted peatland restored 10 yr prior to the study and compared these values to the carbon balance measured at neighboring unrestored and natural sites. Carbon dioxide (CO2 and methane (CH4 fluxes were measured using the chamber technique biweekly during the growing season from May to October 2010 and three times over the winter period. Dissolved organic carbon (DOC export was measured from remnant ditches in the unrestored and restored sites. During the growing season the restored site had greater uptake of CO2 than the natural site when photon flux density was greater than 1000 μmol m−2 s−1, while the unrestored site remained a source of CO2. Ecosystem respiration was similar between natural and restored sites, which were both significantly lower than the unrestored site. Methane flux remained low at the restored site except from open water pools, created as part of restoration, and remnant ditches. Export of DOC during the growing season was 5.0 and 28.8 g m−2 from the restored and unrestored sites, respectively. Due to dry conditions during the study year all sites acted as net carbon sources with annual balance of the natural, restored and unrestored sites of 250.7, 148.0 and 546.6 g C m−2, respectively. Although hydrological conditions and vegetation community at the restored site remained intermediate between natural and unrestored conditions, peatland restoration resulted in a large reduction in annual carbon loss from the system resulting in a carbon balance more similar to a natural

  18. The last glacial maximum (21 000-17 000 14C yr B.P.) in the southern tropical Andes (Bolivia) based on diatom studies

    International Nuclear Information System (INIS)

    Sylvestre, F.

    1998-01-01

    A diatom study, carried out on a core recovered in the Southern Altiplano (Coipasa salt lake 19 deg. S,68 deg. W) currently almost completely dry, shows that during the last glacial maximum he Coipasa salar was entirely occupied by a large shallow lake. Available data for the northern Altiplano (Lake Titicaca, 16 deg. S, 69 deg. W) indicate a water level 17 m lower than today. This opposition is explained by decreased tropical precipitations whose effects registered by Lake Titicaca were obliterated in the Coipasa salar by increased winter precipitation. (authors)

  19. Ages of 24 widespread tephras erupted since 30,000 years ago in New Zealand, with re-evaluation of the timing and palaeoclimatic implications of the Lateglacial cool episode recorded at Kaipo bog

    Science.gov (United States)

    Lowe, David J.; Blaauw, Maarten; Hogg, Alan G.; Newnham, Rewi M.

    2013-08-01

    Tephras are important for the NZ-INTIMATE project because they link all three records comprising the composite inter-regional stratotype developed for the New Zealand climate event stratigraphy (NZ-CES). Here we firstly report new calendar ages for 24 widespread marker tephras erupted since 30,000 calendar (cal.) years ago in New Zealand to help facilitate their use as chronostratigraphic dating tools for the NZ-CES and for other palaeoenvironmental and geological applications. The selected tephras comprise 12 rhyolitic tephras from Taupo, nine rhyolitic tephras from Okataina, one peralkaline rhyolitic tephra from Tuhua, and one andesitic tephra each from Tongariro and Egmont/Taranaki volcanic centres. Age models for the tephras were obtained using three methods: (i) 14C-based wiggle-match dating of wood from trees killed by volcanic eruptions (these dates published previously); (ii) flexible depositional modelling of a high-resolution 14C-dated age-depth sequence at Kaipo bog using two Bayesian-based modelling programs, Bacon and OxCal's P_Sequence function, and the IntCal09 data set (with SH offset correction -44 ± 17 yr); and (iii) calibration of 14C ages using OxCal's Tau_Boundary function and the SHCal04 and IntCal09 data sets. Our preferred dates or calibrated ages for the 24 tephras are as follows (youngest to oldest, all mid-point or mean ages of 95% probability ranges): Kaharoa AD 1314 ± 12; Taupo (Unit Y) AD 232 ± 10; Mapara (Unit X) 2059 ± 118 cal. yr BP; Whakaipo (Unit V) 2800 ± 60 cal. yr BP; Waimihia (Unit S) 3401 ± 108 cal. yr BP; Stent (Unit Q) 4322 ± 112 cal. yr BP; Unit K 5111 ± 210 cal. yr BP; Whakatane 5526 ± 145 cal. yr BP; Tuhua 6577 ± 547 cal. yr BP; Mamaku 7940 ± 257 cal. yr BP; Rotoma 9423 ± 120 cal. yr BP; Opepe (Unit E) 9991 ± 160 cal. yr BP; Poronui (Unit C) 11,170 ± 115 cal. yr BP; Karapiti (Unit B) 11,460 ± 172 cal. yr BP; Okupata 11,767 ± 192 cal. yr BP; Konini (bed b) 11,880 ± 183 cal. yr BP; Waiohau 14,009 ± 155

  20. CalSimHydro Tool - A Web-based interactive tool for the CalSim 3.0 Hydrology Prepropessor

    Science.gov (United States)

    Li, P.; Stough, T.; Vu, Q.; Granger, S. L.; Jones, D. J.; Ferreira, I.; Chen, Z.

    2011-12-01

    CalSimHydro, the CalSim 3.0 Hydrology Preprocessor, is an application designed to automate the various steps in the computation of hydrologic inputs for CalSim 3.0, a water resources planning model developed jointly by California State Department of Water Resources and United States Bureau of Reclamation, Mid-Pacific Region. CalSimHydro consists of a five-step FORTRAN based program that runs the individual models in succession passing information from one model to the next and aggregating data as required by each model. The final product of CalSimHydro is an updated CalSim 3.0 state variable (SV) DSS input file. CalSimHydro consists of (1) a Rainfall-Runoff Model to compute monthly infiltration, (2) a Soil moisture and demand calculator (IDC) that estimates surface runoff, deep percolation, and water demands for natural vegetation cover and various crops other than rice, (3) a Rice Water Use Model to compute the water demands, deep percolation, irrigation return flow, and runoff from precipitation for the rice fields, (4) a Refuge Water Use Model that simulates the ponding operations for managed wetlands, and (5) a Data Aggregation and Transfer Module to aggregate the outputs from the above modules and transfer them to the CalSim SV input file. In this presentation, we describe a web-based user interface for CalSimHydro using Google Earth Plug-In. The CalSimHydro tool allows users to - interact with geo-referenced layers of the Water Budget Areas (WBA) and Demand Units (DU) displayed over the Sacramento Valley, - view the input parameters of the hydrology preprocessor for a selected WBA or DU in a time series plot or a tabular form, - edit the values of the input parameters in the table or by downloading a spreadsheet of the selected parameter in a selected time range, - run the CalSimHydro modules in the backend server and notify the user when the job is done, - visualize the model output and compare it with a base run result, - download the output SV file to be

  1. Spores of coprophilous fungi from under the Dawson tephra (25,300 14C years BP), Yukon Territory, northwestern Canada

    NARCIS (Netherlands)

    van Geel, B.; Zazula, G.D.; Schweger, C.E.

    2007-01-01

    Based on the analysis of pollen and macrofossils Zazula et al. [Zazula, G.D., Froesne, D.G., Elias, S.A., Kuzmina, S., la Farge, C., Reyes, A.V., Sanborn, P.T., Schweger, C.E., Smith, C.A.S., Mathewes, R.W., 2006. Vegetation buried under Dawson tephra (25,300 14C yr BP) and locally diverse late

  2. AcEST: BP918406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m

  3. AcEST: BP918011 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show BP91801...is mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiant...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap

  4. BP Oil Company's approach to risk management

    International Nuclear Information System (INIS)

    Fryman, C.E.

    1996-01-01

    The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams

  5. BP's driving safety strategy

    Energy Technology Data Exchange (ETDEWEB)

    Herman, B. [BP Canada Energy Company, Calgary, AB (Canada)

    2006-07-01

    This presentation focused on why it is important to drive safely. It addressed driver fatigue as well as BP's global driving standard. The Standard applies to all BP employees and contractors that drive any vehicle on BP business and consists of 10 mandatory elements focusing on safety of the driver, the safety of the journey, and the safety of the vehicle. The driving standards focus on several themes, including skill and competency of the driver, safety of the journey, and safety of the vehicle. Fatigue causes more than 20 per cent of motorway accidents and is the most frequent cause of accidental death of truck drivers. The presentation also discussed vehicle data recorders, driving immersion, and Driving Safety Program results. Journey management, driver training, vehicle inspections and policies, and statistics on vehicle incidents were also provided. The presentation revealed that a lack of pre-trip journey management, inadequate training or recall of training, and not following safe driving practices were major contributors to incident occurrences. It also revealed that traveling on gravel or ice and avoiding wildlife were factors in many vehicle incidents. 1 tab., 1 fig.

  6. Human (Clovis)–gomphothere (Cuvieronius sp.) association ∼13,390 calibrated yBP in Sonora, Mexico

    Science.gov (United States)

    Sanchez, Guadalupe; Holliday, Vance T.; Gaines, Edmund P.; Arroyo-Cabrales, Joaquín; Martínez-Tagüeña, Natalia; Kowler, Andrew; Lange, Todd; Hodgins, Gregory W. L.; Mentzer, Susan M.; Sanchez-Morales, Ismael

    2014-01-01

    The earliest known foragers to populate most of North America south of the glaciers [∼11,500 to ≥ ∼10,800 14C yBP; ∼13,300 to ∼12,800 calibrated (Cal) years] made distinctive “Clovis” artifacts. They are stereotypically characterized as hunters of Pleistocene megamammals (mostly mammoth) who entered the continent via Beringia and an ice-free corridor in Canada. The origins of Clovis technology are unclear, however, with no obvious evidence of a predecessor to the north. Here we present evidence for Clovis hunting and habitation ∼11,550 yBP (∼13,390 Cal years) at “El Fin del Mundo,” an archaeological site in Sonora, northwestern Mexico. The site also includes the first evidence to our knowledge for gomphothere (Cuvieronius sp.) as Clovis prey, otherwise unknown in the North American archaeological record and terminal Pleistocene paleontological record. These data (i) broaden the age and geographic range for Clovis, establishing El Fin del Mundo as one of the oldest and southernmost in situ Clovis sites, supporting the hypothesis that Clovis had its origins well south of the gateways into the continent, and (ii) expand the make-up of the North American megafauna community just before extinction. PMID:25024193

  7. Human (Clovis)-gomphothere (Cuvieronius sp.) association ∼13,390 calibrated yBP in Sonora, Mexico

    Science.gov (United States)

    Sanchez, Guadalupe; Holliday, Vance T.; Gaines, Edmund P.; Arroyo-Cabrales, Joaquín; Martínez-Tagüeña, Natalia; Kowler, Andrew; Lange, Todd; Hodgins, Gregory W. L.; Mentzer, Susan M.; Sanchez-Morales, Ismael

    2014-07-01

    The earliest known foragers to populate most of North America south of the glaciers [∼11,500 to ≥ ∼10,800 14C yBP; ∼13,300 to ∼12,800 calibrated (Cal) years] made distinctive "Clovis" artifacts. They are stereotypically characterized as hunters of Pleistocene megamammals (mostly mammoth) who entered the continent via Beringia and an ice-free corridor in Canada. The origins of Clovis technology are unclear, however, with no obvious evidence of a predecessor to the north. Here we present evidence for Clovis hunting and habitation ∼11,550 yBP (∼13,390 Cal years) at "El Fin del Mundo," an archaeological site in Sonora, northwestern Mexico. The site also includes the first evidence to our knowledge for gomphothere (Cuvieronius sp.) as Clovis prey, otherwise unknown in the North American archaeological record and terminal Pleistocene paleontological record. These data (i) broaden the age and geographic range for Clovis, establishing El Fin del Mundo as one of the oldest and southernmost in situ Clovis sites, supporting the hypothesis that Clovis had its origins well south of the gateways into the continent, and (ii) expand the make-up of the North American megafauna community just before extinction.

  8. Chemical and Physical Properties of Hi-Cal-2

    Science.gov (United States)

    Spakowski, A. E.; Allen, Harrison, Jr.; Caves, Robert M.

    1955-01-01

    As part of the Navy Project Zip to consider various boron-containing materials as possible high-energy fuels, the chemical and physical properties of Hi-Cal-2 prepared by the Callery Chemical Company were evaluated at the NACA Lewis laboratory. Elemental chemical analysis, heat of combustion, vapor pressure and decomposition, freezing point, density, self ignition temperature, flash point, and blow-out velocity were determined for the fuel. Although the precision of measurement of these properties was not equal to that obtained for hydrocarbons, this special release research memorandum was prepared to make the data available as soon as possible.

  9. CryoSat/SIRAL Cal1 Calibration Orbits

    Science.gov (United States)

    Scagliola, Michele; Fornari, Marco; Bouffard, Jerome; Parrinello, Tommaso

    2017-04-01

    The main payload of CryoSat is a Ku band pulsewidth limited radar altimeter, called SIRAL (Synthetic interferometric radar altimeter), that transmits pulses at a high pulse repetition frequency thus making the received echoes phase coherent and suitable for SAR processing. This allows to reach an along track resolution that is significantly improved with respect to traditional pulse-width limited altimeters. Due to the fact that SIRAL is a phase coherent pulse-width limited radar altimeter, a proper calibration approach has been developed. In fact, not only corrections for transfer function, gain and instrument path delay have to be computed (as in previous altimeters), but also corrections for phase (SAR/SARIn) and phase difference between the two receiving chains (SARIN only). Recalling that the CryoSat's orbit has a high inclination of 92° and it is non-sun-synchronous, the temperature of the SIRAL changes continuously along the orbit with a period of about 480 days and it is also function of the ascending/descending passes. By analysis of the CAL1 calibration corrections, it has been verified that the internal path delay and the instrument gain variation measured on the SIRAL are affected by the thermal status of the instrument and as a consequence they are expected to vary along the orbit. In order to gain knowledge on the calibration corrections (i.e. the instrument behavior) as function of latitude and temperature, it has been planned to command a few number of orbits where only CAL1 calibration acquisitions are continuously performed. The analysis of the CAL1 calibration corrections produced along the Calibration orbits can be also useful to verify whether the current calibration plan is able to provide sufficiently accurate corrections for the instrument acquisitions at any latitude. In 2016, the CryoSat/SIRAL Cal1 Calibration Orbits have been commanded two times, a first time the 20th of July 2016 and a second time the 24th of November 2016, and they

  10. ATLAS TileCal LVPS Upgrade Hardware and Testing

    CERN Document Server

    Hibbard, Michael James; The ATLAS collaboration; Hadavand, Haleh Khani

    2018-01-01

    UTA (University of Texas at Arlington) has been designing and producing new testing stations to ensure the reliability and quality of new TileLVPS (Low Voltage Power Supplies), also produced at UTA, which will power the next generation of upgraded hardware in the TileCal (Tile Calorimeter) system of ATLAS at CERN. UTA has produced two new types of testing stations, which build upon the previous generation of testing stations used in the initial production of the TileCal system. The first station is the Initial Test Station, and quickly quantifies a multitude of performance metrics of a LVPS. We have developed our own PC based program which graphically display and records onto file these metrics. A few notable metrics we are measuring are the system clock and its jitter. Excessive clock jitter in LVPS can affect system stability and derate the working range of the system duty cycle. This station also verifies protection circuitry of LVPS, which protects it from over temperature, current and voltage. The second...

  11. ATLAS TileCal submodule B-field measurement

    International Nuclear Information System (INIS)

    Budagov, Yu.A.; Fedorenko, S.B.; Kalinichenko, V.V.; Lomakin, Yu.F.; Vorozhtsov, S.B.; Nessi, M.

    1997-01-01

    The work was done to cross check of the previous measurement done at CERN and to simulate the magnetic structure in the vicinity of the symmetry plane of the TileCal. To perform magnetic measurements for submodule the magnet E2 was chosen. The magnetometer used in the magnetic test of the submodule consists of Hall current supply and Hall voltage measuring device. The indium antimonide Hall probe used in this measurement is a model PKhE 606. Experimental set-up provides a true measurement accuracy of order ± 1%. External magnetic field measurements were conducted at the outer surface of the submodule. Two levels of the external field were applied: 108 Gs and 400 Gs. The result of this measurement in general confirms the data, obtained at CERN, but the shielding capability of the submodule under consideration was ∼ 20% higher than there. The field at the tile location is < 150 Gs up to the external field level 500 Gs and the tile field grows much less than the external field level in this range. The data obtained in this measurement could be used as a benchmark when producing a computer model of the TileCal magnetic field distribution

  12. THE RELATIONSHIP BETWEEN MOTOR COMPETENCE AND PHYSICAL FITNESS IS WEAKER IN THE 15-16 YR. ADOLESCENT AGE GROUP THAN IN YOUNGER AGE GROUPS (4-5 YR. AND 11-12 YR.).

    Science.gov (United States)

    Haga, Monika; Gísladóttír, Thórdís; Sigmundsson, Hermundur

    2015-12-01

    Developing motor competence and physical fitness can affect the maintenance of a sufficient level of physical activity in children and adolescents. This study assesses the relationship between motor competence and physical fitness from childhood through early adolescence. A cross-sectional sample of 194 participants from 4 to 16 years old were divided into three groups; 4-6 yr. (n=42, M age=5.2, SD 0.6), 11-12 yr. (n=58, M age=12.4, SD=0.3), and 15-16 yr. (n=94, M age=15.9, SD=0.4). To assess motor competence, each child completed the Movement Assessment Battery for Children (MABC). To measure physical fitness, three tasks (strength, speed, and endurance) were selected from the Test of Physical Fitness (TPF). To analyze the significance of the difference between the correlation coefficient in the three age groups (samples) (4-6, 11-12, and 15-16 yr.), Fischer r-to-z transformation was used. The correlation (Pearson's) between motor competence and physical fitness in the age groups was statistically higher for the youngest age groups (4-6 and 11-12 yr.) and the adolescent group (age 15-16). The differences between the two youngest age groups were not statistically significant. The results demonstrate that the correlation between motor competence and physical fitness decreases with age.

  13. Estrategias de desarrollo para la empresa Cal del Centro S.A.C.

    OpenAIRE

    Bautista Antón, Yovanni Patricia; Mendoza Rojas, Miguel Ángel

    2015-01-01

    Cal del Centro S.A.C. es una sociedad anónima cerrada cuyo negocio gira en torno a la actividad económica de la fabricación de cemento, cal y yeso. El objetivo del presente trabajo es evaluar la posibilidad de éxito de un proyecto de inversión en una planta de cal, a través de Cal del Centro S.A.C. –como empresa autosuficiente–, para asegurar el cien por ciento del suministro de óxido de calcio en cantidad y calidad para el procesamiento de concentrados de cobre y el tratamiento de aguas indu...

  14. ATM signaling and 53BP1

    International Nuclear Information System (INIS)

    Zgheib, Omar; Huyen, Yentram; DiTullio, Richard A.; Snyder, Andrew; Venere, Monica; Stavridi, Elena S.; Halazonetis, Thanos D.

    2005-01-01

    The ATM (mutated in Ataxia-Telangiectasia) protein kinase is an important player in signaling the presence of DNA double strand breaks (DSBs) in higher eukaryotes. Recent studies suggest that ATM monitors the presence of DNA DSBs indirectly, through DNA DSB-induced changes in chromatin structure. One of the proteins that sense these chromatin structure changes is 53BP1, a DNA damage checkpoint protein conserved in all eukaryotes and the putative ortholog of the S. cerevisiae RAD9 protein. We review here the mechanisms by which ATM is activated in response to DNA DSBs, as well as key ATM substrates that control cell cycle progression, apoptosis and DNA repair

  15. δ13Catm and [CO2] measurements in Antarctic ice cores, 160 kyrBP - present

    Science.gov (United States)

    Eggleston, Sarah; Schmitt, Jochen; Schneider, Robert; Joos, Fortunat; Fischer, Hubertus

    2014-05-01

    Measurements from Antarctic ice cores allow us to reconstruct atmospheric concentrations of climatically important gases including CO2 over the past 800 kyr. Such measurements show that [CO2] has varied in parallel with Antarctic temperatures on glacial-interglacial timescales. Knowledge of the variations of the stable carbon isotope of CO2, δ13Catm, can help us better understand the processes involved in these fluctuations. Here, we present a first complete δ13Catmrecord extending from 160 kyrBP to the present accompanied by δ15N2 measurements during Marine Isotope Stage 3 (MIS 3, 57 - 29 kyrBP). The present record, measured primarily on ice from the EPICA Dome C and Talos Dome ice cores, has an average resolution of 500 yr, focused mainly on the Last Glacial Maximum and termination (180 yr; Schmitt et al., 2012), MIS 3 (660 yr), and Termination II through MIS 5.4 (590 yr; Schneider et al., 2013). Throughout the record, δ13Catm varies between approximately -6.8 and -6.4‰Following a period of relatively constant δ13Catm at the end of MIS 6 (around -6.8), the boundaries of MIS 5 correspond roughly with the beginning and end of a gradual enrichment in this isotope. In comparison, the more recent record depicts three more abrupt excursions to lighter values around 63 - 59, 46, and 17 kyrBP, in each case followed by a slower return (0.4o over the course of 5 - 15 kyr) to more enriched isotopic values. These coincide with Heinrich events 6, 5, and 1, respectively. No direct correlation is observed between the concentration and carbon isotope of CO2 over the last 160 kyr. The data indicate rather that numerous processes, such as uptake and release of atmospheric CO2 by the ocean and land biosphere, perhaps influenced by regions of growing permafrost during MIS 3 and 4, acting on a variety of timescales must be considered in explaining the evolution of δ13Catm on glacial-interglacial timescales. References: Schmitt, J. et al. Science 336, 711-714 (2012) Schneider

  16. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  17. Air Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  18. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  19. Air Monitoring Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  20. Surface Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  1. Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  2. Late Holocene monsoon climate as evidenced by proxy records from a lacustrine sediment sequence in western Guangdong, South China

    Science.gov (United States)

    Zhong, Wei; Cao, jiayuan; Xue, Jibin; Ouyang, Jun; Tang, Xiaohong; Yin, Huanling; Liao, Congyun; Long, Kun

    2014-02-01

    The study of a 300-cm-thick exposed lacustrine sediment section in the Hedong village in Zhaoqing area which is located in sub-tropical west Guangdong Province in South China, demonstrates that the lacustrine sedimentary sequence possibly contains evidence for exploring variation of Asian monsoon climate. Multi-proxy records, including the humification intensity, total organic carbon, and grain size fractions, reveal a general trend towards dry and cold conditions in the late Holocene that this is because of a decrease in solar insolation on an orbital scale. Three intensified Asian summer monsoon (ASM) intervals (˜3300-3000 cal yr BP, ˜2600-1600 cal yr BP, and ˜900-600 cal yr BP), and three weakened ASM intervals (˜4000-3300 cal yr BP, ˜3000-2600 cal yr BP, and ˜1600-900 cal yr BP) are identified. Our humification record (HDcal) shows a good correlation on multi-centennial scale with the tree ring Δ14C record, a proxy of solar activity. A spectral analysis of HDcal reveals four significant cycles, i.e., ˜1250 yr, 300 yr, 110 yr, and 70 yr, and most of these cycles are related to the solar activity. Our findings indicate that solar output and oceanic-atmospheric circulation probably have influenced the late Holocene climate variability in the study region.

  3. AcEST: BP918019 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID

  4. Use of annual ABPM, and repeated carotid scan and echocardiography to monitor cardiovascular health over nine yr in pediatric and young adult renal transplant recipients.

    Science.gov (United States)

    Balzano, Rita; Lindblad, Ylva Tranaeus; Vavilis, Georgios; Jogestrand, Tomas; Berg, Ulla B; Krmar, Rafael T

    2011-09-01

    In adult hypertensive patients, increased cIMT and LVH are independent risk factors for cardiovascular events. We have previously observed that in pediatric RTRs with tight control of BP, cIMT did not progress over time. This investigation is an extension of the aforementioned study aimed at re-examining cIMT and also reporting serial echocardiography results. Twenty-two RTRs aged 9.4 ± 3.3 yr at their baseline carotid scan underwent two additional vascular ultrasounds during a follow-up of 9.1 ± 0.9 yr. Carotid scan and echocardiography examinations were carried out simultaneously with ABPM. Antihypertensive therapy was determined according to the recipient's ABPM results, which were performed at yearly intervals. Baseline cIMT was significantly greater in RTRs than in healthy controls. There was no statistical evidence of systematic changes in cIMT over time. At the last examination, 14 of 17 RTRs with treated hypertension had controlled hypertension (prevalence 82%; 95% CI, 56.5-96.2), and the overall prevalence of LVH was 4.5% (95% CI, -0.01 to 23.5). The lack of progression of cIMT over time and the low prevalence of LVH might reflect the effect of long-standing BP control. © 2011 John Wiley & Sons A/S.

  5. Data Management Standards in Computer-aided Acquisition and Logistic Support (CALS)

    Science.gov (United States)

    Jefferson, David K.

    1990-01-01

    Viewgraphs and discussion on data management standards in computer-aided acquisition and logistic support (CALS) are presented. CALS is intended to reduce cost, increase quality, and improve timeliness of weapon system acquisition and support by greatly improving the flow of technical information. The phase 2 standards, industrial environment, are discussed. The information resource dictionary system (IRDS) is described.

  6. The impact of BeamCal performance at different international linear ...

    Indian Academy of Sciences (India)

    The ILC accelerator parameters and detector concepts are still under discussion in the world-wide community. As will be shown, the performance of the BeamCal, the calorimeter in the very forward area of the ILC detector, is very sensitive to the beam parameter and crossing angle choices. We propose here BeamCal ...

  7. Postglacial vegetation history of Mitkof Island, Alexander Archipelago, southeastern Alaska

    Science.gov (United States)

    Ager, Thomas A.; Carrara, Paul E.; Smith, Jane L.; Anne, Victoria; Johnson, Joni

    2010-03-01

    An AMS radiocarbon-dated pollen record from a peat deposit on Mitkof Island, southeastern Alaska provides a vegetation history spanning ˜12,900 cal yr BP to the present. Late Wisconsin glaciers covered the entire island; deglaciation occurred > 15,400 cal yr BP. The earliest known vegetation to develop on the island (˜12,900 cal yr BP) was pine woodland ( Pinus contorta) with alder ( Alnus), sedges (Cyperaceae) and ferns (Polypodiaceae type). By ˜12,240 cal yr BP, Sitka spruce ( Picea sitchensis) began to colonize the island while pine woodland declined. By ˜11,200 cal yr BP, mountain hemlock ( Tsuga mertensiana) began to spread across the island. Sitka spruce-mountain hemlock forests dominated the lowland landscapes of the island until ˜10,180 cal yr BP, when western hemlock ( Tsuga heterophylla) began to colonize, and soon became the dominant tree species. Rising percentages of pine, sedge, and sphagnum after ˜7100 cal yr BP may reflect an expansion of peat bog habitats as regional climate began to shift to cooler, wetter conditions. A decline in alders at that time suggests that coastal forests had spread into the island's uplands, replacing large areas of alder thickets. Cedars ( Chamaecyparis nootkatensis, Thuja plicata) appeared on Mitkof Island during the late Holocene.

  8. Vegetation history along the eastern, desert escarpment of the Sierra San Pedro Mártir, Baja California, Mexico

    Science.gov (United States)

    Holmgren, Camille A.; Betancourt, Julio L.; Rylander, Kate A.

    2011-01-01

    Plant macrofossils from 38 packrat middens spanning the last ~ 33,000 cal yr BP record vegetation between ~ 650 and 900 m elevation along the eastern escarpment of the Sierra San Pedro Mártir, northern Baja California. The middens span most of the Holocene, with a gap between ~ 4600 and 1800 cal yr BP, but coverage in the Pleistocene is uneven with a larger hiatus between 23,100 and 14,400 cal yr BP. The midden flora is relatively stable from the Pleistocene to Holocene. Exceptions include Pinus californiarum, Juniperus californica and other chaparral elements that were most abundant > 23,100 cal yr BP and declined after 14,400 cal yr BP. Despite being near the chaparral/woodland-desertscrub ecotone during glacial times, the midden assemblages reflect none of the climatic reversals evident in the glacial or marine record, and this is corroborated by a nearby semi-continuous pollen stratigraphy from lake sediments. Regular appearance of C4 grasses and summer-flowering annuals since 13,600 cal yr BP indicates occurrence of summer rainfall equivalent to modern (JAS average of ~ 80–90 mm). This casts doubt on the claim, based on temperature proxies from marine sediments in the Guaymas Basin, that monsoonal development in the northern Gulf and Arizona was delayed until after 6200 cal yr BP.

  9. The distribution of silicon on BP Boo

    International Nuclear Information System (INIS)

    Hatzes, A.P.

    1990-01-01

    A version of the Doppler imaging technique which incorporates the principles of maximum entropy reconstruction is used to derive the silicon distribution on the Ap star BP Boo (HR 5857). The method used made it possible to detect an error in the published photometric period and a new value of 1.29557 d was determined. The silicon distribution consists of two depleted spots of unequal area separated by about 180deg in longitude. These spots may coincide with the location of the magnetic poles of the star as in the case of γ 2 Ari. Near the larger of the depleted silicon spots is a spot of enhanced abundance. The unequal area of the depleted spots as well as the close proximity of the enhanced spot to one of the depleted regions suggests the presence of non-axisymmetric magnetic field lines. (author)

  10. AcEST: BP919406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c

  11. AcEST: BP914061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c

  12. AcEST: BP914068 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:

  13. AcEST: BP913406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM

  14. AcEST: BP915406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433

  15. AcEST: BP914064 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi

  16. AcEST: BP912406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406

  17. AcEST: BP916406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c

  18. AcEST: BP917406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,

  19. AcEST: BP914406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406

  20. AcEST: BP921000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D05 407 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D05. BP921000 - Show BP921000...is mRNA. clone: YMU001_000144_D05. Accession BP921000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum cap...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum capillus-veneris mRN

  1. AcEST: BP920140 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  2. AcEST: BP920147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201

  3. AcEST: BP920143 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum

  4. AcEST: BP920144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  5. AcEST: BP920141 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52

  6. AcEST: BP920148 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  7. AcEST: BP920145 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian

  8. AcEST: BP920142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  9. AcEST: BP920998 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven

  10. AcEST: BP920996 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D01. BP92099...6 CL262Contig1 Show BP920996 Clone id YMU001_000144_D01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D01. Accession BP920996 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920996|Adiantum capillus-ve

  11. AcEST: BP920995 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C12 350 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C12. BP920995 - Show BP92099...is mRNA. clone: YMU001_000144_C12. Accession BP920995 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  12. AcEST: BP912099 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_B05 315 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B05. BP912099 - Show BP912099...is mRNA. clone: YMU001_000015_B05. Accession BP912099 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099|Adiantum capillus-vene

  13. AcEST: BP918801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show BP918801...is mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca

  14. AcEST: BP916801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801

  15. AcEST: BP918015 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show BP91801...is mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  16. AcEST: BP918013 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show BP91801...is mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  17. AcEST: BP918018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP91801...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  18. AcEST: BP913801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0

  19. AcEST: BP917801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_F04 280 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F04. BP917801 - Show BP917801...is mRNA. clone: YMU001_000105_F04. Accession BP917801 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-veneris mRNA, clone: YMU001_000105_F04.

  20. AcEST: BP918017 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show BP91801...is mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26

  1. AcEST: BP911801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show BP911801...is mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000

  2. AcEST: BP915801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show BP915801...is mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A

  3. AcEST: BP920801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-

  4. AcEST: BP912801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show BP912801...is mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912801...es. 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0

  5. AcEST: BP918012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show BP91801...is mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1

  6. Applied CAL on Problem Based Learning Using Gagne’s Instructional Design

    Directory of Open Access Journals (Sweden)

    Sri Sundari Purbohadi

    2014-10-01

    Full Text Available Abstract— In the Problem-Based Learning (PBL model, students are expected to study independently. One of the methods that can improve the ability or skill of learners is using Computer Assisted Learning (CAL. Implementation of CAL in PBL should be able to create Self-Directed Learning (SDL culture through appropriate instructional design and interesting modules. In this paper, the CAL software is developed using multimedia learning principles, convenient appearance, and user-friendly navigation. The CAL’s learning content is designed using Gagne's instructional design. The experiment proved the CAL was able to give effect size 0.89 and developed self-directed learning culture. From the interviews, students were very glad and interested to use the CAL modules because they can learn anytime and can reach the course objectives without a lecturer.

  7. Design de calçado do processo criativo à produção

    OpenAIRE

    Rolo, Margarida Filipa Gonçalves Araújo

    2016-01-01

    O seguinte projeto tem como tema principal o Design de calçado, pois foi com base nesse tema que foi feito todo o enquadramento teórico de modo a fundamentar a criação da coleção final de calçado a que este projeto se pretende. Logo, foi realizada uma pesquisa sobre a história do calçado, os seus materiais e componentes, tipos de sapatos e saltos, a indústria do calçado em Portugal e seus principais designers, entre outros. Este projeto consiste na criação de uma coleção cápsula de calçado...

  8. CAL--ERDA program manual. [Building Design Language; LOADS, SYSTEMS, PLANT, ECONOMICS, REPORT, EXECUTIVE, CAL-ERDA

    Energy Technology Data Exchange (ETDEWEB)

    Hunn, B. D.; Diamond, S. C.; Bennett, G. A.; Tucker, E. F.; Roschke, M. A.

    1977-10-01

    A set of computer programs, called Cal-ERDA, is described that is capable of rapid and detailed analysis of energy consumption in buildings. A new user-oriented input language, named the Building Design Language (BDL), has been written to allow simplified manipulation of the many variables used to describe a building and its operation. This manual provides the user with information necessary to understand in detail the Cal-ERDA set of computer programs. The new computer programs described include: an EXECUTIVE Processor to create computer system control commands; a BDL Processor to analyze input instructions, execute computer system control commands, perform assignments and data retrieval, and control the operation of the LOADS, SYSTEMS, PLANT, ECONOMICS, and REPORT programs; a LOADS analysis program that calculates peak (design) zone and hourly loads and the effect of the ambient weather conditions, the internal occupancy, lighting, and equipment within the building, as well as variations in the size, location, orientation, construction, walls, roofs, floors, fenestrations, attachments (awnings, balconies), and shape of a building; a Heating, Ventilating, and Air-Conditioning (HVAC) SYSTEMS analysis program capable of modeling the operation of HVAC components including fans, coils, economizers, humidifiers, etc.; 16 standard configurations and operated according to various temperature and humidity control schedules. A plant equipment program models the operation of boilers, chillers, electrical generation equipment (diesel or turbines), heat storage apparatus (chilled or heated water), and solar heating and/or cooling systems. An ECONOMIC analysis program calculates life-cycle costs. A REPORT program produces tables of user-selected variables and arranges them according to user-specified formats. A set of WEATHER ANALYSIS programs manipulates, summarizes and plots weather data. Libraries of weather data, schedule data, and building data were prepared.

  9. BP180 dysfunction triggers spontaneous skin inflammation in mice.

    Science.gov (United States)

    Zhang, Yang; Hwang, Bin-Jin; Liu, Zhen; Li, Ning; Lough, Kendall; Williams, Scott E; Chen, Jinbo; Burette, Susan W; Diaz, Luis A; Su, Maureen A; Xiao, Shengxiang; Liu, Zhi

    2018-06-04

    BP180, also known as collagen XVII, is a hemidesmosomal component and plays a key role in maintaining skin dermal/epidermal adhesion. Dysfunction of BP180, either through genetic mutations in junctional epidermolysis bullosa (JEB) or autoantibody insult in bullous pemphigoid (BP), leads to subepidermal blistering accompanied by skin inflammation. However, whether BP180 is involved in skin inflammation remains unknown. To address this question, we generated a BP180-dysfunctional mouse strain and found that mice lacking functional BP180 (termed Δ NC16A ) developed spontaneous skin inflammatory disease, characterized by severe itch, defective skin barrier, infiltrating immune cells, elevated serum IgE levels, and increased expression of thymic stromal lymphopoietin (TSLP). Severe itch is independent of adaptive immunity and histamine, but dependent on increased expression of TSLP by keratinocytes. In addition, a high TSLP expression is detected in BP patients. Our data provide direct evidence showing that BP180 regulates skin inflammation independently of adaptive immunity, and BP180 dysfunction leads to a TSLP-mediated itch. The newly developed mouse strain could be a model for elucidation of disease mechanisms and development of novel therapeutic strategies for skin inflammation and BP180-related skin conditions.

