Sedimentary Evidence for a Rapid Sea Level Rise at 7,600 cal yr BP from North-Central Cuba
Peros, M. C.; Agosta G'meiner, A. M.; Collins, S.
2016-12-01
A lack of high-resolution relative sea level (RSL) proxy data has meant that the pattern of early Holocene RSL change in the Caribbean is poorly understood. A RSL curve published by Toscano and Macintyre (2003) using inter-tidal mangrove peats and submerged corals suggests RSL underwent a relatively fast and `smooth' curvilinear increase during the Holocene. However, others, such as Blanchon and Shaw (1995), suggest that RSL increased rapidly at around 7600 cal yr BP, in response to the final stages of the melting of the Laurentide Ice Sheet (melt water pulse 1C or catastrophic rise event 3). We investigated this question using multi-proxy data from a flooded sinkhole (Cenote Jennifer) on the north coast of central Cuba. Cenote Jennifer is located 7 m above mean sea level and 2 km from the Bahamas Channel and appears to have a high degree of connectivity with the ocean through a network of underground caverns. The water depth is 13 m and the bottommost 5 m is anoxic. A sediment core collected from Cenote Jennifer was studied using loss-on-ignition, pollen analysis, high-resolution XRF core-scanning, and grain size analysis. An age-depth model was generated for the core by AMS dating. The results show that the bottommost stratigraphic unit ( 9000 to 7600 cal yr BP) is a fine-grained carbonate-rich mud (i.e., marl). This unit abruptly transitions into finely laminated organic-rich sediment from 7600 cal yr BP to the present. The pollen analysis shows that the sinkhole supported a cattail (Typha) community until 7600 cal yr BP, indicating low water levels ( 1 m). At 7600 cal yr BP, the cattail community disappeared and the vegetation of the surrounding bedrock became dominated by a thorny coastal scrubland. In addition, a 3 cm thick fining-upward siliciclastic unit is present immediately above the marl-organic contact, suggesting: 1) a marine sediment source given the limestone-dominated nature of the region, and 2) the presence of a short-duration, high
Ma, Minmin; Dong, Guanghui; Jia, Xin; Wang, Hui; Cui, Yifu; Chen, Fahu
2017-04-01
:Human diets rely on natural resource availability and can reflect social and cultural values. When environments, societies, and cultures change, diets may also shift. This study traced the extent of dietary change and the factors influencing such change. Through stable carbon and nitrogen isotopic analysis of late Neolithic and early Bronze Age human and animal bone collagen, we found that significant shifts in human diets were closely associated with intercontinental cultural exchanges in Eurasia and climate change in northwestern China. The isotopic evidence indicated that human diets mainly consisted of C4 foodstuffs (presumably millet and/or animals fed with C4 foods) around 4000 calibrated years before the present (cal yr BP), corresponding to the flourishing of millet agriculture in the context of the optimal climate conditions of the mid-Holocene. Subsequently, more C3 foods (probably wheat, barley, and animals fed with C3 foods) were added to human diets post-3600 cal yr BP when the climate became cooler and drier. Such dietary variation is also consistent with the increasing intensity of long-distance exchange after 4000 cal yr BP. While many factors can lead to human dietary shifts (e.g. climate change, population growth, cultural factors, and human migration), climate may have been a key factor in Gansu and Qinghai.
Mensing, Scott A.; Sharpe, Saxon E.; Tunno, Irene; Sada, Don W.; Thomas, Jim M.; Starratt, Scott W.; Smith, Jeremy
2013-01-01
Evidence of a multi-centennial scale dry period between ∼2800 and 1850 cal yr BP is documented by pollen, mollusks, diatoms, and sediment in spring sediments from Stonehouse Meadow in Spring Valley, eastern central Nevada, U.S. We refer to this period as the Late Holocene Dry Period. Based on sediment recovered, Stonehouse Meadow was either absent or severely restricted in size at ∼8000 cal yr BP. Beginning ∼7500 cal yr BP, the meadow became established and persisted to ∼3000 cal yr BP when it began to dry. Comparison of the timing of this late Holocene drought record to multiple records extending from the eastern Sierra Nevada across the central Great Basin to the Great Salt Lake support the interpretation that this dry period was regional. The beginning and ending dates vary among sites, but all sites record multiple centuries of dry climate between 2500 and 1900 cal yr BP. This duration makes it the longest persistent dry period within the late Holocene. In contrast, sites in the northern Great Basin record either no clear evidence of drought, or have wetter than average climate during this period, suggesting that the northern boundary between wet and dry climates may have been between about 40° and 42° N latitude. This dry in the southwest and wet in the northwest precipitation pattern across the Great Basin is supported by large-scale spatial climate pattern hypotheses involving ENSO, PDO, AMO, and the position of the Aleutian Low and North Pacific High, particularly during winter.
Marine04 marine radiocarbon age calibration, 0-26 cal kyr BP
Hughen, Konrad A.; Baillie, Mike G.L.; Bard, Edouard; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, Richard L.; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Paula J.; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.
2004-01-01
New radiocarbon calibration curves, IntCal04 and Marine04, have been constructed and internationally ratified to replace the terrestrial and marine components of IntCal98. The new calibration data sets extend an additional 2000 yr, from 0–26 cal kyr BP (Before Present, 0 cal BP = AD 1950), and
Carcaillet, Christopher; Hörnberg, Greger; Zackrisson, Olle
2012-11-01
New studies indicate the presence of early Holocene ice-free areas far north in Scandinavia. Post-glacial fire and vegetation were investigated based on sedimentary charcoal and pollen from two small lakes in northern Sweden. Accumulation of organic sediment started around 10,900 and 9200 cal yr BP, showing that both lake valleys were ice-free extremely early given their northerly location. Fire events started after 9600 cal yr BP and became less common around the '8.2-ka event'. Woody vegetation provided fuel that contributed to fires. The first vegetation in our pollen record consisted of Hippophae, Dryas, grasses and sedges. Subsequently broadleaved trees (Betula, Salix) increased in abundance and later Pinus, Alnus, ferns and Lycopodium characterized the vegetation. Pollen from Larix, Picea and Malus were also found. The change in vegetation composition was synchronous with the decrease in lake-water pH in the region, indicating ecosystem-scale processes; this occurred during a period of net global and regional warming. The changes in fire frequency and vegetation appear independent of regional trends in precipitation. The reconstructed fire history and vegetation support the scenario of early ice-free areas far north in Scandinavia during early Holocene warming, creating favorable conditions for woody plants and wildfires.
14C concentrations in the old woods at 6000yrBP and the variations of cosmic rays
International Nuclear Information System (INIS)
Sato, Taiichi; Sakurai, Hirohisa; Tokanai, Huyuki
2008-01-01
A large quantity of old woods was recently excavated with the Chuetsu-oki Earthquake in the bottom of the sea of near the Izumozaki-oki Nigata Prefecture. First of all, we have measured the radiocarbon ages for the three samples to identify the calendar ages of the woods. The radiocarbon ages were 5357±45 yrBP, 4573±52 yrBP, and 4812±52 yrBP, respectively. Using the OXCAL program, the calendar ages were calculated in the range from 6300 yrBP to 5100 yrBP. The IntCal04 data shows that the 14 C concentrations with the era are very variable with 20 per mille variations. We show a plan to investigate 14 C concentrations of the old tree rings around 6000 yrBP. (author)
IntCal04 terrestrial radiocarbon age calibration, 0-26 cal kyr BP
Reimer, Paula J.; Baillie, Mike G.L.; Bard, Edouard; Bayliss, Alex; Beck, J. Warren; Bertrand, Chanda J.H.; Blackwell, Paul G.; Buck, Caitlin E.; Burr, George S.; Cutler, Kirsten B.; Damon, Paul E.; Edwards, R. Lawrence; Fairbanks, Richard G.; Friedrich, Michael; Guilderson, Thomas P.; Hogg, Alan G.; Hughen, Konrad A.; Kromer, Bernd; McCormac, Gerry; Manning, Sturt; Bronk Ramsey, Christopher; Reimer, Ron W.; Remmele, Sabine; Southon, John R.; Stuiver, Minze; Talamo, Sahra; Taylor, F.W.; Plicht, Johannes van der; Weyhenmeyer, Constanze E.
2004-01-01
A new calibration curve for the conversion of radiocarbon ages to calibrated (cal) ages has been constructed and internationally ratified to replace IntCal98, which extended from 0–24 cal kyr BP (Before Present, 0 cal BP = AD 1950). The new calibration data set for terrestrial samples extends from
NotCal04 : Comparison/calibration C-14 records 26-50 cal kyr BP
Plicht, J. van der; Beck, J.W.; Bard, E.; Baillie, M.G.L.; Blackwell, P.G.; Buck, C.E.; Friedrich, M.; Guilderson, T.P.; Hughen, K.A.; Kromer, B.; McCormac, F.G.; Bronk Ramsey, C.; Reimer, P.J.; Reimer, R.W.; Remmele, S.; Richards, D.A.; Southon, J.R.; Stuiver, M.; Weyhenmeyer, C.E.
2004-01-01
The radiocarbon calibration curve ImCal04 extends back to 26 cal kyr BP. While several high-resolution records exist beyond this limit, these data sets exhibit discrepancies of up, to several millennia. As a result, no calibration curve for the time range 26-50 cal kyr BP can be recommended as yet,
International Nuclear Information System (INIS)
Switsur, Roy
1986-01-01
A history of the development of the technique of radiocarbon dating highlights the two problems with this method. The first is calibration; the radiocarbon calendar is not linear. However two independent experiments to provide high precision measurements in tree rings have resulted in a high precision calibration curve. The second is how to denote radiocarbon ages and calibrated dates, as this depends on how the dendrochronology time scale used in the calibration is transferred to the actual calendar. If the zero of the dendroscale is transferred from the origin of the Christian calendar to AD 1950, radiocarbon ages are designated CAL BP (BP = before present). There is an alternative method which results in CAL AD and CAL BC. A suggestion for a standard notation is made to avoid the confusion of two systems. (U.K.)
INTCAL09 AND MARINE09 RADIOCARBON AGE CALIBRATION CURVES, 0-50,000 YEARS CAL BP
Reimer, P. J.; Baillie, M. G. L.; Bard, E.; Bayliss, A.; Beck, J. W.; Blackwell, P. G.; Ramsey, C. Bronk; Buck, C. E.; Burr, G. S.; Edwards, R. L.; Friedrich, M.; Grootes, P. M.; Guilderson, T. P.; Hajdas, I.; Heaton, T. J.; Hogg, A. G.; Hughen, K. A.; Kaiser, K. F.; Kromer, B.; McCormac, F. G.; Manning, S. W.; Reimer, R. W.; Richards, D. A.; Southon, J. R.; Talamo, S.; Turney, C. S. M.; van der Plicht, J.; Weyhenmeye, C. E.; Weyhenmeyer, C.E.
2009-01-01
The IntCal04 and Marine04 radiocarbon calibration curves have been updated from 12 cal kBP (cal kBP is here defined as thousands of calibrated years before AD 1950), and extended to 50 cal kBP, utilizing newly available data sets that meet the IntCal Working Group criteria for pristine corals and
Carter, V.; Shinker, J. J.
2017-12-01
Roughly 4200 years ago, a 150-year long mega drought occurred in the central Rocky Mountains, as indicated by pollen evidence from lake sediments from Long Lake, south-eastern Wyoming. However, pollen evidence does not record the climate mechanisms that caused the drought; they only provide evidence that the drought occurred. A modern climate analogue technique using North American Regional Reanalysis data was applied to the sedimentary data in order to identify possible synoptic and dynamic patterns that may have caused the mega drought at 4200 cal yr BP. Our results suggest warm and dry conditions were a result of anomalously higher-than-normal geopotential heights that were centred over the Great Plains beginning in the spring and persisting through the fall. Drought conditions during the growing seasons was the result of the anomalous high-pressure ridge, which suppressed moisture transport via the low level jet from the Gulf of Mexico, as well as brought in dry continental air from in the interior region of North America. The conditions associated with modern analogues offer a potential climate mechanism that caused the mega drought 4200 years ago, and likely led to the changes in vegetation composition as evidenced by the pollen record from Long Lake, Wyoming.
International Nuclear Information System (INIS)
Kobayashi, T.; Nairn, I.; Smith, V.; Shane, P.
2005-01-01
The c. 5600 cal. yr BP Whakatane eruption episode consisted of a sequence of intracaldera rhyolite eruptions from at least five vents spread over 11 km of the Haroharo linear vent zone within Okataina Volcanic Centre. Initial vent-opening eruptions from the Haroharo vent produced coarse lithic clast 'blast beds' and pyroclastic density currents surges). These were immediately followed by eruption of very mobile pumiceous pyroclastic surges from the Makatiti vent 6 km to the southwest. Major plinian eruptions from the Makatiti vent then dispersed Whakatane Tephra pumice fall deposits (bulk volume c. 6 km 3 ) across the northeastern North Island while smaller explosive eruptions produced pyroclastic flows and falls from the Haroharo-Rotokohu vents and at the Pararoa vent on the caldera rim 11 km northeast from Makatiti. The pyroclastic eruptions at all vents were followed by the extrusion of lava flows and domes; extruded lava volumes ranged from 0.03 km 3 for the Pararoa dome to 7.5 km 3 for the Makatiti-Tapahoro lava flows and domes. Minor variations in whole rock and glass chemistry show that the three main vent areas each tapped a slightly different high-silica rhyolite magma. About 10 km 3 of M-type magma was erupted from the Makatiti-Tapahoro vents; c. 1.3 km 3 of H-type magma from the Haroharo-Rotokohu vents, and 0.04 km 3 of P-type magma from the Pararoa vent. There are no significant weathering or erosional breaks within the Whakatane eruptive sequence, which suggests that all Whakatane eruptions occurred within a short time interval. However, extrusion of the Haroharo dome within the Makatiti pyroclastic eruption sequence suggests a duration of c. 2 yr for the main pyroclastic eruption phase. Emplacement of the following voluminous (7.5 km 3 ) lavas from the Makatiti-Tapahoro vents would have occurred over >10 yr at the c. 10-20 m 3 /s inferred extrusion rates. (author). 19 refs., 16 figs., 7 tabs
Tasmaloum, Vanuatu Fossil Coral SST Reconstruction for 4200 YrBP
National Oceanic and Atmospheric Administration, Department of Commerce — Vanuatu Fossil Coral SST Reconstruction, 4200 YrBP. Paleobathymetry estimated at 10-15 m. SST reconstruction is based on the analysis of Sr/Ca and U/Ca ratios in...
Pena, L. D.; Francés, G.; Diz, P.; Nombela, M. A.; Alejo, I.
2003-04-01
Carbon and oxygen stable isotopes and ICP-OES elemental ratio concentrations (Mg/Ca, Sr/Ca, Ba/Ca) from core EUGC-3B (42 45.10'N; 9 02.23'W, at 38 m.b.s.l. and 410 cm length) were measured over monospecific benthic foraminiferal samples (Nonion fabum) ranging over the last 4500 yr BP. From the oldest analysed sample (289 cm) to the core top, stable isotopes signal shows that the whole record can be separated into 4 intervals lasting each of them about 1000 yr. The lowermost interval (4300-3000 yr BP) is characterized by relatively stable delta 18O values (mean 1.77 per mil). Delta 13C is relatively low except for a maximum around 3300 cal BP (-1.50 per mil). An abrupt decrease down to the minimum value in delta 13C (-4.41 per mil) is accomplished in approximately 200 yr. Mg/Ca and Ba/Ca match perfectly this event, both of them showing the respective maxima values. Sr/Ca has a very similar behaviour to that of delta 13C but with smoother fluctuations. We attribute high values of delta 13C, Sr/Ca and Ba/Ca to periods of enhanced coastal productivity, probably due to reinforced upwelling events in the region. According to Mg/Ca signal this reinforcement took place during a relatively warmer period. The most remarkable feature during the two next periods (3000-1900 yr BP and 1900-1000 yr BP) consists of a stepwise increase of delta 13C values punctuated by a sharp decrease at the end of each interval. All the remaining proxies exhibit a nearly constant trend over these intervals. Each period can be interpreted as a weak enhance of marine productivity that the system does not hold up and finally aborts. The most recent interval represents the establishment of current conditions in the coastal system. The most conspicuous event from this interval consists of an abrupt decrease of the delta 18O that lasted for 300 yr. This event could be correlated with the well recognized warm climatic event known as the Medieval Warm Period. However the Mg/Ca ratio does not show high
Ruan, J.; Kherbouche, F.; Genty, D.; Blamart, D.; Cheng, H.; Dewilde, F.; Hachi, S.; Edwards, L. R.; Régnier, E.; Michelot, J.-L.
2015-07-01
Middle Holocene cultures have been widely studied round the E-Mediterranean basin in the last 30 years and past cultural activities have been commonly linked with regional climate changes. However, in many cases such linkage is equivocal, in part due to existing climatic evidence that has been derived from areas outside the distribution of ancient settlements, leading to uncertainty from complex spatial heterogeneity in both climate and demography. A few high-resolution well-dated paleoclimate records were recently established using speleothems in the Central and E-Mediterranean basin, however, the scarcity of such records in the western part of the Mediterranean prevents us from correlating past climate evolutions across the basin and deciphering climate-culture relation at fine time scales. Here we report the first decadal-resolved Mid-Holocene climate proxy records from the W-Mediterranean basin based on the stable carbon and oxygen isotopes analyses of two U/Th dated stalagmites from the Gueldaman GLD1 Cave in N-Algeria. Comparison of our records with those from Italy and Israel reveals synchronous (multi) centennial dry phases centered at ca. 5600, ca. 5200 and ca. 4200 yr BP across the Mediterranean basin. New calibrated radiocarbon dating constrains reasonably well the age of rich anthropogenic deposits (e.g., faunal remains, pottery, charcoal) excavated inside the cave, which allows the comparison between in situ evidence of human occupation and of climate change. This approach shows that the timing of a prolonged drought at ca. 4400-3800 yr BP blankets the onset of cave abandonment shortly after ca. 4403 cal yr BP, supporting the hypothesis that a climate anomaly may have played a role in this cultural disruption.
Ruan, J.; Kherbouche, F.; Genty, D.; Blamart, D.; Cheng, H.; Dewilde, F.; Hachi, S.; Edwards, R. L.; Régnier, E.; Michelot, J.-L.
2016-01-01
Middle Holocene cultures have been widely studied around the Eastern-Mediterranean basin in the last 30 years and past cultural activities have been commonly linked with regional climate changes. However, in many cases such linkage is equivocal, in part due to existing climatic evidence that has been derived from areas outside the distribution of ancient settlements, leading to uncertainty from complex spatial heterogeneity in both climate and demography. A few high-resolution well-dated paleoclimate records were recently established using speleothems in the Central and Eastern-Mediterranean basin, however, the scarcity of such records in the western part of the Mediterranean prevents us from correlating past climate evolutions across the basin and deciphering climate-culture relation at fine timescales. Here we report the first decadal-resolved Mid-Holocene climate proxy records from the Western-Mediterranean basin based on the stable carbon and oxygen isotopes analyses of two U/Th dated stalagmites from the Gueldaman GLD1 Cave in Northern Algeria. Comparison of our records with those from Italy and Israel reveals synchronous (multi) centennial dry phases centered at ca. 5600, ca. 5200 and ca. 4200 yr BP across the Mediterranean basin. New calibrated radiocarbon dating constrains reasonably well the age of rich anthropogenic deposits (e.g., faunal remains, pottery, charcoal) excavated inside the cave, which allows the comparison between in situ evidence of human occupation and of climate change. This approach shows that the timing of a prolonged drought at ca. 4400-3800 yr BP blankets the onset of cave abandonment shortly after ca. 4403 cal yr BP, supporting the hypothesis that a climate anomaly may have played a role in this cultural disruption.
Directory of Open Access Journals (Sweden)
X. Crosta
2012-03-01
Full Text Available Opal content and diatom assemblages were analysed in core GeoB4905-4 to reconstruct siliceous productivity changes in the eastern Gulf of Guinea during the last 40 000 yr. Opal and total diatom accumulation rates presented low values over the considered period, except during the Last Glacial Maximum and between 15 000 calendar years Before Present (15 cal. ka BP and 5.5 cal. ka BP, the so-called African Humid Period, when accumulation rates of brackish and freshwater diatoms at the core site were highest. Conversely, accumulation rates of windblown diatoms exhibited an opposite pattern with higher values before and after the African Humid Period and greatest values during Heinrich Events, the Younger Dryas and since 5.5 cal. ka BP.
Our results demonstrate that siliceous productivity in the eastern Gulf of Guinea was directly driven by the nutrient load from local rivers, whose discharges were forced by precipitation changes over western Equatorial Africa and/or modification of the fluvio-deltaic systems forced by sea level changes. Precipitation in this region is controlled by the West African monsoon which is, in turn, partly dependent on the presence and intensity of the Atlantic Cold Tongue (ACT. Our results therefore suggest that the ACT was weakened, warmer trade winds were less vigorous, and cloud convection and precipitation were greater during the AHP though centennial-to-millennial timescale dry events were observed at ∼10 cal. ka BP, ∼8.5 cal. ka BP and ∼6 cal. ka BP. Conversely, the ACT was more intense, trade winds were more vigorous and African climate was more arid during H1, the Younger Dryas and after 5.5 cal. ka BP into the present.