  10. Multivalent display of the antimicrobial peptides BP100 and BP143

    Directory of Open Access Journals (Sweden)

    Imma Güell

    2012-12-01

    Full Text Available Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100 and KKLfKKILKYL-NH2 (BP143 attached to the carbohydrate template cyclodithioerythritol (cDTE or α-D-galactopyranoside (Galp. The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling to an aminooxy-functionalized carbohydrate template. After purification, the multivalent display systems were obtained in high purities (90–98% and in good yields (42–64%. These compounds were tested against plant and human pathogenic bacteria and screened for their cytotoxicity on eukaryotic cells. They showed lower MIC values than the parent peptides against the bacteria analyzed. In particular, the carbopeptides derived from cDTE and Galp, which contained two or four copies of BP100, respectively, were 2- to 8-fold more active than the monomeric peptide against the phytopathogenic bacteria. These results suggest that preassembling antimicrobial peptides to multimeric structures is not always associated with a significant improvement of the activity. In contrast, the carbopeptides synthesized were active against human red blood cells pointing out that peptide preassembly is critical for the hemolytic activity. Notably, peptide preassembly resulted in an enhanced bactericidal effect.

  11. Control System for ATLAS TileCal HVRemote boards

    CERN Document Server

    AUTHOR|(SzGeCERN)739751; The ATLAS collaboration; Gurriana, Luis; Oleiro Seabra, Luis Filipe; Evans, Guiomar; Gomes, Agostinho; Maio, Amelia; Pinto Silva Rato, Catia Sofia; Almendra Sabino, Joao Maria; Augusto, Jose

    2017-01-01

    One of the proposed solutions for upgrading the high voltage (HV) system of TileCal, the ATLAS central hadron calorimeter, consists in removing the HV regulation boards from the detector and deploying them in a low-radiation room where there is permanent access for maintenance. This option requires many ∼100 m long HV cables but removes the requirement of radiation hard boards. This solution simplifies the control system of the HV regulation cards (called HVRemote). It consists of a Detector Control System (DCS) node linked to 256 HVRemote boards through a tree of Ethernet connections. Each HVRemote includes a smart Ethernet transceiver for converting data and commands from the DCS into serial peripheral interface (SPI) signals routed to SPI-capable devices in the HVRemote. The DCS connection to the transceiver and the control of some SPI-capable devices via Ethernet has been tested successfully. A test board (HVRemote-Ctrl) with the interfacing sub-system of the HVRemote was fabricated. It is being tested ...

  12. Design de interface do ambiente virtual HyperCAL online

    Directory of Open Access Journals (Sweden)

    Jaire Passos

    2010-12-01

    Full Text Available A presente pesquisa objetiva propor uma metodologia que oriente o projeto de interface de ambiente virtual centrado no usuário que seja sistematizada como processo de produto com princípios de design de interação, considerando aspectos de usabilidade e ergonomia, de modo a favorecer o trabalho do usuário, permitindo a apropriação do conteúdo e a execução das tarefas através das funcionalidades do sistema. Para consecução do trabalho foram investigados: os elementos da experiência do usuário; as ferramentas de planejamento de produto; as técnicas engenharia de software; e os conceitos do design de interação. A validação da metodologia foi feita através do projeto de interface do módulo do desenvolvedor (professor/instrutor do HyperCalGD online. A interface projetada apresentou melhores condições para o desenvolvimento de materiais educacionais.

  13. Terracotas del santuario de Calés (Calvi, Campania

    Directory of Open Access Journals (Sweden)

    J. M. BLÁZQUEZ

    2009-10-01

    Full Text Available El Museo Arqueológico Nacional de Madrid, entre sus magníficas colecciones, exhibe una compuesta por un numeroso conjunto de terracotas traídas de Italia en el siglo pasado por el Marqués de Salamanca. La colección Calvi, procedente del Santuario de Calés, en Campania, y así llamada del lugar de procedencia, ha sido repartida entre varios museos españoles, pero el grupo más numeroso es el depositado en el Museo Arqueológico Nacional que, a pesar de la alta calidad artística de las piezas y del buen estado de conservación de todas ellas, ha permanecido hasta el presente inédita. Tan sólo F. Benoit y nosotros, hemos publicado algunas terracotas de las que representan caballos. Otros investigadores, como Bianchi Bandinelli, han aludido a esta colección que, como las similares guardadas en los museos de Lecce, Capua, Louvre, Leide, British Museum, etc., se encuentra inédita. Particular interés ofrece el grupo conservado en la Glyptothek Ny Carlsberg, de Copenhague, algunos ejemplares se guardan en el Museo Universitario de Zurich y en el Museum f. ant. Kleinkunst de Munich. En Roma los conjuntos más numerosos de estas terracotas se encuentran depositados en los Museos Gregoriano Etrusco del Vaticano, Villa Giulia, y Nazionale Romano.

  14. Bayesian chronological analyses consistent with synchronous age of 12,835-12,735 Cal B.P. for Younger Dryas boundary on four continents

    DEFF Research Database (Denmark)

    Kennett, James P.; Kennett, Douglas J.; Culleton, Brendan J.

    2015-01-01

    The Younger Dryas impact hypothesis posits that a cosmic impact across much of the Northern Hemisphere deposited the Younger Dryas boundary (YDB) layer, containing peak abundances in a variable assemblage of proxies, including magnetic and glassy impact-related spherules, high-temperature mineral...

  15. Facies sedimentarias de la laguna kárstica de La Parra (Cuenca) durante los últimos 1600 años cal. BP.

    OpenAIRE

    Barreiro-Lostres, Fernando; Moreno Caballud, Ana; Valero-Garcés, Blas L.

    2014-01-01

    [ES] El análisis sedimentario y geoquímico llevado a cabo en los sondeos del lago kárstico de La Parra (Cordillera Ibérica, Cuenca) ilustra el comienzo de la sedimentación en la cuenca hace 1.600 años y su evolución sedimentaria, que principalmente está controlada por variaciones en la descarga detrítica hacia el lago. Un total de 11 facies sedimentarias han sido descritas, agrupadas en 3 unidades litoestratigráficas, compuestas en su mayor parte por carbonatos bandeados y m...

  16. Face recognition based on improved BP neural network

    Directory of Open Access Journals (Sweden)

    Yue Gaili

    2017-01-01

    Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.

  17. Identification and synchronization of the common cosmic-ray signal in the IntCal13 14C calibration and the Greenland ice-core 10Be records

    Science.gov (United States)

    Muscheler, Raimund; Adolphi, Florian; Bronk Ramsey, Christopher; Rasmussen, Sune; Hughen, Konrad; Cooper, Alan; Turney, Chris

    2017-04-01

    The production rates of cosmogenic radionuclides (such as 10Be and 14C) are modulated by the solar and geomagnetic shielding of galactic cosmic rays. In addition, 14C and 10Be are influenced by the carbon cycle and the atmospheric transport and deposition, respectively. Isolating and identifying the common production signal allows us to synchronize ice core 10Be and tree ring 14C records during the Holocene (Adolphi and Muscheler, 2016), thereby connecting ice core climate records with 14C-dated records. Extending this comparison further back in time is challenging due to deteriorating quality of the 14C calibration record, IntCal13, (Reimer et al., 2013) and possible unidentified climate influences on the ice-core 10Be records. Nevertheless, by focusing on the most prominent production-rate features this comparison can be extended far back into the last glacial where, for example, the linkage of tree-ring based Kauri 14C data and the Greenland ice-core time scale (GICC05) suggested unresolved data and/or time scale differences around the period of the Laschamp geomagnetic field minimum at about 42000 yrs BP (Muscheler et al., 2014). Here we show that the data underlying the IntCal13 14C record and the ice-core 10Be records exhibit common variability that allows us to tentatively link the ice core GICC05 time scale to the radiocarbon time scale for almost the complete radiocarbon dating range. The observed time scale differences could be related to uncertainties in both the U/Th-based dating of the IntCal13 calibration data set and the GICC05 time scale, and we show that the two can be reconciled within the uncertainties of the ice-core layer counting. This direct comparison between IntCal13 and 10Be also suggests that the 14C differences shown in (Muscheler et al., 2014) around the Laschamp geomagnetic field minimum can be reduced by moderate adjustments to the GICC05 time scale. References: Adolphi, F., and Muscheler, R., 2016, Synchronizing the Greenland ice

  18. Recuperación de morteros romanos de cal y chamota en aplicaciones actuales

    OpenAIRE

    González Cortina, Mariano

    2000-01-01

    La tesis se fundamenta en la utilización de residuos de fábricas cerámicas para su aprovechamiento y reutilización mediante una trituración, para posteriormente mezclarlos con cal aérea y obtener así un conglomerante capaz de fraguar, endurecer y adquirir resistencias tanto al aire como sumergido en agua. La cal, como conglomerante hidráulico, no se fabrica actualmente en España debido al uso de los cementos Pórtland. Sin embargo, las propiedades que tienen los morteros realizados con cal, co...

  19. Computer-aided acquisition and logistics support (CALS): Concept of Operations for Depot Maintenance

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, N.C.; Greer, D.K.

    1993-04-01

    This CALS Concept of Operations for Depot Maintenance provides the foundation strategy and the near term tactical plan for CALS implementation in the depot maintenance environment. The user requirements enumerated and the overarching architecture outlined serve as the primary framework for implementation planning. The seamless integration of depot maintenance business processes and supporting information systems with the emerging global CALS environment will be critical to the efficient realization of depot user's information requirements, and as, such will be a fundamental theme in depot implementations.

  20. Implementació d'una Intranet pel Restaurant "Cal Fesu"

    OpenAIRE

    Maldonado Rubio, Lluís Manel

    2007-01-01

    Aquest projecte consisteix en el disseny i implementació d'una intranet amb zona privada pel restaurant "Cal Fesu", utilitzant una tecnologia puntera com és J2EE (struts). Este proyecto consiste en el diseño e implementación de una intranet con zona privada para el restaurante "Cal Fesu", utilizando una tecnología puntera como es J2EE (struts). This project consists of design and implementation of an intranet with a private area for the restaurant "Cal Fesu", using a leading technology ...

  1. Windows Calorimeter Control (WinCal) system configuration control board (SCCB) operating procedure

    International Nuclear Information System (INIS)

    Westsik, G.A.

    1997-01-01

    This document describes the operating procedure for the System Configuration Control Board (SCCB) performed in support of the Windows Calorimeter Control (WinCal) system. This board will consist of representatives from Babcock and Wilcox Hanford Company Babcock and Wilcox Protec, Inc.; and Lockheed Martin Services, Inc. In accordance with agreements for the joint use of the Babcock and Wilcox Hanford Company calorimeters located in the Hanford Site Plutonium Finishing Plant (PFP) Nondestructive Assay Laboratory, concurrence regarding changes to the WinCal system will be obtained from the International Atomic Energy Agency (IAEA). Further, changes to the WinCal software will be communicated to Los Alamos National Laboratory

  2. Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?

    Directory of Open Access Journals (Sweden)

    K. M. Usrey

    2014-01-01

    Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.

  3. Reliability of the Francis Scale of Attitude Toward Christianity among 8-yr-olds.

    Science.gov (United States)

    Robbins, Mandy; Francis, Leslie J; Williams, Naomi

    2003-02-01

    The Francis Scale of Attitude Toward Christianity was completed by 78 8-yr.-olds (40 boys and 38 girls) whose data support reliability measured as the internal consistency of the scale for this young sample.

  4. Late Quaternary palaeoecological and palaeoclimatological reconstruction in the Gutaiului Mountains, northwest Romania

    Science.gov (United States)

    Feurdean, Angelica; Bennike, Ole

    2004-12-01

    Macrofossil, pollen, lithostratigraphy, mineral magnetic measurements (SIRM and magnetic susceptibility), loss-on-ignition, and AMS radiocarbon dating on sediments from two former crater lakes, situated at moderate altitudes in the Gutaiului Mountains of northwest Romania, allow reconstruction of Late Quaternary climate and environment. Shrubs and herbs with steppe and montane affinities along with stands of Betula and Pinus, colonised the surroundings of the sites prior to 14 700 cal. yr BP and the inferred climatic conditions were cold and dry. The gradual transition to open Pinus-Betula forests, slightly higher lake water temperatures, and higher lake productivity, indicate more stable environmental conditions between 14 700 and 14 100 cal. yr BP. This development was interrupted by cooler and drier climatic conditions between 14 100 and 13 800 cal. yr BP, as inferred from a reduction of open forests to patches, or stands, of Pinus, Betula, Larix, Salix and Populus. The expansion of a denser boreal forest, dominated by Picea, but including Pinus, Larix, Betula, Salix, and Ulmus started at 13 800 cal. yr BP, although the forest density seems to have been reduced between 13400 and 13200cal.yrBP. Air temperature and moisture availability gradually increased, but a change towards drier conditions is seen at 13400cal.yrBP. A distinct decrease in temperature and humidity between 12900 and 11500cal.yrBP led to a return of open vegetation, with patches of Betula, Larix, Salix, Pinus and Alnus and individuals of Picea. Macrofossils and pollen of aquatic plants indicate rising lake water temperatures and increased aquatic productivity already by ca. 11800cal.yrBP, 300 years earlier than documented by the terrestrial plant communities. At the onset of the Holocene, 11500cal.yrBP, forests dominated by Betula, Pinus and Larix expanded and were followed by dense Ulmus forests with Picea, Betula and Pinus at 11250cal.yrBP. Larix pollen was not found, but macrofossil evidence

  5. AcEST: BP912612 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;

  6. AcEST: BP912712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

  7. AcEST: BP912126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

  8. AcEST: BP912212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412

  9. AcEST: BP912312 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412

  10. AcEST: BP912128 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412

  11. AcEST: BP912012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t

  12. AcEST: BP912123 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412

  13. AcEST: BP912912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412

  14. AcEST: BP919999 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G09. BP919999... CL2968Contig1 Show BP919999 Clone id YMU001_000131_G09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_G09. Accession BP919999 Tissue type prothallium Developmental stag...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generatio...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919999|Adiantum capillus-ve

  15. AcEST: BP913636 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati

  16. AcEST: BP920997 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D02. BP92099...7 CL10Contig1 Show BP920997 Clone id YMU001_000144_D02 Library YMU01 Length 534 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_D02. Accession BP920997 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920997|Adian...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

  17. AcEST: BP917373 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI

  18. Measurement of the ratio of branching fractions ${\\cal B}(B^0 \\to K^{\\ast 0} \\gamma)/{\\cal B}(B^0_s \\to \\phi \\gamma)$

    CERN Document Server

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Constantin, F; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Nedos, M; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrella, A; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Voss, H; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2012-01-01

    The ratio of branching fractions of the radiative $B$ decays $B^0\\to K^{*0}\\gamma$ and $B^0_s\\to \\phi\\gamma$ has been measured using $0.37\\,$fb$^{-1}$ of $pp$ collisions at a centre of mass energy of $\\sqrt{s}=7\\,$TeV, collected by the LHCb experiment. The value obtained is \\begin{equation} \\frac{{\\cal B}(B^0\\to K^{*0}\\gamma)}{{\\cal B}(B^0_s\\to \\phi\\gamma)} = 1.12 \\pm 0.08^{+0.06}_{-0.04}\\phantom{.}^{+0.09}_{-0.08},\

  19. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    Energy Technology Data Exchange (ETDEWEB)

    Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others

    2012-06-15

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity

  20. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    International Nuclear Information System (INIS)

    Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia

    2012-01-01

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.

  1. Welfare Reform in California. State and County Implementation of CalWORKs in the Second Year

    National Research Council Canada - National Science Library

    Klerman, Jacob

    2001-01-01

    .... California's response to PRWORA was the California Work and Responsibility to Kids (CalWORKs) program-a "work-first" program that provides support services to help recipients move from welfare to work and toward self-sufficiency...

  2. Improvement by the Life Cycle Control System of University Production With Use of CALS-Tehnology

    Directory of Open Access Journals (Sweden)

    Yuriy I. Dreizis

    2013-01-01

    Full Text Available The mechanism of management by life cycle of production of university with use of CALS technologies is described. Tasks of service of marketing and the quality management department, connected with university product quality control are defined

  3. CALS and the Product State Model - Methodology and Supporting Schools and Paradigms

    DEFF Research Database (Denmark)

    Larsen, Michael Holm

    1998-01-01

    incorporates relevant information about each stage of the production process.The paper will describe the research object, the model object and discuss a part of the methodology in developing a Product State Model. The project is primarily technological, however, organisational and human aspects......This paper address the preliminary considerations in a research project, initiated February 1997, regarding Continuous Acquisition and Life-cycle Support (CALS) which is a part of the activities in CALS Center Denmark. The CALS concept is presented focusing on the Product State Model (PSM). The PSM...... will be developed upon, will be discussed. Also, the parameters for evaluating the PSM will be considered. In establishing the theoretical body of knowledge with respect to CALS, an identification of schools and paradigms within the research area of applying information technology in a manufacturing environment...

  4. Cal Poly Apparel Manufacturing Demonstration - Year 4 and 5 Final Technical Report

    National Research Council Canada - National Science Library

    2001-01-01

    .... Since the Southern California apparel industry is primarily small businesses producing low volume fashion products, the Cal Poly Demo factory needed to reflect the size and capability of its customer...

  5. Holocene environmental changes in southern Kamchatka, Far Eastern Russia, inferred from a pollen and testate amoebae peat succession record

    Science.gov (United States)

    Klimaschewski, A.; Barnekow, L.; Bennett, K. D.; Andreev, A. A.; Andrén, E.; Bobrov, A. A.; Hammarlund, D.

    2015-11-01

    High resolution palaeoenvironmental records in Far-Eastern Russia are rare, and the Kamchatka Peninsula is among the least studied areas of the region. This paper describes a record spanning the last ca. 11,000 yr, obtained from a bog in the southern part of Kamchatka. The radiocarbon dated core was analysed for pollen, testate amoebae, charcoal and loss-on-ignition (LOI). The vegetation during the early Holocene was dominated by grasses (Poaceae), birch (Betula) and heath (Ericaceae p. p.). Around 10,300 cal yr BP there was a substantial change in the vegetation cover to shrub alder (Alnus viridis s.l.) stands with sedges and ferns (Polypodiophyta) as well as herbs such as meadow rue (Thalictrum) in the understory. In the surroundings of Utka peatlands started to form. The variations in the vegetation cover were most probably caused by climatic changes. At the beginning of sediment accumulation, before 10,300 cal yr BP, the composition of the vegetation points to cooler summers and/or decreased annual precipitation. Around 10,300 cal yr BP, changes in vegetation occurred due to rising temperatures and/or changed water regimes. Increased abundancies of dry indicating testate amoebae after 9100 cal yr BP point to intermediate to dry soil conditions. Between 8600 and 7700 cal yr BP tree alder (Alnus incana) was widely spread at the site which probably indicates optimal environmental conditions. The tephra layer at 381-384.5 cm (ca. 8500 cal yr BP) produces a strong impact on the testate amoebae assemblages. At 7700 cal yr BP there was a sudden drop of A. incana in the local vegetation. From this time on, A. incana and also A. viridis decrease continuously whereas Betula gradually increases. The upper part of the sequence (after 6300 cal yr BP) shows higher abundancies of meadowsweet (Filipendula) and sweet gale (Myrica) pollen. After 6300 cal yr BP, changes in testate amoebae demonstrate variable soil moisture conditions at the site. Between 3700 and 1800 cal yr BP

  6. Egyptian mummies record increasing aridity in the Nile valley from 5500 to 1500 yr before present

    Science.gov (United States)

    Touzeau, Alexandra; Blichert-Toft, Janne; Amiot, Romain; Fourel, François; Martineau, François; Cockitt, Jenefer; Hall, Keith; Flandrois, Jean-Pierre; Lécuyer, Christophe

    2013-08-01

    Oxygen isotope compositions were measured in teeth (n=29) and bones (n=41) from Egyptian mummies of humans (n=48) in order to track the δ18O evolution of the Nile from 5500 to 1500 B.P. The combination of δ18O values of apatite carbonate and phosphate was used to filter the database for post mortem alteration of bioapatites, while 87Sr/86Sr ratios were used to detect potential allochthonous people buried in the various archeological sites located along the Nile. This approach led to only five apatite samples out of seventy to be discarded from the database. The remaining oxygen isotope compositions of both tooth and bone phosphates from ancient Egyptians were converted into the composition of ingested water ultimately originating from the Nile. It was found that δ18O of Nile waters increases progressively from -1.6 to +1.5 (‰ VSMOW) from the Predynastic (∼5500 B.P.) through the Late Period (∼2550 B.P.). This trend towards higher Nile δ18O values acquired in more recent times is coherent with a general drying trend in Northeast Africa, which was not limited to a drying spell at the end of the Nabtian Pluvial (ca. 12,000 B.P. -ca. 6000 B.P.), but extended far into the following millennia nearly to the beginning of the Common Era (1950 B.P.).

  7. Windows Calorimeter Control (WinCal) program computer software test plan

    International Nuclear Information System (INIS)

    Pertzborn, N.F.

    1997-01-01

    This document provides the information and guidelines necessary to conduct all the required testing of the Windows Calorimeter Control (WinCal) system. The strategy and essential components for testing the WinCal System Project are described in this test plan. The purpose of this test plan is to provide the customer and performing organizations with specific procedures for testing the specified system's functions

  8. Lr67/Yr46 confers adult plant resistance to stem rust and powdery mildew in wheat.

    Science.gov (United States)

    Herrera-Foessel, Sybil A; Singh, Ravi P; Lillemo, Morten; Huerta-Espino, Julio; Bhavani, Sridhar; Singh, Sukhwinder; Lan, Caixia; Calvo-Salazar, Violeta; Lagudah, Evans S

    2014-04-01

    We demonstrate that Lr67/Yr46 has pleiotropic effect on stem rust and powdery mildew resistance and is associated with leaf tip necrosis. Genes are designated as Sr55, Pm46 and Ltn3 , respectively. Wheat (Triticum aestivum) accession RL6077, known to carry the pleiotropic slow rusting leaf and yellow rust resistance genes Lr67/Yr46 in Thatcher background, displayed significantly lower stem rust (P. graminis tritici; Pgt) and powdery mildew (Blumeria graminis tritici; Bgt) severities in Kenya and in Norway, respectively, compared to its recurrent parent Thatcher. We investigated the resistance of RL6077 to stem rust and powdery mildew using Avocet × RL6077 F6 recombinant inbred lines (RILs) derived from two photoperiod-insensitive F3 families segregating for Lr67/Yr46. Greenhouse seedling tests were conducted with Mexican Pgt race RTR. Field evaluations were conducted under artificially initiated stem rust epidemics with Pgt races RTR and TTKST (Ug99 + Sr24) at Ciudad Obregon (Mexico) and Njoro (Kenya) during 2010-2011; and under natural powdery mildew epiphytotic in Norway at Ås and Hamar during 2011 and 2012. In Mexico, a mean reduction of 41 % on stem rust severity was obtained for RILs carrying Lr67/Yr46, compared to RILs that lacked the gene, whereas in Kenya the difference was smaller (16 %) but significant. In Norway, leaf tip necrosis was associated with Lr67/Yr46 and RILs carrying Lr67/Yr46 showed a 20 % reduction in mean powdery mildew severity at both sites across the 2 years of evaluation. Our study demonstrates that Lr67/Yr46 confers partial resistance to stem rust and powdery mildew and is associated with leaf tip necrosis. The corresponding pleiotropic, or tightly linked, genes, designated as Sr55, Pm46, and Ltn3, can be utilized to provide broad-spectrum durable disease resistance in wheat.

  9. AcEST: BP914065 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette

  10. AcEST: BP914069 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001

  11. AcEST: BP914060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett

  12. AcEST: BP920146 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E12 401 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E12. BP92014...6 CL388Contig1 Show BP920146 Clone id YMU001_000133_E12 Library YMU01 Length 401 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_E12. Accession BP920146 Tissue type prothallium Developmental stage...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum ca...rams, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum capillus-veneris mRNA, clone: YMU001_000133_

  13. AcEST: BP920149 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F03 624 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F03. BP92014...9 CL2860Contig1 Show BP920149 Clone id YMU001_000133_F03 Library YMU01 Length 624 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F03. Accession BP920149 Tissue type prothallium Developmental stag...ic Acids Res. 25:3389-3402. Query= BP920149|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F03. (624 l...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  14. Around and beyond 53BP1 Nuclear Bodies.

    Science.gov (United States)

    Fernandez-Vidal, Anne; Vignard, Julien; Mirey, Gladys

    2017-12-05

    Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs) are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1), a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.

  15. AcEST: BP920994 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C10 322 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C10. BP92099...4 CL2871Contig1 Show BP920994 Clone id YMU001_000144_C10 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C10. Accession BP920994 Tissue type prothallium Developmental stag...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  16. AcEST: BP920990 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C03. BP92099...0 CL4123Contig1 Show BP920990 Clone id YMU001_000144_C03 Library YMU01 Length 445 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C03. Accession BP920990 Tissue type prothallium Developmental stag...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9209...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  17. AcEST: BP920999 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D04 588 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D04. BP92099...9 CL317Contig1 Show BP920999 Clone id YMU001_000144_D04 Library YMU01 Length 588 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D04. Accession BP920999 Tissue type prothallium Developmental stage...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  18. AcEST: BP920993 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C06 517 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C06. BP92099...3 CL547Contig1 Show BP920993 Clone id YMU001_000144_C06 Library YMU01 Length 517 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_C06. Accession BP920993 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum capillus-veneris mRNA, clone: YMU001_0001...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum

  19. AcEST: BP920991 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C04. BP92099...1 CL3173Contig1 Show BP920991 Clone id YMU001_000144_C04 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C04. Accession BP920991 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (521 letters) Dat...ucleic Acids Res. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (5

  20. AcEST: BP920992 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C05. BP92099...2 CL2523Contig1 Show BP920992 Clone id YMU001_000144_C05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C05. Accession BP920992 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C05. (525 lett...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_00014

  1. Around and beyond 53BP1 Nuclear Bodies

    Directory of Open Access Journals (Sweden)

    Anne Fernandez-Vidal

    2017-12-01

    Full Text Available Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1, a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.

  2. AcEST: BP919801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C11 513 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C11. BP919801... CL1Contig3 Show BP919801 Clone id YMU001_000129_C11 Library YMU01 Length 513 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000129_C11. Accession BP919801 Tissue type prothallium Developmental stage -...es. 25:3389-3402. Query= BP919801|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C11. (435 letters) Da...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919801|Adiantum capil

  3. AcEST: BP918016 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F04 434 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F04. BP91801...6 CL3779Contig1 Show BP918016 Clone id YMU001_000108_F04 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000108_F04. Accession BP918016 Tissue type prothallium Developmental stag..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...ic Acids Res. 25:3389-3402. Query= BP918016|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F04. (434 l

  4. AcEST: BP914801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_A07 396 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A07. BP914801... CL1121Contig1 Show BP914801 Clone id YMU001_000063_A07 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000063_A07. Accession BP914801 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801|Adiantum capillus-veneris mRNA, clone:

  5. Causes of Greenland temperature variability over the past 4000 yr: implications for northern hemispheric temperature changes

    Directory of Open Access Journals (Sweden)

    T. Kobashi

    2013-10-01

    Full Text Available Precise understanding of Greenland temperature variability is important in two ways. First, Greenland ice sheet melting associated with rising temperature is a major global sea level forcing, potentially affecting large populations in coming centuries. Second, Greenland temperatures are highly affected by North Atlantic Oscillation/Arctic Oscillation (NAO/AO and Atlantic multidecadal oscillation (AMO. In our earlier study, we found that Greenland temperature deviated negatively (positively from northern hemispheric (NH temperature trend during stronger (weaker solar activity owing to changes in atmospheric/oceanic changes (e.g. NAO/AO over the past 800 yr (Kobashi et al., 2013. Therefore, a precise Greenland temperature record can provide important constraints on the past atmospheric/oceanic circulation in the region and beyond. Here, we investigated Greenland temperature variability over the past 4000 yr reconstructed from argon and nitrogen isotopes from trapped air in a GISP2 ice core, using a one-dimensional energy balance model with orbital, solar, volcanic, greenhouse gas, and aerosol forcings. The modelled northern Northern Hemisphere (NH temperature exhibits a cooling trend over the past 4000 yr as observed for the reconstructed Greenland temperature through decreasing annual average insolation. With consideration of the negative influence of solar variability, the modelled and observed Greenland temperatures agree with correlation coefficients of r = 0.34–0.36 (p = 0.1–0.04 in 21 yr running means (RMs and r = 0.38–0.45 (p = 0.1–0.05 on a centennial timescale (101 yr RMs. Thus, the model can explain 14 to 20% of variance of the observed Greenland temperature in multidecadal to centennial timescales with a 90–96% confidence interval, suggesting that a weak but persistent negative solar influence on Greenland temperature continued over the past 4000 yr. Then, we estimated the distribution of multidecadal NH and northern high

  6. The Efficiency of Delone Coverings of the Canonical Tilings MATH {cal T}(*(A_4)) -> T^*(A4) and MATH {cal T}(*(D_6)) -> T^*(D6)

    Science.gov (United States)

    Papadopolos, Zorka; Kasner, Gerald

    This chapter is devoted to the coverings of the two quasiperiodic canonical tilings MATH {cal T}(*(A_4)) -> T^*(A4) and MATH {cal T}(*(D_6)) equiv {cal T}(*(2F)) -> T^*(D6) T^*(2F), obtained by projection from the root lattices A4 and D6, respectively. In the first major part of this chapter, in Sect. 5.2, we shall introduce a Delone covering MATH {cal C}(s_{{cal) T}(*(A_4)}) -> C^sT^*(A4) of the 2-dimensional decagonal tiling MATH {cal T}(*(A_4)) -> T^*(A4). In the second major part of this chapter, Sect. 5.3, we summarize the results related to the Delone covering of the icosahedral tiling MATH {cal T}(*(D_6)) -> T^*(D6), MATH {cal C}_{{cal T}(*(D_6)}) -> CT^*(D6) and determine the zero-, single-, and double- deckings and the resulting thickness of the covering. In the conclusions section, we give some suggestions as to how the definition of the Delone covering might be changed in order to reach some real (full) covering of the icosahedral tiling MATH {cal T}(*(D_6)) -> T^*(D6). In Section 5.2 the definition of the Delone covering is also changed in order to avoid an unnecessary large thickness of the covering.

  7. Holocene seasonal variability inferred from multiple proxy records from Crevice Lake, Yellowstone National Park, USA

    Science.gov (United States)

    Whitlock, Cathy; Dean, Walter E.; Fritz, Sherilyn C.; Stevens, Lora R.; Stone, Jeffery R.; Power, Mitchell J.; Rosenbaum, Joseph R.; Pierce, Kenneth L.; Bracht-Flyr, Brandi B.

    2012-01-01

    A 9400-yr-old record from Crevice Lake, a semi-closed alkaline lake in northern Yellowstone National Park, was analyzed for pollen, charcoal, geochemistry, mineralogy, diatoms, and stable isotopes to develop a nuanced understanding of Holocene environmental history in a region of northern Rocky Mountains that receives both summer and winter precipitation. The limited surface area, conical bathymetry, and deep water (> 31 m) of Crevice Lake create oxygen-deficient conditions in the hypolimnion and preserve annually laminated sediment (varves) for much of the record. Pollen data indicate that the watershed supported a closed Pinus-dominated forest and low fire frequency prior to 8200 cal yr BP, followed by open parkland until 2600 cal yr BP, and open mixed-conifer forest thereafter. Fire activity shifted from infrequent stand-replacing fires initially to frequent surface fires in the middle Holocene and stand-replacing events in recent centuries. Low values of δ18O suggest high winter precipitation in the early Holocene, followed by steadily drier conditions after 8500 cal yr BP. Carbonate-rich sediments before 5000 cal yr BP imply warmer summer conditions than after 5000 cal yr BP. High values of molybdenum (Mo), uranium (U), and sulfur (S) indicate anoxic bottom-waters before 8000 cal yr BP, between 4400 and 3900 cal yr BP, and after 2400 cal yr BP. The diatom record indicates extensive water-column mixing in spring and early summer through much of the Holocene, but a period between 2200 and 800 cal yr BP had strong summer stratification, phosphate limitation, and oxygen-deficient bottom waters. Together, the proxy data suggest wet winters, protracted springs, and warm effectively wet summers in the early Holocene and less snowpack, cool springs, warm dry summers in the middle Holocene. In the late Holocene, the region and lake experienced extreme changes in winter, spring, and summer conditions, with particularly short springs and dry summers and winters during

  8. Expanding the BP1-BP2 15q11.2 Microdeletion Phenotype: Tracheoesophageal Fistula and Congenital Cataracts

    Directory of Open Access Journals (Sweden)

    D. Wong

    2013-01-01

    Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.

  9. THE SOLAR NEIGHBORHOOD. XXV. DISCOVERY OF NEW PROPER MOTION STARS WITH 0.''40 yr-1 > μ ≥ 0.''18 yr-1 BETWEEN DECLINATIONS -470 AND 000

    International Nuclear Information System (INIS)

    Boyd, Mark R.; Winters, Jennifer G.; Henry, Todd J.; Jao, Wei-Chun; Finch, Charlie T.; Subasavage, John P.; Hambly, Nigel C.

    2011-01-01

    We present 2817 new southern proper motion systems with 0.''40 yr -1 > μ ≥ 0.''18 yr -1 and declination between -47 0 and 00 0 . This is a continuation of the SuperCOSMOS-RECONS (SCR) proper motion searches of the southern sky. We use the same photometric relations as previous searches to provide distance estimates based on the assumption that the objects are single main-sequence stars. We find 79 new red dwarf systems predicted to be within 25 pc, including a few new components of previously known systems. Two systems-SCR 1731-2452 at 9.5 pc and SCR 1746-3214 at 9.9 pc-are anticipated to be within 10 pc. We also find 23 new white dwarf (WD) candidates with distance estimates of 15-66 pc, as well as 360 new red subdwarf candidates. With this search, we complete the SCR sweep of the southern sky for stars with μ ≥ 0.''18 yr -1 and R 59F ≤ 16.5, resulting in a total of 5042 objects in 4724 previously unreported proper motion systems. Here we provide selected comprehensive lists from our SCR proper motion search to date, including 152 red dwarf systems estimated to be within 25 pc (9 within 10 pc), 46 WDs (10 within 25 pc), and 598 subdwarf candidates. The results of this search suggest that there are more nearby systems to be found at fainter magnitudes and lower proper motion limits than those probed so far.

  10. Soccer increases bone mass in prepubescent boys during growth: a 3-yr longitudinal study.

    Science.gov (United States)

    Zouch, Mohamed; Zribi, Anis; Alexandre, Christian; Chaari, Hamada; Frere, Delphine; Tabka, Zouhair; Vico, Laurence

    2015-01-01

    The aim of this study was to examine the effect of 3-yr soccer practice on bone acquisition in prepubescent boys. We investigated 65 boys (aged 10-13 yr, Tanner stage I) at baseline, among which only 40 boys (Tanner stages II and III) have continued the 3-yr follow-up: 23 soccer players (F) completed 2-5 h of training plus 1 competition game per week and 17 controls (C). Bone mineral density (BMD, g/cm(2)) and bone mineral content (BMC, g) were measured by dual-energy X-ray absorptiometry at different sites. At baseline, BMD was higher in soccer players than in controls in the whole body and legs. In contrast, there was nonsignificant difference BMD in head, femoral neck, arms, and BMC in all measured sites between groups. At 3-yr follow-up, soccer players were found to have higher BMD and BMC at all sites than controls, except for head BMD and BMC and arms BMC in which the difference was nonsignificant between groups. During the 3-yr follow-up, the soccer players were found to gain significantly more in lumbar spine (31.2% ± 2.9% vs 23.9% ± 2.1%; p soccer players have less %BMD and %BMC changes in the head than controls. A nonsignificant difference was found in legs, dominant arm, head %BMD and %BMC changes, and whole-body %BMC changes between groups. In summary, we suggest that soccer has an osteogenic effect BMD and BMC in loaded sites in pubertal soccer players. The increased bone mass induced by soccer training in the stressed sites was associated to a decreased skull bone mass after 3 yr of follow-up. Copyright © 2015 The International Society for Clinical Densitometry. Published by Elsevier Inc. All rights reserved.