Directory of Open Access Journals (Sweden)
J. C. Stager
2012-05-01
Full Text Available The austral westerlies strongly influence precipitation and ocean circulation in the southern temperate zone, with important consequences for cultures and ecosystems. Global climate models anticipate poleward retreat of the austral westerlies with future warming, but the available paleoclimate records that might test these models have been limited to South America and New Zealand, are not fully consistent with each other and may be complicated by influences from other climatic factors. Here we present the first high-resolution diatom and sedimentological records from the winter rainfall region of South Africa, representing precipitation in the equatorward margin of the westerly wind belt during the last 1400 yr. Inferred rainfall was relatively high ∼1400–1200 cal yr BP, decreased until ∼950 cal yr BP, and rose notably through the Little Ice Age with pulses centred on ∼600, 530, 470, 330, 200, 90, and 20 cal yr BP. Synchronous fluctuations in Antarctic ice core chemistry strongly suggest that these variations were linked to changes in the westerlies. Equatorward drift of the westerlies during the wet periods may have influenced Atlantic meridional overturning circulation by restricting marine flow around the tip of Africa. Apparent inconsistencies among some aspects of records from South America, New Zealand and South Africa warn against the simplistic application of single records to the Southern Hemisphere as a whole. Nonetheless, these findings in general do support model projections of increasing aridity in the austral winter rainfall zones with future warming.
Lowe, David J.; Blaauw, Maarten; Hogg, Alan G.; Newnham, Rewi M.
2013-08-01
Tephras are important for the NZ-INTIMATE project because they link all three records comprising the composite inter-regional stratotype developed for the New Zealand climate event stratigraphy (NZ-CES). Here we firstly report new calendar ages for 24 widespread marker tephras erupted since 30,000 calendar (cal.) years ago in New Zealand to help facilitate their use as chronostratigraphic dating tools for the NZ-CES and for other palaeoenvironmental and geological applications. The selected tephras comprise 12 rhyolitic tephras from Taupo, nine rhyolitic tephras from Okataina, one peralkaline rhyolitic tephra from Tuhua, and one andesitic tephra each from Tongariro and Egmont/Taranaki volcanic centres. Age models for the tephras were obtained using three methods: (i) 14C-based wiggle-match dating of wood from trees killed by volcanic eruptions (these dates published previously); (ii) flexible depositional modelling of a high-resolution 14C-dated age-depth sequence at Kaipo bog using two Bayesian-based modelling programs, Bacon and OxCal's P_Sequence function, and the IntCal09 data set (with SH offset correction -44 ± 17 yr); and (iii) calibration of 14C ages using OxCal's Tau_Boundary function and the SHCal04 and IntCal09 data sets. Our preferred dates or calibrated ages for the 24 tephras are as follows (youngest to oldest, all mid-point or mean ages of 95% probability ranges): Kaharoa AD 1314 ± 12; Taupo (Unit Y) AD 232 ± 10; Mapara (Unit X) 2059 ± 118 cal. yr BP; Whakaipo (Unit V) 2800 ± 60 cal. yr BP; Waimihia (Unit S) 3401 ± 108 cal. yr BP; Stent (Unit Q) 4322 ± 112 cal. yr BP; Unit K 5111 ± 210 cal. yr BP; Whakatane 5526 ± 145 cal. yr BP; Tuhua 6577 ± 547 cal. yr BP; Mamaku 7940 ± 257 cal. yr BP; Rotoma 9423 ± 120 cal. yr BP; Opepe (Unit E) 9991 ± 160 cal. yr BP; Poronui (Unit C) 11,170 ± 115 cal. yr BP; Karapiti (Unit B) 11,460 ± 172 cal. yr BP; Okupata 11,767 ± 192 cal. yr BP; Konini (bed b) 11,880 ± 183 cal. yr BP; Waiohau 14,009 ± 155
A 3500 14C yr High-Resolution Record of Water-Level Changes in Lake Titicaca, Bolivia/Peru
Abbott, Mark B.; Binford, Michael W.; Brenner, Mark; Kelts, Kerry R.
1997-03-01
Sediment cores collected from the southern basin of Lake Titicaca (Bolivia/Peru) on a transect from 4.6 m above overflow level to 15.1 m below overflow level are used to identify a new century-scale chronology of Holocene lake-level variations. The results indicate that lithologic and geochemical analyses on a transect of cores can be used to identify and date century-scale lake-level changes. Detailed sedimentary analyses of subfacies and radiocarbon dating were conducted on four representative cores. A chronology based on 60 accelerator mass spectrometer radiocarbon measurements constrains the timing of water-level fluctuations. Two methods were used to estimate the 14C reservoir age. Both indicate that it has remained nearly constant at ˜250 14C yr during the late Holocene. Core studies based on lithology and geochemistry establish the timing and magnitude of five periods of low lake level, implying negative moisture balance for the northern Andean altiplano over the last 3500 cal yr. Between 3500 and 3350 cal yr B.P., a transition from massive, inorganic-clay facies to laminated organic-matter-rich silts in each of the four cores signals a water-level rise after a prolonged mid-Holocene dry phase. Evidence of other significant low lake levels occurs 2900-2800, 2400-2200, 2000-1700, and 900-500 cal yr B.P. Several of the low lake levels coincided with cultural changes in the region, including the collapse of the Tiwanaku civilization.
International Nuclear Information System (INIS)
Horrocks, M.; Ogden, J.; Nichol, S.L.; Alloway, B.V.; Sutton, D.G.
2000-01-01
Pollen and sediment analyses of two cores from southern Kaitoke (Forsythes' Paddock and Blackwells' Bush), Great Barrier Island, show that at c. 7500 cal. yr BP, the area was an estuary with tidal flats and Avicennia. By c. 3000 cal. yr BP, a Restionaceae (Leptocarpus) salt marsh had developed in the estuary as marine influences lessened. By c. cal. 2550 yr BP, fresh water swamp (Cyperacceae-Gleichenia-Leptspermum) had replaced the salt marsh. Conifer-hardwood forest surrounding the southern Kaitoke sites from c. 7500-c. 2800 cal. yr BP was dominated by Daceydium, Metrosideros and Libocedrus. After c. 2800 cal. yr BP Metrosideros was replaced by Agathis, Phyllocladus and Prumnopitys taxifolia, suggesting climatic change to more variable conditions. The presence of the Kaharoa Tephra suggests that major Polynesian deforestation at southern Kaitoke began c. 600 cal. yr BP Minor pre-Kaharoa fire disturbance is evident c. 1750 cal. yr BP and c. 1290-970 cal. yr BP (author). 52 refs., 4 figs., 2 tabs
International Nuclear Information System (INIS)
Minoshima, Kayo; Kawahata, Hodaka; Irino, Tomohisa; Ikehara, Ken; Aoki, Kaori; Uchida, Masao; Yoneda, Minoru; Shibata, Yasuyuki
2007-01-01
The difference between benthic and planktonic foraminifera radiocarbon (B-P 14 C) age differences in core PC6 (40 o 23.89' N, 143 o 29.87' E) retrieved from the northwestern North Pacific provide a clue to the reconstruction of deep water circulation during the last deglaciation and the early Holocene (15-5 cal. kyr B.P.). The observed B-P 14 C age differences ranged from 1030 to 1630 years, which are comparable to the present-day apparent ventilation age. It suggested that the ventilation generally remained similar during 15-5 cal. kyr B.P. However, B-P 14 C age difference slightly reduced at 14.6 cal. kyr B.P., indicating that the higher ventilation temporality could have occurred in the northwestern North Pacific (∼2200 m water depth)
Feurdean, Angelica; Bennike, Ole
2004-12-01
Macrofossil, pollen, lithostratigraphy, mineral magnetic measurements (SIRM and magnetic susceptibility), loss-on-ignition, and AMS radiocarbon dating on sediments from two former crater lakes, situated at moderate altitudes in the Gutaiului Mountains of northwest Romania, allow reconstruction of Late Quaternary climate and environment. Shrubs and herbs with steppe and montane affinities along with stands of Betula and Pinus, colonised the surroundings of the sites prior to 14 700 cal. yr BP and the inferred climatic conditions were cold and dry. The gradual transition to open Pinus-Betula forests, slightly higher lake water temperatures, and higher lake productivity, indicate more stable environmental conditions between 14 700 and 14 100 cal. yr BP. This development was interrupted by cooler and drier climatic conditions between 14 100 and 13 800 cal. yr BP, as inferred from a reduction of open forests to patches, or stands, of Pinus, Betula, Larix, Salix and Populus. The expansion of a denser boreal forest, dominated by Picea, but including Pinus, Larix, Betula, Salix, and Ulmus started at 13 800 cal. yr BP, although the forest density seems to have been reduced between 13400 and 13200cal.yrBP. Air temperature and moisture availability gradually increased, but a change towards drier conditions is seen at 13400cal.yrBP. A distinct decrease in temperature and humidity between 12900 and 11500cal.yrBP led to a return of open vegetation, with patches of Betula, Larix, Salix, Pinus and Alnus and individuals of Picea. Macrofossils and pollen of aquatic plants indicate rising lake water temperatures and increased aquatic productivity already by ca. 11800cal.yrBP, 300 years earlier than documented by the terrestrial plant communities. At the onset of the Holocene, 11500cal.yrBP, forests dominated by Betula, Pinus and Larix expanded and were followed by dense Ulmus forests with Picea, Betula and Pinus at 11250cal.yrBP. Larix pollen was not found, but macrofossil evidence
International Nuclear Information System (INIS)
Horrocks, M.; Ogden, J.; Nichol, S.L.; Alloway, B.V.; Sutton, D.G.
1999-01-01
Pollen and sediment analysis of two Holocene cores from Awana, Great Barrier Island, shows that at 7000 calibrated yr B.P. the local swamp was an estuarine salt marsh dominated by Restionaceae. By c. 6000 yr B.P. the water table was lower, and a fresh water swamp (Gleichenia-Leptospermum) had replaced the salt marsh. Regional conifer-hardwood forest c. 7000 yr B.P. was initially co-dominated by Libocedrus and Dacrydium cupressinum. Libocedrus declined from c. 6000 yr B.P. During the period c. 6000-c. 2500 yr B.P., relatively stable environmental conditions ensued with little change in local or regional vegetation. Around 2500 yr B.P., the swamp surface became drier and was invaded by Dacrycarpus and Laurelia swamp forest. This forest was subsequently repeatedly disturbed (not by fire), indicating climatic change to drier and windier conditions. Ascarina lucida was periodically a major component of swamp forest. Disturbance is also recorded in the clastic (mineral) sediments, where beds of sand within finer-grained sediment and peat are interpreted as wind blown material derived from partly devegetated dunes to seaward. The presence of the Kaharoa Tephra allows the timing of major Polynesian deforestation at Awana to be reliably dated to c. 600 calibrated yr B.P. In contrast, we see no evidence in the clastic sediment record of disturbance at Awana since Kaharoa time. We attribute this to the maintenance of stable dunes by a herb/scrub cover despite nearby fires, or to the presence of scrub or forest buffering the swamp from ablating dunes. (author). 45 refs., 4 figs., 1 tab
Duprat-Oualid, Fanny; Begeot, Carole; Rius, Damien; Millet, Laurent; Magny, Michel
2016-04-01
Between 9 and 45 kyr cal. BP, two great transitions lead the global climate system to evolve from the Last-Glacial period (115-14.7 kyr cal. BP), to two successive warmer periods, the Late-Glacial Interstadial (14.7-11.7 kyr cal. BP) and the Holocene (11.7-0 kyr cal. BP). δ18O variations recorded in Greenland ice cores (GRIP & NGRIP) revealed high frequency climate variability within the Last Glacial. These reference isotopic records highlighted a succession of centennial-to-millennial warm/cold events, the so-called Greenland Interstadials (GI) and Greenland Stadials (GS). The number continental records about the period 14.7-0 kyr cal. BP is substantial. This allowed to understand the vegetation dynamics in response to climate changes this period at the North-Atlantic scale. However, sequences covering the glacial period (beyond 20 kyr cal.BP) remain rare, because of hiatuses mostly due to local glaciers. Therefore, sedimentary continuous records of vegetation dynamics are still needed to better understand climate changes during the Last Glacial in Western Europe (Heiri et al. 2014). Here we present a new high-resolution pollen record from Lake Bergsee (47°34'20''N, 7°56'11''E, 382 m a.s.l). This lake is located south of Black Forest and north of the Alps, beyond the zone of glaciers maximal extension. Therefore it could have recorded the whole last climatic cycle, i.e. 120-0 kyr cal. BP. In 2013, a 29 m long core was extracted from the Bergsee. According to the depth-age model based on 14C AMS dating and the Laacher See Tephra (LST), the record spans continuously at least the last 45 kyrs. The first series of pollen analysis, focused on the 45-9 kyr cal. BP time window, allows us to reconstruct a precise, faithful and continuous vegetation history at the centennial scale. This high temporal resolution enabled to assess the response of vegetation to secular climate events (e.g. GI-4 = 200 yrs). First, our results show that vegetation responded to climate
Bergadà, M. Mercè; Cervelló, Josep M.; Edo, Manel; Cebrià, Artur; Oms, F. Xavier; Martínez, Pablo; Antolín, Ferran; Morales, Juan Ignacio; Pedro, Mireia
2018-03-01
The stratigraphic, sedimentary and palaeoenvironmental features reflected in cavities in the Catalan Coastal Ranges of NE Iberia (Can Sadurní and Guineu caves) characterize the periods of pronounced climatic and human complexity that occurred c. 13.0-6.0 cal ka BP. This includes the stages of the Younger Dryas and Mid/Early Holocene, the latter being one of the periods of so-called Rapid Climatic Changes (RCCs). These caves, like others in Mediterranean contexts, are the result of an old duct originating in the saturated zone of the karst system and open to the outside; recording a succession of different detrital and anthropic episodes of the Epipaleolithic, Mesolithic and Neolithic communities. From this study it can be seen that paleoclimatic events do not always present clear signals in the karst records, especially c. 12.7-7.4 cal ka BP, corresponding to the Epipaleolithic and Mesolithic. It is characterized by a stratigraphic discontinuity in which there are phases with predominantly detrital sedimentation alternating with hiatus intervals. Detrital sedimentation formed by fine material colluvium with gravitational movements or solifluction processes in fresh and humid conditions. It appears in the following chronological intervals: 12.7-12.2 cal ka BP, 11.5/11.1-10.7/10.4 cal ka BP and 8.2-8.0 cal ka BP (less humid). Hiatus phases are represented in the rest of the sequence up to c. 7.4 cal ka BP. From the sedimentary point of view these stages of hiatus are indicative of phases of stability or lack of episodes with seasonal contrasts; a fact that would cause interruptions to detrital deposition in the interior of the caves. In contrast, in the period c. 7.4 to 6.0 cal ka BP, attributed to the Middle and Early Neolithic, there is a certain stratigraphic continuity. From the sedimentary point of view it is distinguished by a variability of processes that responds to accumulative episodes of short duration characteristic of morphogenesis of the slopes in an
The 3000-4000 cal. BP anthropogenic shift in fire regime in the French Pyrenees.
Rius, D.; Vannière, B.; Galop, D.; Richard, H.
2009-04-01
Fire is a key disturbing agent in a wide range of ecosystems: boreal biome (Pitkanen, 2000), Mediterranean area (Colombaroli et al., 2008) as well as temperate European mountain zones (Tinner et al., 1999). During the Holocene, climate may control fire regime by both ignition and fire spread-favouring conditions (i.e. composition, structure and moisture of biomass) whereas man may change charcoal accumulation patterns through type and intensity of agro-pastoral activities. In western and Mediterranean Europe, single sites charcoal analysis recorded the anthropogenic forcing over fire regime broadly between the mid and the late-Holocene. Turner et al (2008) showed that climate and fire had been disconnected since 1700 cal. BP in Turkey. In central Swiss, Mean Fire Interval decreased by two times 2000 years ago due to increasing human impact (Stahli et al., 2006). In Italy, climate and man have had a combined influence on fire-hazard since ca 4000 cal. BP (Vannière et al., 2008). In the Pyrenees Mountains, the linkage between agro-pastoral practices and fire could be dated back to ca 4000-3000 cal. BP with a clear succession of a clearance phase (high fire frequency) followed by a quite linear trend throughout Middle Ages and Modern times corresponding to a change in fire use (Vanniere et al., 2001; Galop et al., 2002, Rius et al., in press). The quantification of fire regimes parameters such as frequency with robust methodological tools (Inferred Fire Frequency, Mean Fire Interval) is needed to understand and characterise such shifts. Here we present two sequences from the Lourdes basin (col d'Ech peat bog) and from the occidental Pyrenees (Gabarn peat bog), which cover the last 9000 years with high temporal resolution. The main goals of this study were to (1) assess control factors of fire regime throughout the lateglacial and Holocene (climate and/or man) on the local scale, (2) evidence the local/regional significance of these control factors , (3) discuss the
Postglacial vegetation history of Mitkof Island, Alexander Archipelago, southeastern Alaska
Ager, Thomas A.; Carrara, Paul E.; Smith, Jane L.; Anne, Victoria; Johnson, Joni
2010-03-01
An AMS radiocarbon-dated pollen record from a peat deposit on Mitkof Island, southeastern Alaska provides a vegetation history spanning ˜12,900 cal yr BP to the present. Late Wisconsin glaciers covered the entire island; deglaciation occurred > 15,400 cal yr BP. The earliest known vegetation to develop on the island (˜12,900 cal yr BP) was pine woodland ( Pinus contorta) with alder ( Alnus), sedges (Cyperaceae) and ferns (Polypodiaceae type). By ˜12,240 cal yr BP, Sitka spruce ( Picea sitchensis) began to colonize the island while pine woodland declined. By ˜11,200 cal yr BP, mountain hemlock ( Tsuga mertensiana) began to spread across the island. Sitka spruce-mountain hemlock forests dominated the lowland landscapes of the island until ˜10,180 cal yr BP, when western hemlock ( Tsuga heterophylla) began to colonize, and soon became the dominant tree species. Rising percentages of pine, sedge, and sphagnum after ˜7100 cal yr BP may reflect an expansion of peat bog habitats as regional climate began to shift to cooler, wetter conditions. A decline in alders at that time suggests that coastal forests had spread into the island's uplands, replacing large areas of alder thickets. Cedars ( Chamaecyparis nootkatensis, Thuja plicata) appeared on Mitkof Island during the late Holocene.
Song, Bing; Yi, Sangheon; Jia, Hongjuan; Nahm, Wook-Hyun; Kim, Jin-Cheul; Lim, Jaesoo; Lee, Jin-Young; Sha, Longbin; Mao, Limi; Yang, Zhongyong; Nakanishi, Toshimichi; Hong, Wan; Li, Zhen
2018-01-01
To understand historical climate change in western Pacific coastal areas, a sediment core (SOJ-2) from the stable sedimentary environment of the Songjiho Lagoon on the east coast of South Korea was obtained for centennial-resolution palynological analysis. The ages of the SOJ-2 core is well controlled by carbon 14 dating with high-resolution accelerator mass spectrometry (AMS), and the results indicated a general warm to cold climate trend from the mid-Holocene to the present, which can be divided into two different stages: a warmer stage between 6842 and 1297 cal yr BP and a colder stage from 1297 cal yr BP to the present, with fluctuations during these stages. The climate was wetter from 6842 to 6227 cal yr BP and 4520 to 1297 cal yr BP and was drier from 6227 to 4520 cal yr BP. The climate changed to cold and dry during the period from 1297-425 cal yr BP. The impact of human activity on the climate began at approximately 1297 cal yr BP and became pronounced starting in 425 cal yr BP. The general cooling trend may represent a response to decreasing solar insolation; however, the relative dryness or wetness of the climate may have been co-determined by westerlies and the East Asian summer monsoon (EASM). The climate had a teleconnection with the North Atlantic region, resulting from changes in solar activity. Nevertheless, EI Niño-Southern Oscillation (ENSO) activity played an important role in impacting the EASM changes in western Pacific coastal areas.
Whitlock, Cathy; Dean, Walter E.; Fritz, Sherilyn C.; Stevens, Lora R.; Stone, Jeffery R.; Power, Mitchell J.; Rosenbaum, Joseph R.; Pierce, Kenneth L.; Bracht-Flyr, Brandi B.
2012-01-01
A 9400-yr-old record from Crevice Lake, a semi-closed alkaline lake in northern Yellowstone National Park, was analyzed for pollen, charcoal, geochemistry, mineralogy, diatoms, and stable isotopes to develop a nuanced understanding of Holocene environmental history in a region of northern Rocky Mountains that receives both summer and winter precipitation. The limited surface area, conical bathymetry, and deep water (> 31 m) of Crevice Lake create oxygen-deficient conditions in the hypolimnion and preserve annually laminated sediment (varves) for much of the record. Pollen data indicate that the watershed supported a closed Pinus-dominated forest and low fire frequency prior to 8200 cal yr BP, followed by open parkland until 2600 cal yr BP, and open mixed-conifer forest thereafter. Fire activity shifted from infrequent stand-replacing fires initially to frequent surface fires in the middle Holocene and stand-replacing events in recent centuries. Low values of δ18O suggest high winter precipitation in the early Holocene, followed by steadily drier conditions after 8500 cal yr BP. Carbonate-rich sediments before 5000 cal yr BP imply warmer summer conditions than after 5000 cal yr BP. High values of molybdenum (Mo), uranium (U), and sulfur (S) indicate anoxic bottom-waters before 8000 cal yr BP, between 4400 and 3900 cal yr BP, and after 2400 cal yr BP. The diatom record indicates extensive water-column mixing in spring and early summer through much of the Holocene, but a period between 2200 and 800 cal yr BP had strong summer stratification, phosphate limitation, and oxygen-deficient bottom waters. Together, the proxy data suggest wet winters, protracted springs, and warm effectively wet summers in the early Holocene and less snowpack, cool springs, warm dry summers in the middle Holocene. In the late Holocene, the region and lake experienced extreme changes in winter, spring, and summer conditions, with particularly short springs and dry summers and winters during
Benson, Larry V.; May, Howard M.; Antweiler, Ronald C.; Brinton, Terry I.; Kashgarian, Michaele; Smoot, Joseph P.; Lund, Steve P.
1998-09-01
The chemistry of the carbonate-free clay-size fraction of Owens Lake sediments supports the use of total organic carbon and magnetic susceptibility as indicators of stadial-interstadial oscillations. Owens Lake records of total organic carbon, magnetic susceptibility, and chemical composition of the carbonate-free, clay-size fraction indicate that Tioga glaciation began ˜24,500 and ended by ˜13,600 14C yr B.P. Many of the components of glacial rock flour (e.g., TiO 2, MnO, BaO) found in Owens Lake sediments achieved maximum values during the Tioga glaciation when valley glaciers reached their greatest extent. Total organic carbon and SiO 2(amorphous) concentrations reached minimum values during Tioga glaciation, resulting from decreases in productivity that accompanied the introduction of rock flour into the surface waters of Owens Lake. At least 20 stadial-interstadial oscillations occurred in the Sierra Nevada between 52,600 and 14,000 14C yr B.P. Total organic carbon data from a Pyramid Lake sediment core also indicate oscillations in glacier activity between >39,500 and ˜13,600 14C yr B.P. Alpine glacier oscillations occurred on a frequency of ≤1900 yr in both basins, suggesting that millennial-scale oscillations occurred in California and Nevada during most of the past 52,600 yr.
Holmgren, Camille A.; Betancourt, Julio L.; Rylander, Kate A.
2011-01-01
Plant macrofossils from 38 packrat middens spanning the last ~ 33,000 cal yr BP record vegetation between ~ 650 and 900 m elevation along the eastern escarpment of the Sierra San Pedro Mártir, northern Baja California. The middens span most of the Holocene, with a gap between ~ 4600 and 1800 cal yr BP, but coverage in the Pleistocene is uneven with a larger hiatus between 23,100 and 14,400 cal yr BP. The midden flora is relatively stable from the Pleistocene to Holocene. Exceptions include Pinus californiarum, Juniperus californica and other chaparral elements that were most abundant > 23,100 cal yr BP and declined after 14,400 cal yr BP. Despite being near the chaparral/woodland-desertscrub ecotone during glacial times, the midden assemblages reflect none of the climatic reversals evident in the glacial or marine record, and this is corroborated by a nearby semi-continuous pollen stratigraphy from lake sediments. Regular appearance of C4 grasses and summer-flowering annuals since 13,600 cal yr BP indicates occurrence of summer rainfall equivalent to modern (JAS average of ~ 80–90 mm). This casts doubt on the claim, based on temperature proxies from marine sediments in the Guaymas Basin, that monsoonal development in the northern Gulf and Arizona was delayed until after 6200 cal yr BP.
International Nuclear Information System (INIS)
Sifeddine, A.; Bertaux, J.; Mourguiart, Ph.; Disnar, J.R.; Laggoun-Defarge, F.; Argollo, J.
1998-01-01
A sedimentological study of a 755 cm length core sampled in the middle of a marshy depression surrounded by a cloud forest in the central Andes reveals that this site has recorded important environmental variations during the last 50 000 years. For the most part (625 cm) the core is composed of detrital rich sediments deposited during the Upper Pleistocene. The highest amount of detrital influx underlines the Last Glacial Maximum which ranges from ca 29,000 14 C yr B.P. to ca 16,000 14 C yr B.P. (ca 18,500 cal yr B.P.), between two relatively humid phases. The sedimentation of the present Interglacial, starting at ca 12,500 14 C yr B.P. (14,500 cal yr B.P.), is mainly organic, as a consequence of the great development of soils and the forest vegetal cover the catchment area. The maximum extension of this vegetal cover ranging from 12,500 to ca 10,500 14 C yr B.P. (14,500 and 12,400 cal yr B.P.) is followed from 10,500 to 8,000 14 C yr B.P. (12,400 and 8,800 cal yr B.P.) by a drier period is revealed by the occurrence of micro-charcoals in the sediment. Between ca 8,000 and 4,000 14 C yr B.P. (8,800 and 4,500 cal yr B.P.), the sharp increase of micro-charcoals content, likely related to palaeo-fires, underlines an intensification of this dry trend. (authors)
Zhong, Wei; Cao, jiayuan; Xue, Jibin; Ouyang, Jun; Tang, Xiaohong; Yin, Huanling; Liao, Congyun; Long, Kun
2014-02-01
The study of a 300-cm-thick exposed lacustrine sediment section in the Hedong village in Zhaoqing area which is located in sub-tropical west Guangdong Province in South China, demonstrates that the lacustrine sedimentary sequence possibly contains evidence for exploring variation of Asian monsoon climate. Multi-proxy records, including the humification intensity, total organic carbon, and grain size fractions, reveal a general trend towards dry and cold conditions in the late Holocene that this is because of a decrease in solar insolation on an orbital scale. Three intensified Asian summer monsoon (ASM) intervals (˜3300-3000 cal yr BP, ˜2600-1600 cal yr BP, and ˜900-600 cal yr BP), and three weakened ASM intervals (˜4000-3300 cal yr BP, ˜3000-2600 cal yr BP, and ˜1600-900 cal yr BP) are identified. Our humification record (HDcal) shows a good correlation on multi-centennial scale with the tree ring Δ14C record, a proxy of solar activity. A spectral analysis of HDcal reveals four significant cycles, i.e., ˜1250 yr, 300 yr, 110 yr, and 70 yr, and most of these cycles are related to the solar activity. Our findings indicate that solar output and oceanic-atmospheric circulation probably have influenced the late Holocene climate variability in the study region.
Holocene vegetation change in the northern Peten and its implications for Maya prehistory
Wahl, David; Byrne, Roger; Schreiner, Thomas; Hansen, Richard
2006-05-01
An ˜8400 cal yr record of vegetation change from the northern Peten, Guatemala, provides new insights into the environmental history of the archaeological area known as the Mirador Basin. Pollen, loss on ignition, and magnetic susceptibility analyses indicate warm and humid conditions in the early to mid-Holocene. Evidence for a decrease in forest cover around 4600 cal yr B.P. coincides with the first appearance of Zea mays pollen, suggesting that human activity was responsible. The period between 3450 cal yr B.P. and 1000 cal yr B.P. is characterized by a further decline in forest pollen types, includes an abrupt increase in weedy taxa, and exhibits the highest magnetic susceptibility values since the early Holocene, all of which suggest further agricultural disturbance in the watershed. A brief drop in disturbance indicators around 1800 cal yr B.P. may represent the Preclassic abandonment of the area. Changing pollen frequencies around 1000 cal yr B.P. indicate a cessation of human disturbance, which represents the Late Classic collapse of the southern Maya lowlands.
Wang, Jianjun; Sun, Liguang; Chen, Liqi; Xu, Libin; Wang, Yuhong; Wang, Xinming
2016-06-10
Extreme climatic events have profound impacts on human society. Here we present the results of a study of organic biomarkers within a sedimentary section at the archaeological site of Yuchisi, eastern China, in order to reconstruct climatic variability during the Dawenkou (5,050-4,400 yr BP) and Longshan (4,400-4,000 yr BP) cultures. At ~4,400 yr BP, within the cultural transition horizon, abrupt changes in biomarkers, such as the fatty acid ratio C18:2/C18:0, 2C31/(C27 + C29), n-C18-ol and n-C30-ol, indicate the occurrence of local climate changes over the course of a few decades. These changes occurred during the transition from the Holocene warm period to a subsequent cold period which lasted for the following 600 years. This climatic shift has been recorded at numerous sites worldwide, and it is likely to have been the main cause of the widespread collapse of many isolated cultures at that time. The palaeoclimatic and archaeological data from the Yuchisi sediments may provide new insights into the relationship between climate change and prehistoric cultural transitions.
Tephrostratigraphic studies on a sediment core from Lake Prespa in the Balkans
Directory of Open Access Journals (Sweden)
M. Damaschke
2013-01-01
Full Text Available A detailed tephrostratigraphic record, which dates back to Marine Isotope Stage (MIS 5b (ca. 91 kyr, has been established from a 17.76 m long core (Co1215 from Lake Prespa (Macedonia, Albania and Greece. A total of eleven tephra and cryptotephra layers (PT0915-1 to PT0915-11 were identified, using XRF scanning, magnetic susceptibility measurements, and macro- and microscopic inspection of the sediments. The major element composition of glass shards and/or micro-pumice fragments indicates that the tephras and cryptotephras originate from the explosive volcanism of Italy. Eight tephra and cryptotephra layers were correlated with specific volcanic eruptions: the AD 512 eruption of Somma-Vesuvius (1438 cal yr BP, the Mercato eruption of Somma-Vesuvius (8890 ± 90 cal yr BP, the Tufi Biancastri/LN1-LN2 eruption of the Campi Flegrei (14 749 ± 523 cal yr BP and 15 551 ± 621 cal yr BP, the SMP1-e/Y-3 eruption of the Campi Flegrei (30 000–31 000 cal yr BP, the Campanian Ignimbrite/Y-5 eruption of the Campi Flegrei (39 280 ± 110 cal yr BP, the SMP1-a event of Ischia Island (around 44 000 cal yr BP and the Green Tuff/Y-6 eruption of Pantelleria Island (around 45 000 cal yr BP. One tephra could be attributed to the volcanic activity of Mount Etna, but probably represents an unknown eruption at ca. 60 000 cal yr BP. Cryptotephras PT0915-6 and PT0915-10 remain unclassified so far, but according to the presented age-depth model these would have been deposited around 35 000 and 48 500 cal yr BP, respectively. Some of the tephras and cryptotephras are recognised for the first time in the Balkan region. The tephrostratigraphic work provides important information about ash dispersal and explosion patterns of source volcanoes and can be used to correlate and date geographically distant paleoenvironmental and archaeological archives in the central Mediterranean region. Moreover, the tephrostratigraphic work in combination with radiocarbon and electron spin
Klimaschewski, A.; Barnekow, L.; Bennett, K. D.; Andreev, A. A.; Andrén, E.; Bobrov, A. A.; Hammarlund, D.
2015-11-01
High resolution palaeoenvironmental records in Far-Eastern Russia are rare, and the Kamchatka Peninsula is among the least studied areas of the region. This paper describes a record spanning the last ca. 11,000 yr, obtained from a bog in the southern part of Kamchatka. The radiocarbon dated core was analysed for pollen, testate amoebae, charcoal and loss-on-ignition (LOI). The vegetation during the early Holocene was dominated by grasses (Poaceae), birch (Betula) and heath (Ericaceae p. p.). Around 10,300 cal yr BP there was a substantial change in the vegetation cover to shrub alder (Alnus viridis s.l.) stands with sedges and ferns (Polypodiophyta) as well as herbs such as meadow rue (Thalictrum) in the understory. In the surroundings of Utka peatlands started to form. The variations in the vegetation cover were most probably caused by climatic changes. At the beginning of sediment accumulation, before 10,300 cal yr BP, the composition of the vegetation points to cooler summers and/or decreased annual precipitation. Around 10,300 cal yr BP, changes in vegetation occurred due to rising temperatures and/or changed water regimes. Increased abundancies of dry indicating testate amoebae after 9100 cal yr BP point to intermediate to dry soil conditions. Between 8600 and 7700 cal yr BP tree alder (Alnus incana) was widely spread at the site which probably indicates optimal environmental conditions. The tephra layer at 381-384.5 cm (ca. 8500 cal yr BP) produces a strong impact on the testate amoebae assemblages. At 7700 cal yr BP there was a sudden drop of A. incana in the local vegetation. From this time on, A. incana and also A. viridis decrease continuously whereas Betula gradually increases. The upper part of the sequence (after 6300 cal yr BP) shows higher abundancies of meadowsweet (Filipendula) and sweet gale (Myrica) pollen. After 6300 cal yr BP, changes in testate amoebae demonstrate variable soil moisture conditions at the site. Between 3700 and 1800 cal yr BP
Jiménez-Moreno, Gonzalo; Anderson, R. Scott
2012-01-01
High-resolution pollen and magnetic susceptibility (MS) analyses have been carried out on a sediment core taken from a high-elevation alpine bog area located in Sierra Nevada, southern Spain. The earliest part of the record, from 8200 to about 7000 cal yr BP, is characterized by the highest abundance of arboreal pollen and Pediastrum, indicating the warmest and wettest conditions in the area at that time. The pollen record shows a progressive aridification since 7000 cal yr BP that occurred in two steps, first shown by a decrease in Pinus, replaced by Poaceae from 7000 to 4600 cal yr BP and then by Cyperaceae, Artemisia and Amaranthaceae from 4600 to 1200 cal yr BP. Pediastrum also decreased progressively and totally disappeared at ca. 3000 yr ago. The progressive aridification is punctuated by periodically enhanced drought at ca. 6500, 5200 and 4000 cal yr BP that coincide in timing and duration with well-known dry events in the Mediterranean and other areas. Since 1200 cal yr BP, several changes are observed in the vegetation that probably indicate the high-impact of humans in the Sierra Nevada, with pasturing leading to nutrient enrichment and eutrophication of the bog, Pinus reforestation and Olea cultivation at lower elevations.
Andama, M.; Lejju, J. B.; Tolo, C. U.
2013-11-01
Lake Victoria ecosystem has undergone major ecological changes in the recent decades. Sedimentary diatom analysis and Fe / Mn determined by Energy Dispersive X-ray Fluorescence (EDXRF) have provided phytoplankton (diatom) productivity and the resultant anoxia (Fe / Mn) in Lake Victoria at Napoleon Gulf during the late Holocene (1778 cal yr BP (calibrated years before present) to 2008 AD) with radiocarbon dates determined using Accelerator Mass Spectrometry standard method. The results showed that increased total diatom counts in Napoleon Gulf during the late Holocene correspond with increased Fe / Mn ratio (anoxia) in some of the profiles and not in others and in most cases those that correspond correlate very well with increased eutrophication from nitrate input (Total Nitrogen, TN). Therefore slightly increased anoxia not related to increased diatom productivity was recorded in Lake Victoria at Napoleon Gulf from the period 1778 to 1135 cal yr BP. There was slightly increased diatom productivity at Napoleon Gulf from the period 857 to 758 cal yr BP but it did not increase anoxia in the lake. The period 415 cal yr BP to 2008 AD recorded increased anoxia at Napoleon Gulf related to high diatom productivity especially from 415 to 390 cal yr BP and 191 cal yr BP to 2008 AD.
Directory of Open Access Journals (Sweden)
Natália de Paula Sá
Full Text Available ABSTRACT The core PD-67 of 160 cm depth was collected from the delta of Lake Cabaliana situated on the Solimões River. Seventeen samples were removed for palynological and sedimentological analysis and three for radiocarbon analysis. Two dry periods, both in the Late Holocene, were observed (2800-2550 cal yr BP, 1450-550 cal yr BP separated by a wetter phase (2550-1450 cal yr BP. In 2800-2550 cal yr BP, varzea forests of Alchornea, Symmeria, Cecropia, Alternanthera and Asteraceae were predominant. Beginning in 2,550-1450 cal yr BP, the varzea was characterized by pioneer elements, such as Cassia, Laetia, Mabea, Symmeria and Cecropia, and by the expansion of Poaceae, Cyperaceae, Sagittaria, Montrichardia and Asteraceae. In 1450-550 cal yr BP the succession of varzea continued with Pseudobombax, Laetia, Luehea/Lueheopsis and Ryanaea increasing simultaneously with the terra firme vegetation of Rutaceae, Sapotaceae, Styrax, Scleronema, Anthurium, Araceae, pteridophytes and Pariana. The successional dynamics at Lake Cabaliana indicated that the local varzea had become established recently, and is composed of a mosaic of different successional stages of vegetation influenced mainly by flood pulse and variation in rainfall. It is therefore possible to propose that the recent climate history of Central Amazonia reflects changes in rainfall patterns in the basin.
Xu, Lichen; Liu, Yan; Sun, Qianli; Chen, Jing; Cheng, Peng; Chen, Zhongyuan
2017-05-01
High-resolution climate variations since the last 4500 years in the monsoonal-arid transition zone of north-central China were revealed through the integration of proxies from sediment cores in the Lake Daihai basin. Human occupations in the lake basin deduced from archeological findings and historical literatures were then incorporated into the climate sequence to demonstrate the patterns of human responses to the climate changes, and the recent anthropogenic effects. It indicated that: (1) Climate dominated human-environment adaptations prevailed prior to ∼2700 cal yr BP. An amicable climate setting before ∼4100 cal yr BP would facilitate the growth of the Laohushan Culture (LC) in the lake basin, while a pronounced deterioration of water thermal condition after that had led to human exodus and the collapse of the LC. The reduced human activity in the lake basin indicated at ∼3800-3500 cal yr BP and a subsequent cultural blank at ∼3500-2700 cal yr BP, were both in response to the climate and lake level fluctuations during ∼3800-2800 cal yr BP. (2) Transition to a positive human adaptation was seen at ∼2700-1100 cal yr BP, represented by the exploitation of arable land for cultivation and animal husbandry as the lake contracted. (3) An increasing human presence that affected environmental processes became more severe over the last ∼1100 cal yr BP. This was basically due to the ongoing lake shore reclamation for cropping, and more recently heavy metals emissions from fossil fuel combustion and local industries.
Wriston, T.; Smith, G. M.
2017-12-01
Few chronological controls are available for the rise and fall of small pluvial lake systems in the Northwestern Great Basin. Within Warner Basin this control was necessary for interpretation of known archaeological sites and for predicting where evidence of its earliest inhabitants might be expected. We trenched along relic beach ridges of Lake Warner, surveyed a stratified sample of the area for archaeological sites, and excavated some sites and a nearby rockshelter. These efforts produced new ages that we used to construct a lake level curve for Lake Warner. We found that the lake filled the valley floor between ca. 30,000 cal yr BP and ca. 10,300 cal yr BP. In nearby basins, several oscillations are evident before ca. 21,100 cal yr BP, but a steep rise to the LGM maximum occurred between 21,000 and 20,000 cal yr BP. Lake Warner likely mirrored these changes, dropped to the valley floor ca. 18,340 cal yr BP, and then rose to its maximum highstand when its waters briefly reached 1454 m asl. After this highstand the lake receded to moderately high levels. Following ca. 14,385 cal yr BP, the lake oscillated between moderate to moderately-high levels through the Bolling-Allerod interstadials and into the Younger Dryas stadial. The basin's first occupants arrived along its shore around this time, while the lake still filled the valley floor. These earliest people carried either Western Stemmed or Clovis projectile points, both of which are found along the lake margin. The lake receded into the valley floor ca. 10,300 cal yr BP and dune development began, ringing wetlands and small lakes that persisted in the footprint of the once large lake. By the time Mazama tephra fell 7,600 cal yr BP it blanketed pre-existing dunes and marsh peats. Our Lake Warner lake level curve facilitates interdisciplinary testing and refinement of it and similar curves throughout the region while helping us understand the history of lake and the people who lived along its shores.
Northward advection of Atlantic water in the eastern Nordic Seas over the last 3000 yr
Directory of Open Access Journals (Sweden)
C. V. Dylmer
2013-07-01
Full Text Available Three marine sediment cores distributed along the Norwegian (MD95-2011, Barents Sea (JM09-KA11-GC, and Svalbard (HH11-134-BC continental margins have been investigated in order to reconstruct changes in the poleward flow of Atlantic waters (AW and in the nature of upper surface water masses within the eastern Nordic Seas over the last 3000 yr. These reconstructions are based on a limited set of coccolith proxies: the abundance ratio between Emiliania huxleyi and Coccolithus pelagicus, an index of Atlantic vs. Polar/Arctic surface water masses; and Gephyrocapsa muellerae, a drifted coccolith species from the temperate North Atlantic, whose abundance changes are related to variations in the strength of the North Atlantic Current. The entire investigated area, from 66 to 77° N, was affected by an overall increase in AW flow from 3000 cal yr BP (before present to the present. The long-term modulation of westerlies' strength and location, which are essentially driven by the dominant mode of the North Atlantic Oscillation (NAO, is thought to explain the observed dynamics of poleward AW flow. The same mechanism also reconciles the recorded opposite zonal shifts in the location of the Arctic front between the area off western Norway and the western Barents Sea–eastern Fram Strait region. The Little Ice Age (LIA was governed by deteriorating conditions, with Arctic/Polar waters dominating in the surface off western Svalbard and western Barents Sea, possibly associated with both severe sea ice conditions and a strongly reduced AW strength. A sudden short pulse of resumed high WSC (West Spitsbergen Current flow interrupted this cold spell in eastern Fram Strait from 330 to 410 cal yr BP. Our dataset not only confirms the high amplitude warming of surface waters at the turn of the 19th century off western Svalbard, it also shows that such a warming was primarily induced by an excess flow of AW which stands as unprecedented over the last 3000 yr.
Bischoff, James L.; Menking, Kirsten M.; Fitts, Jeffrey P.; Fitzpatrick, John A.