  11. Holocene vegetation and climate change recorded in alpine bog sediments from the Borreguiles de la Virgen, Sierra Nevada, southern Spain

    Science.gov (United States)

    Jiménez-Moreno, Gonzalo; Anderson, R. Scott

    2012-01-01

    High-resolution pollen and magnetic susceptibility (MS) analyses have been carried out on a sediment core taken from a high-elevation alpine bog area located in Sierra Nevada, southern Spain. The earliest part of the record, from 8200 to about 7000 cal yr BP, is characterized by the highest abundance of arboreal pollen and Pediastrum, indicating the warmest and wettest conditions in the area at that time. The pollen record shows a progressive aridification since 7000 cal yr BP that occurred in two steps, first shown by a decrease in Pinus, replaced by Poaceae from 7000 to 4600 cal yr BP and then by Cyperaceae, Artemisia and Amaranthaceae from 4600 to 1200 cal yr BP. Pediastrum also decreased progressively and totally disappeared at ca. 3000 yr ago. The progressive aridification is punctuated by periodically enhanced drought at ca. 6500, 5200 and 4000 cal yr BP that coincide in timing and duration with well-known dry events in the Mediterranean and other areas. Since 1200 cal yr BP, several changes are observed in the vegetation that probably indicate the high-impact of humans in the Sierra Nevada, with pasturing leading to nutrient enrichment and eutrophication of the bog, Pinus reforestation and Olea cultivation at lower elevations.

  12. Stratigraphic evidence of desertification in the west-central Great Plains within the past 1000 yr

    Science.gov (United States)

    Madole, R.F.

    1994-01-01

    Stratigraphic and geomorphic relations, archaeological data, and eight radiocarbon ages at five widely scattered localities in northeastern Colorado indicate that eolian sand was mobilized over broad areas within the past 1000 yr. The mobilization began after 1 ka, was episodic, and ended at some as yet undetermined time prior to the latter part of the 19th century. Given that climate-model simulations suggest only slight variation in average surface temperature and annual precipitation in this region during the past 1000 yr, this part of the Great Plains evidently is near the threshold of widespread eolian sand transport under the present climate. -Author

  13. Tunneling in BP-MoS2 heterostructure

    Science.gov (United States)

    Liu, Xiaochi; Qu, Deshun; Kim, Changsik; Ahmed, Faisal; Yoo, Won Jong

    Tunnel field effect transistor (TFET) is considered to be a leading option for achieving SS mV/dec. In this work, black phosphorus (BP) and molybdenum disulfide (MoS2) heterojunction devices are fabricated. We find that thin BP flake and MoS2 form normal p-n junctions, tunneling phenomena can be observed when BP thickness increases to certain level. PEO:CsClO4 is applied on the surface of the device together with a side gate electrode patterned together with source and drain electrodes. The Fermi level of MoS2 on top of BP layer can be modulated by the side gating, and this enables to vary the MoS2-BP tunnel diode property from off-state to on-state. Since tunneling is the working mechanism of MoS2-BP junction, and PEO:CsClO4\\ possesses ultra high dielectric constant and small equivalent oxide thickness (EOT), a low SS of 55 mV/dec is obtained from MoS2-BP TFET. This work was supported by the Global Research Laboratory and Global Frontier R&D Programs at the Center for Hybrid Interface Materials, both funded by the Ministry of Science, ICT & Future Planning via the National Research Foundation of Korea (NRF).

  14. Lacustrine sedimentation in an altitude forest site, central Andes, Bolivia. Palaeo-climatic implications

    International Nuclear Information System (INIS)

    Sifeddine, A.; Bertaux, J.; Mourguiart, Ph.; Disnar, J.R.; Laggoun-Defarge, F.; Argollo, J.

    1998-01-01

    A sedimentological study of a 755 cm length core sampled in the middle of a marshy depression surrounded by a cloud forest in the central Andes reveals that this site has recorded important environmental variations during the last 50 000 years. For the most part (625 cm) the core is composed of detrital rich sediments deposited during the Upper Pleistocene. The highest amount of detrital influx underlines the Last Glacial Maximum which ranges from ca 29,000 14 C yr B.P. to ca 16,000 14 C yr B.P. (ca 18,500 cal yr B.P.), between two relatively humid phases. The sedimentation of the present Interglacial, starting at ca 12,500 14 C yr B.P. (14,500 cal yr B.P.), is mainly organic, as a consequence of the great development of soils and the forest vegetal cover the catchment area. The maximum extension of this vegetal cover ranging from 12,500 to ca 10,500 14 C yr B.P. (14,500 and 12,400 cal yr B.P.) is followed from 10,500 to 8,000 14 C yr B.P. (12,400 and 8,800 cal yr B.P.) by a drier period is revealed by the occurrence of micro-charcoals in the sediment. Between ca 8,000 and 4,000 14 C yr B.P. (8,800 and 4,500 cal yr B.P.), the sharp increase of micro-charcoals content, likely related to palaeo-fires, underlines an intensification of this dry trend. (authors)

  15. Attitude toward Christianity and paranormal belief among 13- to 16-yr.-old students.

    Science.gov (United States)

    Williams, Emyr; Francis, Leslie J; Robbins, Mandy

    2006-08-01

    A small but statistically significant positive correlation (r = .17) was found in a sample of 279 13- to 16-yr.-old students in Wales between scores on the Francis Scale of Attitude toward Christianity and on a new Index of Paranormal Belief. These data suggest that there is little common variance between attitude toward Christianity and belief in the paranormal.

  16. On the origin of multidecadal to centennial Greenland temperature anomalies over the past 800 yr

    Directory of Open Access Journals (Sweden)

    T. Kobashi

    2013-03-01

    Full Text Available The surface temperature of the Greenland ice sheet is among the most important climate variables for assessing how climate change may impact human societies due to its association with sea level rise. However, the causes of multidecadal-to-centennial temperature changes in Greenland temperatures are not well understood, largely owing to short observational records. To examine these, we calculated the Greenland temperature anomalies (GTA[G-NH] over the past 800 yr by subtracting the standardized northern hemispheric (NH temperature from the standardized Greenland temperature. This decomposes the Greenland temperature variation into background climate (NH; polar amplification; and regional variability (GTA[G-NH]. The central Greenland polar amplification factor as expressed by the variance ratio Greenland/NH is 2.6 over the past 161 yr, and 3.3–4.2 over the past 800 yr. The GTA[G-NH] explains 31–35% of the variation of Greenland temperature in the multidecadal-to-centennial time scale over the past 800 yr. We found that the GTA[G-NH] has been influenced by solar-induced changes in atmospheric circulation patterns such as those produced by the North Atlantic Oscillation/Arctic Oscillation (NAO/AO. Climate modeling and proxy temperature records indicate that the anomaly is also likely linked to solar-paced changes in the Atlantic meridional overturning circulation (AMOC and associated changes in northward oceanic heat transport.

  17. On the Origin of Multidecadal to Centennial Greenland Temperature Anomalies Over the Past 800 yr

    Science.gov (United States)

    Kobashi, T.; Shindell, D. T.; Kodera, K.; Box, J. E.; Nakaegawa, T.; Kawamura, K.

    2013-01-01

    The surface temperature of the Greenland ice sheet is among the most important climate variables for assessing how climate change may impact human societies due to its association with sea level rise. However, the causes of multidecadal-to-centennial temperature changes in Greenland temperatures are not well understood, largely owing to short observational records. To examine these, we calculated the Greenland temperature anomalies (GTA[G-NH]) over the past 800 yr by subtracting the standardized northern hemispheric (NH) temperature from the standardized Greenland temperature. This decomposes the Greenland temperature variation into background climate (NH); polar amplification; and regional variability (GTA[G-NH]). The central Greenland polar amplification factor as expressed by the variance ratio Greenland/NH is 2.6 over the past 161 yr, and 3.3-4.2 over the past 800 yr. The GTA[G-NH] explains 31-35%of the variation of Greenland temperature in the multidecadal-to-centennial time scale over the past 800 yr. We found that the GTA[G-NH] has been influenced by solar-induced changes in atmospheric circulation patterns such as those produced by the North Atlantic Oscillation/Arctic Oscillation (NAO/AO). Climate modeling and proxy temperature records indicate that the anomaly is also likely linked to solar-paced changes in the Atlantic meridional overturning circulation (AMOC) and associated changes in northward oceanic heat transport.

  18. B-mode contamination by synchrotron emission from 3-yr Wilkinson Microwave Anisotropy Probe data

    NARCIS (Netherlands)

    Carretti, E.; Bernardi, G.; Cortiglioni, S.

    2006-01-01

    We study the contamination of the B-mode of the cosmic microwave background polarization (CMBP) by Galactic synchrotron in the lowest emission regions of the sky. The 22.8-GHz polarization map of the 3-yr Wilkinson Microwave Anisotropy Probe (WMAP) data release is used to identify and analyse such

  19. The ecological implications of a Yakutian mammoth’s last meal

    NARCIS (Netherlands)

    van Geel, B.; Aptroot, A.; Baittinger, C.; Birks, H.H.; Bull, I.D.; Cross, H.B.; Evershed, R.P.; Gravendeel, B.; Kompanje, E.J.O.; Kuperus, P.; Mol, D.; Nierop, K.G.J.; Pals, J.P.; Tikhonov, A.N.; van Reenen, G.; van Tienderen, P.

    2008-01-01

    Part of a large male woolly mammoth (Mammuthus primigenius) was preserved in permafrost in northern Yakutia. It was radiocarbon dated to ca. 18,500 14C yr BP (ca. 22,500 cal yr BP). Dung from the lower intestine was subjected to a multiproxy array of microscopic, chemical, and molecular techniques

  20. AcEST: BP912124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total

  1. AcEST: BP912125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show BP91212...is mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12

  2. AcEST: BP912120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show BP91212...is mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412

  3. AcEST: BP921212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29

  4. AcEST: BP912812 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812|Adiant...um capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ

  5. AcEST: BP912122 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum

  6. AcEST: BP912127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi

  7. AcEST: BP912112 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show BP912112...is mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765

  8. AcEST: BP912412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot

  9. AcEST: BP912512 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_D01 513 Adiantum capillus-veneris mRNA. clone: YMU001_000019_D01. BP912512... CL17Contig1 Show BP912512 Clone id YMU001_000019_D01 Library YMU01 Length 513 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000019_D01. Accession BP912512 Tissue type prothallium Developmental stage ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP912512|Adiantum capillus-veneris mRNA, clone: YMU0...01_000019_D01. (489 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear

  10. AcEST: BP912129 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, clo...ne: YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett

  11. BP Spill in the Gulf of Mexico Sediment Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — In response to the BP oil spill, EPA monitored sediment near the spill. While emergency response data collection has ended, results continue to be available on this...

  12. AcEST: BP913939 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show BP913939...is mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP

  13. BP erioperatsioon naftalekke peatamiseks nurjus / Jürgen Tamme

    Index Scriptorium Estoniae

    Tamme, Jürgen

    2010-01-01

    Naftakompanii BP katse peatada Mehhiko lahe naftaleke ebaõnnestus, nüüd püütakse reostust peatada uue toru paigaldamise abil. USA president Barack Obama avaldas taas rahulolematust naftakompaniiga. Kaart

  14. Evaluation of the Specificity of BP3385 for Bordetella pertussis

    Science.gov (United States)

    BP3385 has been proposed as a diagnostic PCR target for discriminating between Bordetella pertussis and other Bordetella species that also infect humans. Our results demonstrate this gene is also present in some strains of Bordetella hinzii and Bordetella bronchiseptica....

  15. Pollen record of the mid- to late-Holocene centennial climate change on the East coast of South Korea and its influential factors

    Science.gov (United States)

    Song, Bing; Yi, Sangheon; Jia, Hongjuan; Nahm, Wook-Hyun; Kim, Jin-Cheul; Lim, Jaesoo; Lee, Jin-Young; Sha, Longbin; Mao, Limi; Yang, Zhongyong; Nakanishi, Toshimichi; Hong, Wan; Li, Zhen

    2018-01-01

    To understand historical climate change in western Pacific coastal areas, a sediment core (SOJ-2) from the stable sedimentary environment of the Songjiho Lagoon on the east coast of South Korea was obtained for centennial-resolution palynological analysis. The ages of the SOJ-2 core is well controlled by carbon 14 dating with high-resolution accelerator mass spectrometry (AMS), and the results indicated a general warm to cold climate trend from the mid-Holocene to the present, which can be divided into two different stages: a warmer stage between 6842 and 1297 cal yr BP and a colder stage from 1297 cal yr BP to the present, with fluctuations during these stages. The climate was wetter from 6842 to 6227 cal yr BP and 4520 to 1297 cal yr BP and was drier from 6227 to 4520 cal yr BP. The climate changed to cold and dry during the period from 1297-425 cal yr BP. The impact of human activity on the climate began at approximately 1297 cal yr BP and became pronounced starting in 425 cal yr BP. The general cooling trend may represent a response to decreasing solar insolation; however, the relative dryness or wetness of the climate may have been co-determined by westerlies and the East Asian summer monsoon (EASM). The climate had a teleconnection with the North Atlantic region, resulting from changes in solar activity. Nevertheless, EI Niño-Southern Oscillation (ENSO) activity played an important role in impacting the EASM changes in western Pacific coastal areas.

  16. BP/Mobil. Joint-venture directions for use

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    This paper analyzes the economical reasons which have led BP and Mobil companies to join their forces in 1996. Thanks to their complementarity and to their European implantation, the two companies could win the first or second position in petroleum products marketing in 8 European countries. The cumulated petrol sales and the number of petrol stations of the BP/Mobil joint venture are the highest in Europe (800 petrol stations in France). (J.S.)

  17. The human element of right-sizing. BP experiences

    International Nuclear Information System (INIS)

    Hollis, J.W.

    1994-01-01

    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  18. Gear Fault Diagnosis Based on BP Neural Network

    Science.gov (United States)

    Huang, Yongsheng; Huang, Ruoshi

    2018-03-01

    Gear transmission is more complex, widely used in machinery fields, which form of fault has some nonlinear characteristics. This paper uses BP neural network to train the gear of four typical failure modes, and achieves satisfactory results. Tested by using test data, test results have an agreement with the actual results. The results show that the BP neural network can effectively solve the complex state of gear fault in the gear fault diagnosis.

  19. Bp'S Baku-Tbilisi-Ceyhan pipeline: the new corporate colonialism.

    Science.gov (United States)

    Marriott, James; Muttitt, Greg

    2006-01-01

    An international campaign was waged questioning the benefits of BP's Baku-Tbilisi-Ceyhan pipeline in an effort to avoid a "zone of sacrifice" there. This article is an offshoot of that effort and explains the contemporary struggle over the pipeline project. The authors describe the project's background and evaluate the actual and potential impacts of the project in which they consider eight areas. They also assess BP's capacity to confront resistance to the pipeline.

  20. The human element of right-sizing. BP experiences

    Energy Technology Data Exchange (ETDEWEB)

    Hollis, J W [BP Norge (Norway)

    1994-12-31

    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  1. 4977-bp mitochondrial DNA deletion in infertile patients with varicocele.

    Science.gov (United States)

    Gashti, N G; Salehi, Z; Madani, A H; Dalivandan, S T

    2014-04-01

    Varicocele is the abnormal inflexion and distension of veins of the pampiniform plexus within spermatic cord and is one of the amendable causes of male infertility. It can increase reactive oxygen species (ROS) production in semen and cause oxidative stress. The purpose of this study was to analyse spermatozoa mtDNA 4977-bp deletion in infertile men with varicocele. To detect 4977-bp deletion in spermatozoa mtDNA, semen samples of 60 infertile patients with clinical varicocele and 90 normal men from northern Iran were prepared. After extraction of spermatozoa total DNA, Gap polymerase chain reaction (Gap PCR) was performed. 4977-bp deletion was observed in 81.66% of patients with varicocele, while approximately 15.55% of controls had this deletion. As spermatozoa from patients with varicocele had a high frequency of occurrence of 4977-bp deletion in mtDNA [OR = 24.18, 95% confidence interval (CI) = 10.15-57.57, P deletion in spermatozoa and cause infertility in north Iranian men. However, to determine the relation between sperm mtDNA 4977-bp deletion and varicocele-induced infertility, larger population-based studies are needed. It is concluded that there is an association between sperm mtDNA 4977-bp deletion and varicocele-induced infertility in the population studied. © 2013 Blackwell Verlag GmbH.

  2. L’Observatoire numérique Nouvelle-Calédonie

    Directory of Open Access Journals (Sweden)

    Charlotte Ullmann

    2013-06-01

    Full Text Available Ses missions consistent à observer le développement numérique et favoriser l’animation territoriale des acteurs en Nouvelle-Calédonie. Parrainée par l’association calédonienne pour les technologies de l’information et de la communication (ACTIC et le ministère en charge de l’économie numérique du Gouvernement de Nouvelle-Calédonie nommé depuis mai 2009, une mission d’étude a été menée depuis juin 2010 pour définir les contours d’un Observatoire numérique. A travers cette étude, il s’agissai...

  3. Frontline CALS - Extranet Enabled Support of Customer Relations Based on Product State Information

    DEFF Research Database (Denmark)

    Larsen, Michael Holm; Franck, Lesley Robert; Pedersen, Mogens Kühn

    1999-01-01

    commerce called Frontline CALS. Frontline CALS integrate three bodies of knowledge, i.e. Continuous Acquisition and Lifecycle Support, Electronic Commerce, and the Customer Consumption Chain in order to construct a concept that enhances the service quality for customers with time critical operations....... The essence of Frontline CALS is that it combines a product and a customer view with the aim of enhancing the service quality offered by the dealers in collaboration with the producer. The article further provides empirical insight from an early prototype implementation of a Web Service System intended......The electronic economy has proliferated during the past decade. Many initiatives are launched in order to support customer's interaction with the company, however, often fragmented. A more holistic approach is provided in this article. The article suggests a business model in the era of electronic...

  4. Late holocene trends of phytoplankton productivity and anoxia as inferred from diatom and geochemical proxies in Lake Victoria, Eastern Africa

    Science.gov (United States)

    Andama, M.; Lejju, J. B.; Tolo, C. U.

    2013-11-01

    Lake Victoria ecosystem has undergone major ecological changes in the recent decades. Sedimentary diatom analysis and Fe / Mn determined by Energy Dispersive X-ray Fluorescence (EDXRF) have provided phytoplankton (diatom) productivity and the resultant anoxia (Fe / Mn) in Lake Victoria at Napoleon Gulf during the late Holocene (1778 cal yr BP (calibrated years before present) to 2008 AD) with radiocarbon dates determined using Accelerator Mass Spectrometry standard method. The results showed that increased total diatom counts in Napoleon Gulf during the late Holocene correspond with increased Fe / Mn ratio (anoxia) in some of the profiles and not in others and in most cases those that correspond correlate very well with increased eutrophication from nitrate input (Total Nitrogen, TN). Therefore slightly increased anoxia not related to increased diatom productivity was recorded in Lake Victoria at Napoleon Gulf from the period 1778 to 1135 cal yr BP. There was slightly increased diatom productivity at Napoleon Gulf from the period 857 to 758 cal yr BP but it did not increase anoxia in the lake. The period 415 cal yr BP to 2008 AD recorded increased anoxia at Napoleon Gulf related to high diatom productivity especially from 415 to 390 cal yr BP and 191 cal yr BP to 2008 AD.

  5. Late Holocene paleoenvironments of the floodplain of the Solimões River, Central Amazonia, based on the palynological record of Lake Cabaliana

    Directory of Open Access Journals (Sweden)

    Natália de Paula Sá

    Full Text Available ABSTRACT The core PD-67 of 160 cm depth was collected from the delta of Lake Cabaliana situated on the Solimões River. Seventeen samples were removed for palynological and sedimentological analysis and three for radiocarbon analysis. Two dry periods, both in the Late Holocene, were observed (2800-2550 cal yr BP, 1450-550 cal yr BP separated by a wetter phase (2550-1450 cal yr BP. In 2800-2550 cal yr BP, varzea forests of Alchornea, Symmeria, Cecropia, Alternanthera and Asteraceae were predominant. Beginning in 2,550-1450 cal yr BP, the varzea was characterized by pioneer elements, such as Cassia, Laetia, Mabea, Symmeria and Cecropia, and by the expansion of Poaceae, Cyperaceae, Sagittaria, Montrichardia and Asteraceae. In 1450-550 cal yr BP the succession of varzea continued with Pseudobombax, Laetia, Luehea/Lueheopsis and Ryanaea increasing simultaneously with the terra firme vegetation of Rutaceae, Sapotaceae, Styrax, Scleronema, Anthurium, Araceae, pteridophytes and Pariana. The successional dynamics at Lake Cabaliana indicated that the local varzea had become established recently, and is composed of a mosaic of different successional stages of vegetation influenced mainly by flood pulse and variation in rainfall. It is therefore possible to propose that the recent climate history of Central Amazonia reflects changes in rainfall patterns in the basin.

  6. Posibilidades estructurales de materiales a base de cal como conglomerante: primeros resultados

    OpenAIRE

    Estrada, Enrique; Barbero, José Miguel

    1986-01-01

    La cal es un material abundante y cuya producción suma a una tecnología muy accesible la ventaja de poder materializarse en pequeñas plantas dispersas, para poder reducir al mínimo la componente de costo debida al transporte. En el presente trabajo se ha planteado la posibilidad de obtener hormigones con fines estructurales, para viviendas de baja altura y que sean de fácil obtención, a base de cal y cenizas volantes o cenizas de cascara de arroz, variando sus proporciones, grados de finur...

  7. Cal-Bridge and CAMPARE: Engaging Underrepresented Students in Physics and Astronomy

    Science.gov (United States)

    Rudolph, Alexander L.; Cal-Bridge and CAMPARE Teams

    2018-01-01

    We describe two programs, Cal-Bridge and CAMPARE, with the common mission of increasing participation of groups traditionally underrepresented in astronomy, through summer research opportunities, in the case of CAMPARE, scholarships in the case of Cal-Bridge, and significant mentoring in both programs, creating a national impact on their numbers successfully pursuing a PhD in the field.In 8 years, the CAMPARE program has sent 112 students, >80% from underrepresented groups, to conduct summer research at one of 14 major research institutions throughout the country. Of the CAMPARE scholars who have graduated with a Bachelor’s degree, almost two-thirds (65%) have completed or are pursuing graduate education in physics, astronomy, or a related field, at institutions including UCLA, UC Riverside, UC Irvine, UC Santa Barbara, USC, Stanford, Univ. of Arizona, Univ. of Washington, Univ. of Rochester, Michigan State Univ., Georgia Tech, Georgia State Univ., Kent State, Indiana Univ., Univ. of Oregon, Syracuse Univ., Montana State Univ., and the Fisk-Vanderbilt Master’s-to-PhD program.Now entering its fourth year, the Cal-Bridge program is a CSU-UC Bridge program comprised of >140 physics and astronomy faculty from 9 University of California (UC), 15 California State University (CSU), and 30 California Community College (CCC) campuses throughout California. In the first four years, 34 Cal-Bridge Scholars have been selected, including 22 Hispanic, 3 African-American and 13 women students, 10 of whom are from URM groups. Thirty (30) of the 34 Cal-Bridge Scholars are first generation college students. In the last two years, 11 of 13 Cal-Bridge Scholars have begun PhD programs in physics or astronomy at top PhD programs nationally. Three (3) of these 11 scholars have won NSF Graduate Research Fellowships; one more received an Honorable Mention. The next cohort applies this fall.Cal-Bridge provides much deeper mentoring and professional development experiences over the last

  8. Effect of a community screening for Helicobacter pylori: a 5-Yr follow-up study

    DEFF Research Database (Denmark)

    Hansen, Jane M; Wildner-Christensen, Mette; Hallas, Jesper

    2008-01-01

    of community H. pylori screening and treatment on the prevalence of dyspepsia, and as secondary outcomes, the effect on dyspepsia-related health-care consumption and quality of life over 5 yr. METHODS: In 1998-1999, individuals aged 40-65 yr were randomized to H. pylori screening and treatment...... ulcers vs 148 ulcers) was seen in the screened group compared to the unscreened group. CONCLUSION: A population H. pylori screening and treatment program in an H. pylori low-prevalence area had only a modest, but insignificant, effect on the rate of dyspepsia, and a modest, significant effect...... on the consultation rate and sick leave days for dyspepsia, but resulted in a decreased ulcer incidence. The intervention resulted in an increased cost due to H. pylori screening and treatment....

  9. Correlations between attitude toward Christianity, prayer, and church attendance among 9- to 11-yr.-olds.

    Science.gov (United States)

    Robbins, Mandy; Babington, Peter; Francis, Leslie J

    2004-02-01

    Data provided by 150 9- to 11-yr.-old primary school pupils in England showed scores on the Francis Scale of Attitude toward Christianity more highly correlated with (personal) prayer (r = .57) than with (public) church attendance (r = .23), providing support for the view that attitude scales access a deeper level of religiosity less contaminated by those contextual and social factors which may influence public church attendance more than personal prayer.

  10. PENGARUH FAKTOR PSIKOLOGIS TERHADAP KEPUTUSAN BERKUNJUNG WISATAWAN MICE MELALUI PT. Y&R KE BALI

    OpenAIRE

    Ni Putu Masni Nistari; I Putu Sudana; I GPB. Sasrawan Mananda

    2017-01-01

    Tourism is a global industry sectors and potentially to be developed as a source of government income countries and regions. MICE (Meeting, Incentive, Convention and Exhibition) in Indonesia has great potential and is the flagship product of the tourism industry Indonesia. The purpose of this research is to determine the influence of psychological factors toward MICE tourists visiting decision to Bali through PT. Y&R. Sampling technique used in this research is purposive sampling. Sa...

  11. Tracking of leisure time physical activity during 28 yr in adults: the Tromsø study.

    Science.gov (United States)

    Morseth, Bente; Jørgensen, Lone; Emaus, Nina; Jacobsen, Bjarne K; Wilsgaard, Tom

    2011-07-01

    Physical activity plays an important role in the prevention of many serious diseases. To develop targeted strategies that encourage physical activity, knowledge of stability of physical activity levels over time is essential. The aim of this study was to examine tracking of leisure time physical activity in adults in Northern Norway during three decades. We followed 5432 women and men who attended the Tromsø Study in 1979-1980, as well as repeated examinations after 7 and 28 yr. Baseline age was 20-54 yr (mean age=35.8 yr). Physical activity was assessed by self-administered questionnaires. Tracking of physical activity, defined as maintenance of relative rank of physical activity level, was estimated by Spearman correlation coefficient and by weighted κ statistics. Tracking in terms of predictability of later values from earlier measurements was analyzed by generalized estimating equations. A higher-than-expected proportion of subjects maintained their physical activity level from examination 1 to 2 (58%) and 3 (53%). κ statistics showed agreement of 0.41 and 0.29, respectively. Belonging to a specific physical activity level at baseline increased the odds of belonging to the same category at later examinations (sedentary odds ratio (OR)=3.9 (95% confidence interval (CI)=3.5-4.4), moderately active OR=2.2 (95% CI=2.0-2.4), active OR=2.9 (95% CI=2.6-3.3), and highly active OR=14.0 (95% CI=8.7-22.5)). Being physically active in young adulthood increased the odds of being physically active later in life (moderately active OR=3.4 (95% CI=3.0-3.9), active OR=5.4 (95% CI=4.6-6.4), and highly active OR=13.0 (95% CI=7.4-22.8)). This study showed tracking of leisure time physical activity during 28 yr in a cohort of adults.

  12. Relationship Between BMD and Prevalent Vertebral Fractures in Indian Women Older Than 50 Yr.

    Science.gov (United States)

    Gupta, Yashdeep; Marwaha, Raman K; Kukreja, Subhash; Bhadra, Kuntal; Narang, Archana; Mani, Kalaivani; Mithal, Ambrish; Tandon, Nikhil

    2016-01-01

    The purpose of the study was to study the relationship of morphometric vertebral fractures with bone mineral density (BMD) in Indian women older than 50 yr. Four hundred fifteen healthy Indian women older than 50 yr (mean age: 62.8 yr) underwent lateral X-rays of the lumbar and thoracic spine. Genant's semiquantitative method was used to diagnose and classify morphometric vertebral fractures. BMD was measured by DXA at lumbar spine and total hip. Recruited subjects underwent anthropometric, biochemical, and hormonal evaluation. Vertebral fractures were present in 17.1% (95% confidence interval: 13.5, 20.8) subjects. Prevalence of osteoporosis based on BMD was 35.7%. By adding those with prevalent fractures, the number of women requiring therapy for osteoporosis would increase to 46.5%. The BMD measured at femur neck, total hip, and lumbar spine (L1eL4) was not found to be lower in women with vertebral fractures as compared with those without fractures. BMD was not found to be lower in women with vertebral fractures as compared with those without fractures. Significant number of additional subjects with BMD in the normal or osteopenic range become eligible for osteoporosis treatment when presence of vertebral fracture is used as an independent indication for such treatment. Copyright © 2016 The International Society for Clinical Densitometry. Published by Elsevier Inc. All rights reserved.

  13. Profile of NF-κBp(65/NFκBp50) among prostate specific antigen sera levels in prostatic pathologies.

    Science.gov (United States)

    Bouraoui, Y; Ben Jemaa, A; Rodriguez, G; Ben Rais, N; Fraile, B; Paniagua, R; Sellemi, S; Royuela, M; Oueslati, R

    2012-10-01

    The aim of this work was to characterise the immunoexpression of NF-κB (p50/p65) in human prostatic pathologies and to study its profiles of activation among sera prostate specific antigen antigen (PSA) according the three groups: 0-4ng/mL, 4-20ng/mL and >20ng/mL. Twenty-four men with benign prostate hyperplasia (BPH); 19 men with prostate cancer (PC) and five men with normal prostates (NP). Immunohistochemical and western blot analysis was performed. Serum levels of PSA were assayed by immulite autoanalyser. In BPH and PC samples, immunoexpressions were observed for NF-κBp65 and NF-κBp50; while in NP samples, only were detected NF-κBp50. PC samples showed immunoreactions to NF-κBp65 and NF-κBp50 more intense (respectively 24.18±0.67 and 28.23±2.01) than that observed in BPH samples (respectively18.46±2.04 and 18.66±1.59) with special localisation in the nucleus. Different profiles of NF-κBp65 immunoexpressions were observed and BPH patients with sera PSA levels between 0-4ng/mL presented a significant weak percentage compared to BPH patients with sera PSA levels between 4-20ng/mL and >20ng/mL. No immunoreactions to NF-κBp65 were observed in PC patients with sera PSA levels between 4-20ng/mL. The sensibility of both NF-κB and PSA to inflammation allowed confirming the relationship between these two molecules and its involvement in prostatic diseases progression (inflammatory and neoplasic). Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  14. Apoptosis of human tongue squamous cell carcinoma cell (CAL-27 induced by Lactobacillus sp. A-2 metabolites

    Directory of Open Access Journals (Sweden)

    Guoliang ZHANG

    2014-07-01

    Full Text Available Objective: To study the effect of Lactobacillus sp. A-2 metabolites on viability of CAL-27 cells and apoptosis in CAL-27 cells. Methods: Lactobacillus sp. A-2 metabolites 1 and 2 (LM1 and LM2 were obtained by culturing Lactobacillus sp. A-2 in reconstituted whey medium and whey-inulin medium; the cultured CAL-27 cells were treated with different concentrations of LM1 and LM2 (0, 3, 6, 12, 24, 48 mg/mL and assayed by methyl thiazolyltetrazolium (MTT method; morphological changes of apoptotic cell were observed under fluorescence microscopy by acridine orange (Ao fluorescent staining; flow cytometry method (FCM and agarose gel electrophoresis were used to detect the apoptosis of CAL-27 cells treated LM1 and LM2. Results: The different concentrations of LM1 and LM2 could restrain the growth of CAL-27 cells, and in a dose-dependent manner; the apoptosis of CAL-27 cells was obviously induced and was time-dependent. Conclusions: Viability of CAL-27 cells was inhibited by Lactobacillus sp. A-2 metabolites; Lactobacillus sp. A-2 metabolites could induce CAL-27 cells apoptosis; study on the bioactive compounds in the Lactobacillus sp. A-2 metabolites and their molecular mechanism is in progress.

  15. 76 FR 70520 - Rovac Corp., RS Group of Companies, Inc., Rymer Foods, Inc. Stratus Services Group, Inc., Sun Cal...

    Science.gov (United States)

    2011-11-14

    ...., Rymer Foods, Inc. Stratus Services Group, Inc., Sun Cal Energy, Inc., Sun Motor International, Inc... current and accurate information concerning the securities of Sun Cal Energy, Inc. because it has not... Sun Motor International, Inc. because it has not filed any periodic reports since the period ended...

  16. Fixed Combination Aerosol Foam Calcipotriene 0.005% (Cal) Plus Betamethasone Dipropionate 0.064% (BD) is More Efficacious than Cal or BD Aerosol Foam Alone for Psoriasis Vulgaris

    Science.gov (United States)

    Tyring, Stephen; Bukhalo, Michael; Alonso-Llamazares, Javier; Olesen, Martin; Lowson, David; Yamauchi, Paul

    2016-01-01

    Objective: To evaluate the efficacy of fixed combination aerosol foam calcipotriene 0.005% (Cal) plus betamethasone dipropionate 0.064% (BD). Design: Patients were randomized (100:101:101) to receive Cal/BD foam, Cal foam, or BD foam once daily for four weeks. Setting: Twenty-eight United States centers. Participants: 302 patients (≥18 years) with Psoriasis vulgaris (plaque Psoriasis; ≥mild disease severity by physicians global assessment). Measurements: Treatment success of the body (“clear”/”almost clear” from baseline moderate/severe disease; “clear” from baseline mild disease). Involved scalp treatment success was an additional endpoint. Results: Most patients (76%) had moderate Psoriasis of the body (66% for scalp). At Week 4, 45 percent of Cal/BD foam patients achieved treatment success, significantly more than Cal foam (14.9%; OR 4.34 [95%CI 2.16,8.72] Pfoam (30.7%; 1.81 [1.00,3.26] P=0.047). Fifty-three percent of Cal/BD foam patients achieved treatment success of the scalp, significantly greater than Cal foam (35.6%; 1.91 [1.09,3.35] P=0.021), but not BD foam (47.5%; 1.24 [0.71,2.16] P=0.45). Mean modified Psoriasis area and severity index (population baseline 7.6) improved in all groups, with statistically significant differences in Week 4 Cal/BD foam score (2.37) versus Cal foam (4.39; mean difference -2.03 [-2.63][-1.43] Pfoam (3.37; -1.19 [-1.80][-0.59] Pfoam was significantly more effective than Cal foam and BD foam in providing treatment success at Week 4 and effective on involved scalp. Trial registration: NCT01536938. PMID:27313822

  17. Study on MPGA-BP of Gravity Dam Deformation Prediction

    Directory of Open Access Journals (Sweden)

    Xiaoyu Wang

    2017-01-01

    Full Text Available Displacement is an important physical quantity of hydraulic structures deformation monitoring, and its prediction accuracy is the premise of ensuring the safe operation. Most existing metaheuristic methods have three problems: (1 falling into local minimum easily, (2 slowing convergence, and (3 the initial value’s sensitivity. Resolving these three problems and improving the prediction accuracy necessitate the application of genetic algorithm-based backpropagation (GA-BP neural network and multiple population genetic algorithm (MPGA. A hybrid multiple population genetic algorithm backpropagation (MPGA-BP neural network algorithm is put forward to optimize deformation prediction from periodic monitoring surveys of hydraulic structures. This hybrid model is employed for analyzing the displacement of a gravity dam in China. The results show the proposed model is superior to an ordinary BP neural network and statistical regression model in the aspect of global search, convergence speed, and prediction accuracy.