1997-11-01
Chemical analyses of the acid-soluble and clay-size fractions of sediment samples (1500-yr resolution) reveal oscillations of lake salinity and of glacial advances in core OL-92 back to 155,000 yr B.P. Relatively saline conditions are indicated by the abundance of carbonate and smectite (both pedogenic and authigenic), reflected by Ca, Sr, and Mg in the acid-soluble suite, and by Cs 2O, excess MgO, and LOI (loss on ignition) in the clay-size fraction. Rock flour produced during glacial advances is represented by the abundance of detrital plagioclase and biotite in the clay-size fraction, the ratio of which remains essentially constant over the entire time span. These phases are quantitatively represented by Na 2O, TiO 2, Ba, and Mn in the clay fraction. The rock-flour record indicates two major ice-advances during the penultimate glacial cycle corresponding to marine isotope stage (MIS) 6, no major advances during the last interglaciation (entire MIS 5), and three major advances during the last glacial cycle (MIS 2, 3, and 4). The ages of the latter three correspond rather well to 36Cl dates reported for Sierra Nevada moraines. The onset of the last interglaciation is shown by abrupt increases in authigenic CaCO 3and an abrupt decrease in rock flour, at about 118,000 yr B.P. according to our time scale. In contrast, the boundary appears to be gradual in the δ 18O record in which the change from light to heavy values begins at about 140,000 yrs B.P. The exact position of the termination, therefore, may be proxy-dependent. Conditions of high carbonate and low rock flour prevailed during the entire period from 118,000 yr B.P. until the glacial advance at 53,000 yr B.P. signaled the end of this long interglaciation.
de Boer, E.J.; Tjallingii, R.; Vélez, M.I.; Rijsdijk, K.F.; Vlug, A.; Reichart, G.J.; Prendergast, A.L.; de Louw, P.G.B.; Vincent Florens, F.B.; Baider, C.; Hooghiemstra, H.
2014-01-01
A multi-proxy reconstruction of a sediment core from the Tatos basin in the Mauritian lowlands reveals a dynamic environmental history during the last 8000 years. Under influence of sea level rise, the basin progressed from a wetland to a shallow lake between 8000 and 2500 cal yr BP and it slowly
De Boer, Erik J.; Tjallingii, Rik; Vélez, Maria I.; Rijsdijk, Kenneth F.; Vlug, Anouk; Reichart, Gert-Jan; Prendergast, Amy L.; de Louw, Perry G B; Florens, F. B Vincent; Baider, Cláudia; Hooghiemstra, Henry
2014-01-01
A multi-proxy reconstruction of a sediment core from the Tatos basin in the Mauritian lowlands reveals a dynamic environmental history during the last 8000 years. Under influence of sea level rise, the basin progressed from a wetland to a shallow lake between 8000 and 2500cal yr BP and it slowly
Chen, S. T.; Chen, W. S.
2016-12-01
Since late Pleistocene, the Coastal Range (Philippine Sea plate) collided and overridden on the Central Range (Eurasian Plate) along the Longitudinal Valley Fault. Therefore, the Coastal Range is exposed widely the late Pleistocene-Holocene marine and fluvial terraces caused by the tectonic uplift. Based on the estimation of paleosea-level elevations (Δh), depositional paleodepth, altitude distribution of Holocene deposits (D), altitude of outcrops (H), and 14C dating of marine deposits (t), the uplift rate (=(Δh+H +d-D)/t) is about 5-10 mm/yr in the southern Coastal Range. In this study, we suggest through field logging that the deposits can be divided into alluvial, foreshore (intertidal), shoreface, and offshore environments. In Dulan area in the southern Coastal Range, the uplift rate was 6-7 mm/yr during 16,380-10,000 cal yr BP and 3-4 mm/yr after 7,000 cal yr BP. Results from the Dulan Coastal alluvial-fan system can be divided into five depositional stages: (1) 16,380-14,300 cal yr BP: The rate of global sea level rise (SLR) has averaged about 6-7 mm/yr, similar to the tectonic uplift rate. In this stage, the bedrock was eroded and formed a wide wave-cut platform. (2) 14,300-10,000 cal yr BP: SLR of about 14 mm/yr that was faster than tectonic uplift rate of 6-7 mm/yr. As a result of transgression, the beach-lagoon deposits about 5 m thick were unconformably overlain on the wave-cut platform. (3) 10,000-8,200 cal yr BP: The ongoing sea level rise (SLR: 11 mm/yr), the lagoon deposits were overlain by an offshore slump deposits representing a gradual deepening of the depositional environment. (4) 8,200-7,930 cal yr BP (SLR: 6-7 mm/yr): The tectonic uplift rate may occur at similar SLR. The alluvial-fan deposits have prograded over the shallow marine deposits. (5) After 7,000 cal yr BP (SLR: 1-0 mm/yr): SLR was much slower than tectonic uplift rate of 3-4 mm/yr. Thus, Holocene marine terraces are extensively developed in the coastal region, showing that the
Environmental change in the Limfjord, Denmark (ca 7500-1500 cal yrs BP): a multiproxy study
Lewis, Jonathan P.; Ryves, David B.; Rasmussen, Peter; Knudsen, Karen L.; Petersen, Kaj S.; Olsen, Jesper; Leng, Melanie J.; Kristensen, Peter; McGowan, Suzanne; Philippsen, Bente
2013-10-01
The Limfjord region of northern Jutland, Denmark, supports a rich archaeological record dating back to the Mesolithic, which documents long-term change in human practices and utilisation of marine resources since approximately 7500 BP. The presence and availability of marine resources in the Limfjord is sensitively regulated by environmental parameters such as salinity, sedimentary regime, nutrient status and primary productivity, but long-term changes in these parameters are currently poorly understood. In this study a multiproxy approach (including sedimentary parameters, diatoms, molluscs, foraminifera, sedimentary pigments, C and O stable isotopes and plant macrofossils) has been adopted to assess environmental change over the period ca 7500-1500 cal yrs BP at Kilen, a coastal fjord (before AD 1856) situated in the Western Limfjord. A diatom-based salinity transfer function based on a pan-Baltic training set has been applied to the fossil diatom dataset for quantitative assessment of salinity change over the study period. This study demonstrates that large-scale shifts in salinity are a common feature of the Limfjord's long-term history and are driven by the level of connection with the North Sea and the Skagerrak respectively, which in turn is likely driven by the complex interplay between climate, sea-level change, current velocity and rates of erosion/sedimentary accretion. Three shifts in state at Kilen are identified over the study period: a deep, periodically stratified fjord with medium-high salinity (and high productivity) between ca 7500-5000 BP, followed by a gradual transition to a shallow benthic system with more oceanic conditions (i.e. higher salinity, lower productivity, slower sedimentary accumulation rate and poorer fossil preservation) after ca 5000 BP and no stratification after ca 4400 BP, and lastly, within this shallow phase, an abrupt shift to brackish conditions around 2000 BP. Environmental-societal interactions are discussed on the
Martínez Cortizas, Antonio; López-Merino, Lourdes; Bindler, Richard; Mighall, Tim; Kylander, Malin E
2016-03-01
Although archaeological research suggests that mining/metallurgy already started in the Chalcolithic (3rd millennium BC), the earliest atmospheric metal pollution in SW Europe has thus far been dated to ~3500-3200 cal.yr. BP in paleo-environmental archives. A low intensity, non-extensive mining/metallurgy and the lack of appropriately located archives may be responsible for this mismatch. We have analysed the older section (>2100 cal.yr. BP) of a peat record from La Molina (Asturias, Spain), a mire located in the proximity (35-100 km) of mines which were exploited in the Chalcolithic/Bronze Age, with the aim of assessing evidence of this early mining/metallurgy. Analyses included the determination of C as a proxy for organic matter content, lithogenic elements (Si, Al, Ti) as markers of mineral matter, and trace metals (Cr, Cu, Zn, Pb) and stable Pb isotopes as tracers of atmospheric metal pollution. From ~8000 to ~4980 cal.yr. BP the Pb composition is similar to that of the underlying sediments (Pb 15 ± 4 μg g(-1); (206)Pb/(207)Pb 1.204 ± 0.002). A sustained period of low (206)Pb/(207)Pb ratios occurred from ~4980 to ~2470 cal.yr. BP, which can be divided into four phases: Chalcolithic (~4980-3700 cal.yr. BP), (206)Pb/(207)Pb ratios decline to 1.175 and Pb/Al ratios increase; Early Bronze Age (~3700-3500 cal.yr. BP), (206)Pb/(207)Pb increase to 1.192 and metal/Al ratios remain stable; Late Bronze Age (~3500-2800 cal.yr. BP), (206)Pb/(207)Pb decline to their lowest values (1.167) while Pb/Al and Zn/Al increase; and Early Iron Age (~2800-2470 cal.yr. BP), (206)Pb/(207)Pb increase to 1.186, most metal/Al ratios decrease but Zn/Al shows a peak. At the beginning of the Late Iron Age, (206)Pb/(207)Pb ratios and metal enrichments show a rapid return to pre-anthropogenic values. These results provide evidence of regional/local atmospheric metal pollution triggered by the earliest phases of mining/metallurgy in the area, and reconcile paleo-environmental and
Yao, Qiang; Liu, Kam-biu; Platt, William J.; Rivera-Monroy, Victor H.
2015-05-01
Palynological, loss-on-ignition, and X-ray fluorescence data from a 5.25 m sediment core from a mangrove forest at the mouth of the Shark River Estuary in the southwestern Everglades National Park, Florida were used to reconstruct changes occurring in coastal wetlands since the mid-Holocene. This multi-proxy record contains the longest paleoecological history to date in the southwestern Everglades. The Shark River Estuary basin was formed 5700 cal yr BP in response to increasing precipitation. Initial wetlands were frequently-burned short-hydroperiod prairies, which transitioned into long-hydroperiod prairies with sloughs in which peat deposits began to accumulate continuously about 5250 cal yr BP. Our data suggest that mangrove communities started to appear after 3800 cal yr BP; declines in the abundance of charcoal suggested gradual replacement of fire-dominated wetlands by mangrove forest over the following 2650 yr. By 1150 cal yr BP, a dense Rhizophora mangle dominated mangrove forest had formed at the mouth of the Shark River. The mangrove-dominated coastal ecosystem here was established at least 2000 yr later than has been previously estimated.
Vargas-Ramirez, L.; Roche, E.; Gerrienne, P.; Hooghiemstra, H.
2008-01-01
A pollen record from Puyehue area (40°S; 72°W) in the southern Lake District, Chile, indicates that prior to 13,410 14C yr BP (ca. 16,500-15,200 cal yr BP), cold resistant and hygrophilous vegetation, particularly Nothofagus forest and myricaceous vegetation, covered the area. From ca. 15,000 cal yr
Energy Technology Data Exchange (ETDEWEB)
Keene, Joshua L. [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2015-04-01
The Pioneer site in southeastern Idaho, an open-air, stratified, multi-component archaeological locality on the upper Snake River Plain, provides an ideal situation for understanding the geomorphic history of the Big Lost River drainage system. We conducted a block excavation with the goal of understanding the geochronological context of both cultural and geomorphological components at the site. The results of this study show a sequence of five soil formation episodes forming three terraces beginning prior to 7200 cal yr BP and lasting until the historic period, preserving one cultural component dated to ~3800 cal yr BP and multiple components dating to the last 800 cal yr BP. In addition, periods of deposition and stability at Pioneer indicate climate fluctuation during the middle Holocene (~7200-3800 cal yr BP), minimal deposition during the late Holocene, and a period of increased deposition potentially linked to the Little Ice Age. In addition, evidence for a high-energy erosion event dated to ~3800 cal yr BP suggest a catastrophic flood event during the middle Holocene that may correlate with volcanic activity at the Craters of the Moon lava fields to the northwest. This study provides a model for the study of alluvial terrace formations in arid environments and their potential to preserve stratified archaeological deposits.
Bischoff, J.L.; Menking, K.M.; Fitts, J.P.; Fitzpatrick, J.A.
1997-01-01
Chemical analyses of the acid-soluble and clay-size fractions of sediment samples (1500-yr resolution) reveal oscillations of lake salinity and of glacial advances in core OL-92 back to 155,000 yr B.P. Relatively saline conditions are indicated by the abundance of carbonate and smectite (both pedogenic and authigenic), reflected by Ca, Sr, and Mg in the acid-soluble suite, and by Cs2O, excess MgO, and LOI (loss on ignition) in the clay-size fraction. Rock flour produced during glacial advances is represented by the abundance of detrital plagioclase and biotite in the clay-size fraction, the ratio of which remains essentially constant over the entire time span. These phases are quantitatively represented by Na2O, TiO2, Ba, and Mn in the clay fraction. The rock-flour record indicates two major ice-advances during the penultimate glacial cycle corresponding to marine isotope stage (MIS) 6, no major advances during the last interglaciation (entire MIS 5), and three major advances during the last glacial cycle (MIS 2, 3, and 4). The ages of the latter three correspond rather well to 36Cl dates reported for Sierra Nevada moraines. The onset of the last interglaciation is shown by abrupt increases in authigenic CaCO3 and an abrupt decrease in rock flour, at about 118,000 yr B.P. according to our time scale. In contrast, the boundary appears to be gradual in the ??18O record in which the change from light to heavy values begins at about 140,000 yrs B.P. The exact position of the termination, therefore, may be proxy-dependent. Conditions of high carbonate and low rock flour prevailed during the entire period from 118,000 yr B.P. until the glacial advance at 53,000 yr B.P. signaled the end of this long interglaciation. ?? 1997 University of Washington.
Early mixed farming of millet and rice 7800 years ago in the Middle Yellow River region, China.
Directory of Open Access Journals (Sweden)
Jianping Zhang
Full Text Available The Peiligang Culture (9000-7000 cal. yr BP in the Middle Yellow River region, North China, has long been considered representative of millet farming. It is still unclear, however, if broomcorn millet or foxtail millet was the first species domesticated during the Peiligang Culture. Furthermore, it is also unknown whether millet was cultivated singly or together with rice at the same period. In this study, phytolith analysis of samples from the Tanghu archaeological site reveals early crop information in the Middle Yellow River region, China. Our results show that broomcorn millet was the early dry farming species in the Peiligang Culture at 7800 cal. yr BP, while rice cultivation took place from 7800 to 4500 cal. yr BP. Our data provide new evidence of broomcorn millet and rice mixed farming at 7800 cal. yr BP in the Middle Yellow River region, which has implications for understanding the domestication process of the two crops, and the formation and continuance of the Ancient Yellow River Civilization.
DEFF Research Database (Denmark)
Philippsen, Bente; Olsen, Jesper; Lewis, Jonathan P.
2013-01-01
Palaeoenvironmental and 14C reservoir age variability in the Limfjord, a sound through northern Jutland, Denmark, was investigated for the period 7300 to 1300 cal yr BP. Shells and bulk sediment samples from a core from a former inlet, Kilen, were analysed by radiocarbon dating and stable isotope....... They are therefore used to differentiate between brackish and marine palaeo-conditions. 14C reservoir ages of shells vary from ΔR=−140 to +300 14C years. Between 7300 and 5400 cal. yr BP, reservoir age and stable isotope values are highly variable and indicate mixing of marine water and brackish surface waters...... with hard water effects. After 5400 cal. yr BP, the ΔR values stabilise and show an increasingly marine environment, with 14C reservoir ages close to 400 years (ΔR=0). After 2000 cal. yr BP, Kilen becomes brackish. Reservoir ages and stable isotope values are again highly variable and δ13C and C/N values...
Liu, Yan; Sun, Qianli; Fan, Daidu; Dai, Bin; Ma, Fuwei; Xu, Lichen; Chen, Jing; Chen, Zhongyuan
2018-06-01
The Yaojiang Valley (YJV) of southern Hangzhou Bay was the birthplace of the well-known Hemudu Culture (HC), one of the representatives of Neolithic civilization in eastern China. To explore the magnitude of natural environmental effects on the HC trajectory, the palaeo-embayment setting of the YJV was studied in detail for the first time in terms of 3D Holocene strata supported by a series of new radiocarbon-dated cores. The results indicated that the local relative sea level rose rapidly during the Early Holocene in the YJV, reached its maximum flooding surface ca. 7900 cal yr BP, and then remained stable ca. 7900-7600 cal yr BP. Thereupon, an estuary stretching inland was first formed by marine transgression, and then, it was transformed to an alluvial-coastal plain by regressive progradation. The alluvial plain was initiated in the foothills and then spread towards the valley centre after sea level stabilization ca. 7600 cal yr BP. Accompanying these natural environmental changes, the earliest arrivals of foragers in the valley occurred no later than ca. 7000 cal yr BP. They engaged in rice farming and fostered the HC for approximately two millennia from ca. 7000-5000 cal yr BP as more lands developed from coastal progradation. The rise and development of the HC are closely associated with the sea level-induced landscape changes in the YJV in the Early-Middle Holocene, but the enigmatic exodus of the HC people after ca. 5000 cal yr BP is still contentious and possibly linked with the rapid waterlogging and deterioration of this setting in such a low-lying coastal plain as well as with associated social reasons.
Wu, Li; Zhu, Cheng; Ma, Chunmei; Li, Feng; Meng, Huaping; Liu, Hui; Li, Linying; Wang, Xiaocui; Sun, Wei; Song, Yougui
2017-10-01
Palaeo-hydrological and archaeological investigations were carried out in the Jianghan Plain in the middle reaches of the Yangtze River. Based on a comparative analysis of modern flood sediments and multidisciplinary approaches such as AMS14C and archaeological dating, zircon micromorphology, grain size, magnetic susceptibility, and geochemistry, we identified palaeoflood sediments preserved at the Zhongqiao archaeological site. The results indicate that three palaeoflood events (i.e. 4800-4597, 4479-4367, and 4168-3850 cal. yr BP) occurred at the Zhongqiao Site. Comparisons of palaeoflood deposit layers at a number of Neolithic cultural sites show that two extraordinary palaeoflood events occurred in the Jianghan Plain during approximately 4900-4600 cal. yr BP (i.e.mid-late Qujialing cultural period) and 4100-3800 cal. yr BP (i.e. from late Shijiahe cultural period to the Xia Dynasty). Further analysis of the environmental context suggests that these flooding events might have been connected with great climate variability during approximately 5000-4500 cal. yr BP and at ca. 4000 cal. yr BP. These two palaeoflood events were closely related to the expansion of the Jianghan lakes driven by the climatic change, which in turn influenced the rise and fall of the Neolithic cultures in the middle reaches of the Yangtze River. Other evidence also suggests that the intensified discrepancy between social development and environmental change processes (especially the hydrological process) during the late Shijiahe cultural period might be the key factor causing the collapse of the Shijiahe Culture. The extraordinary floods related to the climatic anomaly at ca. 4000 cal. yr BP and political conflicts from internal or other cultural areas all accelerated the collapse of the Shijiahe Culture.
Rigsby, Catherine A.; Platt Bradbury, J.; Baker, Paul A.; Rollins, Stephanie M.; Warren, Michelle R.
2005-10-01
Drill cores of sediments from the Rio Desaguadero valley, Bolivia, provide new information about the climate of tropical South America over the past 50 000 years. The modern Rio Desaguadero is fed by Lake Titicaca overflow (and by local tributaries) in the wetter northern Altiplano and discharges into Lake Poopo in the more arid central Altiplano. During the late Quaternary the Rio Desaguadero valley was the site of several generations of palaeolakes and wetlands that formed during periods of increased precipitation and local runoff, augmented by increased overflow from Lake Titicaca. Sediments recovered by drilling in eight localities along the 390-km long valley of the Rio Desaguadero yield a regional history of lacustrine sedimentation and effective precipitation. Lacustrine strata in the drill cores record 12 distinct wet periods in the past 50 000 years. Four of these wet periods resulted in the formation of major palaeolakes in the Rio Desaguadero valley: during the last glacial maximum from before 20 000 to 16 000 cal. yr BP, during the late glacial from about 14 000 to 12 000 cal. yr BP, in the early Holocene from about 10 000 to 7900 cal. yr BP, and in the late Holocene from 4500 cal. yrBP to present. The period that appears to have been most arid was between 7900 and 4500cal.yrBP. The Altiplano wet periods were generally synchronous with North Atlantic cold events (respectively, the last glacial maximum, the Younger Dryas, the 8200cal.yrBP event, and the Neoglacial) implying a relationship between past precipitation variability in tropical South America and North Atlantic sea-surface temperature.
Chen, T.; Ryves, D.; Wang, Z.; Lewis, J.