  18. Preliminary Geological Findings on the BP-1 Simulant

    Science.gov (United States)

    Stoeser, D. B.; Rickman, D. L.; Wilson, S.

    2010-01-01

    A waste material from an aggregate producing quarry has been used to make an inexpensive lunar simulant called BP-1. The feedstock is the Black Point lava flow in northern Arizona. Although this is part of the San Francisco volcanic field, which is also the source of the JSC-1 series feedstock, BP-1 and JSC-1 are distinct. Chemically, the Black Point flow is an amygdaloidal nepheline-bearing basalt. The amygdules are filled with secondary minerals containing opaline silica, calcium carbonate, and ferric iron minerals. X-ray diffraction (XRD) detected approximately 3% quartz, which is in line with tests done by the Kennedy Space Center Industrial Hygiene Office. Users of this material should use appropriate protective equipment. XRD also showed the presence of significant halite and some bassanite. Both are interpreted to be evaporative residues due to recycling of wash water at the quarry. The size distribution of BP-1 may be superior to some other simulants for some applications.

  19. The location of cemento enamel junction for CAL measurement: A clinical crisis

    Directory of Open Access Journals (Sweden)

    Vandana K

    2009-01-01

    Full Text Available Background: We face various problems while measuring the Clinical attachment level (CAL from Cemento-enamel junction (CEJ. This study aims to record and compare the CEJ location measurements using a xed reference point (FRP [Custom made stent] before and after ap elevation. Materials and Methods: A custom made stent and UNC-15 probe were used. Recording of CEJ location was made using a UNC-15 (Hu-Friedy probe, before (close CEJ and after (Open CEJ the reflection of the flap from the lower edge of the stent in those subjects who were indicated for flap surgery, at baseline. Results: We used statistical analysis involving intra-group comparison done by Paired-′t′ test. The close and the open CEJ measurements demonstrated a, statistically, non-significant difference. The equi-measurements of close and open CEJ numerical data were remarkably lower than the under and overestimation of measurements. Thus, despite certain disadvantages of stent, the FRP provides a simple solution for CAL measurement. Conclusion: The results of this study confirms the objective of the study and strongly suggests that CAL measurements done without FRP is subjected to great variation and the diagnostic and prognostic interpretation of CAL should be viewed seriously in periodontics.

  20. Organic Aerosol Composition and Sources in Pasadena, California during the 2010 CalNex Campaign

    Science.gov (United States)

    Organic aerosols (OA) in Pasadena are characterized using multiple measurements from the California Research at the Nexus of Air Quality and Climate Change (CalNex) campaign. Five OA components are identified using positive matrix factorization including hydrocarbon-like OA (HOA) ...

  1. RELATIONSHIP BETWEEN PHYSICAL ACTIVITIES OF GIRLS AND THEIR PARENTS WITH GIRLS` ATTITUDES PHYSI CAL ACTIVITY

    Directory of Open Access Journals (Sweden)

    Nebojša Čokorilo

    2007-05-01

    Full Text Available The re se arch was con duc ted on the sam ple of 222 pa rents of ele men tary school - girls, aged 6-7 years from No vi Sad, Som bor, Srem ska Mi tro vi ca, Bač ka Pa lan ka and Zre nja nin. Physi cal ac ti vi ti es of ma le chil dren and the ir pa rents we re al so eva lu a ted by the ir pa rents. That is the ti me when chil dren can con sti tu te ha bits for physi cal exer ci ses. Pas si ve at ti tu de of fe ma le chil dren to wards physi cal exer ci ses are the con se qu en ces of the sa me at ti tu des sha red by pa rents. Wit hin re se arch it is fo und out that the re is a hu ge im por tan ce of pa rents’ par ti ci pa tion in chil dren’s ac ti vi ti es. That in clu des how much chil dren are physi cal ac ti ve per we ek.

  2. The impact of BeamCal performance at different international linear ...

    Indian Academy of Sciences (India)

    Abstract. The ILC accelerator parameters and detector concepts are still under discus- sion in the world-wide community. As will be shown, the performance of the BeamCal, the calorimeter in the very forward area of the ILC detector, is very sensitive to the beam parameter and crossing angle choices. We propose here ...

  3. Tests with beam setup of the TileCal Phase-II upgrade electronics

    CERN Document Server

    Hlaluku, Dingane Reward; The ATLAS collaboration

    2017-01-01

    The LHC has planned a series of upgrades culminating in the High Luminosity LHC (HL-LHC) which will have an average luminosity 5-7 times larger than the nominal Run-2 value. The ATLAS Tile Calorimeter (TileCal) will undergo an upgrade to accommodate to the HL-LHC parameters. The TileCal electronics both on- and off-detector will be completely redesigned and a new readout architecture will be adopted. The photomultiplier signals will be digitised and transferred to the TileCal PreProcessors (PPr) located off-detector for every bunch crossing. Then, the PPr will provide preprocessed digital data to the first level trigger with improved spatial granularity and energy resolution with respect to the current analog trigger signals. We plan to insert one TileCal module instrumented with the new electronics in the real detector to evaluate and qualify the new readout and trigger concepts in the overall ATLAS data acquisition system. This new drawer, so-called Hybrid Demonstrator, must provide analog trigger signal fo...

  4. Setup, tests and results for the ATLAS TileCal Read Out Driver production

    CERN Document Server

    Valero, Alberto; Castillo, V; Cuenca, C; Ferrer, A; Fullana, E; González, V; Higón, E; Munar, A; Poveda, J; Ruiz-Martínez, A; Salvachúa, B; Sanchís, E; Solans, C; Soret, J; Torres, J; Valls, J A

    2007-01-01

    In this paper we describe the performance and test results of the production of the 38 ATLAS TileCal Read Out Drivers (RODs). We first describe the basic hardware specifications and firmware functionality of the modules, the test-bench setup used for production and the test procedure to qualify the boards. We then finally show and discuss the performance results.

  5. Windows Calorimeter Control (WinCal) program computer software configuration management plan

    International Nuclear Information System (INIS)

    1997-01-01

    This document describes the system configuration management activities performed in support of the Windows Calorimeter Control (WinCal) system, in accordance with Site procedures based on Institute of Electrical and Electronic Engineers (IEEE) Standard 828-1990, Standard for Software Configuration Management Plans (IEEE 1990) and IEEE Standard 1042-1987, Guide to Software Configuration Management (IEEE 1987)

  6. FoCal – A high granularity electromagnetic calorimeter for forward direct photon measurements

    NARCIS (Netherlands)

    Zhang, C.

    2017-01-01

    The measurement of direct photon production at forward rapidity (y∼3−5) at the LHC provides access to the structure of protons and nuclei at very small values of fractional momentum (x∼10−5). FoCal, an extremely-high-granularity Forward Calorimeter covering 3.3<η<5.3 is proposed as a detector

  7. Cal-Bridge and CAMPARE: Engaging Underrepresented Students in Physics and Astronomy

    Science.gov (United States)

    Rudolph, Alexander L.; Smecker-Hane, Tammy A.; Cal-Bridge Team; CAMPARE Team

    2018-06-01

    We describe two programs, Cal-Bridge and CAMPARE, with the common mission of increasing participation of groups traditionally underrepresented in astronomy, through summer research opportunities, in the case of CAMPARE, scholarships in the case of Cal-Bridge, and significant mentoring in both programs, creating a national impact on their numbers successfully pursuing a PhD in the field. In 9 years, the CAMPARE program has sent 150 students, >80% from underrepresented groups, to conduct summer research at one of 14 major research institutions throughout the country. Of the CAMPARE scholars who have graduated with a Bachelor’s degree, almost two-thirds (65%) have completed or are pursuing graduate education in physics, astronomy, or a related field, at institutions including UCLA, UC Riverside, UC Irvine, UC Santa Barbara, USC, Stanford, Univ. of Arizona, Univ. of Washington, Univ. of Rochester, Michigan State Univ., Georgia Tech, Georgia State Univ., Kent State, Indiana Univ., Univ. of Oregon, Syracuse Univ., Montana State Univ., and the Fisk- Vanderbilt Master’s-to-PhD program. Now in its fourth year, the Cal-Bridge program is a CSU-UC Bridge program comprised of physics and astronomy faculty from 9 University of California (UC), 15 California State University (CSU), and more than 30 California Community College (CCC) campuses throughout California. In the first four years, 34 Cal-Bridge Scholars have been selected, including 22 Hispanic, 3 African-American and 13 women students, 10 of whom are from URM groups. Thirty (30) of the 34 Cal-Bridge Scholars are first generation college students. In the last three years, 17 of 21 Cal-Bridge Scholars have begun or been accepted PhD programs in physics or astronomy at top PhD programs nationally. Three (3) of these scholars have won NSF Graduate Research Fellowships; one more received an Honorable Mention. Once selected, Cal-Bridge Scholars benefit from substantial financial support, intensive, joint mentoring by CSU

  8. Acute Toxicity and Ecological Risk Assessment of Benzophenone-3 (BP-3 and Benzophenone-4 (BP-4 in Ultraviolet (UV-Filters

    Directory of Open Access Journals (Sweden)

    Yang Du

    2017-11-01

    Full Text Available Ultraviolet (UV-absorbing chemicals (UV filters are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3 and benzophenone-4 (BP-4 on Chlorella vulgaris, Daphnia magna, and Brachydanio rerio were analyzed in the present study. The EC50 values (96 h of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris, D. magna, and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10−3 and 0.47 mg/L, respectively, by assessment factor (AF method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.

  9. 200-BP-5 operable unit treatability test report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.

  10. 200-BP-5 operable unit Technical Baseline report

    International Nuclear Information System (INIS)

    Jacques, I.D.; Kent, S.K.

    1991-10-01

    This report supports development of a remedial investigation/feasibility study work plan for the 200-BP-5 operable unit. The report summarizes baseline information for waste sites and unplanned release sites located in the 200-BP-5 operable unit. The sites were investigated by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The investigation consisted of review and evaluation of current and historical Hanford Site reports, drawings, and photographs, and was supplemented with recent inspections of the Hanford Site and employee interviews. No field investigations or sampling were conducted

  11. 200-BP-5 operable unit treatability test report

    International Nuclear Information System (INIS)

    1996-04-01

    The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites

  12. A 3400 year paleolimnological record of prehispanic human–environment interactions in the Holmul region of the southern Maya lowlands

    Science.gov (United States)

    Wahl, David B.; Estrada-Belli, Francisco; Anderson, Lysanna

    2015-01-01

    The timing, magnitude and drivers of late Holocene environmental change in the Holmul region of the southern Maya lowlands are examined by combining paleoenvironmental and archeological data. Environmental proxy analyses on a ~ 3350 cal yr lacustrine sediment record include pollen, charcoal, loss on ignition, magnetic suscep- tibility, and elemental geochemistry. Archeological evidence is derived from extensive settlement surveys conducted near the study site. Results indicate nearby settlement and agricultural activity taking place in an environment characterized by open forest from around 3350 to 950 cal yr BP. The fire history shows a dramatic increase in burning during the Classic period, possibly reflecting changing agricultural strategies. A distinct band of carbonate deposited from 1270 to 1040 cal yr BP suggests decreased hydrologic input associated with drier conditions. Abrupt changes in proxy data around 940 cal yr BP indicate a cessation of human disturbance and local abandonment of the area.

  13. A Novel TetR Family Transcriptional Regulator, CalR3, Negatively Controls Calcimycin Biosynthesis in Streptomyces chartreusis NRRL 3882

    Directory of Open Access Journals (Sweden)

    Lixia Gou

    2017-11-01

    Full Text Available Calcimycin is a unique ionophoric antibiotic that is widely used in biochemical and pharmaceutical applications, but the genetic basis underlying the regulatory mechanisms of calcimycin biosynthesis are unclear. Here, we identified the calR3 gene, which encodes a novel TetR family transcriptional regulator and exerts a negative effect on calcimycin biosynthesis. Disruption of calR3 in Streptomyces chartreusis NRRL 3882 led to significantly increased calcimycin and its intermediate cezomycin. Gene expression analysis showed that the transcription of calR3 and its adjacent calT gene were dramatically enhanced (30- and 171-fold, respectively in GLX26 (ΔcalR3 mutants compared with the wild-type strains. Two CalR3-binding sites within the bidirectional calR3-calT promoter region were identified using a DNase I footprinting assay, indicating that CalR3 directly repressed the transcription of its own gene and the calT gene. In vitro electrophoretic mobility shift assays suggested that both calcimycin and cezomycin can act as CalR3 ligands to induce CalR3 to dissociate from its binding sites. These findings indicate negative feedback for the regulation of CalR3 in calcimycin biosynthesis and suggest that calcimycin production can be improved by manipulating its biosynthetic machinery.

  14. Holocene vegetation change in the northern Peten and its implications for Maya prehistory

    Science.gov (United States)

    Wahl, David; Byrne, Roger; Schreiner, Thomas; Hansen, Richard

    2006-05-01

    An ˜8400 cal yr record of vegetation change from the northern Peten, Guatemala, provides new insights into the environmental history of the archaeological area known as the Mirador Basin. Pollen, loss on ignition, and magnetic susceptibility analyses indicate warm and humid conditions in the early to mid-Holocene. Evidence for a decrease in forest cover around 4600 cal yr B.P. coincides with the first appearance of Zea mays pollen, suggesting that human activity was responsible. The period between 3450 cal yr B.P. and 1000 cal yr B.P. is characterized by a further decline in forest pollen types, includes an abrupt increase in weedy taxa, and exhibits the highest magnetic susceptibility values since the early Holocene, all of which suggest further agricultural disturbance in the watershed. A brief drop in disturbance indicators around 1800 cal yr B.P. may represent the Preclassic abandonment of the area. Changing pollen frequencies around 1000 cal yr B.P. indicate a cessation of human disturbance, which represents the Late Classic collapse of the southern Maya lowlands.

  15. The Liang Bua faunal remains: a 95k.yr. sequence from Flores, East Indonesia.

    Science.gov (United States)

    van den Bergh, G D; Meijer, H J M; Due Awe, Rokhus; Morwood, M J; Szabó, K; van den Hoek Ostende, L W; Sutikna, T; Saptomo, E W; Piper, P J; Dobney, K M

    2009-11-01

    Excavations at Liang Bua, a limestone cave on the island of Flores, East Indonesia, have yielded a well-dated archaeological and faunal sequence spanning the last 95k.yr., major climatic fluctuations, and two human species -H. floresiensis from 95 to 17k.yr.(1), and modern humans from 11k.yr. to the present. The faunal assemblage comprises well-preserved mammal, bird, reptile and mollusc remains, including examples of island gigantism in small mammals and the dwarfing of large taxa. Together with evidence from Early-Middle Pleistocene sites in the Soa Basin, it confirms the long-term isolation, impoverishment, and phylogenetic continuity of the Flores faunal community. The accumulation of Stegodon and Komodo dragon remains at the site in the Pleistocene is attributed to Homo floresiensis, while predatory birds, including an extinct species of owl, were largely responsible for the accumulation of the small vertebrates. The disappearance from the sequence of the two large-bodied, endemic mammals, Stegodon florensis insularis and Homo floresiensis, was associated with a volcanic eruption at 17 ka and precedes the earliest evidence for modern humans, who initiated use of mollusc and shell working, and began to introduce a range of exotic animals to the island. Faunal introductions during the Holocene included the Sulawesi warty pig (Sus celebensis) at about 7ka, followed by the Eurasian pig (Sus scrofa), Long-tailed macaque, Javanese porcupine, and Masked palm civet at about 4ka, and cattle, deer, and horse - possibly by the Portuguese within historic times. The Holocene sequence at the site also documents local faunal extinctions - a result of accelerating human population growth, habitat loss, and over-exploitation.

  16. Robot-assisted Partial Nephrectomy: 5-yr Oncological Outcomes at a Single European Tertiary Cancer Center.

    Science.gov (United States)

    Vartolomei, Mihai Dorin; Matei, Deliu Victor; Renne, Giuseppe; Tringali, Valeria Maria; Crisan, Nicolae; Musi, Gennaro; Mistretta, Francesco Alessandro; Russo, Andrea; Cozzi, Gabriele; Cordima, Giovani; Luzzago, Stefano; Cioffi, Antonio; Di Trapani, Ettore; Catellani, Michele; Delor, Maurizio; Bottero, Danilo; Imbimbo, Ciro; Mirone, Vincenzo; Ferro, Matteo; de Cobelli, Ottavio

    2017-10-27

    Nowadays, there is a debate about which surgical treatment should be best for clinical T1 renal tumors. If the oncological outcomes are considered, there are many open and laparoscopic series published. As far as robotic series are concerned, only a few of them report 5-yr oncological outcomes. The aim of this study was to analyze robot-assisted partial nephrectomy (RAPN) midterm oncological outcomes achieved in a tertiary robotic reference center. Between April 2009 and September 2013, 123 consecutive patients with clinical T1-stage renal masses underwent RAPN in our tertiary cancer center. Inclusion criteria were as follows: pathologically confirmed renal cell carcinomas (RCCs) and follow-up for >12 mo. Eighteen patients were excluded due to follow-up of <12 mo and 15 due to benign final pathology. Median follow-up was 59 mo (interquartile range 44-73 mo). Patients were followed according to guideline recommendations and institutional protocol. Outcomes were measured by time to disease progression, overall survival, or time to cancer-specific death. Kaplan-Meier method was used to estimate survival; log-rank tests were applied for pair-wise comparison of survival. From the 90 patients included, 66 (73.3%) had T1a, 12 (13.3%) T1b, three (3.3%) T2a, and nine (10%) T3a tumors. Predominant histological type was clear cell carcinoma: 67 (74.5%). Fuhrmann grade 1 and 2 was found in 73.3% of all malignant tumors. Two patients (2.2%) had positive surgical margins, and complication rate was 17.8%. Relapse rate was 7.7%, including two cases (2.2%) of local recurrences and five (5.5%) distant metastasis. Five-year disease-free survival was 90.9%, 5-yr cancer-specific survival was 97.5%, and 5-yr overall survival was 95.1%. Midterm oncological outcomes after RAPN for localized RCCs (predominantly T1a tumors of low anatomic complexity) were shown to be good, adding significant evidence to support the oncological efficacy and safety of RAPN for the treatment of this type of

  17. Oceanographic profile data using bottle collected during CalCOFI cruises, North Pacific Ocean, 2015-04 to 2015-11 (NCEI Accession 0162193)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bottle data collected during CalCOFI cruises 1504, 1507, and 1511, April 2015 - November 2015. The California Cooperative Oceanic Fisheries Investigations (CalCOFI)...

  18. Bc→BP,BV Decays with the QCD Factorization Approach

    International Nuclear Information System (INIS)

    Chang, Qin; Wang, Na; Sun, Junfeng; Yang, Yueling

    2015-01-01

    We studied the nonleptonic B c →BP, BV decays with the QCD factorization approach. It is found that the Cabibbo favored processes of B c →B s π, B s ρ, B u K - are the promising decay channels with branching ratio larger than 1%, which should be observed earlier by the LHCb collaboration

  19. EST Table: BP124521 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP124521 epV32477 10/09/28 59 %/164 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  20. EST Table: BP123885 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP123885 epV31590 10/09/28 57 %/174 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  1. EST Table: BP125106 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125106 fbpv0387 10/09/28 58 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/165 aa FBpp0212871|DsimGD14469-PA 10/08/28 n.h 10/09/1

  2. EST Table: BP125521 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125521 fbpv0944 10/09/28 59 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/164 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  3. EST Table: BP125005 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125005 fbpv0197 10/09/28 58 %/185 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 58 %/173 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  4. TopBP1-mediated DNA processing during mitosis.

    Science.gov (United States)

    Gallina, Irene; Christiansen, Signe Korbo; Pedersen, Rune Troelsgaard; Lisby, Michael; Oestergaard, Vibe H

    2016-01-01

    Maintenance of genome integrity is crucial to avoid cancer and other genetic diseases. Thus faced with DNA damage, cells mount a DNA damage response to avoid genome instability. The DNA damage response is partially inhibited during mitosis presumably to avoid erroneous processing of the segregating chromosomes. Yet our recent study shows that TopBP1-mediated DNA processing during mitosis is highly important to reduce transmission of DNA damage to daughter cells. (1) Here we provide an overview of the DNA damage response and DNA repair during mitosis. One role of TopBP1 during mitosis is to stimulate unscheduled DNA synthesis at underreplicated regions. We speculated that such genomic regions are likely to hold stalled replication forks or post-replicative gaps, which become the substrate for DNA synthesis upon entry into mitosis. Thus, we addressed whether the translesion pathways for fork restart or post-replicative gap filling are required for unscheduled DNA synthesis in mitosis. Using genetics in the avian DT40 cell line, we provide evidence that unscheduled DNA synthesis in mitosis does not require the translesion synthesis scaffold factor Rev1 or PCNA ubiquitylation at K164, which serve to recruit translesion polymerases to stalled forks. In line with this finding, translesion polymerase η foci do not colocalize with TopBP1 or FANCD2 in mitosis. Taken together, we conclude that TopBP1 promotes unscheduled DNA synthesis in mitosis independently of the examined translesion polymerases.

  5. EST Table: BP117517 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP117517 ce--0464 10/09/28 63 %/173 aa ref|XP_002092422.1| GE14184 [Drosophila yakuba] gb|EDW92134.1| GE14...184 [Drosophila yakuba] 10/08/28 63 %/173 aa FBpp0259194|DyakGE14184-PA 10/08/28 35 %

  6. EST Table: BP121749 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP121749 ceN-5256 10/09/28 100 %/172 aa ref|NP_001036831.1| saposin-related [Bombyx...|GB16561-PA 10/09/10 44 %/178 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...

  7. EST Table: BP121763 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP121763 ceN-5273 10/09/28 99 %/184 aa ref|NP_001036831.1| saposin-related [Bombyx ...GB16561-PA 10/09/10 43 %/192 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...

  8. Note: Primer Amysat 001; Fragment size is 211bp

    Indian Academy of Sciences (India)

    Renuka

    Bhandara : Lanes 1–14 represent different strains of Bhandara Ecorace. Note: Primer Amysat 001; Fragment size is 211bp. Fig. 1. SSR profiles generated from genomic DNA of 16 strains from different individuals of (A.L, D. TV, D. BV, Modal, Sukinda, Raily, Bhandara) ecoraces of tasar silk worm, Antheraea mylitta using the.

  9. EST Table: BP182610 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP182610 NRPG0829 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 NRPG ...

  10. EST Table: BP121050 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP121050 ceN-4078 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 ceN- ...

  11. PM : Cabinet likely to choose TNK-BP

    Index Scriptorium Estoniae

    2005-01-01

    Tõenäoliselt saab Mazeikiu Nafta aktsiate ostjaks Suurbritannia-Vene ettevõte TNK-BP. Endiselt soovib ka Leedu Jukose osa naftakompaniist osta, kuid selleks raha laenamine võib mõjutada riigi majandust ja üleminekut eurole

  12. Cabinet chooses TNK-BP, but doors remain open

    Index Scriptorium Estoniae

    2005-01-01

    Leedu valitsus alustab Vene-Suurbritannia ühisfirmaga TNK-BP läbirääkimisi Mazeikiu Nafta aktsiaenamuse omandamiseks. Kuid samal ajal on võimalik alustada läbirääkimisi ka teiste võimalike investoritega

  13. Tephrostratigraphic studies on a sediment core from Lake Prespa in the Balkans

    Directory of Open Access Journals (Sweden)

    M. Damaschke

    2013-01-01

    Full Text Available A detailed tephrostratigraphic record, which dates back to Marine Isotope Stage (MIS 5b (ca. 91 kyr, has been established from a 17.76 m long core (Co1215 from Lake Prespa (Macedonia, Albania and Greece. A total of eleven tephra and cryptotephra layers (PT0915-1 to PT0915-11 were identified, using XRF scanning, magnetic susceptibility measurements, and macro- and microscopic inspection of the sediments. The major element composition of glass shards and/or micro-pumice fragments indicates that the tephras and cryptotephras originate from the explosive volcanism of Italy. Eight tephra and cryptotephra layers were correlated with specific volcanic eruptions: the AD 512 eruption of Somma-Vesuvius (1438 cal yr BP, the Mercato eruption of Somma-Vesuvius (8890 ± 90 cal yr BP, the Tufi Biancastri/LN1-LN2 eruption of the Campi Flegrei (14 749 ± 523 cal yr BP and 15 551 ± 621 cal yr BP, the SMP1-e/Y-3 eruption of the Campi Flegrei (30 000–31 000 cal yr BP, the Campanian Ignimbrite/Y-5 eruption of the Campi Flegrei (39 280 ± 110 cal yr BP, the SMP1-a event of Ischia Island (around 44 000 cal yr BP and the Green Tuff/Y-6 eruption of Pantelleria Island (around 45 000 cal yr BP. One tephra could be attributed to the volcanic activity of Mount Etna, but probably represents an unknown eruption at ca. 60 000 cal yr BP. Cryptotephras PT0915-6 and PT0915-10 remain unclassified so far, but according to the presented age-depth model these would have been deposited around 35 000 and 48 500 cal yr BP, respectively. Some of the tephras and cryptotephras are recognised for the first time in the Balkan region. The tephrostratigraphic work provides important information about ash dispersal and explosion patterns of source volcanoes and can be used to correlate and date geographically distant paleoenvironmental and archaeological archives in the central Mediterranean region. Moreover, the tephrostratigraphic work in combination with radiocarbon and electron spin

  14. Treatment of patients with multiple myeloma over 65 yr: more tolerability or better response?

    Science.gov (United States)

    Tarkun, Pinar; Atalay, Figen; Atesoglu, Elif Birtas; Mehtap, Ozgur; Simsek, Melih; Terzi, Esra; Geduk, Ayfer; Balli, Fatih; Batman, Adnan; Baydemir, Canan; Hacihanefioglu, Abdullah

    2015-05-01

    Two-thirds of newly diagnosed patients with multiple myeloma (MM) are over 65 yr and/or physically unfit. Such patients are not eligible for high-dose chemotherapy or stem cell transplantation. The treatment aims in these patients should be to prolong survival by obtaining the best possible response, while maintaining good tolerability. The aim of our study was to evaluate the response to treatment and treatment-related toxicities in patients treated with conventional and novel protocols. The records of 138 elderly (≥65 yr) patients with MM were retrospectively evaluated. The median overall survival(OS) of the patients was 46 months. The median progression-free survival (PFS) was 18 months. The OS and PFS of the patients treated with the conventional protocols did not differ significantly from those treated with the novel protocols. The statistical analysis of the quality of the response to the treatment with the conventional and novel therapies showed that complete remission (CR), combined with a very good partial response (VGPR), was significantly higher in the latter. However, the toxicities were higher in the novel treatment group. The novel drug protocols significantly increased the quality of the responses of elderly patients with MM to therapy, but they did not increase the patients' tolerability. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  15. Adiposity and hypertension associated risk factors in young (<40 yr urban industrial men from Pune, India

    Directory of Open Access Journals (Sweden)

    Amol Prakash Mankar

    2017-09-01

    Full Text Available Background: Prevalence of hypertension is not only on the rise in urban population, but its precedence is of concern. Aims & Objective: To identify risk factors associated with hypertension among urban young Indian males. (<40yr.  Material & Methods: Young males (<40yr working in Hinjewadi industrial area of Pune, Maharashtra were studied (n=254 for anthropometry, blood pressure and diet, lifestyle, and stress at work. Results: Prevalence of overweight was 72.5% and 48.4 % were obese while 38.2% were centrally obese (WC90. Prevalence of hypertension (HTN was high (25.6% and showed significant association only with BMI.  Non vegetarian diet was a risk factor (OR-1.94;p<0.05 for overweight while lifestyle factors increased risk for obesity (OR-2.1;p<0.05 as also central obesity (OR-1.91;p<0.05.  Among subjects with high BMI, these factors became non-significant and stress alone showed independent influence on HTN (OR-4.43; p<0.05 indicating that their influence was mediated through adiposity. Conclusion: Promoting good dietary practices, healthy lifestyle and better work environment for reducing obesity and consequent risk of NCDs among young urban males is essential in India.

  16. Adiposity and hypertension associated risk factors in young (<40 yr urban industrial men from Pune, India

    Directory of Open Access Journals (Sweden)

    Amol Prakash Mankar

    2017-09-01

    Full Text Available Background: Prevalence of hypertension is not only on the rise in urban population, but its precedence is of concern. Aims & Objective: To identify risk factors associated with hypertension among urban young Indian males. (<40yr.  Material & Methods: Young males (<40yr working in Hinjewadi industrial area of Pune, Maharashtra were studied (n=254 for anthropometry, blood pressure and diet, lifestyle, and stress at work. Results: Prevalence of overweight was 72.5% and 48.4 % were obese while 38.2% were centrally obese (WC90. Prevalence of hypertension (HTN was high (25.6% and showed significant association only with BMI.  Non vegetarian diet was a risk factor (OR-1.94;p<0.05 for overweight while lifestyle factors increased risk for obesity (OR-2.1;p<0.05 as also central obesity (OR-1.91;p<0.05.  Among subjects with high BMI, these factors became non-significant and stress alone showed independent influence on HTN (OR-4.43; p<0.05 indicating that their influence was mediated through adiposity. Conclusion: Promoting good dietary practices, healthy lifestyle and better work environment for reducing obesity and consequent risk of NCDs among young urban males is essential in India.

  17. Final Report Feasibility Study for the California Wave Energy Test Center (CalWavesm)

    Energy Technology Data Exchange (ETDEWEB)

    Blakeslee, Samuel Norman [California Polytechnic State Univ. (CalPoly), San Luis Obispo, CA (United States). Inst. for Advanced Technology and Public Policy; Toman, William I. [Protean Wave Energy Ltd., Los Osos, CA (United States); Williams, Richard B. [Leidos Maritime Solutions, Reston, VA (United States); Davy, Douglas M. [CH2M, Sacramento, CA (United States); West, Anna [Kearns and West, Inc., San Francisco, CA (United States); Connet, Randy M. [Omega Power Engineers, LLC, Anaheim, CA (United States); Thompson, Janet [Kearns and West, Inc., San Francisco, CA (United States); Dolan, Dale [California Polytechnic State Univ. (CalPoly), San Luis Obispo, CA (United States); Baltimore, Craig [California Polytechnic State Univ. (CalPoly), San Luis Obispo, CA (United States); Jacobson, Paul [Electric Power Research Inst. (EPRI), Knoxville, TN (United States); Hagerman, George [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Potter, Chris [California Natural Resources Agency, Sacramento, CA (United States); Dooher, Brendan [Pacific Gas and Electric Company, San Francisco, CA (United States); Wendt, Dean [California Polytechnic State Univ. (CalPoly), San Luis Obispo, CA (United States); Sheppard, Colin [Humboldt State Univ., Arcata, CA (United States); Harris, Andrew [Humboldt State Univ., Arcata, CA (United States); Lawson, W. Graham [Power Delivery Consultants, Inc., Albany, NY (United States)

    2017-07-31

    The California Wave Energy Test Center (CalWave) Feasibility Study project was funded over multiple phases by the Department of Energy to perform an interdisciplinary feasibility assessment to analyze the engineering, permitting, and stakeholder requirements to establish an open water, fully energetic, grid connected, wave energy test center off the coast of California for the purposes of advancing U.S. wave energy research, development, and testing capabilities. Work under this grant included wave energy resource characterization, grid impact and interconnection requirements, port infrastructure and maritime industry capability/suitability to accommodate the industry at research, demonstration and commercial scale, and macro and micro siting considerations. CalWave Phase I performed a macro-siting and down-selection process focusing on two potential test sites in California: Humboldt Bay and Vandenberg Air Force Base. This work resulted in the Vandenberg Air Force Base site being chosen as the most favorable site based on a peer reviewed criteria matrix. CalWave Phase II focused on four siting location alternatives along the Vandenberg Air Force Base coastline and culminated with a final siting down-selection. Key outcomes from this work include completion of preliminary engineering and systems integration work, a robust turnkey cost estimate, shoreside and subsea hazards assessment, storm wave analysis, lessons learned reports from several maritime disciplines, test center benchmarking as compared to existing international test sites, analysis of existing applicable environmental literature, the completion of a preliminary regulatory, permitting and licensing roadmap, robust interaction and engagement with state and federal regulatory agency personnel and local stakeholders, and the population of a Draft Federal Energy Regulatory Commission (FERC) Preliminary Application Document (PAD). Analysis of existing offshore oil and gas infrastructure was also performed

  18. Como enfrentar o \\'Fenômeno China\\' na produção de calçados: proposta de estratégia competitiva para a indústria calçadista brasileira.

    OpenAIRE

    Mario Luiz Bimbatti

    2007-01-01

    A competição no mercado internacional com os produtores mundiais, pode ser uma fonte de excelentes oportunidades ou de perigosas armadilhas, como o desafio de difícil solução, representado pelos produtores mundiais de calçados com baixos custos de mão-de-obra, por exemplo, os chineses. A grande maioria dos produtores brasileiros de calçados está estabelecida em clusters, como na Europa os produtores italianos de calçados estão estabelecidos nos \\"distretti\\". Essas concentrações geográficas d...

  19. Synergistic suppression of the PI3K inhibitor CAL-101 with bortezomib on mantle cell lymphoma growth

    International Nuclear Information System (INIS)

    Qu, Fu-Lian; Xia, Bing; Li, Su-Xia; Tian, Chen; Yang, Hong-Liang; Li, Qian; Wang, Ya-Fei; Yu, Yong; Zhang, Yi-Zhuo

    2015-01-01

    To investigate the effects of CAL-101, particularly when combined with bortezomib (BTZ) on mantle cell lymphoma (MCL) cells, and to explore its relative mechanisms. MTT assay was applied to detect the inhibitory effects of different concentrations of CAL-101. MCL cells were divided into four groups: control group, CAL-101 group, BTZ group, and CAL-101/BTZ group. The expression of PI3K-p110σ, AKT, ERK, p-AKT and p-ERK were detected by Western blot. The apoptosis rates of CAL-101 group, BTZ group, and combination group were detected by flow cytometry. The location changes of nuclear factor kappa-B (NF-κB) of 4 groups was investigated by NF-κB Kit exploring. Western blot was applied to detect the levels of caspase-3 and the phosphorylation of AKT in different groups. CAL-101 dose- and time-dependently induced reduction in MCL cell viability. CAL-101 combined with BTZ enhanced the reduction in cell viability and apoptosis. Western blot analysis showed that CAL-101 significantly blocked the PI3K/AKT and ERK signaling pathway in MCL cells. The combination therapy contributed to the inactivation of NF-κB and AKT in MCL cell lines. However, cleaved caspase-3 was up-regulated after combined treatment. Our study showed that PI3K/p110σ is a novel therapeutic target in MCL, and the underlying mechanism could be the blocking of the PI3K/AKT and ERK signaling pathways. These findings provided a basis for clinical evaluation of CAL-101 and a rationale for its application in combination therapy, particularly with BTZ

  20. A marine to freshwater sediment succession from Kowhai Beach wetland, Northland : implications for Holocene sea level

    International Nuclear Information System (INIS)

    Hicks, H.; Nichol, S.L.

    2007-01-01

    An infilled wetland located behind coastal dunes in north-east Northland is used to reconstruct a local history of environmental change spanning early Holocene (c. 7000 yr BP) to modern time. Proxy indicators (sediment texture, diatoms and pollen) provide evidence for a transition from marginal marine- to brackish- to freshwater-conditions in the wetland. Radiocarbon ages constrain the chronology of this succession to 7880-7430 cal. yr BP for the early period of marine conditions, 3570-3210 cal. yr BP for the latter brackish phase and 1060-800 cal. yr BP for the change to freshwater conditions. Within this succession, the diatom record preserves a strong brackish signal at core depths above the limit of the modern tidal range. This is presented as preliminary evidence for a mid-Holocene sea level highstand for northern New Zealand of approximately 1.2 m above present mean sea level. (author). 40 refs., 7 figs., 1 tab

  1. 76 FR 69712 - Application To Export Electric Energy; BP Energy Company

    Science.gov (United States)

    2011-11-09

    ... DEPARTMENT OF ENERGY [OE Docket No. EA-315-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... BP Energy to transmit electric energy from the United States to Canada as a power marketer for a five...

  2. Diseño del sistema para extracción de gases de un horno para cal

    OpenAIRE

    Vega Basurto, Carlos W.; Martinez Lozano, Ernesto Rolando

    2009-01-01

    Esta tesis es realizada en una empresa distribuidora de material no metálico ubicada en la ciudad de Guayaquil en el kilómetro 12 ½ Vía a la costa. Es una planta que tiene dos procesos fundamentales que son obtención de Cal y de procesamiento de áridos (piedra y arena). Este trabajo se enfoca en la parte del proceso de obtención de Cal que tiene una gran demanda en estos momentos en el país. La empresa posee un horno de una capacidad de 80 Toneladas Por Día de Cal pero no logra cubrir to...

  3. An IPMI-compliant control system for the ATLAS TileCal Phase-II Upgrade PreProcessor module

    CERN Document Server

    Zuccarello, Pedro Diego; The ATLAS collaboration

    2016-01-01

    Abstract–The electronics of the hadronic calorimeter of the ATLAS detector (TileCal) is being redesigned as part of the works that will lead to the High Luminosity Large Hadron Collider (HL-LHC). TileCal electronics is divided in front and back-end subsystems. While the front-end is inside the detector, the back-end is located off-detector inserted in an ATCA shelf. The main objective of this paper is to describe the work being carried out in the hardware management aspects of the back-end electronics of TileCal.

  4. A modern documented Italian identified skeletal collection of 2127 skeletons: The CAL Milano Cemetery Skeletal Collection.

    Science.gov (United States)

    Cattaneo, Cristina; Mazzarelli, Debora; Cappella, Annalisa; Castoldi, Elisa; Mattia, Mirko; Poppa, Pasquale; De Angelis, Danilo; Vitello, Antonio; Biehler-Gomez, Lucie

    2018-04-24

    The CAL Milano Cemetery Skeletal Collection is a modern and continuously growing identified osteological collection of 2127 skeletons under study in the Laboratorio di Antropologia e Odontologia Forense (LABANOF) in the Department of Biomedical Sciences for Health of the University of Milan (Italy), and part of the Collezione Antropologica LABANOF (CAL). The collection presents individuals of both sexes and of all age groups with a high representation of elderly and an interesting sample of infants. Each individual is associated with a documentation that includes sex, age-at-death, dates of birth and death, and a death certificate that specifies the exact cause of death and the chain of events that led to it (related pathological conditions or traumatic events). It was also possible to recover for several individuals the autopsy reports and antemortem photographs. Copyright © 2017 Elsevier Ltd and ISBI. All rights reserved.

  5. A qualitative evaluation of UC CalFresh Plan, Shop, Save, Cook curriculum reveals additional outcomes

    Directory of Open Access Journals (Sweden)

    Andra Nicoli

    2016-04-01

    Full Text Available UC ANR Cooperative Extension (UCCE conducted six focus groups in 2013 with CalFresh-eligible adults to determine how to improve the existing evaluation method for the Plan, Shop, Save, Cook nutrition education classes. Focus group participants (n = 54 cited many behavior changes that are captured by the existing method. During the focus groups, changes in cooking practices and types of food purchased emerged as two domains that are not currently captured. A small pilot study conducted on 22 of the 54 focus group participants suggests that using a telephone interview to survey participants is a feasible and practical approach to collect follow-up data on long-term behavior changes. More rigorous follow-up studies may guide the development of policies aimed at increasing diet quality and food security of adult CalFresh participants.

  6. OxCal: versatile tool for developing paleoearthquake chronologies--a primer

    Science.gov (United States)

    Lienkaemper, J.J.; Ramsey, C.B.

    2009-01-01

    Ages of paleoearthquakes (events), i.e., evidence of earthquakes inferred from the geologic record, provide a critical constraint on estimation of the seismic hazard posed by an active fault. The radiocarbon calibration program OxCal (4.0.3 and above; Bronk Ramsey 2007, 2001) provides paleoseismologists with a straightforward but rigorous means of estimating these event ages and their uncertainties. Although initially developed for the chronologic modeling of archaeological data from diverse sources (e.g., radiocarbon, historical knowledge, etc.), OxCal is readily adaptable to other disciplines requiring chronological modeling, such as paleoseismology (Fumal et al. 2002; Lindvall et al. 2002; Kelson et al. 2006; Noriega et al. 2006; Lienkaemper and Williams 2007; Yen et al. 2008).

  7. A PROPOSITO DE UN ENSAYO CON ABONOS (cal y harina de huesos EN ALFALFAl (Medicago sativa

    Directory of Open Access Journals (Sweden)

    Isidoro Mogilner

    1960-01-01

    Full Text Available En este trabajo, los autores estudian el efecto que sobre el rendimiento de la alfalfa (Medicago sativa produce la incorporación de diferentes dosis de cal y harina de huesos, en un suelo pobre de P y Ca; de una textura pesada con alto contenido de arcilla en todos los horizontes, de un pH ácido (5.1 a 6.2 y que es característico de la zona donde fué hecha la experiencia.Se han obtenido resultados referentes a la influencia de la inoculación de la semilla con Rhizobium y el agregado de cal y harina de huesos sobre los rendimientos.

  8. New outburst of the symbiotic nova AG Pegasi after 165 yr

    Science.gov (United States)

    Skopal, A.; Shugarov, S. Yu.; Sekeráš, M.; Wolf, M.; Tarasova, T. N.; Teyssier, F.; Fujii, M.; Guarro, J.; Garde, O.; Graham, K.; Lester, T.; Bouttard, V.; Lemoult, T.; Sollecchia, U.; Montier, J.; Boyd, D.

    2017-08-01

    Context. AG Peg is known as the slowest symbiotic nova, which experienced its nova-like outburst around 1850. After 165 yr, during June of 2015, it erupted again showing characteristics of the Z And-type outburst. Aims: The primary objective is to determine basic characteristics, the nature and type of the 2015 outburst of AG Peg. Methods: We achieved this aim by modelling the spectral energy distribution using low-resolution spectroscopy (330-750 nm; R = 500-1000), medium-resolution spectroscopy (420-720 nm; R 11 000), and UBVRCIC photometry covering the 2015 outburst with a high cadence. Optical observations were complemented with the archival HST and FUSE spectra from the preceding quiescence. Results: During the outburst, the luminosity of the hot component was in the range of 2-11 × 1037 (d/ 0.8 kpc)2 erg s-1, being in correlation with the light curve (LC) profile. To generate the maximum luminosity by the hydrogen burning, the white dwarf (WD) had to accrete at 3 × 10-7 M⊙ yr-1, which exceeds the stable-burning limit and thus led to blowing optically thick wind from the WD. We determined its mass-loss rate to a few × 10-6 M⊙ yr-1. At the high temperature of the ionising source, 1.5-2.3 × 105 K, the wind converted a fraction of the WD's photospheric radiation into the nebular emission that dominated the optical. A one order of magnitude increase of the emission measure, from a few × 1059 (d/ 0.8 kpc)2 cm-3 during quiescence, to a few × 1060 (d/ 0.8 kpc)2 cm-3 during the outburst, caused a 2 mag brightening in the LC, which is classified as the Z And-type of the outburst. Conclusions: The very high nebular emission and the presence of a disk-like H I region encompassing the WD, as indicated by a significant broadening and high flux of the Raman-scattered O vi 6825 Å line during the outburst, is consistent with the ionisation structure of hot components in symbiotic stars during active phases. Full Table 1 and Table 6 are only available at the CDS are

  9. Social complexity in the third millennium cal BC in southern Portugal

    OpenAIRE

    Soares, Joaquina

    2016-01-01

    The starting point of this paper is the extensive archaeological fieldwork developed at the Chalcolithic fortification of Porto das Carretas on the left bank of the Middle Guadiana River (Soares, 2013). The well-preserved stratigraphy and correlated radiocarbon dates of Porto das Carretas enabled a new and deep insight into the third millennium cal BC, displaying environmental, economic and social transformations from the first to the second half of the millenium. Furhermore, the integration ...

  10. Microdeletion/microduplication of proximal 15q11.2 between BP1 and BP2: a susceptibility region for neurological dysfunction including developmental and language delay.

    Science.gov (United States)

    Burnside, Rachel D; Pasion, Romela; Mikhail, Fady M; Carroll, Andrew J; Robin, Nathaniel H; Youngs, Erin L; Gadi, Inder K; Keitges, Elizabeth; Jaswaney, Vikram L; Papenhausen, Peter R; Potluri, Venkateswara R; Risheg, Hiba; Rush, Brooke; Smith, Janice L; Schwartz, Stuart; Tepperberg, James H; Butler, Merlin G

    2011-10-01

    The proximal long arm of chromosome 15 has segmental duplications located at breakpoints BP1-BP5 that mediate the generation of NAHR-related microdeletions and microduplications. The classical Prader-Willi/Angelman syndrome deletion is flanked by either of the proximal BP1 or BP2 breakpoints and the distal BP3 breakpoint. The larger Type I deletions are flanked by BP1 and BP3 in both Prader-Willi and Angelman syndrome subjects. Those with this deletion are reported to have a more severe phenotype than individuals with either Type II deletions (BP2-BP3) or uniparental disomy 15. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes that are not imprinted. Reports of mutations or disturbed expression of these genes appear to impact behavioral and neurological function in affected individuals. Recently, reports of deletions and duplications flanked by BP1 and BP2 suggest an association with speech and motor delays, behavioral problems, seizures, and autism. We present a large cohort of subjects with copy number alteration of BP1 to BP2 with common phenotypic features. These include autism, developmental delay, motor and language delays, and behavioral problems, which were present in both cytogenetic groups. Parental studies demonstrated phenotypically normal carriers in several instances, and mildly affected carriers in others, complicating phenotypic association and/or causality. Possible explanations for these results include reduced penetrance, altered gene dosage on a particular genetic background, or a susceptibility region as reported for other areas of the genome implicated in autism and behavior disturbances.

  11. Validation of the Welch Allyn SureBP (inflation) and StepBP (deflation) algorithms by AAMI standard testing and BHS data analysis.

    Science.gov (United States)

    Alpert, Bruce S

    2011-04-01

    We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.

  12. BP-Mobil partnership. The common network takes place

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    After the partnership between BP and Mobil was signed, the program of transformation of the petrol stations network started in November 1996 in the UK and concern 3300 stations in Europe and 800 stations in France. About 9100 stations will be transformed by the end of 1998. BP France is the operator for petroleum products (petrol, fuel, bitumens, LPG..) with a 70% share holding (30% for Mobil) while Mobil is the major shareholder (51%) for the lubricants and special products activities. The chemical, aviation nd maritime activities are not concerned. Thanks to the fusion of their down-file activities in Europe, the benefits of the partnership should reach 600 to 700 million of US Dollars each year. However the restructuring cost should reach 740 millions of US Dollars in two years, which doubles the initial estimation. Short paper. (J.S.)

  13. Posibilidades estructurales de materiales a base de cal como conglomerante: primeros resultados

    Directory of Open Access Journals (Sweden)

    Estrada, Enrique

    1986-11-01

    Full Text Available Lime is a plentiful material which production combine a very accessible technology with the advantage that it must be prepared in little disperse plants, so that the transport charges can be reduced to the minimum. This work expound the possibility to obtain concretes with structural purposes, for housing of scarce height, of easy obtention, basically from flying ashes or rice husk ashes, varying its proportions and fineness degree and studying the initial and final resistance. Good results have been obtained mainly with rice husk ashes and lime, with 60 days resistance higher than 15 Mpa.La cal es un material abundante y cuya producción suma a una tecnología muy accesible la ventaja de poder materializarse en pequeñas plantas dispersas, para poder reducir al mínimo la componente de costo debida al transporte. En el presente trabajo se ha planteado la posibilidad de obtener hormigones con fines estructurales, para viviendas de baja altura y que sean de fácil obtención, a base de cal y cenizas volantes o cenizas de cascara de arroz, variando sus proporciones, grados de finura y estudiando la influencia de distintos factores en la resistencia inicial y final. Se han obtenido buenos resultados, principalmente con ceniza de cascara de arroz y cal con resistencias a 60 días superiores a los 15 MPa.

  14. A modern documented Italian identified skeletal collection of 2127 skeletons: the CAL Milano Cemetery Skeletal Collection.

    Science.gov (United States)

    Cattaneo, Cristina; Mazzarelli, Debora; Cappella, Annalisa; Castoldi, Elisa; Mattia, Mirko; Poppa, Pasquale; De Angelis, Danilo; Vitello, Antonio; Biehler-Gomez, Lucie

    2018-06-01

    The CAL Milano Cemetery Skeletal Collection is a modern and continuously growing identified osteological collection of 2127 skeletons under study in the Laboratorio di Antropologia e Odontologia Forense (LABANOF) in the Department of Biomedical Sciences for Health of the University of Milan (Italy), and part of the Collezione Antropologica LABANOF (CAL). The collection presents individuals of both sexes and of all age groups with a high representation of the elderly and an interesting sample of infants. Each individual is associated with a documentation that includes sex, age-at-death, dates of birth and death, and a death certificate that specifies the exact cause of death and the chain of events that led to it (related pathological conditions or traumatic events). It was also possible to recover for several individuals the autopsy reports and antemortem photographs. This documented osteological collection is of crucial interest in physical and forensic anthropology: it provides unique teaching opportunities and more importantly considerable research possibilities to test and develop sex and age estimation methods, investigate key subjects of forensic relevance and discuss pathological markers, among others. The aim of this paper is to introduce the CAL Milano Cemetery Skeletal Collection as a new identified skeletal collection and present its research and teaching potential. Copyright © 2018 Elsevier B.V. All rights reserved.

  15. A Mathematica-based CAL matrix-theory tutor for scientists and engineers

    Directory of Open Access Journals (Sweden)

    M. A. Kelmanson

    1993-12-01

    Full Text Available Under the TLTP initiative, the Mathematics Departments at Imperial College and Leeds University are jointly developing a CAL method directed at supplementing the level of mathematics of students entering science and engineering courses from diverse A-level (or equivalent backgrounds. The aim of the joint project is to maintain – even increase - the number of students enrolling on such first-year courses without lowering the courses' existing mathematical standards. A CAL tutor for matrix theory is presented in this paper, in the form of Mathematica Notebooks. This constitutes one of a list of specific A-level mathematics core options required by science and engineering departments. The module has been written so as to recognize students' errors and advise accordingly. Questions are generated randomly, at run time, in order to preclude copying between users. The module incorporates automated performance indicators so as to impinge minimally on existing staff resources. As an aid to other CAL authors considering the use of Mathematica Notebooks, idiosyncratic difficulties encountered within Mathematica Notebooks are catalogued and discussed in detail.

  16. The upgrade of the laser calibration system for the ATLAS hadron calorimeter TileCal

    CERN Document Server

    Spalla, Margherita; The ATLAS collaboration

    2014-01-01

    The Tile Calorimeter (TileCal), the central section of the hadronic calorimeter of the ATLAS experiment, is a key detector component to detect hadrons, jets and taus and to measure the missing transverse energy. TileCal is built of steel and scintillating tiles coupled to optical fibers and read‐out by photomultipliers (PMT). The performance of TileCal relies on a continuous, high resolution calibration of the individual response of the 10,000 channels forming the detector. The calibration is based on a three level architecture: a charge injection system used to monitor the full electronics chain including front-end amplifiers, digitizers and event builder blocks for each individual channel; a distributed optical system using laser pulses to excite all PMTs; and a mobile Cesium radiative source which is driven through the detector cell floating inside a pipe system. This architecture allows for a cascade calibration of the electronics, of the PMT and electronics, and of full chain including the active detec...

  17. CubiCal - Fast radio interferometric calibration suite exploiting complex optimisation

    Science.gov (United States)

    Kenyon, J. S.; Smirnov, O. M.; Grobler, T. L.; Perkins, S. J.

    2018-05-01

    It has recently been shown that radio interferometric gain calibration can be expressed succinctly in the language of complex optimisation. In addition to providing an elegant framework for further development, it exposes properties of the calibration problem which can be exploited to accelerate traditional non-linear least squares solvers such as Gauss-Newton and Levenberg-Marquardt. We extend existing derivations to chains of Jones terms: products of several gains which model different aberrant effects. In doing so, we find that the useful properties found in the single term case still hold. We also develop several specialised solvers which deal with complex gains parameterised by real values. The newly developed solvers have been implemented in a Python package called CubiCal, which uses a combination of Cython, multiprocessing and shared memory to leverage the power of modern hardware. We apply CubiCal to both simulated and real data, and perform both direction-independent and direction-dependent self-calibration. Finally, we present the results of some rudimentary profiling to show that CubiCal is competitive with respect to existing calibration tools such as MeqTrees.

  18. A Full Slice Test Version of a Tentative Upgraded Readout System for TileCal

    CERN Document Server

    Muschter, S; The ATLAS collaboration; Bohm, C; Eriksson, D; Kavianipour, H; Oreglia, M; Tang, F

    2011-01-01

    The upgrade plans on the ATLAS hadronic calorimeter (TileCal) include the full readout of all data to the counting room. In order to study functional requirements of the future upgraded TileCal readout system we have assembled a minimal TDAQ slice. The aim is to implement a tentative readout chain for TileCal, starting with a newly developed 3-in-1 FE-board from University of Chicago and ending with the storage of triggered data on a PC. Later we will use PMT pulses, amplified and shaped by the 3-in-1 board, as a data source. However, for simplicity we start by using well defined calibration pulses also generated by the 3-in-1 board. The pulses are sampled by a 12 bit ADC, which is connected to an ML605 evaluation board from XILINX. These boards emulate the new on-detector electronics. The ML605 communicates via two 5Gb/s optical links with a Virtex-6 FPGA development board from HighTech Global which emulates the off-detector electronics. The off-detector board is situated in a PC and uses PCIe for readout an...

  19. EST Table: BP183868 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP183868 P5PG0462 10/09/28 50 %/126 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 P5PG ...

  20. EST Table: BP126151 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126151 ps4M0084 10/09/28 52 %/232 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 ps4M ...

  1. EST Table: BP182659 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP182659 NRPG0886 10/09/28 51 %/153 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 NRPG ...

  2. Bank Organizational Structure Choice Dilemma. Case of PKO BP

    Directory of Open Access Journals (Sweden)

    Adam Szafarczyk

    2008-06-01

    Full Text Available Organizational structures are differing for different banks. They depend on individual bank economic situation, its technology, strategy and form of competition struggle. Usually the biggest EU banks are consists from formally or really independent divisions. The most common divisions are Retail Banking, Corporate Banking, Treasury and Investment, sometimes Insurance. PKO BP, the biggest Polish Bank, ought to change its structure due to implementation new IT system.

  3. EST Table: BP125370 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 10 56 %/150 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] FS906662 fbpv ... ...n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 55...BP125370 fbpv0758 10/09/28 56 %/150 aa ref|XP_967018.2| PREDICTED: similar to resti

  4. EST Table: BP182152 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP182152 NRPG0186 10/09/28 87 %/125 aa ref|NP_001098702.1| nanos-like protein [Bomb...yx mori] gb|ABS17681.1| nanos-like protein [Bombyx mori] 10/08/29 low homology 10/08/28 n.h 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology NM_001105232 NRPG ...

  5. Isotopic and chemical composition of groundwater in the Bolivian Altiplano, present space evolution records hydrologic conditions since 11,000 Yr

    International Nuclear Information System (INIS)

    Coudrain, A.; Talbi, A.; Loubet, M.; Gallaire, R.; Jusserand, C.; Ramirez, E.; Ledoux, E.

    1999-01-01

    The phreatic aquifer of the central Altiplano shows a Cl concentration that increases from 0.5 meq l -1 upstream to 150 meq l -1 downstream. The main outflow process from the aquifer is the upward flow E into the unsaturated zone associated to evaporation close to soil surface. A relation has been established for any arid zone areas on the base of isotopic profiles: E (mm yr -1 ) = 63 Z -1.5 where Z (m) is the water table depth under soil surface. The aquifer under study may have acquired its high chlorine content during last lacustrine phase (Tauca, 12 ka BP). Arguments for this hypothesis are: (i) maximum level of the lake (3780 m) higher than present soil elevation in the area, (ii) same order of salinity in the paleolake and in the more saline groundwater, (iii) weak molar ratio of Li/Cl in saline groundwater and in the Tauca, (iv) modelling of Cl transport over 11,000 years consistent with observed spatial evolution of Cl in groundwater. To this scenario, might be superimposed the assumption of a delay for the convective transfer of salt towards south by the coupled effects of accumulation of salt in the unsaturated zone by evaporation from the aquifer during thousand or so years, and of the subsequent return of this salt downwards to the aquifer during some short rainy periods. The 87 Sr/ 86 Sr, major and trace element compositions of surface and groundwater support this proposed scenario. (author)

  6. Foreground removal from WMAP 5 yr temperature maps using an MLP neural network

    DEFF Research Database (Denmark)

    Nørgaard-Nielsen, Hans Ulrik

    2010-01-01

    CMB signal makes it essential to minimize the systematic errors in the CMB temperature determinations. Methods. The feasibility of using simple neural networks to extract the CMB signal from detailed simulated data has already been demonstrated. Here, simple neural networks are applied to the WMAP 5...... yr temperature data without using any auxiliary data. Results. A simple multilayer perceptron neural network with two hidden layers provides temperature estimates over more than 75 per cent of the sky with random errors significantly below those previously extracted from these data. Also......, the systematic errors, i.e. errors correlated with the Galactic foregrounds, are very small. Conclusions. With these results the neural network method is well prepared for dealing with the high-quality CMB data from the ESA Planck Surveyor satellite. © ESO, 2010....

  7. BP Canada Energy Company energy efficiency and GHG reduction opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Forsyth, B. [BP Canada Energy Company, Calgary, AB (Canada)

    2004-07-01

    This paper presented an outline of the BP Canada Energy Company's energy efficiency program, which uses an innovative approach that relies on front line operations staff to generate, evaluate and implement ideas for energy reduction projects. An outline of the organization team was presented, with details of the small central Calgary group responsible for coordination, technical support and tracking of data. Key objectives of the team were identified as: the promotion of energy efficiency; sharing of best practices; and coordination of efforts at operations at both the development and corporate level. An outline of BP upstream operations and emissions reduction strategies was provided along with a timeline of BP Canada greenhouse gas (GHG) emissions and sustainable reductions projects. A chart representing energy savings through conversion to natural gas was also presented, sorted by project type. Results included over 400 GHG or energy reduction projects completed, with an average pay out of 30 months as well as 300,000 tonnes equivalent of GHGs reduced at an estimated value of of $13,000,000. Areas of focus for future projects include: compression; fired equipment; flaring; venting; and fugitive emissions. Strategies to reduce emissions in all areas of future research were also provided. tabs, figs.

  8. Temperature changes of the past 2000 yr in China and comparison with Northern Hemisphere

    Science.gov (United States)

    Ge, Q.; Hao, Z.; Zheng, J.; Shao, X.

    2013-01-01

    In this paper, we use principal components and partial least squares regression analysis to reconstruct a composite profile of temperature variations in China, and the associated uncertainties, at a decadal resolution over the past 2000 yr. Our aim is to contribute a new temperature time series to the paleoclimatic strand of the Asia2K working group, which is part of the PAGES (Past Global Changes) project. The reconstruction was developed using proxy temperature data, with relatively high confidence levels, from five locations across China, and an observed temperature dataset provided by Chinese Meteorological Administration covering the decades from the 1870s to the 1990s. Relative to the 1870s-1990s climatology, our two reconstructions both show three warm intervals during the 270s-390s, 1080s-1210s, and after the 1920s; temperatures in the 260s-400s, 560s-730s and 970s-1250s were comparable with those of the Present Warm Period. Temperature variations over China are typically in phase with those of the Northern Hemisphere (NH) after 1100, a period which covers the Medieval Climate Anomaly, Little Ice Age, and Present Warm Period. The recent rapid warming trend that developed between the 1840s and the 1930s occurred at a rate of 0.91° C/100 yr. The temperature difference between the cold spell (-0.74° C in the 1650s) during the Little Ice Age, and the warm peak of the Present Warm Period (0.08° C in the 1990s) is 0.82° C at a centennial time scale.

  9. Constraints on primary and secondary particulate carbon sources using chemical tracer and 14C methods during CalNex-Bakersfield

    Data.gov (United States)

    U.S. Environmental Protection Agency — The present study investigates primary and secondary sources of organic carbon for Bakersfield, CA, USA as part of the 2010 CalNex study. The method used here...

  10. CAMPARE and Cal-Bridge: Two Institutional Networks Increasing Diversity in Astronomy

    Science.gov (United States)

    Rudolph, Alexander L.; Impey, Chris David; Phillips, Cynthia B.; Povich, Matthew S.; Prather, Edward E.; Smecker-Hane, Tammy A.

    2015-01-01

    We describe two programs, CAMPARE and Cal-Bridge, with the common mission of increasing participation of groups traditionally underrepresented in astronomy, particularly underrepresented minorities and women, through summer research opportunities, in the case of CAMPARE, scholarships in the case of Cal-Bridge, and significant mentoring in both programs, leading to an increase in their numbers successfully pursuing a PhD in the field.CAMPARE is an innovative REU-like summer research program, currently in its sixth year, comprising a network of comprehensive universities and community colleges in Southern California and Arizona (most of which are minority serving institutions), and ten major research institutions (University of Arizona Steward Observatory, the SETI Institute, JPL, Caltech, and the five Southern California UC campuses, UCLA, UCI, UCSD, UCR, and UCSB).In its first five summers, CAMPARE sent a total of 49 students from 10 different CSU and community college campuses to 5 research sites of the program. Of these 49 participants, 25 are women and 24 are men; 22 are Hispanic, 4 are African American, and 1 is Native American, including 6 female Hispanic and 2 female African-American participants. Twenty-one (21) CAMPARE participants have graduated from college, and more than half (11) have attended or are attending a graduate program, including 8 enrolled in PhD or Master's-to-PhD programs. Over twenty CAMPARE students have presented at the AAS and other national meetings.The Cal-Bridge program is a diverse network of higher education institutions in Southern California, including 5 UC campuses, 8 CSU campuses, and 7 community colleges dedicated to the goal of increasing the number of underrepresented minority and female students attending graduate school in astronomy or related fields. We have recently selected our inaugural group of five 2014 Cal-Bridge Scholars, including four women (two Hispanic and one part Native American), and one Hispanic man

  11. Antarctic Surface Reflectivity Measurements from the ANITA-3 and HiCal-1 Experiments

    Science.gov (United States)

    Gorham, P. W.; Allison, P.; Banerjee, O.; Beatty, J. J.; Belov, K.; Besson, D. Z.; Binns, W. R.; Bugaev, V.; Cao, P.; Chen, C.; Chen, P.; Clem, J. M.; Connolly, A.; Dailey, B.; Dasgupta, P.; Deaconu, C.; Cremonesi, L.; Dowkontt, P. F.; Fox, B. D.; Gordon, J.; Hill, B.; Hupe, R.; Israel, M. H.; Jain, P.; Kowalski, J.; Lam, J.; Learned, J. G.; Liewer, K. M.; Liu, T. C.; Matsuno, S.; Miki, C.; Mottram, M.; Mulrey, K.; Nam, J.; Nichol, R. J.; Novikov, A.; Oberla, E.; Prohira, S.; Rauch, B. F.; Romero-Wolf, A.; Rotter, B.; Ratzlaff, K.; Russell, J.; Saltzberg, D.; Seckel, D.; Schoorlemmer, H.; Stafford, S.; Stockham, J.; Stockham, M.; Strutt, B.; Tatem, K.; Varner, G. S.; Vieregg, A. G.; Wissel, S. A.; Wu, F.; Young, R.

    The primary science goal of the NASA-sponsored ANITA project is measurement of ultra-high energy neutrinos and cosmic rays, observed via radio-frequency signals resulting from a neutrino or cosmic ray interaction with terrestrial matter (e.g. atmospheric or ice molecules). Accurate inference of the energies of these cosmic rays requires understanding the transmission/reflection of radio wave signals across the ice-air boundary. Satellite-based measurements of Antarctic surface reflectivity, using a co-located transmitter and receiver, have been performed more-or-less continuously for the last few decades. Our comparison of four different reflectivity surveys, at frequencies ranging from 2 to 45GHz and at near-normal incidence, yield generally consistent maps of high versus low reflectivity, as a function of location, across Antarctica. Using the Sun as an RF source, and the ANITA-3 balloon borne radio-frequency antenna array as the RF receiver, we have also measured the surface reflectivity over the interval 200-1000MHz, at elevation angles of 12-30∘. Consistent with our previous measurement using ANITA-2, we find good agreement, within systematic errors (dominated by antenna beam width uncertainties) and across Antarctica, with the expected reflectivity as prescribed by the Fresnel equations. To probe low incidence angles, inaccessible to the Antarctic Solar technique and not probed by previous satellite surveys, a novel experimental approach (“HiCal-1”) was devised. Unlike previous measurements, HiCal-ANITA constitute a bi-static transmitter-receiver pair separated by hundreds of kilometers. Data taken with HiCal, between 200 and 600MHz shows a significant departure from the Fresnel equations, constant with frequency over that band, with the deficit increasing with obliquity of incidence, which we attribute to the combined effects of possible surface roughness, surface grain effects, radar clutter and/or shadowing of the reflection zone due to Earth

  12. Non-weight-bearing status compromises the functional level up to 1 yr after hip fracture surgery

    DEFF Research Database (Denmark)

    Ariza-Vega, Patrocinio; Jiménez-Moleón, José Juan; Kristensen, Morten Tange

    2014-01-01

    , age, health status, and cognitive impairment of the patient were associated negatively with the 1-yr functional outcome (P ≤ 0.03). Prefracture functional level and non-WB status were the strongest determinants of functional level (β = 0.599 and -0.204, respectively; P ... after surgery, in addition to prefracture function, cognitive status, health status, age and fracture type, was found to be an independent predictor of the 1-yr functional outcome in hip fracture patients....

  13. Climate change and human occupations in the Lake Daihai basin, north-central China over the last 4500 years: A geo-archeological perspective

    Science.gov (United States)

    Xu, Lichen; Liu, Yan; Sun, Qianli; Chen, Jing; Cheng, Peng; Chen, Zhongyuan

    2017-05-01

    High-resolution climate variations since the last 4500 years in the monsoonal-arid transition zone of north-central China were revealed through the integration of proxies from sediment cores in the Lake Daihai basin. Human occupations in the lake basin deduced from archeological findings and historical literatures were then incorporated into the climate sequence to demonstrate the patterns of human responses to the climate changes, and the recent anthropogenic effects. It indicated that: (1) Climate dominated human-environment adaptations prevailed prior to ∼2700 cal yr BP. An amicable climate setting before ∼4100 cal yr BP would facilitate the growth of the Laohushan Culture (LC) in the lake basin, while a pronounced deterioration of water thermal condition after that had led to human exodus and the collapse of the LC. The reduced human activity in the lake basin indicated at ∼3800-3500 cal yr BP and a subsequent cultural blank at ∼3500-2700 cal yr BP, were both in response to the climate and lake level fluctuations during ∼3800-2800 cal yr BP. (2) Transition to a positive human adaptation was seen at ∼2700-1100 cal yr BP, represented by the exploitation of arable land for cultivation and animal husbandry as the lake contracted. (3) An increasing human presence that affected environmental processes became more severe over the last ∼1100 cal yr BP. This was basically due to the ongoing lake shore reclamation for cropping, and more recently heavy metals emissions from fossil fuel combustion and local industries.

  14. Depositional Architecture of Late Pleistocene-Holocene Coastal Alluvial-fan System in the Coastal Range, Taiwan

    Science.gov (United States)

    Chen, S. T.; Chen, W. S.

    2016-12-01

    Since late Pleistocene, the Coastal Range (Philippine Sea plate) collided and overridden on the Central Range (Eurasian Plate) along the Longitudinal Valley Fault. Therefore, the Coastal Range is exposed widely the late Pleistocene-Holocene marine and fluvial terraces caused by the tectonic uplift. Based on the estimation of paleosea-level elevations (Δh), depositional paleodepth, altitude distribution of Holocene deposits (D), altitude of outcrops (H), and 14C dating of marine deposits (t), the uplift rate (=(Δh+H +d-D)/t) is about 5-10 mm/yr in the southern Coastal Range. In this study, we suggest through field logging that the deposits can be divided into alluvial, foreshore (intertidal), shoreface, and offshore environments. In Dulan area in the southern Coastal Range, the uplift rate was 6-7 mm/yr during 16,380-10,000 cal yr BP and 3-4 mm/yr after 7,000 cal yr BP. Results from the Dulan Coastal alluvial-fan system can be divided into five depositional stages: (1) 16,380-14,300 cal yr BP: The rate of global sea level rise (SLR) has averaged about 6-7 mm/yr, similar to the tectonic uplift rate. In this stage, the bedrock was eroded and formed a wide wave-cut platform. (2) 14,300-10,000 cal yr BP: SLR of about 14 mm/yr that was faster than tectonic uplift rate of 6-7 mm/yr. As a result of transgression, the beach-lagoon deposits about 5 m thick were unconformably overlain on the wave-cut platform. (3) 10,000-8,200 cal yr BP: The ongoing sea level rise (SLR: 11 mm/yr), the lagoon deposits were overlain by an offshore slump deposits representing a gradual deepening of the depositional environment. (4) 8,200-7,930 cal yr BP (SLR: 6-7 mm/yr): The tectonic uplift rate may occur at similar SLR. The alluvial-fan deposits have prograded over the shallow marine deposits. (5) After 7,000 cal yr BP (SLR: 1-0 mm/yr): SLR was much slower than tectonic uplift rate of 3-4 mm/yr. Thus, Holocene marine terraces are extensively developed in the coastal region, showing that the

  15. Decreasing pH trend estimated from 25-yr time series of carbonate parameters in the western North Pacific

    Energy Technology Data Exchange (ETDEWEB)

    Midorikawa, Takashi; Ishii, Masao; Sasano, Daisuke; Kosugi, Naohiro (Geochemical Research Dept., Meteorological Research Institute Tsukuba (Japan)), e-mail: midorika@mri-jma.go.jp; Saito, Shu (Geochemical Research Dept., Meteorological Research Institute, Tsukuba (Japan); Institute of Observational Research for Global Change (IORGC), Japan Agency for Marine-Earth Science and Technology (JAMSTEC), Yokosuka (Japan)); Motoi, Tatsuo (Oceanographic Research Dept., Meteorological Research Institute, Tsukuba (Japan)); Kamiya, Hitomi; Nakadate, Akira; Nemoto, Kazuhiro (Global Environment and Marine Dept., Japan Meteorological Agency, Tokyo (Japan)); Inoue, Hisayuki Y. (Graduate School of Environmental Earth Science, Hokkaido Univ., Sapporo (Japan))

    2010-11-15

    We estimated long-term trends of ocean acidification in surface waters in latitudinal zones from 3 deg N to 33 deg N along the repeat hydrographic line at 137 deg E in the western North Pacific Ocean. Estimates were based on the observational records of oceanic CO{sub 2} partial pressure and related surface properties over the last two decades. The computed pH time series both for 25 yr in winter (late January to early February) and for 21 yr in summer (June-July) exhibited significant decreasing trends in the extensive subtropical to equatorial zones, with interannual variations that were larger in summer. The calculated rates of pH decrease ranged from 0.0015 to 0.0021 yr-1 (average, 0.0018 +- 0.0002 yr-1) in winter and from 0.0008 to 0.0019 yr-1 (average, 0.0013 +- 0.0005 yr-1 ) in summer. The thermodynamic effects of rising sea surface temperature (SST) accounted for up to 44% (average, 15%) of the trend of pH decrease in the subtropical region in winter, whereas a trend of decreasing SST slowed the pH decrease in the northern subtropical region (around 25 deg N) in summer. We used the results from recent trends to evaluate future possible thermodynamic changes in the upper ocean carbonate system

  16. Crystallization and Preliminary Diffraction Analysis of the CAL PDZ Domain in Complex with a Selective Peptide Inhibitor

    Energy Technology Data Exchange (ETDEWEB)

    J Amacher; P Cushing; J Weiner; D Madden

    2011-12-31

    Cystic fibrosis (CF) is associated with loss-of-function mutations in the CF transmembrane conductance regulator (CFTR), which regulates epithelial fluid and ion homeostasis. The CFTR cytoplasmic C-terminus interacts with a number of PDZ (PSD-95/Dlg/ZO-1) proteins that modulate its intracellular trafficking and chloride-channel activity. Among these, the CFTR-associated ligand (CAL) has a negative effect on apical-membrane expression levels of the most common disease-associated mutant {Delta}F508-CFTR, making CAL a candidate target for the treatment of CF. A selective peptide inhibitor of the CAL PDZ domain (iCAL36) has recently been developed and shown to stabilize apical expression of {Delta}F508-CFTR, enhancing net chloride-channel activity, both alone and in combination with the folding corrector corr-4a. As a basis for structural studies of the CAL-iCAL36 interaction, a purification protocol has been developed that increases the oligomeric homogeneity of the protein. Here, the cocrystallization of the complex in space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 35.9, b = 47.7, c = 97.3 {angstrom}, is reported. The crystals diffracted to 1.4 {angstrom} resolution. Based on the calculated Matthews coefficient (1.96 {angstrom}{sup 3} Da{sup -1}), it appears that the asymmetric unit contains two complexes.