2017-12-01
During the middle Holocene, the hydrological environments in the Taihu Plain, Yangtze Delta, China, varied tremendously under the influence of sea-level and climate change. Simultaneously, several Neolithic cultures, such as, the Majiabang, Songze, and Liangzhu culture, developed in this region. Basing on AMS14C dating, diatom identification, measurements of C-N elements and their stable isotopes of sediments from core DTX4 and DTX10, obtained in the East Tiaoxi Plain, south Taihu plain, we discussed the influence of hydrology changes on the development of Neolithic cultures. The results revealed that the East Tiaoxi River plain was in an estuary (the Palaeo-Taihu Estuary) condition at 7500 cal. yr BP, undergoing elevated in-fill in response to rapid sea-level rise. After 7500 cal. yr BP, low salinity conditions occurred, likely influenced by the Yangtze freshwater evidenced by constant occurrence of Aulacoseira granulata, which implied Yangtze runoff discharged along the channel of Palaeo-incised Taihu valley into the Hangzhou Bay during the middle Holocene. Sea-water penetration interrupted after 7000 cal. yr BP caused by an abrupt sea-level rise. During 6500-5600 cal. yr BP, sea-water retreated gradually, corresponding to the infilling of Palaeo-Taihu Estuary. Combing records from previously studied cores in the Taihu plain, stable freshwater condition (or dry land) established in most area of the Taihu plain after 5600 cal. yr BP due to the closure of the Palaeo-Taihu Estuary. We speculate that the low-salinity marsh started at about 7500-7000 cal. yr BP probably attracted the early Majiabang people to live around the Palaeo-Taihu Estuary. The sea water penetration between 7000-6500 cal. yr BP matches the left of the late Majiabang and the early-middle Songze people lived in the east of the Palaeo-Taihu Estuary, to the north and east of the Taihu Plain. The context of stable freshwater condition (or dry land) in the East Tiaoxi River plain promoted the
Energy Technology Data Exchange (ETDEWEB)
Martínez Cortizas, Antonio, E-mail: antonio.martinez.cortizas@usc.es [Departamento de Edafoloxía e Química Agrícola, Facultade de Bioloxía, Universidade de Santiago de Compostela, Campus Sur s/n, Santiago de Compostela (Spain); López-Merino, Lourdes, E-mail: lourdes.lopez-merino@brunel.ac.uk [Institute of Environment, Health and Societies, Brunel University London, UB8 3PH Uxbridge (United Kingdom); Bindler, Richard, E-mail: richard.bindler@umu.se [Department of Ecology and Environmental Science, Umeå University, Umeå (Sweden); Mighall, Tim, E-mail: t.mighall@abdn.ac.uk [Department of Geography & Environment, School of Geosciences, University of Aberdeen, Elphinstone Road, Aberdeen AB24 3UF (United Kingdom); Kylander, Malin E., E-mail: malin.kylander@geo.su.se [Department of Geological Sciences and the Bolin Centre for Climate Research, Stockholm University, SE-10691, Stockholm (Sweden)
2016-03-01
Although archaeological research suggests that mining/metallurgy already started in the Chalcolithic (3rd millennium BC), the earliest atmospheric metal pollution in SW Europe has thus far been dated to ~ 3500–3200 cal. yr. BP in paleo-environmental archives. A low intensity, non-extensive mining/metallurgy and the lack of appropriately located archives may be responsible for this mismatch. We have analysed the older section (> 2100 cal. yr. BP) of a peat record from La Molina (Asturias, Spain), a mire located in the proximity (35–100 km) of mines which were exploited in the Chalcolithic/Bronze Age, with the aim of assessing evidence of this early mining/metallurgy. Analyses included the determination of C as a proxy for organic matter content, lithogenic elements (Si, Al, Ti) as markers of mineral matter, and trace metals (Cr, Cu, Zn, Pb) and stable Pb isotopes as tracers of atmospheric metal pollution. From ~ 8000 to ~ 4980 cal. yr. BP the Pb composition is similar to that of the underlying sediments (Pb 15 ± 4 μg g{sup −1}; {sup 206}Pb/{sup 207}Pb 1.204 ± 0.002). A sustained period of low {sup 206}Pb/{sup 207}Pb ratios occurred from ~ 4980 to ~ 2470 cal. yr. BP, which can be divided into four phases: Chalcolithic (~ 4980–3700 cal. yr. BP), {sup 206}Pb/{sup 207}Pb ratios decline to 1.175 and Pb/Al ratios increase; Early Bronze Age (~ 3700–3500 cal. yr. BP), {sup 206}Pb/{sup 207}Pb increase to 1.192 and metal/Al ratios remain stable; Late Bronze Age (~ 3500–2800 cal. yr. BP), {sup 206}Pb/{sup 207}Pb decline to their lowest values (1.167) while Pb/Al and Zn/Al increase; and Early Iron Age (~ 2800–2470 cal. yr. BP), {sup 206}Pb/{sup 207}Pb increase to 1.186, most metal/Al ratios decrease but Zn/Al shows a peak. At the beginning of the Late Iron Age, {sup 206}Pb/{sup 207}Pb ratios and metal enrichments show a rapid return to pre-anthropogenic values. These results provide evidence of regional/local atmospheric metal pollution triggered by the
Western equatorial African forest-savanna mosaics: a legacy of late Holocene climatic change?
Directory of Open Access Journals (Sweden)
A. Ngomanda
2009-10-01
Full Text Available Past vegetation and climate changes reconstructed using two pollen records from Lakes Maridor and Nguène, located in the coastal savannas and inland rainforest of Gabon, respectively, provide new insights into the environmental history of western equatorial African rainforests during the last 4500 cal yr BP. These pollen records indicate that the coastal savannas of western equatorial Africa did not exist during the mid-Holocene and instead the region was covered by evergreen rainforests. From ca. 4000 cal yr BP a progressive decline of inland evergreen rainforest, accompanied by the expansion of semi-deciduous rainforest, occurred synchronously with grassland colonisation in the coastal region of Gabon. The contraction of moist evergreen rainforest and the establishment of coastal savannas in Gabon suggest decreasing humidity from ca. 4000 cal yr BP. The marked reduction in evergreen rainforest and subsequent savanna expansion was followed from 2700 cal yr BP by the colonization of secondary forests dominated by the palm, Elaeis guineensis, and the shrub, Alchornea cordifolia (Euphorbiaceae. A return to wetter climatic conditions from about 1400 cal yr BP led to the renewed spread of evergreen rainforest inland, whereas a forest-savanna mosaic still persists in the coastal region. There is no evidence to suggest that the major environmental changes observed were driven by human impact.
Wahl, David B.; Estrada-Belli, Francisco; Anderson, Lysanna
2015-01-01
The timing, magnitude and drivers of late Holocene environmental change in the Holmul region of the southern Maya lowlands are examined by combining paleoenvironmental and archeological data. Environmental proxy analyses on a ~ 3350 cal yr lacustrine sediment record include pollen, charcoal, loss on ignition, magnetic suscep- tibility, and elemental geochemistry. Archeological evidence is derived from extensive settlement surveys conducted near the study site. Results indicate nearby settlement and agricultural activity taking place in an environment characterized by open forest from around 3350 to 950 cal yr BP. The fire history shows a dramatic increase in burning during the Classic period, possibly reflecting changing agricultural strategies. A distinct band of carbonate deposited from 1270 to 1040 cal yr BP suggests decreased hydrologic input associated with drier conditions. Abrupt changes in proxy data around 940 cal yr BP indicate a cessation of human disturbance and local abandonment of the area.
Mumma, Stephanie Ann; Whitlock, Cathy; Pierce, Kenneth
2012-01-01
A sediment core extending to 28,000 cal yr BP from Lower Red Rock Lake in the Centennial Valley of southwestern Montana provides new information on the nature of full-glacial vegetation as well as a history of late-glacial and Holocene vegetation and climate in a poorly studied region. Prior to 17,000 cal yr BP, the eastern Centennial Valley was occupied by a large lake (Pleistocene Lake Centennial), and valley glaciers were present in adjacent mountain ranges. The lake lowered upon erosion of a newly formed western outlet in late-glacial time. High pollen percentages of Juniperus, Poaceae, Asteraceae, and other herbs as well as low pollen accumulation rates suggest sparse vegetation cover. Inferred cold dry conditions are consistent with a strengthened glacial anticyclone at this time. Between 17,000 and 10,500 cal yr BP, high Picea and Abies pollen percentages suggest a shift to subalpine parkland and warmer conditions than before. This is attributed to the northward shift of the jet stream and increasing summer insolation. From 10,500 to 7100 cal yr BP, pollen evidence of open dry forests suggests warm conditions, which were likely a response to increased summer insolation and a strengthened Pacific subtropical high-pressure system. From 7100 to 2400 cal yr BP, cooler moister conditions promoted closed forest and wetlands. Increases in Picea and Abies pollen percentages after 2400 cal yr BP suggest increasing effective moisture. The postglacial pattern of Pseudotsuga expansion indicates that it arrived later on the Atlantic side of the Continental Divide than on the Pacific side. The Divide may have been a physical barrier for refugial populations or it delimited different climate regions that influenced the timing of Pseudotsuga expansion.
Directory of Open Access Journals (Sweden)
M. Servant
2010-05-01
Full Text Available A new pollen sequence from the Lake Mbalang (7°19´ N, 13°44´ E, 1110 m a.s.l. located on the eastern Adamawa plateau, in Central Cameroon, is presented in this paper to analyze the Holocene African Humid Period (AHP termination and related vegetation changes at 7° N in tropical Africa, completing an important transect for exploring shifts in the northern margin of the African Monsoon. This sequence, spanning the last 7000 cal yr BP, shows that the vegetation response to this transitional climatic period was marked by significant successional changes within the broad context of long-term aridification. Semi-deciduous/sub-montane forest retreat in this area is initially registered as early as ca. 6100 cal yr BP and modern savannah was definitely established at ca. 3000 cal yr BP and stabilized at ca. 2400 cal yr BP; but a slight forest regeneration episode is observed between ca. 5200 and ca. 4200 cal yr BP. In this area with modern high rainfall, increasing in the length of the dry season during the AHP termination linked to a contraction of the northern margin of the Intertropical Convergence Zone (ITCZ from ca. 6100 cal yr BP onward, probably associated with decreasing in cloud cover and/or fog frequency, has primarily controlled vegetation dynamics and above all the disappearance of the forested environment on the Adamawa plateau. Compared to previous studies undertaken in northern tropical and Central Africa, this work clearly shows that the response of vegetation to transitional periods between climatic extremes such as the AHP termination might be different in timing, mode and amplitude according to the regional climate of the study sites, but also according to the stability of vegetation before and during these climatic transitions.
Energy Technology Data Exchange (ETDEWEB)
Power, M.J. [University of Edinburgh, Institute of Geography, School of Geosciences, Edinburgh (United Kingdom); Marlon, J.; Ortiz, N.; Bartlein, P.J.; Harrison, S.P.; Mayle, F.E.; Ballouche, A.; Bradshaw, R.H.W.; Carcaillet, C.; Cordova, C.; Mooney, S.; Moreno, P.I.; Prentice, I.C.; Thonicke, K.; Tinner, W.; Whitlock, C.; Zhang, Y.; Zhao, Y.; Ali, A.A.; Anderson, R.S.; Beer, R.; Behling, H.; Briles, C.; Brown, K.J.; Brunelle, A.; Bush, M.; Camill, P.; Chu, G.Q.; Clark, J.; Colombaroli, D.; Connor, S.; Daniau, A.L.; Daniels, M.; Dodson, J.; Doughty, E.; Edwards, M.E.; Finsinger, W.; Foster, D.; Frechette, J.; Gaillard, M.J.; Gavin, D.G.; Gobet, E.; Haberle, S.; Hallett, D.J.; Higuera, P.; Hope, G.; Horn, S.; Inoue, J.; Kaltenrieder, P.; Kennedy, L.; Kong, Z.C.; Larsen, C.; Long, C.J.; Lynch, J.; Lynch, E.A.; McGlone, M.; Meeks, S.; Mensing, S.; Meyer, G.; Minckley, T.; Mohr, J.; Nelson, D.M.; New, J.; Newnham, R.; Noti, R.; Oswald, W.; Pierce, J.; Richard, P.J.H.; Rowe, C.; Sanchez Goni, M.F.; Shuman, B.N.; Takahara, H.; Toney, J.; Turney, C.; Urrego-Sanchez, D.H.; Umbanhowar, C.; Vandergoes, M.; Vanniere, B.; Vescovi, E.; Walsh, M.; Wang, X.; Williams, N.; Wilmshurst, J.; Zhang, J.H.
2008-06-15
Fire activity has varied globally and continuously since the last glacial maximum (LGM) in response to long-term changes in global climate and shorter-term regional changes in climate, vegetation, and human land use. We have synthesized sedimentary charcoal records of biomass burning since the LGM and present global maps showing changes in fire activity for time slices during the past 21,000 years (as differences in charcoal accumulation values compared to pre-industrial). There is strong broad-scale coherence in fire activity after the LGM, but spatial heterogeneity in the signals increases thereafter. In North America, Europe and southern South America, charcoal records indicate less-than-present fire activity during the deglacial period, from 21,000 to {proportional_to}11,000 cal yr BP. In contrast, the tropical latitudes of South America and Africa show greater-than-present fire activity from {proportional_to}19,000 to {proportional_to}17,000 cal yr BP and most sites from Indochina and Australia show greater-than-present fire activity from 16,000 to {proportional_to}13,000 cal yr BP. Many sites indicate greater-than-present or near-present activity during the Holocene with the exception of eastern North America and eastern Asia from 8,000 to {proportional_to}3,000 cal yr BP, Indonesia and Australia from 11,000 to 4,000 cal yr BP, and southern South America from 6,000 to 3,000 cal yr BP where fire activity was less than present. Regional coherence in the patterns of change in fire activity was evident throughout the post-glacial period. These complex patterns can largely be explained in terms of large-scale climate controls modulated by local changes in vegetation and fuel load. (orig.)
DEFF Research Database (Denmark)
Rasmussen, Peter; Hede, Mikkel Ulfeldt; Noe-Nygaard, Nanna
2009-01-01
of climate and the effects of human activities. These problems also complicate the prediction of possible future climate influence on lake ecology. A way of circumventing these problems is the use of lake sediment records which contain a wealth of information about past lake history over long time scales...... productivity as reflected by high algal pigment accumulation rates in the period c. 8400–7950 cal yr BP. After c. 7950 cal yr BP algal productivity declined somewhat but the lake did not return to its pre-8400 cal yr BP conditions remaining a more productive and nutrient rich lake than before the climate...... was of more importance for lake ecosystem process than the change in air temperature....
Alloway, Brent V.; Lowe, David J.; Barrell, David J. A.; Newnham, Rewi M.; Almond, Peter C.; Augustinus, Paul C.; Bertler, Nancy A. N.; Carter, Lionel; Litchfield, Nicola J.; McGlone, Matt S.; Shulmeister, Jamie; Vandergoes, Marcus J.; Williams, Paul W.; Members, Nz-Intimate
2007-01-01
It is widely recognised that the acquisition of high-resolution palaeoclimate records from southern mid-latitude sites is essential for establishing a coherent picture of inter-hemispheric climate change and for better understanding of the role of Antarctic climate dynamics in the global climate system. New Zealand is considered to be a sensitive monitor of climate change because it is one of a few sizeable landmasses in the Southern Hemisphere westerly circulation zone, a critical transition zone between subtropical and Antarctic influences. New Zealand has mountainous axial ranges that amplify the climate signals and, consequently, the environmental gradients are highly sensitive to subtle changes in atmospheric and oceanic conditions. Since 1995, INTIMATE has, through a series of international workshops, sought ways to improve procedures for establishing the precise ages of climate events, and to correlate them with high precision, for the last 30 000 calendar years. The NZ-INTIMATE project commenced in late 2003, and has involved virtually the entire New Zealand palaeoclimate community. Its aim is to develop an event stratigraphy for the New Zealand region over the past 30 000 years, and to reconcile these events against the established climatostratigraphy of the last glacial cycle which has largely been developed from Northern Hemisphere records (e.g. Last Glacial Maximum (LGM), Termination I, Younger Dryas). An initial outcome of NZ-INTIMATE has been the identification of a series of well-dated, high-resolution onshore and offshore proxy records from a variety of latitudes and elevations on a common calendar timescale from 30 000 cal. yr BP to the present day. High-resolution records for the last glacial coldest period (LGCP) (including the LGM sensu stricto) and last glacial-interglacial transition (LGIT) from Auckland maars, Kaipo and Otamangakau wetlands on eastern and central North Island, marine core MD97-2121 east of southern North Island, speleothems
International Nuclear Information System (INIS)
Hicks, H.; Nichol, S.L.
2007-01-01
An infilled wetland located behind coastal dunes in north-east Northland is used to reconstruct a local history of environmental change spanning early Holocene (c. 7000 yr BP) to modern time. Proxy indicators (sediment texture, diatoms and pollen) provide evidence for a transition from marginal marine- to brackish- to freshwater-conditions in the wetland. Radiocarbon ages constrain the chronology of this succession to 7880-7430 cal. yr BP for the early period of marine conditions, 3570-3210 cal. yr BP for the latter brackish phase and 1060-800 cal. yr BP for the change to freshwater conditions. Within this succession, the diatom record preserves a strong brackish signal at core depths above the limit of the modern tidal range. This is presented as preliminary evidence for a mid-Holocene sea level highstand for northern New Zealand of approximately 1.2 m above present mean sea level. (author). 40 refs., 7 figs., 1 tab
Energy Technology Data Exchange (ETDEWEB)
Kokorowski, H D; Anderson, P M; Sletten, R S; Lozhkin, A V; Brown, T A
2008-05-20
Palynological (species assemblage, pollen accumulation rate), geochemical (carbon to nitrogen ratios, organic carbon and biogenic silica content), and sedimentological (particle size, magnetic susceptibility) data combined with improved chronology and greater sampling resolution from a new core from Elikchan 4 Lake provide a stronger basis for defining paleoenvironmental changes than was previously possible. Persistence of herb-dominated tundra, slow expansion of Betula and Alnus shrubs, and low percentages of organic carbon and biogenic silica suggest that the Late-Glacial transition (ca. 16,000-11,000 cal. yr BP) was a period of gradual rather than abrupt vegetation and climatic change. Consistency of all Late-Glacial data indicates no Younger Dryas climatic oscillation. A dramatic peak in pollen accumulation rates (ca. 11,000-9800 cal. yr BP) suggests a possible summer temperature optimum, but finer grain-sizes, low magnetic susceptibility, and greater organic carbon and biogenic silica, while showing significant warming at ca. 11,000 cal. yr BP, offer no evidence of a Holocene thermal maximum. When compared to trends in other paleo-records, the new Elikchan data underscore the apparent spatial complexity of climatic responses in Northeast Siberia to global forcings between ca. 16,000-9000 cal. yr BP.
Directory of Open Access Journals (Sweden)
Amon, Leeli
2010-06-01
Full Text Available Reinvestigation of the late glacial Solova (Remmeski basin, based on plant macrofossil and diatom record, AMS 14C chronology and sediment composition (loss-on-ignition and magnetic susceptibility data, provided information on vegetation history and palaeoenvironmental and palaeoclimatic changes since the time of the deglaciation of the area around 14 000 cal yr BP. The chronology of the sequence is based on seven AMS dates on terrestrial macrofossils, providing evidence of rapid sedimentation in between 14 000 and 13 500 cal yr BP. Loss-on-ignition data show a clear short-lived warming episode centred to 13 800 cal yr BP, tentatively correlated with the GI-1c warming of the event stratigraphy of the Last Termination in the North Atlantic region, which suggests that at least parts of the Haanja Heights were ice-free by 14 000 cal yr BP. Macrofossil evidence indicates Betula nana–Dryas octopetala-dominated open tundra communities with Saxifraga on dry ground, and Carex sp. and Juncus on wet ground at that time. The first evidence of the postglacial presence of tree birch (Betula pendula in Estonia is dated back to 13 500 cal yr BP. However, conifer remains were not found in the late glacial sediment sequence of Solova Bog. The late-Allerød (GI-1a organic deposits, which are quite typical of other parts of Estonia and indicate general warming, are missing at Solova, most probably due to a hiatus in sedimentation in this very small and shallow upland basin.
Liu, Y.; Sun, Q.; Fan, D.; Chen, Z.
2017-12-01
The formation of Holocene coast in eastern China provided material base for the development of Neolithic civilizations. The coastal Yaojiang valley of south Hangzhou bay was one of the examples where the well-known Neolithic Hemudu Culture (HC) of Eastern China initiated. Here, we studied the early-to-middle Holocene environment changes in relation to sea-level fluctuations on the basis of a serial of sediment cores based on a set of new Accelerator Mass Spectrometry radiocarbon (AMS 14C) chronology. The result indicated that relative sea-level rose rapidly in the Yaojiang valley at the early Holocene, reaching its maximum at ca. 8000-7800 cal yr BP and then decelerated at ca. 7800-7500 cal yr BP. The alluvial plain in Yaojiang valley began to form at the foothills first and then grew towards the valley center accompanying with the sea-level stabilization after ca. 7500 cal yr BP. This progressive progradation of alluvial plain would attract the early arrivals of foragers to dwell at the foothills to engaging in rice farming after ca.7000 cal yr BP and starting the epic Hemudu Culture. The HC people then move down to the valley center as more land became available thanks to sediment aggregation and progradation. The rise and development of HC were closely associated with the sea-level induced landscape changes in Yaojiang valley at the early-middle Holocene, and the unstable hydraulic condition in the valley after 5000 cal yr BP could be accountable for the cultural termination.