  17. AcEST: BP911457 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D K YR G++ + N +G Sbjct: 192 WLKPEGFPHQEIRQYSLTRKPDGKGYRIAVKREEGGQVSNWLHNHANVG 240 >sp|Q5TIS6|NOTO_MOUSE Homeobox protein notochord...=h... 32 2.1 sp|Q7ABK6|HMP_ECO57 Flavohemoprotein OS=Escherichia coli O157:H7... 32 2.1 sp|Q5TIS6|NOTO_MOUSE Homeobox protein notocho...rd OS=Mus musculus ... 31 2.8 sp|Q9BYQ7|KRA41_HUMAN Kera

  18. Feasibility study report for the 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1993-06-01

    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9x10 -5

  19. Feasibility study report for the 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1994-01-01

    This feasibility study (FS) examines a range of alternatives and provides recommendations for selecting a preferred altemative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965-1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-:levels of contamination with cesium-137, radium-226, strontium-90, thorium-228 and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9 x 10 5

  20. Feasibility study report for the 200-BP-1 operable unit

    Energy Technology Data Exchange (ETDEWEB)

    1993-06-01

    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9{times}10{sup {minus}5}.

  1. BP and sustainable development and biodiversity in Azerbaijan

    International Nuclear Information System (INIS)

    Grant, Vidrine; Askerov, Faig

    2002-01-01

    Full text: BP takes its commitment to the environmental extremely seriously. BP believes it is essential to ensure that our operations and activities comply with the environmental standards in our PSAs and with the laws of Azerbaijan. To achieve this we have developed Environmental Operating Procedures. These procedures are currently being audited and we expect to receive ISO 14001 certification for all of our operations. Together with our Emergency Response and Oil Spill Response Plans we are able to manage our operations to ensure minimum impact and regulatory compliance. Additional, AIOC contributed to opening the Caspian Environmental Laboratory in 1999 to provide on a commercial basis, environmental services in Azerbaijan of an internationally recognized standard. We have conducted many other activities to promote biodiversity. In absence of the appropriate infrastructure we have built a waste management site at Serenja where we are currently disposing of synthetic based muds from our offshore drilling operations. We have also developed and implemented a Research and Monitoring Program in co-operation with representatives from SOCAR, Academy of Sciences, Azgipromorneftegaz and State Committee of Ecology. We have conducted Seals mortality investigation, Birds monitoring, Fish monitoring, Offshore surveys studying macrobenthos, water chemistry, sediments, groundwater monitoring, re-vegetation, etc. In developing our overall strategy BP has set some long term environmental aspirations or expectations: stop the use of halocarbons; to reduce Green House Gases by 10% by 20 lOin comparison with baseline data for 1990; stop venting and flaring; stop discharges to water of synthetic and oil based muds. BP recognizes that this is a goal. It is something we commit to and aspire to achieve and something we are wise enough to realize cannot be achieved overnight. None-the-less, it is something we constantly work towards. We also realize that this goal cannot be achieved in

  2. Risk assessment of logistics outsourcing based on BP neural network

    Science.gov (United States)

    Liu, Xiaofeng; Tian, Zi-you

    The purpose of this article is to evaluate the risk of the enterprises logistics outsourcing. To get this goal, the paper first analysed he main risks existing in the logistics outsourcing, and then set up a risk evaluation index system of the logistics outsourcing; second applied BP neural network into the logistics outsourcing risk evaluation and used MATLAB to the simulation. It proved that the network error is small and has strong practicability. And this method can be used by enterprises to evaluate the risks of logistics outsourcing.

  3. EST Table: BP183486 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 56...43 aa gnl|Amel|GB30360-PB 10/09/10 54 %/174 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expres...sed intermediate filament-associated protein) [Tribolium castaneum] FS906662 NRPG ... ...BP183486 NRPG1970 10/09/28 54 %/174 aa ref|XP_967018.2| PREDICTED: similar to resti

  4. Regulation of salt marsh mosquito populations by the 18.6-yr lunar-nodal cycle.

    Science.gov (United States)

    Rochlin, Ilia; Morris, James T

    2017-08-01

    The 18.6-yr lunar-nodal cycle drives changes in tidal amplitude globally, affecting coastal habitat formation, species and communities inhabiting rocky shores, and salt marsh vegetation. However, the cycle's influence on salt marsh fauna lacked sufficient long-term data for testing its effect. We circumvented this problem by using salt marsh mosquito records obtained over a period of over four decades in two estuaries in the northeastern USA. Salt marsh mosquito habitat is near the highest tide level where the impact of the nodal cycle on flood frequency is greatest. Wavelet spectral and cross-correlation analyses revealed periodicity in salt marsh mosquito abundance that was negatively correlated with tidal amplitude. Tidal amplitude was a significant predictor of salt marsh mosquito abundance with the cycle maxima coinciding with lower mosquito populations, possibly due to access by predatory fish. However, these effects were detected only at the location with extensive salt marsh habitat and astronomical tides and were weakened or lacked significance at the location with small microtidal salt marshes and wind-driven tides. Mosquitoes can serve as proxy indicators for numerous invertebrate species on the salt marsh. These predictable cycles and their effects need to be taken into consideration when investigating, restoring, or managing intertidal communities that are also facing sea-level rise. © 2017 by the Ecological Society of America.

  5. CLARA-SAL: a global 28 yr timeseries of Earth's black-sky surface albedo

    Directory of Open Access Journals (Sweden)

    A. Riihelä

    2013-04-01

    Full Text Available We present a novel 28 yr dataset of Earth's black-sky surface albedo, derived from AVHRR instruments. The dataset is created using algorithms to separately derive the surface albedo for different land use areas globally. Snow, sea ice, open water and vegetation are all treated independently. The product features corrections for the atmospheric effect in satellite-observed surface radiances, a BRDF correction for the anisotropic reflectance properties of natural surfaces, and a novel topography correction of geolocation and radiometric accuracy of surface reflectance observations over mountainous areas. The dataset is based on a homogenized AVHRR radiance timeseries. The product is validated against quality-controlled in situ observations of clear-sky surface albedo at various BSRN sites around the world. Snow and ice albedo retrieval validation is given particular attention using BSRN sites over Antarctica, Greenland Climate Network stations on the Greenland Ice Sheet (GrIS, as well as sea ice albedo data from the SHEBA and Tara expeditions. The product quality is found to be comparable to other previous long-term surface albedo datasets from AVHRR.

  6. Foreground removal from WMAP 5 yr temperature maps using an MLP neural network

    Science.gov (United States)

    Nørgaard-Nielsen, H. U.

    2010-09-01

    Aims: One of the main obstacles for extracting the cosmic microwave background (CMB) signal from observations in the mm/sub-mm range is the foreground contamination by emission from Galactic component: mainly synchrotron, free-free, and thermal dust emission. The statistical nature of the intrinsic CMB signal makes it essential to minimize the systematic errors in the CMB temperature determinations. Methods: The feasibility of using simple neural networks to extract the CMB signal from detailed simulated data has already been demonstrated. Here, simple neural networks are applied to the WMAP 5 yr temperature data without using any auxiliary data. Results: A simple multilayer perceptron neural network with two hidden layers provides temperature estimates over more than 75 per cent of the sky with random errors significantly below those previously extracted from these data. Also, the systematic errors, i.e. errors correlated with the Galactic foregrounds, are very small. Conclusions: With these results the neural network method is well prepared for dealing with the high - quality CMB data from the ESA Planck Surveyor satellite. unknown author type, collab

  7. PENGARUH FAKTOR PSIKOLOGIS TERHADAP KEPUTUSAN BERKUNJUNG WISATAWAN MICE MELALUI PT. Y&R KE BALI

    Directory of Open Access Journals (Sweden)

    Ni Putu Masni Nistari

    2017-01-01

    Full Text Available Tourism is a global industry sectors and potentially to be developed as a source of government income countries and regions. MICE (Meeting, Incentive, Convention and Exhibition in Indonesia has great potential and is the flagship product of the tourism industry Indonesia. The purpose of this research is to determine the influence of psychological factors toward MICE tourists visiting decision to Bali through PT. Y&R. Sampling technique used in this research is purposive sampling. Samples are 100 respondents and sampling method is accidental sampling. Test instrument used are validity, reliability and test the classical assumption of normality test, multicollinearity, and heteroscedasticity test. Data were analyzed using multiple linear regression analysis. The results of hypothesis testing psychological factor partially and simultaneously the t test and F test is a significant effect and positive value to the decision of MICE tourists visited through PT. Y & R to Bali. Based on the analysis of multiple test showed that psychological factors have a positive coefficient values consisting of motivation (X1 of 0.216, perception (X2 is 0.298, learning (X3 of 0.370, beliefs and attitudes (X4 of 0.212 against the decision to visit. Value Adjusted R Square of 0.610 or 61.0% of decision variables been influenced by psychological factors, while 39.0% describe by other causes beyond the variables studied.

  8. Resolving an 80-yr-old controversy: the beginning of the modern era of renal physiology.

    Science.gov (United States)

    Jamison, Rex L

    2014-12-01

    Marcello Malpighi discovered the glomerulus that bears his name in the 17th century, but it was not until the middle of the 19th century, in 1842, that William Bowman in London published his studies of the histological structure of the glomerulus and proposed that urine formation begins with glomerular secretion. At nearly the same time in Marburg, Carl Ludwig, unaware of Bowman's findings, proposed that urine formation begins with glomerular filtration followed by tubule reabsorption. The controversy lasted 80 yr. Prominent investigators weighed in on both sides. Rudolph Heidenhain's findings in 1874 swung the pendulum toward Bowman's theory until Arthur Cushny published his book, The Secretion of Urine, in 1917, in which he found the evidence insufficient to prove either theory. In 1921, a young physician, Joseph Wearn, began his postresidency training in the laboratory of Alfred N. Richards. He read Cushny's book and learned how to expose the glomerulus of a living frog. Richards proposed that Wearn use that experimental preparation to inject epinephrine into the glomerulus. Wearn proposed a different experiment: instead of using injection, collect fluid from the glomerulus and analyze it. Richards agreed, and the landmark results of that experiment, published in 1924, settled the controversy. The modern era of renal physiology was born. Copyright © 2014 The American Physiological Society.

  9. Assembly of human C-terminal binding protein (CtBP) into tetramers.

    Science.gov (United States)

    Bellesis, Andrew G; Jecrois, Anne M; Hayes, Janelle A; Schiffer, Celia A; Royer, William E

    2018-06-08

    C-terminal binding protein 1 (CtBP1) and CtBP2 are transcriptional coregulators that repress numerous cellular processes, such as apoptosis, by binding transcription factors and recruiting chromatin-remodeling enzymes to gene promoters. The NAD(H)-linked oligomerization of human CtBP is coupled to its co-transcriptional activity, which is implicated in cancer progression. However, the biologically relevant level of CtBP assembly has not been firmly established; nor has the stereochemical arrangement of the subunits above that of a dimer. Here, multi-angle light scattering (MALS) data established the NAD + - and NADH-dependent assembly of CtBP1 and CtBP2 into tetramers. An examination of subunit interactions within CtBP1 and CtBP2 crystal lattices revealed that both share a very similar tetrameric arrangement resulting from assembly of two dimeric pairs, with specific interactions probably being sensitive to NAD(H) binding. Creating a series of mutants of both CtBP1 and CtBP2, we tested the hypothesis that the crystallographically observed interdimer pairing stabilizes the solution tetramer. MALS data confirmed that these mutants disrupt both CtBP1 and CtBP2 tetramers, with the dimer generally remaining intact, providing the first stereochemical models for tetrameric assemblies of CtBP1 and CtBP2. The crystal structure of a subtle destabilizing mutant suggested that small structural perturbations of the hinge region linking the substrate- and NAD-binding domains are sufficient to weaken the CtBP1 tetramer. These results strongly suggest that the tetramer is important in CtBP function, and the series of CtBP mutants reported here can be used to investigate the physiological role of the tetramer. © 2018 Bellesis et al.

  10. CalTOX, a multimedia total exposure model for hazardous-waste sites

    International Nuclear Information System (INIS)

    McKone, T.E.

    1993-06-01

    CalTOX has been developed as a spreadsheet model to assist in health-risk assessments that address contaminated soils and the contamination of adjacent air, surface water, sediments, and ground water. The modeling effort includes a multimedia transport and transformation model, exposure scenario models, and efforts to quantify and reduce uncertainty in multimedia, multiple-pathway exposure models. This report provides an overview of the CalTOX model components, lists the objectives of the model, describes the philosophy under which the model was developed, identifies the chemical classes for which the model can be used, and describes critical sensitivities and uncertainties. The multimedia transport and transformation model is a dynamic model that can be used to assess time-varying concentrations of contaminants introduced initially to soil layers or for contaminants released continuously to air or water. This model assists the user in examining how chemical and landscape properties impact both the ultimate route and quantity of human contact. Multimedia, multiple pathway exposure models are used in the CalTOX model to estimate average daily potential doses within a human population in the vicinity of a hazardous substances release site. The exposure models encompass twenty-three exposure pathways. The exposure assessment process consists of relating contaminant concentrations in the multimedia model compartments to contaminant concentrations in the media with which a human population has contact (personal air, tap water, foods, household dusts soils, etc.). The average daily dose is the product of the exposure concentrations in these contact media and an intake or uptake factor that relates the concentrations to the distributions of potential dose within the population

  11. Cal/Val activities for DubaiSat-2 performance assessment

    Science.gov (United States)

    Bushahab, A.; Al-Mansoori, S.; Al-Suwaidi, K.; Al Matroushi, Hessa; Al-Tunaiji, E.; Al Shamsi, Meera

    2014-10-01

    Emirates Institution for Advanced Science and Technology (EIAST) was established by the Dubai Government in 2006. After three years of working together with Satrec Initiative (South Korea), EIAST was able to launch DubaiSat-1 on the 29th of July 2009. Building on the success of DubaiSat-1 and the roll out of the knowledge transfer program, UAE engineers were involved in almost 70% of the total build and design of DubaiSat-2. Targeting the commercial market, DubaiSat-2 was launched on the 21st of November 2013 for capturing 1-meter resolution images. The 1st Cal/Val phase was the most critical phase in the satellite life-time, where most of the initial measurements took place. This phase extended over the period of 25/11/2013 till 12/12/2013. Moreover, this phase included most of the relative calibration tasks, color balancing and band matching. 2nd Cal/Val phase included most of the debugging and the pointing accuracy calibration tests. This phase extended over the period of 11/02/2014 till 09/03/2014. This phase emphasized on the calibration of the pointing accuracy. The 3rd Cal/Val phase included fine tuning for the Gyro system to further increase the stability of the satellite and thus improve the pointing accuracy. Moreover, new techniques were implemented to the Pan-Sharpening and to the MTF compensation procedures to enhance the final product. This phase extended over the period of 04/05/2014 till 21/05/2014.

  12. The TileCal Online Energy Estimation for the Next LHC Operation Period

    Science.gov (United States)

    Sotto-Maior Peralva, B.; ATLAS Collaboration

    2015-05-01

    The ATLAS Tile Calorimeter (TileCal) is the detector used in the reconstruction of hadrons, jets and missing transverse energy from the proton-proton collisions at the Large Hadron Collider (LHC). It covers the central part of the ATLAS detector (|η| occupancy, the pile-up, which is often modeled by a non-Gaussian distribution, can be seen as outlier events. Consequently, the classical covariance matrix estimation does not describe correctly the second order statistics of the background for the majority of the events, as this approach is very sensitive to outliers. As a result, the OF (or MF) coefficients are miscalculated leading to a larger variance and biased energy estimator. This work evaluates the usage of a robust covariance estimator, namely the Minimum Covariance Determinant (MCD) algorithm, to be applied in the OF design. The goal of the MCD estimator is to find a number of observations whose classical covariance matrix has the lowest determinant. Hence, this procedure avoids taking into account low likelihood events to describe the background. It is worth mentioning that the background covariance matrix as well as the OF coefficients for each TileCal channel are computed offline and stored for both online and offline use. In order to evaluate the impact of the MCD estimator on the performance of the OF, simulated data sets were used. Different average numbers of interactions per bunch crossing and bunch spacings were tested. The results show that the estimation of the background covariance matrix through MCD improves significantly the final energy resolution with respect to the identity matrix which is currently used. Particularly, for high occupancy cells, the final energy resolution is improved by more than 20%. Moreover, the use of the classical covariance matrix degrades the energy resolution for the majority of TileCal cells.

  13. SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU

    International Nuclear Information System (INIS)

    Chen, Wei; Johns-Krull, Christopher M.

    2013-01-01

    We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star

  14. Effect of turmeric and curcumin on BP-DNA adducts.

    Science.gov (United States)

    Mukundan, M A; Chacko, M C; Annapurna, V V; Krishnaswamy, K

    1993-03-01

    Many human cancers that are widely prevalent today can be prevented through modifications in life-styles, of which diet appears to be an important agent. Several dietary constituents modulate the process of carcinogenesis and prevent genotoxicity. Many plant constituents including turmeric appear to be potent antimutagens and antioxidants. Therefore the modulatory effects of turmeric and curcumin on the levels of benzo[a]pyrene induced DNA adducts in the livers of rats were studied by the newly developed 32P-postlabelling assay method. Turmeric when fed at 0.1, 0.5 and 3% and the active principle of turmeric (curcumin) when fed at a level of 0.03% in the diet for 4 weeks significantly reduced the level of BP-DNA adducts including the major adduct dG-N2-BP, formed within 24 h in response to a single i.p. injection of benzo[a]pyrene. The significance of these effects in terms of the potential anticarcinogenic effects of turmeric is discussed. Further, these results strengthen the various other biological effects of turmeric which have direct relevance to anticarcinogenesis and chemoprevention.

  15. Research on AHP decision algorithms based on BP algorithm

    Science.gov (United States)

    Ma, Ning; Guan, Jianhe

    2017-10-01

    Decision making is the thinking activity that people choose or judge, and scientific decision-making has always been a hot issue in the field of research. Analytic Hierarchy Process (AHP) is a simple and practical multi-criteria and multi-objective decision-making method that combines quantitative and qualitative and can show and calculate the subjective judgment in digital form. In the process of decision analysis using AHP method, the rationality of the two-dimensional judgment matrix has a great influence on the decision result. However, in dealing with the real problem, the judgment matrix produced by the two-dimensional comparison is often inconsistent, that is, it does not meet the consistency requirements. BP neural network algorithm is an adaptive nonlinear dynamic system. It has powerful collective computing ability and learning ability. It can perfect the data by constantly modifying the weights and thresholds of the network to achieve the goal of minimizing the mean square error. In this paper, the BP algorithm is used to deal with the consistency of the two-dimensional judgment matrix of the AHP.

  16. SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Wei; Johns-Krull, Christopher M., E-mail: wc2@rice.edu, E-mail: cmj@rice.edu [Department of Physics and Astronomy, Rice University, Houston, TX 77005 (United States)

    2013-10-20

    We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star.

  17. Calculation of the TileCal magnetic forces using 3D Tosca model

    International Nuclear Information System (INIS)

    Morozov, N.A.; Samsonov, E.V.; Vorozhtsov, S.B.; Nessi, M.

    1998-01-01

    The purpose of the given paper is to contribute to the new summary (taking into account the latest information) of magnetic forces, acting on various parts of the TileCal of the ATLAS detector (LHC, CERN). To get an impression of the field distribution in the vicinity of the objects under consideration of existing 3D Tosca field model of the detector was used. The detailed distribution of forces along the border of various parts of the system, derived here, is valuable for understanding the mechanics of system performance

  18. Morteros de cal : aplicación en el patrimonio histórico

    OpenAIRE

    Cazalla Vázquez, Olga

    2013-01-01

    Los morteros de cal, ha sido un material de construcción muy utilizado en sus múltiples funciones a lo largo de la historia. Se construía tras una selección especialmente cuidada de sus materias primas y eran totalmente compatibles con el resto de elementos de fábrica. Hoy en día, se tiende a reemplazarlos por morteros de cemento, que aunque tienen muy buenas propiedades físico-mecánicas, son totalmente incompatibles con los demás elementos de fábrica, ya que además producen un fuerte impacto...

  19. Gale Digital Collections: Ray Abruzzi Interviewed by Luisa Calè and Ana Parejo Vadillo

    Directory of Open Access Journals (Sweden)

    Ray Abruzzi

    2015-12-01

    Full Text Available This interview addresses the commercial dimensions of the nineteenth-century digital archive. Luisa Calè and Ana Parejo Vadillo ask Ray Abruzzi, Vice President and Publisher for 'Gale Digital Collections' at Gale, about the company’s origins, its commercial approach to digital collections, and the challenges of digitization. In the context of the open access movement, the architecture of participation, and crowdsourcing, Abruzzi discusses how the company works with academic partners and interfaces with other digital libraries and platforms.

  20. Hitachi product data management system toward the 21st century by CALS approach

    International Nuclear Information System (INIS)

    Yoshinaga, Toshiaki; Kibushi, Haruo; Kitaur, Ayumu

    1998-01-01

    HIPDM21 (Hitachi Product Data Management System for the 21st century) is a comprehensive computer information management system which has been developed for the purpose of plant life cycle business support in terms of the electronics information exchange and sharing between the disciplines using the product data management technology. The system consists of core systems (Engineering Data Control System, Integrated Commodity Database system, and Document Management System) and business application systems. In the present development phase, the system is being enhanced to support CALS standards including EDT, SGML, and STEP, and to support information exchange and sharing with outside the company including clients, construction companies, and domestic/international vendors. (author)

  1. Aerodynamic design of the Cal Poly Da Vinci Human-Powered Helicopter

    Science.gov (United States)

    Larwood, Scott; Saiki, Neal

    1990-01-01

    This paper will discuss the methodology used in designing the rotor and drive propellers for the third generation Cal Poly Da Vinci Human-Powered Helicopter. The rotor was designed using a lifting surface, uniform inflow hover analysis code and the propeller was designed using a minimum induced-loss method. Construction, geometry, and operating considerations are discussed as they impact the designs. Optimization of the design performance is also explained. The propellers were tested in a wind tunnel and results are compared with theoretical data. Successful flight tests of the Da Vinci III are discussed.

  2. The CAL: cognitive, apperceptive and representative aspects of fashion design - Side note to neuroaesthetic theory

    Science.gov (United States)

    Csanák, Edit

    2017-10-01

    This article deals with the creative and cognitive process of the creative work from the aspect of fashion design. It is examined through the Cognitive-Apperceptive-Limn process (The CAL), analysing the stages of design work referring to prominent literature, and discussing exciting theories, such the FLOW and the AHA effects are, and the neuro aesthetic theory. Setting them into a new context, the article offers a fresh approach of a designer, rather than a scientific statement based on pragmatic findings. Since theories on artistic performance and creativity can never be enough ‘empirical’, and the process can be never understood enough well…

  3. Efecto antiinflamatorio preclínico del polvo seco de Caléndula officinalis

    OpenAIRE

    Núñez Figueredo, Yanier; Montero Alarcón, Claudia; Agüero Fernández, Sara; Muñoz Cernuda, Adriana

    2007-01-01

    Para demostrar la actividad antiinflamatoria del polvo seco Caléndula officinalis secado por atomización se emplearon dosis de 50, 150 y 450 mg/Kg y se evaluó el efecto sobre la inflamación aguda provocada por carragenina, dextrán, histamina y serotonina y granuloma inducido por discos de algodón en ratas y edema auricular inducido por aceite de crotón en ratones. El polvo seco mostró efecto inhibitorio sobre los diferentes modelos empleados sin afectar el peso del timo y las glándulas suprar...

  4. Transfer of Air Force technical procurement bid set data to small businesses, using CALS and EDI: Test report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-08-15

    This report documents a test transfer of three Air Force technical procurement bid sets to one large and twelve small businesses, using the Department of Defense (DoD) Continuous Acquisition and Life-cycle Support (CALS) and ANSI ASC X12 Electronic Data Interchange (EDI) standards. The main goal of the test was to evaluate the effectiveness of using CALS technical data within the context of the DoD`s EDI-based standard approach to electronic commerce in procurement, with particular emphasis on receipt and use of the data by small contractors. Air Force procurement data was provided by the Sacramento Air Logistics Center at McClellan Air Force Base; the manufacturing participants were selected from among McClellan`s ``Blue Ribbon`` contractors, located throughout the US. The test was sponsored by the Air Force CALS Test Network, headquartered at Wright-Patterson Air Force Base. The test successfully demonstrated the technical feasibility of including CALS MIL-R-28002 (Raster) engineering data in an EDI Specification/Technical Information transaction set (ANSI ASC X12 841) when issuing electronic requests for quotation to small businesses. In many cases, the data was complete enough for the contractor participant to feel comfortable generating a quote. Lessons learned from the test are being fed back to the CALS and EDI standards organizations, and to future implementors of CALS-EDI based acquisition or contracting systems, which require the transfer of technical information, such as engineering data, manufacturing process data, quality test data, and other product or process data, in the form of a CALS or other digital datafile.

  5. Hot deformation behaviors and processing maps of B{sub 4}C/Al6061 neutron absorber composites

    Energy Technology Data Exchange (ETDEWEB)

    Li, Yu-Li [School of Materials Science and Engineering, Taiyuan University Of Technology, Taiyuan 030024 (China); Key Laboratory of Interface Science and Engineering in Advanced Materials, Ministry of Education, Taiyuan University of Technology, Taiyuan 030024 (China); Wang, Wen-Xian, E-mail: Wangwenxian@tyut.edu.cn [School of Materials Science and Engineering, Taiyuan University Of Technology, Taiyuan 030024 (China); Key Laboratory of Interface Science and Engineering in Advanced Materials, Ministry of Education, Taiyuan University of Technology, Taiyuan 030024 (China); Zhou, Jun [School of Materials Science and Engineering, Taiyuan University Of Technology, Taiyuan 030024 (China); Department of Mechanical Engineering, Pennsylvania State University Erie, The Behrend College, Erie, PA 16563 (United States); Chen, Hong-Sheng [School of Materials Science and Engineering, Taiyuan University Of Technology, Taiyuan 030024 (China); Key Laboratory of Interface Science and Engineering in Advanced Materials, Ministry of Education, Taiyuan University of Technology, Taiyuan 030024 (China)

    2017-02-15

    In this study, the hot deformation behaviors of 30 wt.% B{sub 4}C/Al6061 neutron absorber composites (NACs) have been investigated by conducting isothermal compression tests at temperatures ranging from 653 K to 803 K and strain rates from 0.01 to 10 s{sup −1}. It was found that, during hot compression, the B{sub 4}C/Al6061 NACs exhibited a steady flow characteristic which can be expressed by the Zener-Hollomon parameter as a hyperbolic-sine function of flow stress. High average activation energy (185.62 kJ/mol) of B{sub 4}C/Al6061 NACs is noted in current study owing to the high content of B{sub 4}C particle. The optimum hot working conditions for B{sub 4}C/Al6061 NACs are found to be 760–803 K/0.01–0.05 s{sup −1} based on processing map and microstructure evolution. Typical material instabilities are thought to be attributed to void formation, adiabatic shear bands (ASB), particle debonding, and matrix cracking. Finally, the effect of the plastic deformation zones (PDZs) on the microstructure evolution in this 30 wt.% B{sub 4}C/Al6061 composite is found to be very important. - Highlights: •The hot deformation behavior of the 30 wt.% B{sub 4}C/Al6061 NACs was first analyzed. •The 3D efficiency map and the instability map are developed. •The optimum hot working conditions were identified and validated by SEM and TEM. •The hot deformation schematic diagram of 30 wt.% B{sub 4}C/Al6061 NACs is developed.

  6. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Directory of Open Access Journals (Sweden)

    Azamat Aslanukov

    2006-10-01

    Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  7. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Science.gov (United States)

    Aslanukov, Azamat; Bhowmick, Reshma; Guruju, Mallikarjuna; Oswald, John; Raz, Dorit; Bush, Ronald A; Sieving, Paul A; Lu, Xinrong; Bock, Cheryl B; Ferreira, Paulo A

    2006-10-01

    The Ran-binding protein 2 (RanBP2) is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s) of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI) via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/-) are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/-) mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  8. Multiproxy evidence for terrestrial and aquatic ecosystem responses during the 8.2 ka cold event as recorded at Højby Sø, Denmark

    DEFF Research Database (Denmark)

    Hede, Mikkel Ulfeldt; Rasmussen, Peter; Noe-Nygaard, Nanna

    2010-01-01

    ecosystems to the 8.2 ka cold event. A reduced pollen production by thermophilous deciduous tree taxa in the period c. 8250–8000 cal yr BP reveal that the forest ecosystem was affected by low temperatures during the summer and winter/early-spring seasons. This finding is consistent with the timing of the 8.......2 ka cold event as registered in the Greenland ice cores. At Højby Sø, the climate anomaly appears to have started 200–250 yr earlier than the 8.2 ka cold event as the lake proxy data provide strong evidence for a precipitation-induced distinct increase in catchment soil erosion beginning around 8500...... cal yr BP. Alteration of the terrestrial environment then resulted in a major aquatic ecosystem change with nutrient enrichment of the lake and enhanced productivity, which lasted until c. 7900 cal yr BP. Keywords: 8.2 ka cold event; Lake sediments; Palaeoclimate; Pollen; Macrofossils; Geochemistry...

  9. Correlation of expression of BP1, a homeobox gene, with estrogen receptor status in breast cancer

    International Nuclear Information System (INIS)

    Fu, Sidney W; Poola, Indira; Stephan, Dietrich A; Berg, Patricia E; Schwartz, Arnold; Stevenson, Holly; Pinzone, Joseph J; Davenport, Gregory J; Orenstein, Jan M; Gutierrez, Peter; Simmens, Samuel J; Abraham, Jessy

    2003-01-01

    BP1 is a novel homeobox gene cloned in our laboratory. Our previous studies in leukemia demonstrated that BP1 has oncogenic properties, including as a modulator of cell survival. Here BP1 expression was examined in breast cancer, and the relationship between BP1 expression and clinicopathological data was determined. Total RNA was isolated from cell lines, tumors, and matched normal adjacent tissue or tissue from autopsy. Reverse transcription polymerase chain reaction was performed to evaluate BP1 expression. Statistical analysis was accomplished with SAS. Analysis of 46 invasive ductal breast tumors demonstrated BP1 expression in 80% of them, compared with a lack of expression in six normal breast tissues and low-level expression in one normal breast tissue. Remarkably, 100% of tumors that were negative for the estrogen receptor (ER) were BP1-positive, whereas 73% of ER-positive tumors expressed BP1 (P = 0.03). BP1 expression was also associated with race: 89% of the tumors of African American women were BP1-positive, whereas 57% of those from Caucasian women expressed BP1 (P = 0.04). However, there was no significant difference in BP1 expression between grades I, II, and III tumors. Interestingly, BP1 mRNA expression was correlated with the ability of malignant cell lines to cause breast cancer in mice. Because BP1 is expressed abnormally in breast tumors, it could provide a useful target for therapy, particularly in patients with ER-negative tumors. The frequent expression of BP1 in all tumor grades suggests that activation of BP1 is an early event

  10. Polymer-Based Black Phosphorus (bP) Hybrid Materials by in Situ Radical Polymerization: An Effective Tool To Exfoliate bP and Stabilize bP Nanoflakes

    Science.gov (United States)

    2018-01-01

    Black phosphorus (bP) has been recently investigated for next generation nanoelectronic multifunctional devices. However, the intrinsic instability of exfoliated bP (the bP nanoflakes) toward both moisture and air has so far overshadowed its practical implementation. In order to contribute to fill this gap, we report here the preparation of new hybrid polymer-based materials where bP nanoflakes (bPn) exhibit a significantly improved stability. The new materials have been prepared by different synthetic paths including: (i) the mixing of conventionally liquid-phase exfoliated bP (in dimethyl sulfoxide, DMSO) with poly(methyl methacrylate) (PMMA) solution; (ii) the direct exfoliation of bP in a polymeric solution; (iii) the in situ radical polymerization after exfoliating bP in the liquid monomer (methyl methacrylate, MMA). This last methodology concerns the preparation of stable suspensions of bPn–MMA by sonication-assisted liquid-phase exfoliation (LPE) of bP in the presence of MMA followed by radical polymerization. The hybrids characteristics have been compared in order to evaluate the bP dispersion and the effectiveness of the bPn interfacial interactions with polymer chains aimed at their long-term environmental stabilization. The passivation of the bPn is particularly effective when the hybrid material is prepared by in situ polymerization. By using this synthetic methodology, the nanoflakes, even if with a gradient of dispersion (size of aggregates), preserve their chemical structure from oxidation (as proved by both Raman and 31P-solid state NMR studies) and are particularly stable to air and UV light exposure. The feasibility of this approach, capable of efficiently exfoliating bP while protecting the bPn, has been then verified by using different vinyl monomers (styrene and N-vinylpyrrolidone), thus obtaining hybrids where the nanoflakes are embedded in polymer matrices with a variety of intriguing thermal, mechanical, and solubility characteristics.

  11. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Energy Technology Data Exchange (ETDEWEB)

    Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)

    2015-04-15

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

  12. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    International Nuclear Information System (INIS)

    Kanginakudru, Sriramana; DeSmet, Marsha; Thomas, Yanique; Morgan, Iain M.; Androphy, Elliot J.

    2015-01-01

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication

  13. 76 FR 69713 - Application To Export Electric Energy; BP Energy Company

    Science.gov (United States)

    2011-11-09

    ... DEPARTMENT OF ENERGY [OE Docket No. EA-314-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... electric energy from the United States to Mexico as a power marketer for a five-year term using existing...

  14. Modification of the Clinical Global Impressions (CGI) Scale for use in bipolar illness (BP): the CGI-BP.

    Science.gov (United States)

    Spearing, M K; Post, R M; Leverich, G S; Brandt, D; Nolen, W

    1997-12-05

    The Clinical Global Impressions Scale (CGI) was modified specifically for use in assessing global illness severity and change in patients with bipolar disorder. Criticisms of the original CGI were addressed by correcting inconsistencies in scaling, identifying time frames for comparison, clarifying definitions of illness severity and change, and separating out assessment of treatment side effects from illness improvement during treatment. A Detailed User's Guide was developed to train clinicians in the use of the new CGI-Bipolar Version (CGI-BP) for rating severity of manic and depressive episodes and the degree of change from the immediately preceding phase and from the worst phase of illness. The revised scale and manual provide a focused set of instructions to facilitate the reliability of these ratings of mania, depression, and overall bipolar illness during treatment of an acute episode or in longer-term illness prophylaxis. Interrater reliability of the scale was demonstrated in preliminary analyses. Thus, the modified CGI-BP is anticipated to be more useful than the original CGI in studies of bipolar disorder.