Alizadeh, Kamaleddin; Cohen, Marcelo; Behling, Hermann
2015-08-01
Presence of a coastal savanna belt expanding from British Guiana to northeastern Brazil cannot be explained by present-day climate. Using pollen and charcoal analyses on an 11.6 k old sediment core from a coastal depression in the savanna belt near the mouth of the Amazon River we investigated the paleoenvironmental history to shed light on this question. Results indicate that small areas of savanna accompanied by a forest type composed primarily by the genus Micropholis (Sapotaceae) that has no modern analog existed at the beginning of the Holocene. After 11,200 cal yr BP, savanna accompanied by few trees replaced the forest. In depressions swamp forest developed and by ca 10,000 cal yr BP replaced by Mauritia swamps. Between 8500 and 5600 cal yr BP gallery forest (composed mainly of Euphorbiaceae) and swamp forest succeeded the treeless savanna. The modern vegetation with alternating gallery forest and savanna developed after 5600 cal yr BP. We suggest that the early Holocene no-analog forest is a relict of previously more extensive forest under cooler and moister Lateglacial conditions. The early Holocene savanna expansion indicates a drier phase probably related to the shift of the Intertropical Convergence Zone (ITCZ) towards its northernmost position. The mid-Holocene forest expansion is probably a result of the combined influence of equatorwards shift of ITCZ joining the South Atlantic Convergence Zone (SACZ). The ecosystem variability during the last 5600 cal yr BP, formed perhaps under influence of intensified ENSO condition. High charcoal concentrations, especially during the early Holocene, indicate that natural and/or anthropogenic fires may have maintained the savanna. However, our results propose that climate change is the main driving factor for the formation of the coastal savanna in this region. Our results also show that the early Holocene sea level rise established mangroves near the study site until 7500 cal yr BP and promoted swamp formation in
Goodman, Adam Y.; Rodbell, Donald T.; Seltzer, Geoffrey O.; Mark, Bryan G.
2001-07-01
The Cordillera Vilcanota and Quelccaya Ice Cap region of southern Peru (13°30‧-14°00‧S; 70°40‧-71°25‧W) contains a detailed record of late Quaternary glaciation in the tropical Andes. Quantification of soil development on 19 moraine crests and radiocarbon ages are used to reconstruct the glacial history. Secondary iron and clay increase linearly in Quelccaya soils and clay accumulates at a linear rate in Vilcanota soils, which may reflect the semicontinuous addition of eolian dust enriched in secondary iron to all soils. In contrast, logarithmic rates of iron buildup in soils in the Cordillera Vilcanota reflect chemical weathering; high concentrations of secondary iron in Vilcanota tills may mask the role of eolian input to these soils. Soil-age estimates from extrapolation of field and laboratory data suggest that the most extensive late Quaternary glaciation occurred >70,000 yr B.P. This provides one of the first semiquantitative age estimates for maximum ice extent in southern Peru and is supported by a minimum-limiting age of ∼41,520 14C yr B.P. A late glacial readvance culminated ∼16,650 cal yr B.P. in the Cordillera Vilcanota. Following rapid deglaciation of unknown extent, an advance of the Quelccaya Ice Cap occurred between ∼13,090 and 12,800 cal yr B.P., which coincides approximately with the onset of the Younger Dryas cooling in the North Atlantic region. Moraines deposited <394 cal yr B.P. in the Cordillera Vilcanota and <300 cal yr B.P. on the west side of the Quelccaya Ice Cap correlate with Little Ice Age moraines of other regions.
Benthic foraminifera response to Holocene environmental changes in the ria de Muros (NW Spain)
Diz, P.; Francés, G.; Pena, L. D.; Nombela, M. A.; Alejo, I.
2003-04-01
Benthic foraminifera assemblages from the outer sector of the ría de Muros have been analyzed in order to obtain a detailed reconstruction of Holocene environmental evolution. The studied core (EUGC-3B: 42' 45.10'N; 9' 02.23'W, at 38 m.b.s.l. and 410 cm length) consists of muddy sand from the core bottom (8200 cal yr BP) to 200 cm (2700 cal yr BP) and mainly mud from 200 cm to the core top. Measurements of geochemical properties carried out by a XRF core scanner revealed different signatures in the two aforementioned intervals and an enhancing terrigenous influence during the last 2000 yr. The prevalence of Bulimina spp., Nonion fabum, Ammonia beccarii and Cibicides ungerianus along the whole core indicates high organic carbon concentration and/or low oxygenation levels into the sediment. Nevertheless, the percentage of these species shows noticeable changes, indicating the existence of five periods with different environmental conditions. The basal assemblage (8200-7500 cal yr BP) is dominated by epifaunal taxa and it can be interpreted as a low sea level assemblage. An increase of fresh water influence during the Holocene Climate Optimum (7500-5000 cal yr BP) is revealed by maxima percentages of A. beccarii. The oceanic influence increased during the Subboreal period (5000-2750 cal yr BP) leading to an active water interchange between the ría and the open ocean and a higher marine productivity. The oceanic influence is recorded by the increase of typical marine species as Elphidium advenum, Bulimina spp., N. fabum, and Nonionella turgida. The appearance of Rectuvigerina phlegeri at 4000 cal yr BP denotes full marine conditions. Environmental conditions similar to the current ones were achieved during the Subatlantic period (2750-Rec). In a first step an assemblage dominated by Bulimina spp. N. fabum, and C. ungerianus permit us to interpret a relatively stable period with episodic pulses of fluvial influence. Afterwards the appearance and the rapid increase of
Lamair, Laura; Hubert-Ferrari, Aurélia; Yamamoto, Shinya; El Ouahabi, Meriam; Vander Auwera, Jacqueline; Obrochta, Stephen; Boes, Evelien; Nakamura, Atsunori; Fujiwara, Osamu; Shishikura, Masanobu; Schmidt, Sabine; Siani, Giuseppe; Miyairi, Yosuke; Yokoyama, Yusuke; De Batist, Marc; Heyvaert, Vanessa M. A.; QuakeRecNankai Team
2018-01-01
Lacustrine sediments are particularly sensitive to modifications within the lake catchment. In a volcanic area, sedimentation rates are directly affected by the history of the volcano and its eruptions. Here, we investigate the impact of Mt. Fuji Volcano (Japan) on Lake Motosu and its watershed. The lacustrine infill is studied by combining seismic reflection profiles and sediment cores. We show evidence of changes in sedimentation patterns during the depositional history of Lake Motosu. The frequency of large mass-transport deposits recorded within the lake decreases over the Holocene. Before 8000 cal yr BP, large sublacustrine landslides and turbidites were filling the lacustrine depression. After 8000 cal yr BP, only one large sublacustrine landslide was recorded. The change in sedimentation pattern coincides with a change in sediment accumulation rate. Over the last 8000 cal yr BP, the sediment accumulation rate was not sufficient enough to produce large sublacustrine slope failures. Consequently, the frequency of large mass-transport deposits decreased and only turbidites resulting from surficial slope reworking occurred. These constitute the main sedimentary infill of the deep basin. We link the change in sediment accumulation rate with (i) climate and vegetation changes; and (ii) the Mt. Fuji eruptions which affected the Lake Motosu watershed by reducing its size and strongly modified its topography. Moreover, this study highlights that the deposition of turbidites in the deep basin of Lake Motosu is mainly controlled by the paleobathymetry of the lakefloor. Two large mass-transport deposits, occurring around 8000 cal yr BP and 2000 cal yr BP respectively, modified the paleobathymetry of the lakefloor and therefore changed the turbidite depositional pattern of Lake Motosu.
Walsh, Megan K.; Pearl, Christopher A.; Whitlock, Cathy; Bartlein, Patrick J.; Worona, Marc A.
2010-01-01
High-resolution macroscopic charcoal and pollen analysis were used to reconstruct an 11??000-year-long record of fire and vegetation history from Beaver Lake, Oregon, the first complete Holocene paleoecological record from the floor of the Willamette Valley. In the early Holocene (ca 11??000-7500 calendar years before present [cal??yr??BP]), warmer, drier summers than at present led to the establishment of xeric woodland of Quercus, Corylus, and Pseudotsuga near the site. Disturbances (i.e., floods, fires) were common at this time and as a result Alnus rubra grew nearby. High fire frequency occurred in the early Holocene from ca 11??200-9300??cal??yr??BP. Riparian forest and wet prairie developed in the middle Holocene (ca 7500??cal??yr??BP), likely the result of a decrease in the frequency of flooding and a shift to effectively cooler, wetter conditions than before. The vegetation at Beaver Lake remained generally unchanged into the late Holocene (from 4000??cal??yr??BP to present), with the exception of land clearance associated with Euro-American settlement of the valley (ca 160??cal??yr BP). Middle-to-late Holocene increases in fire frequency, coupled with abrupt shifts in fire-episode magnitude and charcoal composition, likely indicate the influence anthropogenic burning near the site. The paleoecological record from Beaver Lake, and in particular the general increase in fire frequency over the last 8500??years, differs significantly from other low-elevation sites in the Pacific Northwest, which suggests that local controls (e.g., shifts in vegetation structure, intensification of human land-use), rather than regional climatic controls, more strongly influenced its environmental history. ?? 2010 Elsevier Ltd.
Holocene Dynamics of Temperate Rainforests in West-Central Patagonia
Directory of Open Access Journals (Sweden)
Virginia Iglesias
2018-01-01
Full Text Available Analyses of long-term ecosystem dynamics offer insights into the conditions that have led to stability vs. rapid change in the past and the importance of disturbance in regulating community composition. In this study, we (1 used lithology, pollen, and charcoal data from Mallín Casanova (47°S to reconstruct the wetland, vegetation, and fire history of west-central Patagonia; and (2 compared the records with independent paleoenvironmental and archeological information to assess the effects of past climate and human activity on ecosystem dynamics. Pollen data indicate that Nothofagus-Pilgerodendron forests were established by 9,000 cal yr BP. Although the biodiversity of the understory increased between 8,480 and 5,630 cal yr BP, forests remained relatively unchanged from 9,000 to 2,000 cal yr BP. The charcoal record registers high fire-episode frequency in the early Holocene followed by low biomass burning between 6,500 and 2,000 cal yr BP. Covarying trends in charcoal, bog development, and Neoglacial advances suggest that climate was the primary driver of these changes. After 2,000 cal yr BP, the proxy data indicate (a increased fire-episode frequency; (b centennial-scale shifts in bog and forest composition; (c the emergence of vegetation-fire linkages not recorded in previous times; and (d paludification in the last 500 years possibly associated with forest loss. Our results therefore suggest that Nothofagus-Pilgerodendron dominance was maintained through much of the Holocene despite long-term changes in climate and fire. Unparalleled fluctuations in local ecosystems during the last two millennia were governed by disturbance-vegetation-hydrology feedbacks likely triggered by greater climate variability and deforestation.
DEFF Research Database (Denmark)
Hede, Mikkel Ulfeldt; Rasmussen, Peter; Noe-Nygaard, Nanna
2010-01-01
ecosystems to the 8.2 ka cold event. A reduced pollen production by thermophilous deciduous tree taxa in the period c. 8250–8000 cal yr BP reveal that the forest ecosystem was affected by low temperatures during the summer and winter/early-spring seasons. This finding is consistent with the timing of the 8.......2 ka cold event as registered in the Greenland ice cores. At Højby Sø, the climate anomaly appears to have started 200–250 yr earlier than the 8.2 ka cold event as the lake proxy data provide strong evidence for a precipitation-induced distinct increase in catchment soil erosion beginning around 8500...... cal yr BP. Alteration of the terrestrial environment then resulted in a major aquatic ecosystem change with nutrient enrichment of the lake and enhanced productivity, which lasted until c. 7900 cal yr BP. Keywords: 8.2 ka cold event; Lake sediments; Palaeoclimate; Pollen; Macrofossils; Geochemistry...
Woodward, C. A.; Shulmeister, J.
2007-01-01
We present chironomid-based temperature reconstructions from lake sediments deposited between ca 26,600 cal yr BP and 24,500 cal yr BP from Lyndon Stream, South Island, New Zealand. Summer (February mean) temperatures averaged 1 °C cooler, with a maximum inferred cooling of 3.7 °C. These estimates corroborate macrofossil and beetle-based temperature inferences from the same site and suggest climate amelioration (an interstadial) at this time. Other records from the New Zealand region also show a large degree of variability during the late Otiran glacial sequence (34,000-18,000 cal yr BP) including a phase of warming at the MIS 2/3 transition and a maximum cooling that did not occur until the global LGM (ca 20,000 cal yr BP). The very moderate cooling identified here at the MIS 2/3 transition confirms and enhances the long-standing discrepancy in New Zealand records between pollen and other proxies. Low abundances (<20%) of canopy tree pollen in records from late MIS 3 to the end of MIS 2 cannot be explained by the minor (<5 °C) cooling inferred from this and other studies unless other environmental parameters are considered. Further work is required to address this critical issue.
IntCal13 and Marine13 Radiocarbon Age Calibration Curves 0–50,000 Years cal BP
Reimer, Paula J.; Bard, Edouard; Bayliss, Alex; Beck, J. Warren; Blackwell, Paul G.; Bronk Ramsey, Christopher; Buck, Caitlin E.; Cheng, Hai; Edwards, R. Lawrence; Friedrich, Michael; Grootes, Pieter M.; Guilderson, Thomas P.; Haflidason, Haflidi; Hajdas, Irka; Hatté, Christine; Heaton, Timothy J.; Hoffmann, Dirk L.; Hogg, Alan G.; Hughen, Konrad A.; Kaiser, K. Felix; Kromer, Bernd; Manning, Sturt W.; Niu, Mu; Reimer, Ron W.; Richards, David A.; Scott, E. Marian; Southon, John R.; Staff, Richard A.; Turney, Christian S.M.; Plicht, Johannes van der; Reimer, Paula J.
2013-01-01
The IntCal09 and Marine09 radiocarbon calibration curves have been revised utilizing newly available and updated data sets from C-14 measurements on tree rings, plant macrofossils, speleothems, corals, and foraminifera. The calibration curves were derived from the data using the random walk model
Dynamics of floodplain lakes in the Upper Amazon Basin during the late Holocene
Quintana-Cobo, Isabel; Moreira-Turcq, Patricia; Cordeiro, Renato C.; Aniceto, Keila; Crave, Alain; Fraizy, Pascal; Moreira, Luciane S.; Duarte Contrera, Julia Maria de Aguiar; Turcq, Bruno
2018-01-01
To better understand the impact of channel migration processes and climate change on the depositional dynamics of floodplain lakes of the upper Amazon Basin during the late Holocene, we collected three sediment cores from floodplain lakes of the Ucayali River and one from the Marañón River. The cores were dated with 14C, radiographed and described. Bulk density, grain size analysis and total organic carbon (TOC) were determined. The results show that sedimentation in Ucayali floodplain lakes was marked by variations during the late Holocene, with periods of intense hydrodynamic energy and abrupt accumulations, a gap in the record between about 2870 and 690 cal yr BP, and periods of more lacustrine conditions. These changes in sedimentation were associated with variations in the river's influence related to changes in its meandering course (2870 cal yr BP) and a period of severe flooding between 3550 and 3000 cal yr BP. Lake Lagarto on the Marañón River floodplain exhibits a different sedimentary environment of low hydrodynamics with palm trees and macrophytes. Apparently, the lake has not experienced intense migration processes during the last 600 cal yr BP (base of the core). Nevertheless, the river sediment flux to the lake was important from 600 to 500 cal yr BP, although it decreased thereafter until the present. This decrease in the mineral accumulation rate indicates a decrease in river discharge since 500 cal yr BP, which coincides with precipitation records from the central Andes. In the upper part of the three Ucayali floodplain cores, a 30- to 250-cm-thick layer of reworked sediments has been deposited since 1950 AD (post-bomb). In Lake Carmen, this layer is associated with invasion of the lake by the levee of a migrating meander of the Ucayali. In Lakes Hubos and La Moringa, however, the river is still far away and the deposition must be interpreted as the result of extreme flooding. The beginning of the Ucayali meander migration is dated back to
Nelson, Alan R.; Personius, Stephen F.; Sherrod, Brian L.; Kelsey, Harvey M.; Johnson, Samuel Y.; Bradley, Lee-Ann; Wells, Ray E.
2014-01-01
Earthquake prehistory of the southern Puget Lowland, in the north-south compressive regime of the migrating Cascadia forearc, reflects diverse earthquake rupture modes with variable recurrence. Stratigraphy and Bayesian analyses of previously reported and new 14C ages in trenches and cores along backthrust scarps in the Seattle fault zone restrict a large earthquake to 1040–910 cal yr B.P. (2σ), an interval that includes the time of the M 7–7.5 Restoration Point earthquake. A newly identified surface-rupturing earthquake along the Waterman Point backthrust dates to 940–380 cal yr B.P., bringing the number of earthquakes in the Seattle fault zone in the past 3500 yr to 4 or 5. Whether scarps record earthquakes of moderate (M 5.5–6.0) or large (M 6.5–7.0) magnitude, backthrusts of the Seattle fault zone may slip during moderate to large earthquakes every few hundred years for periods of 1000–2000 yr, and then not slip for periods of at least several thousands of years. Four new fault scarp trenches in the Tacoma fault zone show evidence of late Holocene folding and faulting about the time of a large earthquake or earthquakes inferred from widespread coseismic subsidence ca. 1000 cal yr B.P.; 12 ages from 8 sites in the Tacoma fault zone limit the earthquakes to 1050–980 cal yr B.P. Evidence is too sparse to determine whether a large earthquake was closely predated or postdated by other earthquakes in the Tacoma basin, but the scarp of the Tacoma fault was formed by multiple earthquakes. In the northeast-striking Saddle Mountain deformation zone, along the western limit of the Seattle and Tacoma fault zones, analysis of previous ages limits earthquakes to 1200–310 cal yr B.P. The prehistory clarifies earthquake clustering in the central Puget Lowland, but cannot resolve potential structural links among the three Holocene fault zones.
Improved precision radiocarbon measurements and natural 14C variations around 10.000 cal BP
International Nuclear Information System (INIS)
Goslar, T.
1990-01-01
The subject of present work, natural radiocarbon variations in the past, is one of the most significant methodological questions of radiocarbon chronology. In the first three chapters, the author discusses problems connected with calibration of conventional radiocarbon dates, and consequences of monitoring the 14 C variations for the research of the changes of geomagnetic field, solar activity and global carbon cycle. Dendrochronological dating, which, in connection with 14 C measurements enables us to reconstruct the radiocarbon variations in the past, is also widely described. Fourth chapter concerns the technical problems of detection 14 C β-activity, especially accounting for proportional counters technique. In the next chapter the author describes results of his own dendrochonological research. Sixth chapter comprises frame discussion of the system for improved precision radiocarbon dating, together with short presentation of equipment, its calibration and analysis of errors. The last chapter gives the reconstruction of the pattern of atmospheric 14 C variations in 300-year period around 10.000 cal BP. It was found that in the last 10.000 years similar pattern repeats periodically. In the end, the author discusses the meaning of negative correlation between 14 C variations and changes of annual tree-ring widths in the oak trunk from Lublinek, for searching the connection between solar activity and climate. (author)
Multistep food plant processing at Grotta Paglicci (Southern Italy) around 32,600 cal B.P.
Mariotti Lippi, Marta; Foggi, Bruno; Aranguren, Biancamaria; Ronchitelli, Annamaria; Revedin, Anna
2015-09-29
Residue analyses on a grinding tool recovered at Grotta Paglicci sublayer 23A [32,614 ± 429 calibrated (cal) B.P.], Southern Italy, have demonstrated that early modern humans collected and processed various plants. The recording of starch grains attributable to Avena (oat) caryopses expands our information about the food plants used for producing flour in Europe during the Paleolithic and about the origins of a food tradition persisting up to the present in the Mediterranean basin. The quantitative distribution of the starch grains on the surface of the grinding stone furnished information about the tool handling, confirming its use as a pestle-grinder, as suggested by the wear-trace analysis. The particular state of preservation of the starch grains suggests the use of a thermal treatment before grinding, possibly to accelerate drying of the plants, making the following process easier and faster. The study clearly indicates that the exploitation of plant resources was very important for hunter-gatherer populations, to the point that the Early Gravettian inhabitants of Paglicci were able to process food plants and already possessed a wealth of knowledge that was to become widespread after the dawn of agriculture.
Huang, Chao; Wei, Gangjian; Li, Wuxian; Liu, Ying
2018-04-01
This paper presents relatively high-resolution geochemical records spanning the past 4000 cal yr BP obtained from the lacustrine sediments of Poyang Lake in central China. The variations in the intensity of the East Asian summer monsoon (EASM) are traced using the K/Na, Ti/Na, Al/K, kaolinite/illite and clay/feldspar ratios, together with the chemical index of alteration (CIA), as indicators of chemical weathering. During the last 4000 years, the proxy records of chemical weathering from Poyang Lake exhibit an overall enhanced trend, consistent with regional hydrological changes in previous independent records. Further comparisons and analyses demonstrate that regional moisture variations in central China is inversely correlated with the EASM intensity, with weak EASM generating high precipitation in central China. Our data reveal three intervals of dramatically dry climatic conditions (i.e., ca. 4000-3200 cal yr BP, ca. 2800-2400 cal yr BP, and ca. 500-200 cal yr BP). A period of weak chemical weathering, related to cold and dry climatic conditions, occurred during the Little Ice Age (LIA), whereas more intense chemical weathering, reflecting warm and humid climatic conditions, was recorded during the Medieval Warm Period (MWP). Besides, an intensification of chemical weathering in Poyang Lake during the late Holocene agrees well with strong ENSO activity, suggesting that moisture variations in central China may be predominantly driven by ENSO variability.
Booth, R.K.; Jackson, S.T.; Thompson, T.A.
2002-01-01
We reconstructed Holocene water-level and vegetation dynamics based on pollen and plant macrofossils from a coastal lake in Upper Michigan. Our primary objective was to test the hypothesis that major fluctuations in Great Lakes water levels resulted in part from climatic changes. We also used our data to provide temporal constraints to the mid-Holocene dry period in Upper Michigan. From 9600 to 8600 cal yr B.P. a shallow, lacustrine environment characterized the Mud Lake basin. A Sphagnum-dominated wetland occupied the basin during the mid-Holocene dry period (???8600 to 6600 cal yr B.P.). The basin flooded at 6600 cal yr B.P. as a result of rising water levels associated with the onset of the Nipissing I phase of ancestral Lake Superior. This flooding event occured contemporaneously with a well-documented regional expansion of Tsuga. Betula pollen increased during the Nipissing II phase (4500 cal yr B.P.). Macrofossil evidence from Mud Lake suggests that Betula alleghaniensis expansion was primarily responsible for the rising Betula pollen percentages. Major regional and local vegetational changes were associated with all the major Holocene highstands of the western Great Lakes (Nipissing I, Nipissing II, and Algoma). Traditional interpretations of Great Lakes water-level history should be revised to include a major role of climate. ?? 2002 University of Washington.
Evidence of a higher late-Holocene treeline along the Continental Divide in central Colorado
Carrara, Paul E.; McGeehin, John
2015-01-01
Using a combination of 23 radiocarbon ages and annual ring counts from 18 Rocky Mountain bristlecone pine (Pinus aristata) remnants above the local present-day limits, a period of higher treeline has been determined for two sites near the Continental Divide in central Colorado. The highest remnants were found about 30 m above live bristlecone pines of similar size. The majority of the remnants, consisting of standing snags, large logs, and smaller remains, are highly eroded, such that the innermost annual rings of all but one are missing. The radiocarbon ages obtained from the oldest wood recovered from each remnant indicate that the majority were established above the present-day limit of bristlecone pine from prior to 2700 cal. yr BP to no later than about 1200 cal. yr BP. These radiocarbon ages combined with the annual ring count from the corresponding remnant indicate that the majority of the sampled remnants grew above the present-day limit of bristlecone pine from sometime before 2700 cal. yr BP to about 800 cal. yr BP. Evidence of recent climatic warming is demonstrated at one of the sites by young bristlecone pine saplings growing next to the highest remnants; the saplings were established after AD 1965 and represent the highest advance of treeline in at least 1200 years.
Wood Usage and Fire Veneration in the Pamir, Xinjiang, 2500 yr BP.
Directory of Open Access Journals (Sweden)
Hui Shen
Full Text Available Located on the Pamir Plateau in Xinjiang Province, China, the Ji'erzankale Necropolis dates back to 2500 yr BP. Many materials that have been unearthed in this cemetery, including shoo konghou (musical instrument, bronze mirrors and glass beads, suggest cultural transference between East and West. Furthermore, small-sized and rounded fire altars made from sweet-scented Sabina were found for the first time and regarded as implements for fire veneration. We identified 70 wooden objects from 25 tombs within the Necropolis, and found that each object had been made from one of seven tree species. Analysis revealed that the inhabitants of the region mainly used the most widely available types of wood, namely Betula and Populus. People also specifically chose inflammable Populus wood to make hearth boards and hand drills (both are used for making fire by drilling, rigid Betula wood to craft wooden plates. Salix was used for fashioning wooden sticks, while sweet-scented Sabina was the preferred choice for making fire altars. Lonicera was selected for arrow shaft manufacture and Fraxinus syriaca, which has a beautiful grain, was chosen for making musical instruments. Conscious selection of different types of wood indicates that people of the Pamir Plateau were aware of the properties of various types of timbers, and were able to exploit these properties to the full. In turn, this demonstrates their wisdom and their ability to survive in, and adapt to, their local environment.
Directory of Open Access Journals (Sweden)
L. Amon
2016-12-01
Full Text Available In this study, the deglaciation chronology of the Pandivere Upland is defined, and the late-glacial vegetation trends of north-eastern Estonia are summarised. The multi-proxy study includes accelerated mass spectrometry 14 C dating, plant macrofossil, magnetic susceptibility, loss-on-ignition and grain-size distribution data of the lacustrine sediment record from one previously unpublished study site (Kursi, and the study discusses the results in combination with five previously published study locations from the area. The results indicate that the deglaciation of the Pandivere Upland started at approximately 14 200 cal. yr BP and was completed by 13 800 cal. yr BP. The ice recession rate was approximately 180 m yr -1 . Based on these new radiocarbon dates, the Baltic Ice Lake stage A 1 submerged the northern and western ice-free areas of Estonia by ca. 13 800 cal. yr BP. The prevalent vegetation type in north-eastern Estonia during the late-glacial period was tundra with local variations in the dominant shrub species. The region remained treeless until the Holocene.
An 8700 year paleoclimate reconstruction from the southern Maya lowlands
Wahl, David B.; Byrne, Roger; Anderson, Lysanna
2014-01-01
Analysis of a sediment core from Lago Puerto Arturo, a closed basin lake in northern Peten, Guatemala, has provided an ∼8700 cal year record of climate change and human activity in the southern Maya lowlands. Stable isotope, magnetic susceptibility, and pollen analyses were used to reconstruct environmental change in the region. Results indicate a relatively wet early to middle Holocene followed by a drier late Holocene, which we interpret as reflecting long-term changes in insolation (precession). Higher frequency variability is more likely attributable to changes in ocean/atmosphere circulation in both the North Atlantic and the Pacific Oceans. Pollen and isotope data show that most of the period of prehispanic agricultural settlement, i.e. ∼5000–1000 cal yr BP, was characterized by drier conditions than previous or subsequent periods. The presence ofZea (corn) pollen through peak aridity during the Terminal Classic period (∼1250–1130 cal yr BP) suggests that drought may not have had as negative an impact as previously proposed. A dramatic negative shift in isotope values indicates an increase in precipitation after ∼950 cal yr BP (hereafter BP).
Middle Holocene rapid environmental changes and human adaptation in Greece
Lespez, Laurent; Glais, Arthur; Lopez-Saez, José-Antonio; Le Drezen, Yann; Tsirtsoni, Zoï; Davidson, Robert; Biree, Laetitia; Malamidou, Dimitra
2016-03-01
Numerous researchers discuss of the collapse of civilizations in response to abrupt climate change in the Mediterranean region. The period between 6500 and 5000 cal yr BP is one of the least studied episodes of rapid climate change at the end of the Late Neolithic. This period is characterized by a dramatic decline in settlement and a cultural break in the Balkans. High-resolution paleoenvironmental proxy data obtained in the Lower Angitis Valley enables an examination of the societal responses to rapid climatic change in Greece. Development of a lasting fluvio-lacustrine environment followed by enhanced fluvial activity is evident from 6000 cal yr BP. Paleoecological data show a succession of dry events at 5800-5700, 5450 and 5000-4900 cal yr BP. These events correspond to incursion of cold air masses to the eastern Mediterranean, confirming the climatic instability of the middle Holocene climate transition. Two periods with farming and pastural activities (6300-5600 and 5100-4700 cal BP) are evident. The intervening period is marked by environmental changes, but the continuous occurrence of anthropogenic taxa suggests the persistence of human activities despite the absence of archaeological evidence. The environmental factors alone were not sufficient to trigger the observed societal changes.
Energy Technology Data Exchange (ETDEWEB)
Nakamura, Toshio, E-mail: nakamura@nendai.nagoya-u.ac.jp [Center for Chronological Research, Nagoya University, Chikusa, Nagoya 464-8602 (Japan); Matsui, Akira [National Research Institute for Cultural Properties, Nara, Nijyo-cho, Nara 630-8577 (Japan); Nishida, Iwao; Nakano, Mitsuru [Saga-City Board of Education, Sakae-machi, Saga 840-8501 (Japan); Omori, Takayuki [University Museum, University of Tokyo, Hongo 7-3-1, Bunkyo, Tokyo 113-0033 (Japan)
2013-01-15
Numerous large and small shell middens have been reported throughout the world. An interesting question is when the huge and thick shell middens were formed, and how many years were required to build up the whole midden. Shell middens contain not only shell fragments but also organic substances such as bones, nuts, acorn, and plant residues, which are suitable substances with which to establish {sup 14}C chronology of the middens. We have conducted {sup 14}C dating on terrestrial and marine materials collected from two lowland shell middens, the Higashimyo site in Japan (the Earliest Jomon period) and the Kimhae site in Korea (the Proto-Three Kingdom period), to establish high precision {sup 14}C chronologies and determine the time required for shell accumulation. According to Bayesian analysis of {sup 14}C ages from terrestrial samples, accumulation of Midden No. 1 at Higashimyo (altitude from -1.1 to -2.3 m a.s.l., {Delta}d = 1.2 m) started at around 8050-7950 cal BP and ended at 7950-7750 cal BP, lasting for ca. 100 cal yr, while accumulation of Midden No. 2 (altitude from -0.5 to -2.0 m a.s.l., {Delta}d = 1.5 m) started at around 8050-7800 cal BP and ended at 7800-7650 cal BP, lasting for ca. 200 cal yr. Thus the Midden No. 1 was abandoned a bit earlier than Midden No. 2, but the time range for sediment accumulation overlaps each other. Accumulation at the Kimhae shell midden (altitude from 5 to 14 m a.s.l., {Delta}d = 9 m) started at around the middle of the 1st C cal BC and ended at around the middle of the 3rd C cal AD, lasting for ca. 250 to 300 cal yr.
Relative Sea-Level Stability in Natuna Island, Indonesia, since 6400 yr BP
Wan, J. X. W.; Meltzner, A. J.; Switzer, A.; Horton, B.; Ke, L.; Wang, X.; Bradley, S.; Natawidjaja, D.; Suwargadi, B. W.
2017-12-01
In order to understand the regional variability of relative sea level (RSL) due to glacio-isostatic adjustment (GIA) and other natural influences, high-precision records of Holocene RSL on the Sunda Shelf are required. Accurate estimates of past RSL at a variety of locations allow us to validate geophysical and climate models, and provide context for understanding modern RSL change in the face of global climate change. For the aforementioned purposes, we surveyed and dated coral microatoll colonies, which are precise RSL proxy archives, from Natuna Island in Indonesia. Our analysis of 11 coral microatoll elevations from a total of four sites on Natuna Island is constrained in time by a minimum of one radiocarbon date and one U-Th age on each microatoll. The distribution of ages and elevations indicates that RSL was relatively stable from 6400 to 1400 yr BP at 0.3-0.6 m higher than present, before a more recent fall to current levels. The radiocarbon and U-Th ages are consistent with one another, with preliminary estimates of ΔR ≈ 0 for our entire data set. Our data are roughly compatible with predictions of a recently developed GIA model for the Southeast Asia region (Bradley et al., 2016, Quat. Sci. Rev.). This new dataset is part of larger project with more than 25 sites in Malaysia and Indonesia. Our new constraints on past RSL on the Sunda Shelf will allow for validation and calibration of GIA models in the tropics, where RSL data are presently insufficient.
Mid-late Holocene paleoseismicity of the eastern Clarence Fault, Marlborough, New Zealand
International Nuclear Information System (INIS)
Van Dissen, R.J.; Nicol, A.
2009-01-01
The middle Clarence valley, or eastern, section of the active Clarence Fault bounds the steep southeast flank of the Inland Kaikoura Range, Marlborough, New Zealand. This section of the fault extends c. 45 km northeastwards from its junction with the Elliott Fault to Mead Stream, where the active trace of the fault appears to abruptly end. Along the active trace, 41 separate right-lateral offsets of c. 3-40 m were recorded with uncertainties of 10-50% (mean 25%) using tape measurement of displaced topographic features (e.g., gully walls, landslide margins, and ridge crests). Single-event right-lateral displacements of 7 ± 2 m are inferred and indicate earthquake magnitudes of Mw 7.2-7.9. Probable rupture lengths have been in excess of 45 km, which suggests that rupture of the middle Clarence valley (eastern) section of the fault extended to the west onto the central Clarence and/or Elliott faults. Stream incision through the uphill-facing fault scarp at Ravine Stream and Dead Horse Gully has exposed progressively faulted peat and charcoal horizons. Elsewhere, there are several exposures of unfaulted sediments. Twelve radiocarbon samples dated from these horizons constrain the timing of the four most recent surface-rupture earthquakes on the Clarence Fault in the study area. The most recent surface rupture took place at c. 1700-1900 cal. yr BP (rounded to the nearest hundred years), with two surface ruptures since c. 3400 cal. yr BP, three since 6700 cal. yr BP, and most likely a fourth surface rupture at c. 6600-6900 cal. yr BP. These data suggest a recurrence interval for surface-rupture earthquakes of c. 1700 yr, and imply a lateral slip rate of c. 4 mm/yr (i.e., c. 7 m of slip every c. 1700 yr). (author). 45 refs., 9 figs., 3 tabs.
Li, Xiangzhong; Liu, Xiangjun; He, Yuxin; Liu, Weiguo; Zhou, Xin; Wang, Zheng
2018-02-01
Holocene climatic and environmental changes on the northeastern Tibetan Plateau (TP) have been widely discussed based on the climatic records from sedimentary cores. However, differences in the reconstructed climatic history from various studies in this region still exist, probably due to influence of climatic proxies from multiple factors and the chronological uncertainties in lacustrine sediments. Here we present records of terrestrial plant δ13C, soil color and total organic carbon content over the past 8400 years from a well-dated meadow section on the northeastern TP. The terrestrial plant δ13C value serves as a good summer precipitation/moisture indicator in the studied region. Soil color property and TOC content are also able to disentangle the moisture evolution history. All the data show much wet climates at 8400-7400 cal yr BP, dry climates at 7400-6000 cal yr BP and then wet conditions with fluctuation at 6000-3200 cal yr BP. Late Holocene moisture appears to be comparable with moist conditions from 6000 to 3200 cal yr BP. By further comparing the climatic variations in the Lake Qinghai area with records of the reconstructed summer temperature and the Asian Monsoon precipitation, we believe that the pattern of moisture/precipitation evolution in the Lake Qinghai area was not completely consistent with regions around Lake Qinghai, probably due to complicated interaction between the East Asian Summer Monsoon and the Indian Summer Monsoon.
The ecological implications of a Yakutian mammoth’s last meal
van Geel, B.; Aptroot, A.; Baittinger, C.; Birks, H.H.; Bull, I.D.; Cross, H.B.; Evershed, R.P.; Gravendeel, B.; Kompanje, E.J.O.; Kuperus, P.; Mol, D.; Nierop, K.G.J.; Pals, J.P.; Tikhonov, A.N.; van Reenen, G.; van Tienderen, P.
2008-01-01
Part of a large male woolly mammoth (Mammuthus primigenius) was preserved in permafrost in northern Yakutia. It was radiocarbon dated to ca. 18,500 14C yr BP (ca. 22,500 cal yr BP). Dung from the lower intestine was subjected to a multiproxy array of microscopic, chemical, and molecular techniques
Scheel-Ybert
2000-06-01
Charcoal analysis of six shell mounds showed that no major changes of the mainland vegetation ecosystem have taken place along the southeastern Brazilian coast (22 degrees 53'-22 degrees 57'S, 42 degrees 03'-42 degrees 33'W) from 5500 to 1400 14C yr BP. These shell mounds have been occupied by sedentary fisher-gatherer-hunters. Charcoal fragments retrieved from vertical profiles in the archaeological sites were examined; taxonomic determinations were based on a reference collection of charred woods and a program for computer-aided identification. Charcoal assemblages of all the studied sites present taxa from various restinga vegetation types, mangroves, xeromorphic coastal forest, and inland Atlantic Forest. The restinga ecosystem, characteristic of the Brazilian coast, is associated with sandy beach ridges; the restinga forest was much more abundant during the studied period than nowadays. The charcoal assemblages represent mainly the local vegetation; a regional reconstruction depends on the study of numerous sites. In the Cabo Frio region, open restinga taxa are more abundant in the Sambaqui do Forte, while forest elements are more important in the Sambaquis Salinas Peroano and Boca da Barra. The sites studied in the Arraial do Cabo (Sambaqui da Ponta da Cabeça) and in the Saquarema regions (Sambaquis da Pontinha and da Beirada) show that open restinga formations were locally predominant. A comparison of multivariate analysis applied to both charcoal assemblages and to phytosociological data of the extant vegetation showed a good correspondence between the charcoal spectra and the present vegetation. The high taxonomic diversity of archaeological charcoal samples and numerous fragments showing traces of decay before charring suggests that aleatory gathering of dead wood constituted the main source of firewood for fisher-gatherer-hunters populations. Condalia sp. was probably selected for cultural reasons.The only significant fluctuations on the charcoal
Panno, Samuel V.; Curry, B. Brandon; Wang, Hongfang; Hackley, Keith C.; Liu, Chao-Li; Lundstrom, Craig; Zhou, Juanzuo
2004-01-01
Matrix-supported diamicton and uniform to laminated, silty, fine-grained sediment deposited from about 42,500 to 27,600 cal yr B.P. under slackwater conditions nearly filled two caves in southwestern Illinois. At some point, most of the sediment was flushed from the caves and from about 22,700 to 4000 cal yr B.P., floods deposited a drape of sandy and silty sediment on remnant slackwater successions, cobbly alluvium, and bedrock (especially from 7700 to 4000 cal yr B.P.). Clay mineral analyses of the slackwater cave sediment reveal a provenance of chiefly Petersburg Silt, a smectite- and illite-rich proglacial lacustrine unit present in the overlying Illinois Episode glacial succession. Today, remnants of the ancient subterranean slackwater deposits nearly fill several secondary passages and, in at least two locations, cover a cobble-mantled strath terrace 1.3 to 1.5 m above active stream channels. Slumping and sinkhole formation appear to have been important mechanisms for deposition of the ancient subterranean deposits. Slumping of these surficial deposits and associated vegetation can occur along the flanks of sinkholes (in addition to sinkhole formation) and enter caves; however, the finer organics, some of them comminuted during transport into the caves, become part of the cave alluvium. This finer organic fraction is the modern analog of the humified organic matter disseminated in slackwater sediment dated in this investigation by radiocarbon methods. Twenty-four 14C ages on humified organic matter provide chronologic control. The ??13C values of the organic matter reflect the proportion of C4-type to C3-type vegetation growing in and around swallets and sinkholes at the time of redeposition. Drought-tolerant C4-type vegetation was more prevalent relative to C3-type vegetation from 42,500 to 31,200 cal yr B.P. compared to conditions from 28,800 cal yr B.P. to the present. The ??13C values are consistent with the results from other investigations of
Holocene vegetation and climatic variations in Central India: A study based on multiproxy evidences
Chauhan, M. S.; Sharma, Anupam; Phartiyal, Binita; Kumar, Kamlesh
2013-11-01
Palynology, texture, mineralogy, geochemistry, and magnetic susceptibility analysis of a 2 m deep sediment core from Padauna Swamp, southeastern Madhya Pradesh infers that between 8600 and 7500 cal yr BP a warm and relatively less-humid climate prevailed with open tree-savannahs dominated by grasses followed by sedges, Artemisia and members of Chenopodiaceae/Amaranthaceae with scanty trees viz., Schrebera, Aegle marmelos and Sterculia urens. This is well supported by lower organic to carbonate carbon ratio, coarser texture having relatively low CIA and magnetic susceptibility values and presence of some primary minerals. Between 7500 and 6250 cal yr BP the tree-savannahs were succeeded by open mixed deciduous forests with the invasion of a few more trees viz., Madhuca indica, Holoptelea, Emblica officinalis, Mitragyna parvifolia and members of Anacardiaceae in response to onset of a warm and humid climate. A considerable rise in organic carbon generated from the degradation of plentiful biomass along with increase in clay content with signs of kaolinite and increase in immobile over mobile elements with slightly higher CIA and magnetic susceptibility values also suggest climatic amelioration. The presence of ruderal plants such as Artemisia, Cannabis sativa and Cheno/Am further infers initiation of human activities in the region. Between 6250 and 2800 cal yr BP, the mixed deciduous forests became more diverse and dense, subduing grasses and other herbaceous elements. Sporadic incursion of Shorea robusta (Sal) in forest floristic was recorded around 5000 cal yr BP. The overall change in the vegetation mosaic reflects that a warm and more-humid climate prevailed in the region, probably on account of invigoration of southwest monsoon. This observation is further corroborated by other proxy data showing a spurt in organic/inorganic carbon ratio, increase in clay content with matured mineralogy, significantly higher CIA and magnetic susceptibility values. Since 2800 cal
Neoglacial fluctuations of Deming Glacier, Mt. Baker, Washington USA.
Osborn, G.; Menounos, B.; Scott, K.; Clague, J. J.; Tucker, D.; Riedel, J.; Davis, P.
2007-12-01
Deming Glacier flows from the upper west slopes of Mt. Baker, a stratovolcano in the Cascade Range of Washington, USA. The north and south lateral moraines of Deming Glacier are composed of at least four tills separated by layers of detrital wood and sheared stumps in growth position. The stratigraphy records fluctuations of the glacier during the Holocene. The outer ten rings of an in situ stump from the middle wood layer, which is about 40 m below the north lateral moraine crest and 1.2 km downvalley from the present glacier terminus, yielded an age of 1750 ± 50~~ 14C yr BP [1810-1550 cal yr BP]. The stump revealed at least 300 rings and thus records a period of landscape stability and relatively restricted glaciation for several hundred years prior to ca. 1750 14C yr BP . Samples from the lowest wood layer also have been submitted for radiocarbon dating. Outer rings of detrital wood samples collected from two wood mats exposed in the south lateral moraine, 2.3 km downvalley of the glacier terminus, returned radiocarbon ages of 1600 ± 30~~ 14C yr BP [1550- 1410 cal yr BP] and 430 ± 30~~ 14C yr BP [AD 1420-1620]. These data indicate that Deming Glacier advanced over a vegetated moraine sometime after 1810 cal yr BP to a position less extensive that it achieved at the peak of the Little Ice Age. The glacier then receded before it began its final and most extensive Holocene advance after AD 1420. The older advance is correlative with the 'First Millennium AD' advance, recently recognized throughout western North America. The younger advance coincides with an advance of Mt. Baker's Easton Glacier [AD 1430-1630], and advances of many alpine glaciers elsewhere in western North America. Our data suggest that glaciers on Mt. Baker fluctuated in a similar manner to alpine glaciers in the Coast Mountains of British Columbia and in other mountain ranges of northwest North America during Neoglaciation.