  15. João Pandiá Calógeras

    Directory of Open Access Journals (Sweden)

    Sílvio Fernandes Lopes

    1961-12-01

    Full Text Available A honra de ocupar uma cadeira numa instituição cientí-fica de renome, não é maior, decerto, do que aquela de o fazer à sombra de um vulto de primeira grandeza, a lhe servir de patrono. Dupla honra e dupla responsabilidade, portanto, o que neste momento me toca, pois se a Cadeira pertence ao Instituto Histórico e Geográfico de Santos, entidade que digni-fica a cultura da nossa terra e da nossa gente em vinte e dois anos de trajetória científica e social, a invocação pertence a uma das maiores figuras do Brasil República, o grande Caló-geras, que Afonso de Taunay chamou de "gigante do pensa-mento brasileiro", quando, em discurso de saudação a Rodol-fo Garcia na Academia Brasileira de Letras, verberava que, naquela Academia ilustre, não estivessem três gigantes do pen-samento brasileiro: Pandiá Calógeras, Martim Francisco e Ca-pistrano de Abreu.

  16. The TileCal Online Energy Estimation for the Next LHC Operation Period

    CERN Document Server

    Peralva, B S; The ATLAS collaboration; Cerqueira, A S; Seixas, J M

    2014-01-01

    This work presents a study on the TileCal online energy estimation for the next LHC operation period (Run2). Due to hardware limitation, the algorithm that performs the online energy estimation must remain based on the linear and fast Optimal Filter (OF) technique, which envisages the use of the background covariance matrix in its design. During Run1, TileCal made use of an identity matrix to describe and the background covariance matrix, which showed to be a reasonable approximation for the low luminosity scenario. Under such conditions, the background for most of its cells comprised mainly electronic noise which can be approximated as a uncorrelated Gaussian process. However, as the pile-up introduces a non-Gaussian component to the background, the OF method presents larger variance and it becomes biased. The use of the background covariance matrix in the design of the OF weights is expected to improve the energy estimation performance. The results for the scenario considered show that for high occupancy ce...

  17. The TileCal Energy Reconstruction for LHC Run2 and Future Perspectives

    CERN Document Server

    Seixas, Jose; The ATLAS collaboration

    2015-01-01

    The Tile Calorimeter (TileCal) is the main hadronic calorimeter of ATLAS and it covers the central part of the detector (|η|<1.6). The energy deposited by the particles in TileCal is read out by approximately 10,000 channels. The signal provided by the readout electronics for each channel is digitized at 40 MHz and its amplitude is estimated by an optimal filtering algorithm. The increase of LHC luminosity leads to signal pile-up that deforms the signal of interest and compromises the amplitude estimation performance. This work presents the proposed algorithm for energy estimation during LHC Run 2. The method is based on the same approach used during LHC Run 1, namely the Optimal Filter (OF). The only difference is that the signal baseline (pedestal) will be subtracted from the received digitized samples, while in Run 1 this quantity was estimated on an event-by-event basis. The pedestal value is estimated through special calibration runs and it is stored in a data base for online and offline usage. Addit...

  18. The TileCal Energy Reconstruction for LHC Run2 and Future Perspectives

    CERN Document Server

    INSPIRE-00517880

    2015-01-01

    The TileCal is the main hadronic calorimeter of ATLAS and it covers the central part of the detector ($|\\eta|$ < 1.6). The energy deposited by the particles in TileCal is read out by approximately 10,000 channels. The signal provided by the readout electronics for each channel is digitized at 40 MHz and its amplitude is estimated by an optimal filtering algorithm. The increase of LHC luminosity leads to signal pile-up that deforms the signal of interest and compromises the amplitude estimation performance. This work presents the proposed algorithm for energy estimation during LHC Run 2. The method is based on the same approach used during LHC Run 1, namely the Optimal Filter. The only difference is that the signal baseline (pedestal) will be subtracted from the received digitized samples, while in Run 1 this quantity was estimated on an event-by-event basis. The pedestal value is estimated through special calibration runs and it is stored in a data base for online and offline usage. Additionally, the backg...

  19. The TileCal Energy Reconstruction for LHC Run2 and Future Perspectives

    CERN Document Server

    Seixas, Jose; The ATLAS collaboration

    2015-01-01

    The Tile Calorimeter (TileCal) is the main hadronic calorimeter of ATLAS and it covers the central part of the detector (|eta|<1.6). The energy deposited by the particles in TileCal is read out by approximately 10,000 channels. The signal provided by the readout electronics for each channel is digitized at 40 MHz and its amplitude is estimated by an optimal filtering algorithm. The increase of LHC luminosity leads to signal pile-up that deforms the signal of interest and compromises the amplitude estimation performance. This work presents the proposed algorithm for energy estimation during LHC Run 2. The method is based on the same approach used during LHC Run 1, namely the Optimal Filter (OF). The only difference is that the signal baseline (pedestal) will be subtracted from the received digitized samples, while in Run 1 this quantity was estimated on an event-by-event basis. The pedestal value is estimated through special calibration runs and it is stored in a data base for online and offline usage. Addi...

  20. Firmware Development for the ATLAS TileCal sROD

    CERN Document Server

    Moreno Marti, Pablo; The ATLAS collaboration; Valero, Alberto

    2015-01-01

    TileCal is the central hadronic calorimeter of the ATLAS experiment at the Large Hadron Collider (LHC) at CERN. A main upgrade of the LHC (also called Phase-II) is planned in order to increase the instantaneous luminosity in 2022. At the TileCal level, the upgrade involves the redesign of the complete read-out architecture, affecting both the front-end and the back-end electronics. In the new read-out architecture, the front-end electronics will transmit digitized information of the full detector to the back-end system every single bunch-crossing. Thus, the back-end system must provide digital calibrated information to the first level of trigger. Having all detector data per bunch crossing in the back-end will increase the precision and granularity of the trigger information, improving this way the trigger efficiencies. A reduced part of the detector, 1/256 of the total, will be equipped with the new electronics during 2015 to evaluate the proposed architecture in real conditions in the so-called “demonstra...

  1. Firmware Development for the ATLAS TileCal sROD

    CERN Document Server

    Moreno Marti, Pablo; The ATLAS collaboration; Valero, Alberto

    2015-01-01

    TileCal is the central hadronic calorimeter of the ATLAS experiment at the Large Hadron Collider (LHC) at CERN. A main upgrade of the LHC (also called Phase-II) is planned in order to increase the instantaneous luminosity in 2022. For TileCal, the upgrade involves the redesign of the complete read-out architecture, affecting both the front-end and the back-end electronics. In the new read-out architecture, the front-end electronics will transmit digitized information of the full detector to the back-end system every single bunch-crossing. Thus, the back-end system must provide digital calibrated information to the first level of trigger. Having all detector data per bunch crossing in the back-end will increase the precision and granularity of the trigger information, improving this way the trigger efficiencies. A reduced part of the detector, 1/256 of the total, will be equipped with the new electronics during 2016 to evaluate the proposed architecture in real conditions in the so-called “demonstrator proje...

  2. The Cal-Bridge Program: Supporting Diverse Graduate Students in Astrophysics

    Science.gov (United States)

    Smecker-Hane, Tammy A.; Rudolph, Alexander L.; Abazajian, Kevork; Povich, Matthew S.

    2018-06-01

    The mission of the Cal-Bridge program is to increase the number of underrepresented minority and women students completing a bachelor’s degree and entering a PhD program in astronomy, physics, or closely-related fields. To do so, we have built a network of faculty at diverse higher education institutions, including University of California (UC) campuses, California State Universities (CSUs), and community colleges dedicated to this goal. Students selected for our program are known as Cal-Bridge Scholars, and we give them a wide variety of support: (1) financial scholarships in their junior/senior years at CSU and their first year of graduate school at a UC, (2) intensive mentoring by a pair of CSU and UC faculty members, (3) tutoring, (4) professional development workshops, (5) exposure to research opportunities at various universities, and (6) membership in a growing cohort of like-minded students. In this poster, we report on our work in designing an effective mentoring program and developing tools like our mentoring and graduate application handbooks, and we discuss our tutoring program and the professional development workshops we have designed, and we report on their effectiveness. Funding for this program is provided by NSF-SSTEM Grant #1356133.

  3. CalFitter: a web server for analysis of protein thermal denaturation data.

    Science.gov (United States)

    Mazurenko, Stanislav; Stourac, Jan; Kunka, Antonin; Nedeljkovic, Sava; Bednar, David; Prokop, Zbynek; Damborsky, Jiri

    2018-05-14

    Despite significant advances in the understanding of protein structure-function relationships, revealing protein folding pathways still poses a challenge due to a limited number of relevant experimental tools. Widely-used experimental techniques, such as calorimetry or spectroscopy, critically depend on a proper data analysis. Currently, there are only separate data analysis tools available for each type of experiment with a limited model selection. To address this problem, we have developed the CalFitter web server to be a unified platform for comprehensive data fitting and analysis of protein thermal denaturation data. The server allows simultaneous global data fitting using any combination of input data types and offers 12 protein unfolding pathway models for selection, including irreversible transitions often missing from other tools. The data fitting produces optimal parameter values, their confidence intervals, and statistical information to define unfolding pathways. The server provides an interactive and easy-to-use interface that allows users to directly analyse input datasets and simulate modelled output based on the model parameters. CalFitter web server is available free at https://loschmidt.chemi.muni.cz/calfitter/.

  4. NO2 fluxes from Tijuana using a mobile mini-DOAS during Cal-Mex 2010

    Science.gov (United States)

    Rivera, Claudia; Barrera, Hugo; Grutter, Michel; Zavala, Miguel; Galle, Bo; Bei, Naifang; Li, Guohui; Molina, Luisa T.

    2013-05-01

    NO2 fluxes were measured using a mobile mini-DOAS during Cal-Mex 2010 field study, between May 15 and June 30, 2010, from the urban area of Tijuana, Baja California as well as the Rosarito power plant. The average calculated NO2 fluxes were 328 ± 184 (269 ± 201) g s-1, and 23.4 ± 4.9 (12.9 ± 11.9) g s-1 for Tijuana urban area and Rosarito power plant, respectively, using model based wind fields and onsite measurements (in parenthesis). Wind speed and wind direction data needed to estimate the fluxes were both modeled and obtained from radiosondes launched regularly during the field campaign, whereas the mixing layer height throughout the entire field campaign was measured using a ceilometer. Large variations in the NO2 fluxes from both the Tijuana urban area and Rosarito power plant were observed during Cal-Mex 2010; however, the variability was less when model based wind fields were used. Qualitative comparisons of modeled and measured plumes from the Tijuana urban area and Rosarito power plant showed good agreement.

  5. Study of TileCal scintillator irradiation using the minimum bias integrators

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00387867; The ATLAS collaboration

    2016-01-01

    The Tile Calorimeter (TileCal) is the central hadronic calorimeter of the ATLAS experiment at the LHC. It provides precise energy measurements of hadrons, jets, taus and missing transverse energy. The monitoring and calibration of the calorimeter response at each stage of the signal development is done by a movable $^{137}$Cs radioactive source, a laser calibration system and a charge injection system. Moreover, during LHC data taking, an integrator-based readout provides the signals coming from inelastic proton-proton collisions at predominantly low momentum transfer (minimum bias events) and allows monitoring of the instantaneous ATLAS luminosity as well as the response of calorimeter cells. The integrator currents have been used to detect and quantify the effect of TileCal scintillator irradiation using the data taken in 2012 and 2015 that correspond to about 22 fb$^{−1}$ and 4 fb$^{−1}$ of integrated luminosity, respectively. Finally, the response variation for an irradiated cell has been studied comb...

  6. All partial breakings in ${\\cal N}=2$ supergravity with a single hypermultiplet arXiv

    CERN Document Server

    Antoniadis, Ignatios; Petropoulos, P. Marios; Siampos, Konstantinos

    We consider partial supersymmetry breaking in ${\\cal N}=2$ supergravity coupled to a single vector and a single hypermultiplet. This breaking pattern is in principle possible if the quaternion-K\\"ahler space of the hypermultiplet admits (at least) one pair of commuting isometries. For this class of manifolds, explicit metrics exist and we analyse a generic electro-magnetic (dyonic) gauging of the isometries. An example of partial breaking in Minkowski spacetime has been found long ago by Ferrara, Girardello and Porrati, using the gauging of two translation isometries on $SO(4,1)/SO(4)$. We demonstrate that no other example of partial breaking of ${\\cal N}=2$ supergravity in Minkowski spacetime exists. We also examine partial-breaking vacua in anti-de Sitter spacetime that are much less constrained and exist generically even for electric gaugings. On $SO(4,1)/SO(4)$, we construct the partially-broken solution and its global limit which is the Antoniadis-Partouche-Taylor model.

  7. Characterization of emissions sources in the California-Mexico Border Region during Cal-Mex 2010

    Science.gov (United States)

    Zavala, M. A.; Lei, W.; Li, G.; Bei, N.; Barrera, H.; Tejeda, D.; Molina, L. T.; Cal-Mex 2010 Emissions Team

    2010-12-01

    The California-Mexico border region provides an opportunity to evaluate the characteristics of the emission processes in rapidly expanding urban areas where intensive international trade and commerce activities occur. Intense anthropogenic activities, biomass burning, as well as biological and geological sources significantly contribute to high concentration levels of particulate matter (PM), polycyclic aromatic hydrocarbons (PAHs), nitrogen oxides (NOx), volatile organic compounds (VOCs), air toxics, and ozone observed in the California-US Baja California-Mexico border region. The continued efforts by Mexico and US for improving and updating the emissions inventories in the sister cities of San Diego-Tijuana and Calexico-Mexicali has helped to understand the emission processes in the border region. In addition, the recent Cal-Mex 2010 field campaign included a series of measurements aimed at characterizing the emissions from major sources in the California-Mexico border region. In this work we will present our analyzes of the data obtained during Cal-Mex 2010 for the characterization of the emission sources and their use for the evaluation of the recent emissions inventories for the Mexican cities of Tijuana and Mexicali. The developed emissions inventories will be implemented in concurrent air quality modeling efforts for understanding the physical and chemical transformations of air pollutants in the California-Mexico border region and their impacts.

  8. The TileCal Online Energy Estimation for the Next LHC Operation Period

    CERN Document Server

    Peralva, B S; The ATLAS collaboration

    2014-01-01

    The ATLAS Tile Calorimeter (TileCal) is the detector used in the reconstruction of hadrons, jets, muons and missing transverse energy from the proton-proton collisions at the Large Hadron Collider (LHC). It covers the central part of the ATLAS detector (|η|<1.6). The energy deposited by the particles is read out by approximately 5,000 cells, with double readout channels. The signal provided by the readout electronics for each channel is digitized at 40 MHz and its amplitude is estimated by an optimal filtering algorithm, which expects a single signal with a well-defined shape. However, the LHC luminosity is expected to increase leading to signal pile-up that deforms the signal of interest. Due to limited resources, the current DSP-based hardware setup does not allow the implementation of sophisticated energy estimation methods that deal with the pile-up. Therefore, the technique to be employed for online energy estimation in TileCal for next LHC operation period must be based on fast filters such as the M...

  9. TEM study of soot, organic aerosol, and sea-salt particles collected during CalNex

    Science.gov (United States)

    Adachi, K.; Buseck, P. R.

    2010-12-01

    Anthropogenic aerosol particles are emitted in abundance from megacities. Those particles can have important effects on both human health and climate. In this study, aerosol particles having aerodynamic diameters between 50 and 300 nm were collected during the CalNex campaign at the Pasadena ground site from May 15 to June 15, 2010, ~15 km northeast of downtown Los Angeles. The samples were analyzed using transmission electron microscopes (TEMs) to characterize particle shapes and compositions. Most samples are dominated by soot, organic aerosol (OA), sulfate, sea salt, or combinations thereof. Sizes and amounts of OA particles increased during the afternoons, and most soot particles were internally mixed with OA and sulfate in the afternoons. The proportion of soot to other material in individual particles increased and soot particles were more compact during the nights and early mornings. Sea-salt particles were commonly internally mixed with other materials. They have high Na contents with lesser N, Mg, S, K, and Ca and almost no Cl, suggesting that the Cl was replaced by sulfate or nitrate in the atmosphere. There is less OA and more sea salt and sulfate in the CalNex samples than in the samples from Mexico City that were collected during the MILAGRO campaign. Our study indicates that compositions of internally mixed aerosol particles and shapes of soot particles change significantly within a day. These changes probably influence the estimates of their effects on human health and climate.

  10. Supersoft X-Ray Source CAL 83: A Possible AE Aqr-like System

    Directory of Open Access Journals (Sweden)

    A. Odendaal

    2015-02-01

    Full Text Available CAL83 is a close binary supersoft X-ray source in the Large Magellanic Cloud. A ~67 s periodicity detected in supersoft X-rays is most probably associated with the spin period of a highly spun-up white dwarf (WD. The variability in the period is ascribed to the obscuration of the WD by the hydrogen burning envelope surrounding it, rotating with a period that is close to, but not quite synchronized with, the WD rotation period. Optical spectra obtained with SALT exhibit accretion disc emission lines with broad wing structures and P Cyg profiles, indicating mass outflows. Timing analysis of photometrical observations performed at the South African Astronomical Observatory (SAAO revealed variable signals at ≤1 mHz which are thought to be associated with quasi-periodic oscillations from an accretion disc. The short spin period inferred for CAL83 can be the result of spin-up by accretion disc torques during a long mass transfer history, placing this source on a similar evolutionary track as the cataclysmic variable AE Aqr.

  11. Radioisotope dating beyond 50,000 years BP

    International Nuclear Information System (INIS)

    Beukens, R.P.

    1980-01-01

    A counting method for radiocarbon dating has been developed by the Toronto-Rochester-General Ionex group over the past two years using electrostatic tandem-accelerators as part of a mass spectrometer. The method uses very small samples of 1 mg or less and reaches high accuracy after counting for only a few hours. In principle this 14 C method can be used to date samples up to 100,000 years old but severe problems are anticipated with respect to sample contamination, particularly beyond 70,000 years BP. The counting method can also be applied to the detection of longer lived radioisotopes created in the upper atmosphere by the interaction of cosmic radiation, such as 36 Cl, 26 Al and 10 Be. (author)

  12. BP and Mobil present a united front in Europe

    International Nuclear Information System (INIS)

    Jackson, Kim.

    1997-01-01

    BP and Mobil announced the pooling of their European refining, marketing and lubricants businesses in February last year in an unprecedented step to cut costs and improve their competitive position in what is becoming an increasingly cut-throat market. Like their competitors, the two companies had been battling to contented with the continuing surplus refining capacity throughout Europe as well as significantly reduced profit margins on gasoline and other products sold at the pumps. This was particularly the case in the United Kingdom which is still reeling from the effects of the petrol pump price war waged over the past year and in France, too, where the hypermarkets are fiercely battling to retain their market share. (author)

  13. RanBP3 influences interactions between CRM1 and its nuclear protein export substrates

    OpenAIRE

    Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike

    2001-01-01

    We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...

  14. Western equatorial African forest-savanna mosaics: a legacy of late Holocene climatic change?

    Directory of Open Access Journals (Sweden)

    A. Ngomanda

    2009-10-01

    Full Text Available Past vegetation and climate changes reconstructed using two pollen records from Lakes Maridor and Nguène, located in the coastal savannas and inland rainforest of Gabon, respectively, provide new insights into the environmental history of western equatorial African rainforests during the last 4500 cal yr BP. These pollen records indicate that the coastal savannas of western equatorial Africa did not exist during the mid-Holocene and instead the region was covered by evergreen rainforests. From ca. 4000 cal yr BP a progressive decline of inland evergreen rainforest, accompanied by the expansion of semi-deciduous rainforest, occurred synchronously with grassland colonisation in the coastal region of Gabon. The contraction of moist evergreen rainforest and the establishment of coastal savannas in Gabon suggest decreasing humidity from ca. 4000 cal yr BP. The marked reduction in evergreen rainforest and subsequent savanna expansion was followed from 2700 cal yr BP by the colonization of secondary forests dominated by the palm, Elaeis guineensis, and the shrub, Alchornea cordifolia (Euphorbiaceae. A return to wetter climatic conditions from about 1400 cal yr BP led to the renewed spread of evergreen rainforest inland, whereas a forest-savanna mosaic still persists in the coastal region. There is no evidence to suggest that the major environmental changes observed were driven by human impact.

  15. Geochronology and Geomorphology of the Pioneer Archaeological Site (10BT676), Upper Snake River Plain, Idaho

    Energy Technology Data Exchange (ETDEWEB)

    Keene, Joshua L. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-04-01

    The Pioneer site in southeastern Idaho, an open-air, stratified, multi-component archaeological locality on the upper Snake River Plain, provides an ideal situation for understanding the geomorphic history of the Big Lost River drainage system. We conducted a block excavation with the goal of understanding the geochronological context of both cultural and geomorphological components at the site. The results of this study show a sequence of five soil formation episodes forming three terraces beginning prior to 7200 cal yr BP and lasting until the historic period, preserving one cultural component dated to ~3800 cal yr BP and multiple components dating to the last 800 cal yr BP. In addition, periods of deposition and stability at Pioneer indicate climate fluctuation during the middle Holocene (~7200-3800 cal yr BP), minimal deposition during the late Holocene, and a period of increased deposition potentially linked to the Little Ice Age. In addition, evidence for a high-energy erosion event dated to ~3800 cal yr BP suggest a catastrophic flood event during the middle Holocene that may correlate with volcanic activity at the Craters of the Moon lava fields to the northwest. This study provides a model for the study of alluvial terrace formations in arid environments and their potential to preserve stratified archaeological deposits.

  16. AMP-activated protein kinase phosphorylates CtBP1 and down-regulates its activity

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jae-Hwan; Choi, Soo-Youn; Kang, Byung-Hee; Lee, Soon-Min [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); Park, Hyung Soon; Kang, Gum-Yong; Bang, Joo Young [Center for Biomedical Mass Spectrometry, Diatech Korea Co., Ltd., Seoul (Korea, Republic of); Cho, Eun-Jung [National Research Laboratory for Chromatin Dynamics, College of Pharmacy, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Youn, Hong-Duk, E-mail: hdyoun@snu.ac.kr [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); WCU Department of Molecular Medicine and Biopharmaceutical Sciences, Graduate School of Convergence and Technology, Seoul National University, Seoul (Korea, Republic of)

    2013-02-01

    Highlights: ► AMPK phosphorylates CtBP1 on serine 158. ► AMPK-mediated phosphorylation of CtBP1 causes the ubiquitination and nuclear export of CtBP1. ► AMPK downregulates the CtBP1-mediated repression of Bax transcription. -- Abstract: CtBP is a transcriptional repressor which plays a significant role in the regulation of cell proliferation and tumor progression. It was reported that glucose withdrawal causes induction of Bax due to the dissociation of CtBP from the Bax promoter. However, the precise mechanism involved in the regulation of CtBP still remains unclear. In this study, we found that an activated AMP-activated protein kinase (AMPK) phosphorylates CtBP1 on Ser-158 upon metabolic stresses. Moreover, AMPK-mediated phosphorylation of CtBP1 (S158) attenuates the repressive function of CtBP1. We also confirmed that triggering activation of AMPK by various factors resulted in an increase of Bax gene expression. These findings provide connections of AMPK with CtBP1-mediated regulation of Bax expression for cell death under metabolic stresses.

  17. Transfer of Air Force technical procurement bid set data to small businesses, using CALS and EDI. Summary report. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-01-10

    This report provides a summary of the Air Force CALS Test Network (AFCTN) Test Report Transfer of Air Force Technical Procurement Bid Set Data to Small Businesses, Using CALS and EDI (AFCTN Test Report 94-034, UCRL-ID-118619). It represents a synthesis of the results, conclusions, and recommendations, as well as a more concise presentation of the issues and strategies as viewed from AFCTN`s perspective. This report documents a test transfer of three Air Force technical procurement bid sets to one large and twelve small businesses, using the Department of Defense (DoD) Continuous Acquisition and Life-cycle Support (CALS) and ANSI ASC X12 Electronic Data Interchange (EDI) standards. The main goal of the test was to evaluate the effectiveness of using CALS technical data within the context of the DoD`s EDI-based standard approach to electronic commerce in procurement, with particular emphasis on receipt and use of the data by small contractors. Air Force procurement data was provided by the Sacramento Air Logistics Center at McClellan Air Force Base; the manufacturing participants were selected from among McClellan`s {open_quote}Blue Ribbon{close_quote} contractors, located throughout the United States. The test was sponsored by the Air Force CALS Test Network, headquartered at Wright-Patterson Air Force Base. The test successfully demonstrated the technical feasibility of including CALS MIL-R-28002 (Raster) engineering data in an EDI Specification/Technical Information transaction set (ANSI ASC X12 841) when issuing electronic requests for quotation to small businesses. In many cases, the data was complete enough for the contractor participant to feel comfortable generating a quote.

  18. House dust mite allergen reduction and allergy at 4 yr : Follow up of the PIAMA-study

    NARCIS (Netherlands)

    Corver, K; Kerkhof, M; Brussee, JE; Brunekreef, B; van Strien, RT; Vos, AP; Smit, HA; Gerritsen, J; Neijens, HJ; de Jongste, JC

    Exposure to high allergen levels in early life is a risk factor for the development of allergy. We previously reported limited effects of mite allergen impermeable mattress covers in the prevention and incidence of asthma and mite allergy (PIAMA) cohort at the age of 1 and 2 yr. We now present the

  19. Determinants of fire activity during the last 3500 yr at a wildland-urban interface, Alberta, Canada

    Science.gov (United States)

    Davis, Emma L.; Courtney Mustaphi, Colin J.; Gall, Amber; Pisaric, Michael F. J.; Vermaire, Jesse C.; Moser, Katrina A.

    2016-11-01

    Long-term records of wildfires and their controlling factors are important sources of information for informing land management practices. Here, dendrochronology and lake sediment analyses are used to develop a 3500-yr fire and vegetation history for a montane forest in Jasper National Park, Alberta, Canada. The tree-ring record (AD 1771-2012) indicates that this region historically experienced a mixed-severity fire regime, and that effective fire suppression excluded widespread fire events from the study area during the 20th century. A sediment core collected from Little Trefoil Lake, located near the Jasper townsite, is analyzed for subfossil pollen and macroscopic charcoal (>150 μm). When comparing the tree-ring record to the 3500-yr record of sediment-derived fire events, only high-severity fires are represented in the charcoal record. Comparisons between the charcoal record and historical climate and pollen data indicate that climate and vegetation composition have been important controls on the fire regime for most of the last 3500 yr. Although fire frequency is presently within the historical range of variability, the fire return interval of the last 150 yr is longer than expected given modern climate and vegetation conditions, indicating that humans have become the main control on fire activity around Little Trefoil Lake.

  20. A new model of Earth's radial conductivity structure derived from over 10 yr of satellite and observatory magnetic data

    DEFF Research Database (Denmark)

    Püthe, Christoph; Kuvshinov, Alexey; Khan, Amir

    2015-01-01

    We present a newmodel of the radial (1-D) conductivity structure of Earth's mantle. This model is derived frommore than 10 yr of magnetic measurements from the satellites ørsted, CHAMP, SAC-C and the Swarm trio as well as the global network of geomagnetic observatories. After removal of core...

  1. Academic Performance in Human Anatomy and Physiology Classes: A 2-Yr Study of Academic Motivation and Grade Expectation

    Science.gov (United States)

    Sturges, Diana; Maurer, Trent W.; Allen, Deborah; Gatch, Delena Bell; Shankar, Padmini

    2016-01-01

    This project used a nonexperimental design with a convenience sample and studied the relationship between academic motivation, grade expectation, and academic performance in 1,210 students enrolled in undergraduate human anatomy and physiology (HAP) classes over a 2-yr period. A 42-item survey that included 28 items of the adapted academic…

  2. CalWater 2 - Precipitation, Aerosols, and Pacific Atmospheric Rivers Experiment

    Science.gov (United States)

    Spackman, Ryan; Ralph, Marty; Prather, Kim; Cayan, Dan; DeMott, Paul; Dettinger, Mike; Fairall, Chris; Leung, Ruby; Rosenfeld, Daniel; Rutledge, Steven; Waliser, Duane; White, Allen

    2014-05-01

    Emerging research has identified two phenomena that play key roles in the variability of the water supply and the incidence of extreme precipitation events along the West Coast of the United States. These phenomena include the role of (1) atmospheric rivers (ARs) in delivering much of the precipitation associated with major storms along the U.S. West Coast, and (2) aerosols—from local sources as well as those transported from remote continents—and their modulating effects on western U.S. precipitation. A better understanding of these processes is needed to reduce uncertainties in weather predictions and climate projections of extreme precipitation and its effects, including the provision of beneficial water supply. This presentation summarizes science gaps associated with (1) the evolution and structure of ARs including cloud and precipitation processes and air-sea interaction, and (2) aerosol interaction with ARs and the impact on precipitation, including locally-generated aerosol effects on orographic precipitation along the U.S. West Coast. Observations are proposed for multiple winter seasons as part of a 5-year broad interagency vision referred to as CalWater 2 to address these science gaps (http://esrl.noaa.gov/psd/calwater). In the near term, a science investigation is being planned including a targeted set of aircraft and ship-based measurements and associated evaluation of data in near-shore regions of California and in the eastern Pacific for an intensive observing period between January 2015 and March 2015. DOE's Atmospheric Radiation Measurement (ARM) program and NOAA are coordinating on deployment of airborne and ship-borne facilities for this period in a DOE-sponsored study called ACAPEX (ARM Cloud Aerosol and Precipitation Experiment) to complement CalWater 2. The motivation for this major study is based on findings that have emerged in the last few years from airborne and ground-based studies including CalWater and NOAA's HydroMeterology Testbed

  3. Modeling the formation and aging of secondary organic aerosols in Los Angeles during CalNex 2010

    Science.gov (United States)

    Hayes, P. L.; Carlton, A. G.; Baker, K. R.; Ahmadov, R.; Washenfelder, R. A.; Alvarez, S.; Rappengluck, B.; Gilman, J. B.; Kuster, W. C.; de Gouw, J. A.; Zotter, P.; Prevot, A. S. H.; Szidat, S.; Kleindienst, T. E.; Offenberg, J. H.; Ma, P. K.; Jimenez, J. L.

    2015-05-01

    Four different literature parameterizations for the formation and evolution of urban secondary organic aerosol (SOA) frequently used in 3-D models are evaluated using a 0-D box model representing the Los Angeles metropolitan region during the California Research at the Nexus of Air Quality and Climate Change (CalNex) 2010 campaign. We constrain the model predictions with measurements from several platforms and compare predictions with particle- and gas-phase observations from the CalNex Pasadena ground site. That site provides a unique opportunity to study aerosol formation close to anthropogenic emission sources with limited recirculation. The model SOA that formed only from the oxidation of VOCs (V-SOA) is insufficient to explain the observed SOA concentrations, even when using SOA parameterizations with multi-generation oxidation that produce much higher yields than have been observed in chamber experiments, or when increasing yields to their upper limit estimates accounting for recently reported losses of vapors to chamber walls. The Community Multiscale Air Quality (WRF-CMAQ) model (version 5.0.1) provides excellent predictions of secondary inorganic particle species but underestimates the observed SOA mass by a factor of 25 when an older VOC-only parameterization is used, which is consistent with many previous model-measurement comparisons for pre-2007 anthropogenic SOA modules in urban areas. Including SOA from primary semi-volatile and intermediate-volatility organic compounds (P-S/IVOCs) following the parameterizations of Robinson et al. (2007), Grieshop et al. (2009), or Pye and Seinfeld (2010) improves model-measurement agreement for mass concentration. The results from the three parameterizations show large differences (e.g., a factor of 3 in SOA mass) and are not well constrained, underscoring the current uncertainties in this area. Our results strongly suggest that other precursors besides VOCs, such as P-S/IVOCs, are needed to explain the observed

  4. Incidence of type 1 diabetes mellitus in 0 to 14-yr-old children in Croatia--2004 to 2012 study.

    Science.gov (United States)

    Rojnic Putarek, Natasa; Ille, Jasenka; Spehar Uroic, Anita; Skrabic, Veselin; Stipancic, Gordana; Krnic, Nevena; Radica, Ana; Marjanac, Igor; Severinski, Srecko; Svigir, Alen; Bogdanic, Ana; Dumic, Miroslav

    2015-09-01

    The incidence of type 1 diabetes mellitus (T1DM) among children and adolescents increased during the last 50 yr. The T1DM incidence in Croatia was 8.87/100.000/yr over 1995-2003, with an annual increase of 9%, which placed Croatia among countries with moderate risk for T1DM. To investigate incidence rates and trends of T1DM from 2004 to 2012 in 0 to 14-yr-old Croatian children, and to compare the results with previous studies in Croatia and other European countries. T1DM crude incidence rates are estimated for the entire group and three subgroups: 0-4, 5-9, and 10-14 yr. Standardized incidence is calculated using the method of direct standardization according to World Health Organization (WHO) standard world population. The incidence rates by gender, age groups, seasonality, and calendar year, and their interactions were analyzed using Poisson regression model. A total of 1066 cases were ascertained over 2004-2012. The standardized incidence was 17.23/100.000/yr (95% CI: 16.19-18.26), with no significant differences in incidence rates or trends between boys and girls. Statistically significant annual increase of 5.87% (p Croatia, thus placing Croatia among countries with high risk for T1DM. The annual increment of 5.87% is considerably lower than 9.0% reported earlier, but still higher than the European average (3.9%). The increase in incidence ceased in youngest children. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  5. Spectral analysis of the IntCal98 calibration curve: a Bayesian view

    International Nuclear Information System (INIS)

    Palonen, V.; Tikkanen, P.

    2004-01-01

    Preliminary results from a Bayesian approach to find periodicities in the IntCal98 calibration curve are given. It has been shown in the literature that the discrete Fourier transform (Schuster periodogram) corresponds to the use of an approximate Bayesian model of one harmonic frequency and Gaussian noise. Advantages of the Bayesian approach include the possibility to use models for variable, attenuated and multiple frequencies, the capability to analyze unevenly spaced data and the possibility to assess the significance and uncertainties of spectral estimates. In this work, a new Bayesian model using random walk noise to take care of the trend in the data is developed. Both Bayesian models are described and the first results of the new model are reported and compared with results from straightforward discrete-Fourier-transform and maximum-entropy-method spectral analyses

  6. Altimetry, bathymetry and geoid variations at the Gavdos permanent Cal/Val facility

    DEFF Research Database (Denmark)

    Mertikas, Stelios P.; Daskalakis, Antonis; Tziavos, Ilias N.

    2013-01-01

    The aim of this work has been to examine the relationship of steep bathymetry in the coastal areas around the permanent Cal/Val facility of Gavdos, and their influence on the produced calibration values for the Jason-2 satellite altimeter. The paper describes how changes in seafloor topography...... (from 200 to 3500m depth over a distance of 10km) are reflected on the determined altimeter parameters using different reference surfaces for satellite calibration. Finally, it describes the relation between these parameter trends and the region’s local characteristics.Using 3.5years of Jason-2...... to be related to the general oceanographic circulation, but others of short wavelength (in the order of 1km) are because of the insufficient geoid model resolution. Along Pass No. 109, the concealed effect of bathymetry on the geoid has produced a slope of 3.1cm over 14–21km from Gavdos. Along the other Pass No...

  7. Practical Aspects of CALS in Design and Manufacturing of Sheet Metal Products

    DEFF Research Database (Denmark)

    Shpitalni, Moshe; Alting, Leo; Bilberg, Arne

    1998-01-01

    The transition from design to process planning and to the various stages of manufacturing is traditionally sequential. In many cases, practical problems associated with manufacturing cannot be resolved if only individual processes are examined. These problems can be overcome, however, by adopting...... with the design and manufacture of sheet metal parts. It is demonstrated that through implementation of the CALS approach, the overall process can be optimised and products can be manufactured significantly more accurately, faster and less expensively.......The transition from design to process planning and to the various stages of manufacturing is traditionally sequential. In many cases, practical problems associated with manufacturing cannot be resolved if only individual processes are examined. These problems can be overcome, however, by adopting...

  8. Layered growth model and epitaxial growth structures for SiCAlN alloys

    International Nuclear Information System (INIS)

    Liu Zhaoqing; Ni Jun; Su Xiaoao; Dai Zhenhong

    2009-01-01

    Epitaxial growth structures for (SiC) 1-x (AlN) x alloys are studied using a layered growth model. First-principle calculations are used to determine the parameters in the layered growth model. The phase diagrams of epitaxial growth are given. There is a rich variety of the new metastable polytype structures at x=1/6 ,1/5 ,1/4 ,1/3 , and 1/2 in the layered growth phase diagrams. We have also calculated the electronic properties of the short periodical SiCAlN alloys predicted by our layered growth model. The results show that various ordered structures of (SiC) 1-x (AlN) x alloys with the band gaps over a wide range are possible to be synthesized by epitaxial growth.

  9. 4E-BP1 regulates the differentiation of white adipose tissue.

    Science.gov (United States)

    Tsukiyama-Kohara, Kyoko; Katsume, Asao; Kimura, Kazuhiro; Saito, Masayuki; Kohara, Michinori

    2013-07-01

    4E Binding protein 1 (4E-BP1) suppresses translation initiation. The absence of 4E-BP1 drastically reduces the amount of adipose tissue in mice. To address the role of 4E-BP1 in adipocyte differentiation, we characterized 4E-BP1(-/-) mice in this study. The lack of 4E-BP1 decreased the amount of white adipose tissue and increased the amount of brown adipose tissue. In 4E-BP1(-/-) MEF cells, PPARγ coactivator 1 alpha (PGC-1α) expression increased and exogenous 4E-BP1 expression suppressed PGC-1α expression. The level of 4E-BP1 expression was higher in white adipocytes than in brown adipocytes and showed significantly greater up-regulation in white adipocytes than in brown adipocytes during preadipocyte differentiation into mature adipocytes. The amount of PGC-1α was consistently higher in HB cells (a brown preadipocyte cell line) than in HW cells (a white preadipocyte cell line) during differentiation. Moreover, the ectopic over-expression of 4E-BP1 suppressed PGC-1α expression in white adipocytes, but not in brown adipocytes. Thus, the results of our study indicate that 4E-BP1 may suppress brown adipocyte differentiation and PGC-1α expression in white adipose tissues. © 2013 The Authors Genes to Cells © 2013 by the Molecular Biology Society of Japan and Wiley Publishing Asia Pty Ltd.

  10. Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.

    Science.gov (United States)

    Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W

    2017-12-01

    We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.

  11. The Adaptation Study of the Questionnaires of the Attitude towards CALL (A-CALL), the Attitude towards CAL (A-CAL), the Attitude towards Foreign Language Learning (A-FLL) to Turkish Language

    Science.gov (United States)

    Erdem, Cahit; Saykili, Abdullah; Kocyigit, Mehmet

    2018-01-01

    This study primarily aims to adapt the Foreign Language Learning (FLL), Computer assisted Learning (CAL) and Computer assisted Language Learning (CALL) scales developed by Vandewaetere and Desmet into Turkish context. The instrument consists of three scales which are "the attitude towards CALL questionnaire" ("A-CALL")…

  12. Droplet activation properties of organic aerosols observed at an urban site during CalNex-LA

    Energy Technology Data Exchange (ETDEWEB)

    Mei, Fan [Brookhaven National Laboratory, Upton New York USA; Pacific Northwest National Laboratory, Richland Washington USA; Hayes, Patrick L. [Cooperative Institute for Research in Environmental Sciences, Boulder Colorado USA; Department of Chemistry and Biochemistry, University of Colorado, Boulder Colorado USA; Ortega, Amber [Cooperative Institute for Research in Environmental Sciences, Boulder Colorado USA; Department of Chemistry and Biochemistry, University of Colorado, Boulder Colorado USA; Taylor, Jonathan W. [School of Earth, Atmospheric and Environmental Sciences, University of Manchester, Manchester UK; Allan, James D. [School of Earth, Atmospheric and Environmental Sciences, University of Manchester, Manchester UK; National Centre for Atmospheric Science, University of Manchester, Manchester UK; Gilman, Jessica [NOAA Earth System Research Laboratory, Boulder Colorado USA; Kuster, William [NOAA Earth System Research Laboratory, Boulder Colorado USA; de Gouw, Joost [NOAA Earth System Research Laboratory, Boulder Colorado USA; Jimenez, Jose L. [Cooperative Institute for Research in Environmental Sciences, Boulder Colorado USA; Department of Chemistry and Biochemistry, University of Colorado, Boulder Colorado USA; Wang, Jian [Brookhaven National Laboratory, Upton New York USA

    2013-04-11

    Size-resolved cloud condensation nuclei (CCN) spectra and aerosol chemical composition were characterized at an urban supersite in Pasadena, California, from 15 May to 4 June 2010, during the CalNex campaign. The derived hygroscopicity (κCCN) of CCN-active particles with diameter between 97 and 165 nm ranged from 0.05 to 0.4. Diurnal variation showed a slight decrease of κCCN from 8:00 to 16:00 (from 0.24 to 0.20), which is attributed to increasing organics volume fraction resulted from secondary organic aerosol (SOA) formation. The derived hygroscopicity distribution and maximum activated fraction of the size selected particles were examined as functions of photochemical age. The result indicates that condensation of secondary species (e.g., SOA and sulfate) quickly converted hydrophobic particles to hydrophilic ones, and during daytime, nearly every particle became a CCN at ~0.4% in just a few hours. Based on κCCN and aerosol chemical composition, the organic hygroscopicity (κorg) was derived, and ranged from 0.05 to 0.23 with an average value of 0.13, consistent with the results from earlier studies. The derived κorg generally increased with the organic oxidation level, and most of the variation in κorg could be explained by the variation of the organic O : C atomic ratio alone. The least squares fit of the data yielded κorg = (0.83 ± 0.06) × (O:C) + (-0.19 ± 0.02). Compared to previous results based on CCN measurements of laboratory generated aerosols, κorg derived from measurements during the CalNex campaign exhibited stronger increase with O : C atomic ratio and therefore substantially higher values for organics with average O : C greater than 0.5.

  13. CalWater 2 - Precipitation, Aerosols, and Pacific Atmospheric Rivers Experiment

    Science.gov (United States)

    Spackman, J. R.; Ralph, F. M.; Prather, K. A.; Cayan, D. R.; DeMott, P. J.; Dettinger, M. D.; Fairall, C. W.; Leung, L. R.; Rosenfeld, D.; Rutledge, S. A.; Waliser, D. E.; White, A. B.

    2014-12-01

    Emerging research has identified two phenomena that play key roles in the variability of the water supply and the incidence of extreme precipitation events along the West Coast of the United States. These phenomena include the role of (1) atmospheric rivers (ARs) in delivering much of the precipitation associated with major storms along the U.S. West Coast, and (2) aerosols—from local sources as well as those transported from remote continents—and their modulating effects on western U.S. precipitation. A better understanding of these processes is needed to reduce uncertainties in weather predictions and climate projections of extreme precipitation and its effects, including the provision of beneficial water supply. This presentation summarizes the science objectives and strategies to address gaps associated with (1) the evolution and structure of ARs including cloud and precipitation processes and air-sea interaction, and (2) aerosol interaction with ARs and the impact on precipitation, including locally-generated aerosol effects on orographic precipitation along the U.S. West Coast. Observations are proposed for multiple winter seasons as part of a 5-year broad interagency vision referred to as CalWater 2 to address these science gaps (http://esrl.noaa.gov/psd/calwater). In January-February 2015, a field campaign has been planned consisting of a targeted set of aircraft and ship-based measurements and associated evaluation of data in near-shore regions of California and in the eastern Pacific. In close coordination with NOAA, DOE's Atmospheric Radiation Measurement (ARM) program is also contributing air and shipborne facilities for ACAPEX (ARM Cloud Aerosol and Precipitation Experiment), a DOE-sponsored study complementing CalWater 2. Ground-based measurements from NOAA's HydroMeteorological Testbed (HMT) network in California and aerosol chemical instrumentation at Bodega Bay, California have been designed to add important near surface-level context for the

  14. The BP oil spill and the bounty of Plaquemines Parish.

    Science.gov (United States)

    Fertel, Randy

    2011-01-01

    The source of 25 to 30 percent of America's seafood, the Mississippi River Delta's cornucopian world is now uncertain. And yet, even if shrimp, oysters, and finfish are unaffected by the BP Oil Spill - a big if - one can already reflect on the passing of the culture once built upon gathering them. For almost three centuries, levees made life possible along the riverbanks and in the wetlands beyond. Those same levees also ensured the wetlands would eventually melt away into the Gulf. Cutting off the silt left behind during annual river inundations subjected the fragile land to erosion. Sulfur, natural gas, and oil production companies dug twenty thousand miles of canals to gain more direct routes to their fields and to pump out their mineral wealth. This caused salt-water intrusion that killed off plant life and caused more erosion. The world that sustained my Plaquemines ancestors was less subject to collapse following disasters not only because the ecosystem before the wetlands' ongoing loss was then more vibrant, complex, and robust; but also because their lives, especially their culinary lives, were more vibrant, complex, and robust. Life was hard, but when it came to putting food on the table, life followed the seasons.

  15. Mid-wavelength infrared unipolar nBp superlattice photodetector

    Science.gov (United States)

    Kazemi, Alireza; Myers, Stephen; Taghipour, Zahra; Mathews, Sen; Schuler-Sandy, Ted; Lee, Seunghyun; Cowan, Vincent M.; Garduno, Eli; Steenbergen, Elizabeth; Morath, Christian; Ariyawansa, Gamini; Scheihing, John; Krishna, Sanjay

    2018-01-01

    We report a Mid-Wavelength Infrared (MWIR) barrier photodetector based on the InAs/GaSb/AlSb type-II superlattice (T2SL) material system. The nBp design consists of a single unipolar barrier (InAs/AlSb SL) placed between a 4 μm thick p-doped absorber (InAs/GaSb SL) and an n-type contact layer (InAs/GaSb SL). At 80 K, the device exhibited a 50% cut-off wavelength of 5 μm, was fully turned-ON at zero bias and the measured QE was 50% (front side illumination with no AR coating) at 4.5 μm with a dark current density of 4.7 × 10-6 A/cm2 at Vb = 50 mV. At 150 K and Vb = 50 mV, the 50% cut-off wavelength increased to 5.3 μm, and the QE was 54% at 4.5 μm with a dark current of 5.0 × 10-4 A/cm2.

  16. Synchronizing Greenland ice-core records and the Meerfelder maar sediment record via the global cosmogenic radionuclide signature and insights on climate around 11,230 years BP

    Science.gov (United States)

    Mekhaldi, F.; Czymzik, M.; Brauer, A.; Martin-Puertas, C.; Aldahan, A.; Possnert, G.; Muscheler, R.

    2017-12-01

    The causal investigation of multiple paleoclimate records relies on the accuracy of their respective chronostratigraphy. To achieve relative synchronization, cosmogenic radionuclides are an excellent tool because their common signature is global and can be retrieved and measured in different paleoclimate archives. For instance, 10Be can be measured in both ice cores and lake sediments (Berggren et al., 2013; Czymzik et al., 2016) which allows for both archives to be anchored onto radiocarbon timescales by synchronizing 10Be with 14C. We investigate the period 11,500-11,000 years BP when a short cold climate spell is known, from ice-core proxy records, to have occurred in Greenland shortly after the onset of the Holocene - the Preboreal Oscillation (PBO). This period also coincides with one of the largest and longest-lived increase in 14C production rate during the Holocene, which most likely corresponds to a grand solar minimum (around 11,230-11,000 years BP). In consequence, this period ideally illustrates the potential of using a known and clear signal in the production rate of cosmogenic radionuclides as a synchronizing tool, such as caused by large variations in solar activity. Here we measure 10Be in Meerfelder Maar (a well-dated and widely used sediment record from Germany) around 11,230 years BP which allows us to align the 10Be signal in both the Meerfelder Maar (MFM) sediment record and the GRIP ice core to IntCal13. Doing so, we report that i) the structure of the grand solar minimum is well-preserved in the 10Be signal of MFM sediments, ii) the PBO in Greenland occurs during high levels of solar activity and is not clearly observed in MFM, and iii) the PBO in Greenland ends precisely at the onset of the grand solar minimum at 11,230 years BP which also corresponds to a depositional change in MFM sediments (Martin-Puertas et al., 2017). These results thus suggest that changes in solar activity could have been a forcing at play eventually resulting in the

  17. Mismatch between observed and modeled trends in dissolved upper-ocean oxygen over the last 50 yr

    Directory of Open Access Journals (Sweden)

    L. Stramma

    2012-10-01

    Full Text Available Observations and model runs indicate trends in dissolved oxygen (DO associated with current and ongoing global warming. However, a large-scale observation-to-model comparison has been missing and is presented here. This study presents a first global compilation of DO measurements covering the last 50 yr. It shows declining upper-ocean DO levels in many regions, especially the tropical oceans, whereas areas with increasing trends are found in the subtropics and in some subpolar regions. For the Atlantic Ocean south of 20° N, the DO history could even be extended back to about 70 yr, showing decreasing DO in the subtropical South Atlantic. The global mean DO trend between 50° S and 50° N at 300 dbar for the period 1960 to 2010 is –0.066 μmol kg−1 yr−1. Results of a numerical biogeochemical Earth system model reveal that the magnitude of the observed change is consistent with CO2-induced climate change. However, the pattern correlation between simulated and observed patterns of past DO change is negative, indicating that the model does not correctly reproduce the processes responsible for observed regional oxygen changes in the past 50 yr. A negative pattern correlation is also obtained for model configurations with particularly low and particularly high diapycnal mixing, for a configuration that assumes a CO2-induced enhancement of the C : N ratios of exported organic matter and irrespective of whether climatological or realistic winds from reanalysis products are used to force the model. Depending on the model configuration the 300 dbar DO trend between 50° S and 50° N is −0.027 to –0.047 μmol kg−1 yr−1 for climatological wind forcing, with a much larger range of –0.083 to +0.027 μmol kg−1 yr−1 for different initializations of sensitivity runs with reanalysis wind forcing. Although numerical models reproduce the overall sign and, to

  18. Retooling CalEnviroScreen: Cumulative Pollution Burden and Race-Based Environmental Health Vulnerabilities in California

    Science.gov (United States)

    2018-01-01

    The California Community Environmental Health Screening Tool (CalEnviroScreen) advances research and policy pertaining to environmental health vulnerability. However, CalEnviroScreen departs from its historical foundations and comparable screening tools by no longer considering racial status as an indicator of environmental health vulnerability and predictor of cumulative pollution burden. This study used conceptual frameworks and analytical techniques from environmental health and inequality literature to address the limitations of CalEnviroScreen, especially its inattention to race-based environmental health vulnerabilities. It developed an adjusted measure of cumulative pollution burden from the CalEnviroScreen 2.0 data that facilitates multivariate analyses of the effect of neighborhood racial composition on cumulative pollution burden, net of other indicators of population vulnerability, traffic density, industrial zoning, and local and regional clustering of pollution burden. Principal component analyses produced three new measures of population vulnerability, including Latina/o cumulative disadvantage that represents the spatial concentration of Latinas/os, economic disadvantage, limited English-speaking ability, and health vulnerability. Spatial error regression analyses demonstrated that concentrations of Latinas/os, followed by Latina/o cumulative disadvantage, are the strongest demographic determinants of adjusted cumulative pollution burden. Findings have implications for research and policy pertaining to cumulative impacts and race-based environmental health vulnerabilities within and beyond California. PMID:29659481

  19. Retooling CalEnviroScreen: Cumulative Pollution Burden and Race-Based Environmental Health Vulnerabilities in California

    Directory of Open Access Journals (Sweden)

    Raoul S. Liévanos

    2018-04-01

    Full Text Available The California Community Environmental Health Screening Tool (CalEnviroScreen advances research and policy pertaining to environmental health vulnerability. However, CalEnviroScreen departs from its historical foundations and comparable screening tools by no longer considering racial status as an indicator of environmental health vulnerability and predictor of cumulative pollution burden. This study used conceptual frameworks and analytical techniques from environmental health and inequality literature to address the limitations of CalEnviroScreen, especially its inattention to race-based environmental health vulnerabilities. It developed an adjusted measure of cumulative pollution burden from the CalEnviroScreen 2.0 data that facilitates multivariate analyses of the effect of neighborhood racial composition on cumulative pollution burden, net of other indicators of population vulnerability, traffic density, industrial zoning, and local and regional clustering of pollution burden. Principal component analyses produced three new measures of population vulnerability, including Latina/o cumulative disadvantage that represents the spatial concentration of Latinas/os, economic disadvantage, limited English-speaking ability, and health vulnerability. Spatial error regression analyses demonstrated that concentrations of Latinas/os, followed by Latina/o cumulative disadvantage, are the strongest demographic determinants of adjusted cumulative pollution burden. Findings have implications for research and policy pertaining to cumulative impacts and race-based environmental health vulnerabilities within and beyond California.

  20. 77 FR 77183 - Union Pacific Railroad Company-Abandonment of Freight Easement Exemption-in Alameda County, Cal...

    Science.gov (United States)

    2012-12-31

    ...--Abandonment of Residual Common Carrier Obligation Exemption--in Alameda County, Cal. (San Jose Industrial Lead... easement on, and for SCVTA, the owner of the line, to abandon its residual common carrier obligation for, a portion of the San Jose Industrial Lead between mileposts 5.38 and 7.35 near the Warm Springs freight rail...

  1. Retooling CalEnviroScreen: Cumulative Pollution Burden and Race-Based Environmental Health Vulnerabilities in California.

    Science.gov (United States)

    Liévanos, Raoul S

    2018-04-16

    The California Community Environmental Health Screening Tool (CalEnviroScreen) advances research and policy pertaining to environmental health vulnerability. However, CalEnviroScreen departs from its historical foundations and comparable screening tools by no longer considering racial status as an indicator of environmental health vulnerability and predictor of cumulative pollution burden. This study used conceptual frameworks and analytical techniques from environmental health and inequality literature to address the limitations of CalEnviroScreen, especially its inattention to race-based environmental health vulnerabilities. It developed an adjusted measure of cumulative pollution burden from the CalEnviroScreen 2.0 data that facilitates multivariate analyses of the effect of neighborhood racial composition on cumulative pollution burden, net of other indicators of population vulnerability, traffic density, industrial zoning, and local and regional clustering of pollution burden. Principal component analyses produced three new measures of population vulnerability, including Latina/o cumulative disadvantage that represents the spatial concentration of Latinas/os, economic disadvantage, limited English-speaking ability, and health vulnerability. Spatial error regression analyses demonstrated that concentrations of Latinas/os, followed by Latina/o cumulative disadvantage, are the strongest demographic determinants of adjusted cumulative pollution burden. Findings have implications for research and policy pertaining to cumulative impacts and race-based environmental health vulnerabilities within and beyond California.

  2. Neolithisation of the Aegean and Southeast Europe during the 6600–6000 calBC period of Rapid Climate Change

    Directory of Open Access Journals (Sweden)

    Bernhard Weninger

    2014-12-01

    Full Text Available In extension of the recently established ‘Rapid Climate Change (RCC Neolithisation Model’ (Clare 2013, in the present paper we demonstrate the existence of a remarkable coincidence between the exact (decadel-scale entry and departure dates of the Neolithic into/from the Aegean (~6600/6050 calBC with begin/end of RCC-conditions.

  3. The EuroSprite2005 Observational Campaign: an example of training and outreach opportunities for CAL young scientists

    Directory of Open Access Journals (Sweden)

    O. Chanrion

    2007-07-01

    Full Text Available The four year "Coupling of Atmospheric Layers (CAL" EU FP5 Research Training Network project studied unanswered questions related to transient luminous events (sprites, jets and elves in the upper atmosphere. Consisting of ten scientific work-packages CAL also included intensive training and outreach programmes for the young scientists hired. Educational activities were based on the following elements: national PhD programmes, activities at CAL and other meetings, a dedicated summer school, and two European sprite observational campaigns. The young scientists were strongly involved in the latter and, as an example, the "EuroSprite2005" observational campaign is presented in detail. Some of the young scientists participated in the instrument set-up, others in the campaign logistics, some coordinated the observations, and others gathered the results to build a catalogue. During the four-month duration of this campaign, all of them took turns in operating the system and making their own night observations. The ongoing campaign activities were constantly advertised and communicated via an Internet blog. In summary the campaign required all the CAL young scientists to embark on experimental work, to develop their organisational skills, and to enhance their ability to communicate their activities. The campaign was a unique opportunity to train and strengthen skills that will be an asset to their future careers and, overall, was most successful.

  4. Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage

    DEFF Research Database (Denmark)

    Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon

    2015-01-01

    Lamins A/C have been implicated in DNA damage response pathways. We show that the DNA repair protein 53BP1 is a lamin A/C binding protein. In undamaged human dermal fibroblasts (HDF), 53BP1 is a nucleoskeleton protein. 53BP1 binds to lamins A/C via its Tudor domain, and this is abrogated by DNA...... damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...

  5. Expression of the Transcription Factor E4BP4 in Human Basophils

    DEFF Research Database (Denmark)

    Jensen, Bettina Margrethe; Gohr, Maria; Poulsen, Lars Kærgaard

    2014-01-01

    Rationale The cytokine IL-3 plays an important role for human basophil development, function and survival. IL-3 is also reported to induce the expression of the transcription factor E4BP4, but it is not known whether E4BP4 is expressed in basophils and influences basophil responsiveness. The aim...... by Alcian blue. RNA was extracted (0.005-0.02 µg RNA from 0.5 - 1 x 106 cells), and the corresponding cDNA analyzed by real-time PCR where E4BP4 expression was calculated as 2-(CT(E4BP4) - CT(β-actin)). E4BP4 protein expression was visualized in basophil lysates (107 cells/ml) by Western blot followed...... the transcription factor E4BP4 which might have an impact on basophil histamine release....

  6. A new BP Fourier algorithm and its application in English teaching evaluation

    Science.gov (United States)

    Pei, Xuehui; Pei, Guixin

    2017-08-01

    BP neural network algorithm has wide adaptability and accuracy when used in complicated system evaluation, but its calculation defects such as slow convergence have limited its practical application. The paper tries to speed up the calculation convergence of BP neural network algorithm with Fourier basis functions and presents a new BP Fourier algorithm for complicated system evaluation. First, shortages and working principle of BP algorithm are analyzed for subsequent targeted improvement; Second, the presented BP Fourier algorithm adopts Fourier basis functions to simplify calculation structure, designs new calculation transfer function between input and output layers, and conducts theoretical analysis to prove the efficiency of the presented algorithm; Finally, the presented algorithm is used in evaluating university English teaching and the application results shows that the presented BP Fourier algorithm has better performance in calculation efficiency and evaluation accuracy and can be used in evaluating complicated system practically.

  7. The last glacial maximum (21 000-17 000 {sup 14}C yr B.P.) in the southern tropical Andes (Bolivia) based on diatom studies; Le dernier maximum glaciaire (21 000-17 000{sup 14}C ans B.P.) dans les Andes tropicales de Bolivies d`apres l`etude des diatomees

    Energy Technology Data Exchange (ETDEWEB)

    Sylvestre, F. [Angers Univ., 49 (France). Laboratoire de geologie; Servant-Vildary, S. [ORSTOM-MNHN-Esa, 75 - Paris (France). Laboratoire de geologie; Servant, M. [ORSTOM, 93 - Bondy (France)

    1998-11-01

    A diatom study, carried out on a core recovered in the Southern Altiplano (Coipasa salt lake 19 deg. S,68 deg. W) currently almost completely dry, shows that during the last glacial maximum he Coipasa salar was entirely occupied by a large shallow lake. Available data for the northern Altiplano (Lake Titicaca, 16 deg. S, 69 deg. W) indicate a water level 17 m lower than today. This opposition is explained by decreased tropical precipitations whose effects registered by Lake Titicaca were obliterated in the Coipasa salar by increased winter precipitation. (authors) 23 refs.

  8. Interactions of the human MCM-BP protein with MCM complex components and Dbf4.

    Directory of Open Access Journals (Sweden)

    Tin Nguyen

    Full Text Available MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.

  9. Interactions of the human MCM-BP protein with MCM complex components and Dbf4.

    Science.gov (United States)

    Nguyen, Tin; Jagannathan, Madhav; Shire, Kathy; Frappier, Lori

    2012-01-01

    MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.

  10. Crisis strategies in BP's Deepwater Horizon response : An image repair and situational crisis communication study

    OpenAIRE

    Johansson, Mikael

    2017-01-01

    The BP Deepwater Horizon crisis in 2010 was one the largest catastrophes in the history of the oil industry. BP was sued over the disaster, and lost several billion dollars. This study examines the crisis response strategies and/or image repair strategies, which can be found in BP's press releases following the Deepwater Horizon crisis. In particular, the study looks closer at what established crisis communication strategies could be discerned in the material, and how they are used discursive...

  11. Early diagenesis of recently deposited organic matter: A 9-yr time-series study of a flood deposit

    Science.gov (United States)

    Tesi, T.; Langone, L.; Goñi, M. A.; Wheatcroft, R. A.; Miserocchi, S.; Bertotti, L.

    2012-04-01

    In Fall 2000, the Po River (Italy) experienced a 100-yr return period flood that resulted in a 1-25 cm-thick deposit in the adjacent prodelta (10-25 m water depth). In the following years, numerous post-depositional perturbations occurred including bioturbation, reworking by waves with heights exceeding 5 m, as well as periods of extremely high and low sediment supply. Cores collected in the central prodelta after the Fall 2000 flood and over the following 9 yr, allowed characterization of the event-strata in their initial state and documentation of their subsequent evolution. Sedimentological characteristics were investigated using X-radiographs and sediment texture analyses, whereas the composition of sedimentary organic matter (OM) was studied via bulk and biomarker analyses, including organic carbon (OC), total nitrogen (TN), carbon stable isotope composition (δ13C), lignin phenols, cutin-products, p-hydroxy benzenes, benzoic acids, dicarboxylic acids, and fatty acids. The 9-yr time-series analysis indicated that roughly the lower half of the original event bed was preserved in the sediment record. Conversely, the upper half of the deposit experienced significant alterations including bioturbation, addition of new material, as well as coarsening. Comparison of the recently deposited material with 9-yr old preserved strata represented a unique natural laboratory to investigate the diagenesis of sedimentary OM in a non-steady system. Bulk data indicated that OC and TN were degraded at similar rates (loss ∼17%) whereas biomarkers exhibited a broad spectrum of reactivities (loss from ∼6% to ∼60%) indicating selective preservation during early diagenesis. Given the relevance of episodic sedimentation in several margins, this study has demonstrated the utility of event-response and time-series sampling of the seabed for understanding the early diagenesis in non-steady conditions.

  12. A Lactose-Binding Lectin from the Marine Sponge Cinachyrella Apion (Cal) Induces Cell Death in Human Cervical Adenocarcinoma Cells

    Science.gov (United States)

    Rabelo, Luciana; Monteiro, Norberto; Serquiz, Raphael; Santos, Paula; Oliveira, Ruth; Oliveira, Adeliana; Rocha, Hugo; Morais, Ana Heloneida; Uchoa, Adriana; Santos, Elizeu

    2012-01-01

    Cancer represents a set of more than 100 diseases, including malignant tumors from different locations. Strategies inducing differentiation have had limited success in the treatment of established cancers. Marine sponges are a biological reservoir of bioactive molecules, especially lectins. Several animal and plant lectins were purified with antitumor activity, mitogenic, anti-inflammatory and antiviral, but there are few reports in the literature describing the mechanism of action of lectins purified from marine sponges to induce apoptosis in human tumor cells. In this work, a lectin purified from the marine sponge Cinachyrella apion (CaL) was evaluated with respect to its hemolytic, cytotoxic and antiproliferative properties, besides the ability to induce cell death in tumor cells. The antiproliferative activity of CaL was tested against HeLa, PC3 and 3T3 cell lines, with highest growth inhibition for HeLa, reducing cell growth at a dose dependent manner (0.5–10 µg/mL). Hemolytic activity and toxicity against peripheral blood cells were tested using the concentration of IC50 (10 µg/mL) for both trials and twice the IC50 for analysis in flow cytometry, indicating that CaL is not toxic to these cells. To assess the mechanism of cell death caused by CaL in HeLa cells, we performed flow cytometry and western blotting. Results showed that lectin probably induces cell death by apoptosis activation by pro-apoptotic protein Bax, promoting mitochondrial membrane permeabilization, cell cycle arrest in S phase and acting as both dependent and/or independent of caspases pathway. These results indicate the potential of CaL in studies of medicine for treating cancer. PMID:22690140

  13. A Lactose-Binding Lectin from the Marine Sponge Cinachyrella Apion (Cal Induces Cell Death in Human Cervical Adenocarcinoma Cells

    Directory of Open Access Journals (Sweden)

    Adriana Uchoa

    2012-03-01

    Full Text Available Cancer represents a set of more than 100 diseases, including malignant tumors from different locations. Strategies inducing differentiation have had limited success in the treatment of established cancers. Marine sponges are a biological reservoir of bioactive molecules, especially lectins. Several animal and plant lectins were purified with antitumor activity, mitogenic, anti-inflammatory and antiviral, but there are few reports in the literature describing the mechanism of action of lectins purified from marine sponges to induce apoptosis in human tumor cells. In this work, a lectin purified from the marine sponge Cinachyrella apion (CaL was evaluated with respect to its hemolytic, cytotoxic and antiproliferative properties, besides the ability to induce cell death in tumor cells. The antiproliferative activity of CaL was tested against HeLa, PC3 and 3T3 cell lines, with highest growth inhibition for HeLa, reducing cell growth at a dose dependent manner (0.5–10 µg/mL. Hemolytic activity and toxicity against peripheral blood cells were tested using the concentration of IC50 (10 µg/mL for both trials and twice the IC50 for analysis in flow cytometry, indicating that CaL is not toxic to these cells. To assess the mechanism of cell death caused by CaL in HeLa cells, we performed flow cytometry and western blotting. Results showed that lectin probably induces cell death by apoptosis activation by pro-apoptotic protein Bax, promoting mitochondrial membrane permeabilization, cell cycle arrest in S phase and acting as both dependent and/or independent of caspases pathway. These results indicate the potential of CaL in studies of medicine for treating cancer.

  14. BP reactivity to public speaking in stage 1 hypertension: influence of different task scenarios.

    Science.gov (United States)

    Palatini, Paolo; Bratti, Paolo; Palomba, Daniela; Bonso, Elisa; Saladini, Francesca; Benetti, Elisabetta; Casiglia, Edoardo

    2011-10-01

    To investigate the blood pressure (BP) reaction to public speaking performed according to different emotionally distressing scenarios in stage 1 hypertension. METHODS. We assessed 64 hypertensive and 30 normotensive subjects. They performed three speech tasks with neutral, anger and anxiety scenarios. BP was assessed with the Finometer beat-to-beat non-invasive recording system throughout the test procedure. For all types of speech, the systolic BP response was greater in the hypertensive than the normotensive subjects (all p public speaking is increased in stage 1 hypertension. A speech with anxiety or anger scenario elicits a greater diastolic BP reaction than tasks with neutral content.

  15. TopBP1 associates with NBS1 and is involved in homologous recombination repair

    International Nuclear Information System (INIS)

    Morishima, Ken-ichi; Sakamoto, Shuichi; Kobayashi, Junya; Izumi, Hideki; Suda, Tetsuji; Matsumoto, Yoshiyuki; Tauchi, Hiroshi; Ide, Hiroshi; Komatsu, Kenshi; Matsuura, Shinya

    2007-01-01

    TopBP1 is involved in DNA replication and DNA damage checkpoint. Recent studies have demonstrated that TopBP1 is a direct positive effecter of ATR. However, it is not known how TopBP1 recognizes damaged DNA. Here, we show that TopBP1 formed nuclear foci after exposure to ionizing radiation, but such TopBP1 foci were abolished in Nijmegen breakage syndrome cells. We also show that TopBP1 physically associated with NBS1 in vivo. These results suggested that NBS1 might regulate TopBP1 recruitment to the sites of DNA damage. TopBP1-depleted cells showed hypersensitivity to Mitomycin C and ionizing radiation, an increased frequency of sister-chromatid exchange level, and a reduced frequency of DNA double-strand break induced homologous recombination repair. Together, these results suggested that TopBP1 might be a mediator of DNA damage signaling from NBS1 to ATR and promote homologous recombination repair

  16. Prediction of Industrial Electric Energy Consumption in Anhui Province Based on GA-BP Neural Network

    Science.gov (United States)

    Zhang, Jiajing; Yin, Guodong; Ni, Youcong; Chen, Jinlan

    2018-01-01

    In order to improve the prediction accuracy of industrial electrical energy consumption, a prediction model of industrial electrical energy consumption was proposed based on genetic algorithm and neural network. The model use genetic algorithm to optimize the weights and thresholds of BP neural network, and the model is used to predict the energy consumption of industrial power in Anhui Province, to improve the prediction accuracy of industrial electric energy consumption in Anhui province. By comparing experiment of GA-BP prediction model and BP neural network model, the GA-BP model is more accurate with smaller number of neurons in the hidden layer.

  17. BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer

    Science.gov (United States)

    Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.

    2010-01-01

    Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225

  18. Research on wind field algorithm of wind lidar based on BP neural network and grey prediction

    Science.gov (United States)

    Chen, Yong; Chen, Chun-Li; Luo, Xiong; Zhang, Yan; Yang, Ze-hou; Zhou, Jie; Shi, Xiao-ding; Wang, Lei

    2018-01-01

    This paper uses the BP neural network and grey algorithm to forecast and study radar wind field. In order to reduce the residual error in the wind field prediction which uses BP neural network and grey algorithm, calculating the minimum value of residual error function, adopting the residuals of the gray algorithm trained by BP neural network, using the trained network model to forecast the residual sequence, using the predicted residual error sequence to modify the forecast sequence of the grey algorithm. The test data show that using the grey algorithm modified by BP neural network can effectively reduce the residual value and improve the prediction precision.

  19. Association of Autoantibodies to BP180 with Disease Activity in Greek Patients with Bullous Pemphigoid

    Directory of Open Access Journals (Sweden)

    Aikaterini Patsatsi

    2012-01-01

    Full Text Available 39 bullous pemphigoid (BP patients were studied to assess the clinical significance of anti-BP180 and anti-BP230 circulating autoantibodies of BP and correlate their titers with the clinical scores of the BP Disease Area Index (BPDAI and the Autoimmune Bullous Skin Disorder Intensity Score (ABSIS as well as with the intensity of pruritus measured by the BPDAI pruritus component. All parameters were evaluated by the time of diagnosis (baseline, month 3, and month 6. Titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with BPDAI component for the intensity of pruritus (, at baseline. At month 3, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . At month 6, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . There was no statistically significant correlation between titers of anti-BP230 autoantibodies and the BPDAI, ABSIS, and BPDAI component for the intensity of pruritus at the same time points.

  20. Nuclear Enterprises portable dose rate meter type PDR4 and external probes types BP1/1, BP8 and GP9

    International Nuclear Information System (INIS)

    Burgess, P.H.; Iles, W.J.

    1979-08-01

    The performance characteristics of Nuclear Enterprises Portable Dose Rate Meter Type PDR4 are evaluated under the headings: general description, facilities and controls, radiation characteristics, electrical characteristics, environmental characteristics, mechanical characteristics, the manual, summary of performance, and conclusions. Results of an investigation of the radiation characteristics of the external probes Type BP1/1, Type BP8, and Type GP9 are also detailed. (U.K.)