Late Neolithic vegetation history at the pile-dwelling site of Palù di Livenza (northeastern Italy
Pini, Roberta
2004-12-01
The Late Neolithic pile-dwelling of Palù di Livenza yielded archaeological remains typical of the Square Mouth Pottery and Lagozza Cultures. A palynological investigation reveals important changes in the vegetation due to anthropogenic pressure. Between ca. 6590 and 5960 cal. yr BP, dense oak wood forests with deciduous Quercus, Fagus and Corylus extended around the mire, with no signs of human impact. The establishment of the pile-dwelling, dated to ca. 5960 cal. yr BP, led to a strong reduction of forests, reclamation of wetlands, and expansion of herbaceous communities, with cultivated species, infestant weeds, nitrophilous and ruderal herbs, pastures and meadows. According to AMS dates and previous archaeological chronologies, the pile-dwelling persisted for about 700 years (from ca. 5960 to 5260 cal. yr BP). The history of the pile-dwelling after ca. 5260 cal. yr BP cannot be reconstructed because of recent contamination of the top part of the section. Rarefaction analysis was applied to estimate changes of palynological richness through time: the highest E(Tn) (between 56 and 69 taxa) are contemporaneous with the local development of the pile-dwelling. The comparison of pollen data with archaeobotanical evidence indicates that Fragaria vesca, Malus sylvestris, Papaver somniferum and Physalis alkekengi were gathered at some distance from the site and that Linum usitatissimum is strongly under-represented in pollen samples. Crop cultivation can be estimated for a radius of several hundred metres around the mire. Palù di Livenza is significant in the context of Neolithic archaeobotany of northern Italy and neighbouring countries. Copyright
Gao, Chuanyu; He, Jiabao; Zhang, Yan; Cong, Jinxin; Han, Dongxue; Wang, Guoping
2018-03-01
The northeastern region of China, at the limit of the summer monsoon, is characterized by the presence of mountains that influenced by the Asian summer monsoon on one side and the westerlies on the other; however, few studies have compared the environmental characteristics on the two sides of these mountains. In this study, two peatland cores from the western and eastern sides of the Great Hinggan Mountains were investigated to better understand the climatic and environmental conditions and the measurements of black carbon (BC) and δ13C-BC were used to reconstruct the fire history and environmental characteristics during the last millennium. Our results showed that the variations in the δ13C-BC values are more sensitive to climate changes than the BC fluxes, and the climate forcing mechanisms differed between the two sides of the mountains. Lower δ13C-BC values around 500 cal yr BP on the western side of the mountains indicated climate conditions were wetter than that on the eastern side, and were influenced by low sea surface temperatures in the North Atlantic Ocean. The region east of the mountains was mainly influenced by the strong Asian summer monsoon, and the decreasing of δ13C-BC values indicated climate conditions became wetter from 250 cal yr BP to the present and were wetter than that on the western side after 150 cal yr BP. Moreover, when one of these two forcing factors weakened and the other strengthened (e.g. from 400 to 150 cal yr BP), climate conditions in these two sides were similar.
Grigg, L.D.; Whitlock, C.; Dean, W.E.
2001-01-01
Pollen and geochemical data from Little Lake, western Oregon, suggest several patterns of millennial-scale environmental change during marine isotope stage (MIS) 2 (14,100-27,600 cal yr B.P.) and the latter part of MIS 3 (27,600-42,500 cal yr B.P.). During MIS 3, a series of transitions between warm- and cold-adapted taxa indicate that temperatures oscillated by ca. 2??-4??C every 1000-3000 yr. Highs and lows in summer insolation during MIS 3 are generally associated with the warmest and coldest intervals. Warm periods at Little Lake correlate with warm sea-surface temperatures in the Santa Barbara Basin. Changes in the strength of the subtropical high and the jet stream may account for synchronous changes at the two sites. During MIS 2, shifts between mesic and xeric subalpine forests suggest changes in precipitation every 1000-3000 yr. Increases in Tsuga heterophylla pollen at 25,000 and 22,000 cal yr B.P. imply brief warmings. Minimum summer insolation and maximum global ice-volumes during MIS 2 correspond to cold and dry conditions. Fluctuations in precipitation at Little Lake do not correlate with changes in the Santa Barbara Basin and may be explained by variations in the strength of the glacial anticyclone and the position of the jet stream. ?? 2001 University of Washington.
Atmospheric 14C variations derived from tree rings during the early Younger Dryas
Hua, Quan; Barbetti, Mike; Fink, David; Kaiser, Klaus Felix; Friedrich, Michael; Kromer, Bernd; Levchenko, Vladimir A.; Zoppi, Ugo; Smith, Andrew M.; Bertuch, Fiona
2009-12-01
Atmospheric radiocarbon variations over the Younger Dryas interval, from ˜13,000 to 11,600 cal yr BP, are of immense scientific interest because they reveal crucial information about the linkages between climate, ocean circulation and the carbon cycle. However, no direct and reliable atmospheric 14C records based on tree rings for the entire Younger Dryas have been available. In this paper, we present (1) high-precision 14C measurements on the extension of absolute tree-ring chronology from 12,400 to 12,560 cal yr BP and (2) high-precision, high-resolution atmospheric 14C record derived from a 617-yr-long tree-ring chronology of Huon pine from Tasmania, Australia, spanning the early Younger Dryas. The new tree-ring 14C records bridge the current gap in European tree-ring radiocarbon chronologies during the early Younger Dryas, linking the floating Lateglacial Pine record to the absolute tree-ring timescale. A continuous and reliable atmospheric 14C record for the past 14,000 cal yr BP including the Younger Dryas is now available. The new records indicate that the abrupt rise in atmospheric Δ 14C associated with the Younger Dryas onset occurs at ˜12,760 cal yr BP, ˜240 yrs later than that recorded in Cariaco varves, with a smaller magnitude of ˜40‰ followed by several centennial Δ 14C variations of 20-25‰. Comparing the tree-ring Δ 14C to marine-derived Δ 14C and modelled Δ 14C based on ice-core 10Be fluxes, we conclude that changes in ocean circulation were mainly responsible for the Younger Dryas onset, while a combination of changes in ocean circulation and 14C production rate were responsible for atmospheric Δ 14C variations for the remainder of the Younger Dryas.
Four thousand years of environmental change and human activity in the Cochabamba Basin, Bolivia
Williams, Joseph J.; Gosling, William D.; Coe, Angela L.; Brooks, Stephen J.; Gulliver, Pauline
The Cochabamba Basin (Bolivia) is on the ancient road network connecting Andean and lowland areas. Little is known about the longevity of this trade route or how people responded to past environmental changes. The eastern end of the Cochabamba valley system constricts at the Vacas Lake District, constraining the road network and providing an ideal location in which to examine past human-environmental interactions. Multi-proxy analysis of sediment from Lake Challacaba has allowed a c. 4000 year environmental history to be reconstructed. Fluctuations in drought tolerant pollen taxa and calcium carbonate indicate two periods of reduced moisture availability ( c. 4000-3370 and c. 2190-1020 cal yr BP) compared to adjacent wetter episodes ( c. 3370-2190 and c. 1020 cal yr BP-present). The moisture fluctuations broadly correlate to El Niño/Southern Oscillation variations reported elsewhere. High charcoal abundance from c. 4000 to 2000 yr ago indicates continuous use of the ancient road network. A decline in charcoal and an increase in dung fungus ( Sporormiella) c. 1340 -1210 cal yr BP, suggests that cultural changes were a major factor in shaping the modern landscape. Despite undisputable impacts of human populations on the Polylepis woodlands today, we see no evidence of woodland clearance in the Challacaba record.
The development and adaption of early agriculture in Huanghe River Valley, China
Li, X.
2017-12-01
The expanding and developing of agriculture are the basic of population growth, the expansions of material cultures and civilization. The Huanghe River valley, as the origin center of millet agriculture, lies between the heartlands of wheat and rice, which gestates the flourishing Neolithic culture based on agriculture. Recent work using botanical remains has greatly expanded the knowledge concerning early agriculture. Here, we report the new progress on the development and adaption of early agriculture in Huanghe River valley and the surrounding areas. Based on the analysis of phytolith from 13 sites in middle reaches of Huanghe River and the survey of crop seeds from 5 sites in Guanzhong Basin, the rice have been cultivated around 7600 cal BP in semi-humid regions dominated by rain-fed agriculture. The mixed agriculture of common millet, foxtail millet, and rice continued to exist between 7600-3500 BP. In semi-arid region of Huanghe River valley, the agriculture was dominated by the production of common and foxtail millet and 3 major changes have taken place around 6500 BP, 5500 BP, and 4000 BP during Neolithic. The cultivating ratio of common and foxtail millet was adjusted by farmer for adapting the climate changes during Holocene. Approximately 5000 yr BP, the rain-fed agriculture continues to break geographical boundaries to expand to west and southwest from Huanghe River valley. Millet agriculture appeared in southern Ganshu and north eastern Tibetan Plateau. The common and foxtail millet spread to the arid-area of Hexi corridor, a major crossroad of the famous Silk Road, around 4500 yr BP. Wheat was added as a new crop to the existing millet based agricultural systems around 4100-4000 cal yr BP in Hexi corridor. Between 3800 and 3400 cal yr BP, the proportion of wheat and barley in agriculture was up to 90%,which have replaced the local millet and become the main crops. And now, some new evidences of wheat agriculture from NW Xijiang have been obtained and
Nazarova, Larisa; Grebennikova, Tatiana A.; Razjigaeva, Nadezhda G.; Ganzey, Larisa A.; Belyanina, Nina I.; Arslanov, Khikmat A.; Kaistrenko, Victor M.; Gorbunov, Aleksey O.; Kharlamov, Andrey A.; Rudaya, Natalia; Palagushkina, Olga; Biskaborn, Boris K.; Diekmann, Bernhard
2017-12-01
We investigated a well-dated sediment section of a palaeolake situated in the coastal zone of Shikotan Island (Lesser Kurils) for organic sediment-geochemistry and biotic components (diatoms, chironomids, pollen) in order to provide a reconstruction of the palaeoenvironmental changes and palaeo-events (tsunamis, sea-level fluctuations and landslides) in Holocene. During the ca 8000 years of sedimentation the changes in organic sediment-geochemistry and in composition of the diatoms and chironomids as well as the shifts in composition of terrestrial vegetation suggest that the period until ca 5800 cal yr BP was characterized by a warm and humid climate (corresponds to middle Holocene optimum) with climate cooling thereafter. A warm period reconstructed from ca 900 to at least ca 580 cal yr BP corresponds to a transition to a Nara-Heian-Kamakura warm stage and can be correlated to a Medieval Warm Period. After 580 cal yr PB, the lake gradually dried out and climatic signals could not be obtained from the declining lacustrine biological communities, but the increasing role of spruce and disappearance of the oak from the vegetation give evidences of the climate cooling that can be correlated with the LIA. The marine regression stages at the investigated site are identified for ca 6200-5900 (at the end of the middle Holocene transgression), ca 5500-5100 (Middle Jomon regression or Kemigawa regression), and ca 1070-360 cal yr BP (at the end of Heian transgression). The lithological structure of sediments and the diatom compositions give evidences for the multiple tsunami events of different strengths in the Island. Most remarkable of them can be dated at around ca 7000, 6460, 5750, 4800, 950 cal yr BP. The new results help to understand the Holocene environmental history of the Southern Kurils as a part of the Kuril-Kamchatka and Aleutian Marginal Sea-Island Arc Systems in the North-Western Pacific region.
Anderson, L.; Wahl, D.; Estrada-Belli, F.
2015-12-01
Widespread demographic shifts in the southern Maya lowlands at the end of the Classic period have been attributed to environmental change caused by human activity and/or climate variability. Fire was essential to landscape modification and was a primary agent of environmental change associated with prehispanic land use. While several studies have provided insight into the dynamic relationship between natural and anthropogenic drivers of change, defining the specific interplay between natural environmental change, human modification of the environment, and cultural response to changes remains a persistent challenge. Here we present the results of a multi-proxy study that reconstructs fire history, agricultural land use, and environmental change during and after Pre-Columbian Maya settlement. Results are interpreted in the context of settlement history as inferred from archaeological mapping around the study site. Our findings suggest landscape disturbance, as indicated by erosion, local burning, and nearby maize agriculture, was at its peak during the Early Classic period. This disturbance was likely due to large-scale settlement at the nearby site of Witzna'. All proxies indicate a slow decline in disturbance into the Late Classic period, beginning around 1300 cal yr BP. Cival and Chanchich, two proximal site centers to the south of Laguna Ek'Naab, supported their largest populations during the Late Preclassic and Late Classic, with little or no settlement during the Early Classic. The data from Laguna Ek'Naab suggests that Witzna' may have been an important center during the Early Classic. Whether the decreasing environmental degradation after 1240 cal yr BP is do to a decline in local population or changing land use strategies is not discernable based on the data thus far. However, the near complete absence of burning and continued decrease in erosion from 1240-1090 cal yr BP suggests little anthropogenic activity in the area. Burning resumes in the watershed
Villota, Andrea; León-Yánez, Susana; Behling, Hermann
2012-12-01
The last 15,000 years of vegetation, fire and climate history were reconstructed from the Laguna Natosa Peat bog core (3600 m elevation) in the Páramo of Jimbura region in the Cordillera Real, close to the Peruvian border of southern Ecuador in the southernmost part of the Andean depression. The pollen record, dated by 5 radiocarbon dates, indicates that during the late Glacial (ca. 15,000-12,000 cal yr BP) a gradual expansion of mountain forest, restricting the páramo vegetation to small patches, and a shift of the forest line to higher elevation took place; reflecting an increase in temperature. However, a clear signal of the warmer Bølling/Allerød interstadial and the cooler Younger Dryas period, are not reflected in the record. During the transition from the late Glacial to the early/mid-Holocene (ca. 12,000-4800 cal yr BP), tree taxa such as Hedyosmum and Podocarpaceae are well represented, suggesting that the upper forest line, especially in the mid-Holocene, reached slightly higher elevations than at present. Hence, páramo vegetation was limited, indicating warmer climatic conditions for the early to mid-Holocene period than today. The late Holocene from 4800 cal yr BP until the present is characterized by higher occurrences of páramo taxa. During this period, the upper forest line shifted downwards giving room to the expansion of the páramo vegetation to its current size. Fire was rare during the late Glacial period but became more frequent after about 8000 cal yr BP, probably due to the dry event during the mid-Holocene and increased human activity.
The history of South American tropical precipitation for the past 25,000 years.
Baker, P A; Seltzer, G O; Fritz, S C; Dunbar, R B; Grove, M J; Tapia, P M; Cross, S L; Rowe, H D; Broda, J P
2001-01-26
Long sediment cores recovered from the deep portions of Lake Titicaca are used to reconstruct the precipitation history of tropical South America for the past 25,000 years. Lake Titicaca was a deep, fresh, and continuously overflowing lake during the last glacial stage, from before 25,000 to 15,000 calibrated years before the present (cal yr B.P.), signifying that during the last glacial maximum (LGM), the Altiplano of Bolivia and Peru and much of the Amazon basin were wetter than today. The LGM in this part of the Andes is dated at 21,000 cal yr B.P., approximately coincident with the global LGM. Maximum aridity and lowest lake level occurred in the early and middle Holocene (8000 to 5500 cal yr B.P.) during a time of low summer insolation. Today, rising levels of Lake Titicaca and wet conditions in Amazonia are correlated with anomalously cold sea-surface temperatures in the northern equatorial Atlantic. Likewise, during the deglacial and Holocene periods, there were several millennial-scale wet phases on the Altiplano and in Amazonia that coincided with anomalously cold periods in the equatorial and high-latitude North Atlantic, such as the Younger Dryas.
Hydroclimate variability in the low-elevation Atacama Desert over the last 2500 yr
Gayo, E. M.; Latorre, C.; Santoro, C. M.; Maldonado, A.; de Pol-Holz, R.
2012-02-01
Paleoclimate reconstructions reveal that Earth system has experienced sub-millennial scale climate changes over the past two millennia in response to internal/external forcing. Although sub-millennial hydroclimate fluctuations have been detected in the central Andes during this interval, the timing, magnitude, extent and direction of change of these events remain poorly defined. Here, we present a reconstruction of hydroclimate variations on the Pacific slope of the central Andes based on exceptionally well-preserved plant macrofossils and associated archaeological remains from a hyperarid drainage (Quebrada Maní, ∼21° S, 1000 m a.s.l.) in the Atacama Desert. During the late Holocene, riparian ecosystems and farming social groups flourished in the hyperarid Atacama core as surface water availability increased throughout this presently sterile landscape. Twenty-six radiocarbon dates indicate that these events occurred between 1050-680, 1615-1350 and 2500-2040 cal yr BP. Regional comparisons with rodent middens and other records suggest that these events were synchronous with pluvial stages detected at higher-elevations in the central Andes over the last 2500 yr. These hydroclimate changes also coincide with periods of pronounced SST gradients in the Tropical Pacific (La Niña-like mode), conditions that are conducive to significantly increased rainfall in the central Andean highlands and flood events in the low-elevation watersheds at inter-annual timescales. Our findings indicate that the positive anomalies in the hyperarid Atacama over the past 2500 yr represent a regional response of the central Andean climate system to changes in the global hydrological cycle at centennial timescales. Furthermore, our results provide support for the role of tropical Pacific sea surface temperature gradient changes as the primary mechanism responsible for climate fluctuations in the central Andes. Finally, our results constitute independent evidence for comprehending the
Lin, J.C.; Broecker, W.S.; Hemming, S.R.; Hajdas, I.; Anderson, Robert F.; Smith, G.I.; Kelley, M.; Bonani, G.
1998-01-01
U-Th isochron ages of tufas formed on shorelines suggest that the last pluvial event in Lake Lahontan and Searles Lake was synchronous at about 16,500 cal yr B.P. (equivalent to a radiocarbon age of between 14,000 and 13,500 yr B.P.), whereas the timing of this pluvial event determined by radiocarbon dating is on the order of 1000 yr younger. The timing of seven distinct periods of near desiccation in Searles Lake during late-glacial time has been reinvestigated for U-Th age determination by mass spectrometry. U-Th dating of evaporite layers in the interbedded mud and salt unit called the Lower Salt in Searles Lake was hampered by the uncertainty in assessing the initial 230Th/232Th of the samples. The resulting ages, corrected by a conservative range of initial 230Th/ 232Th ratios, suggest close correlation of the abrupt changes recorded in Greenland ice cores (Dansgaard-Oeschger events) and wet-dry conditions in Searles Lake between 35,000 and 24,000 Cal yr B.P. ?? 1998 University of Washington.
Directory of Open Access Journals (Sweden)
ANDREA VILLOTA
2014-12-01
Full Text Available To reconstruct the environmental history including vegetation, fire and climate dynamics, from the Cajanuma valley area ( 3285 m elevation in the Podocarpus National Park, southern Ecuador , we address the following major research question: (1 How did the mountain vegetation developed during the late Glacial and Holocene? (2 Did fire played an important control on the vegetation change and was it natural or of anthropogenic origin?. Palaeoenvironmental changes were investigated using multiple proxies such as pollen, spores, charcoal analyses and radiocarbon dating. Pollen data indicated that during the late Glacial and transition to the early Holocene (ca. 16 000-10 500 cal yr BP herb páramo was the main vegetation type around the study area, while subpáramo and mountain rainforest were scarcely represented. The early and mid-Holocene (ca. 10 500 to 5600 cal yr BP is marked by high abundance of páramo during the early Holocene followed by a slight expansion of mountain forest during the mid-Holocene. During the mid- to late Holocene (ca. 5600-1200 cal yr BP there is a significant presence of páramo and subpáramo while Lower Mountain Forest decreased substantially, although, Upper Mountain Forest remained relatively stable during this period. The late Holocene, from ca. 1200 cal yr BP to present, was characterized by páramo; however, mountain forest and subpáramo presented significantly abundance compared to the previous periods. Fires became frequent since the late Holocene. The marked increased local and regional fire intensity during the wetter late Holocene strongly suggests that were of anthropogenic origin. During the late Glacial and early Holocene, the upper forest line was located at low elevations; but shifted slightly upslope to higher elevations during the mid-Holocene.
3000 years of environmental change at Zaca Lake, California, USA
Directory of Open Access Journals (Sweden)
Theodore eDingemans
2014-07-01
Full Text Available Climatic variations of the last few millennia can reveal patterns of variability beyond that recorded by the instrumental record. In this study we use pollen and sediments to generate a high resolution 3000 year record of vegetation and climate along the southern California coast. An increase in Pinus and Quercus pollen found in the top 100 years of the record is a result of known planting and fire suppression by the forest service. In the pre-historic record, a period of high Salix percentages and high pollen concentration from 500-250 cal yr BP represents the wettest period of the record and coincides with the Little Ice Age. We also find evidence for 3 warm periods between 1350 and 650 cal yr BP which are identified in the record by the presence of Pediastrum boryanum var. boryanum. The latter two of these periods, dating from 1070-900 and 700–650 cal yr BP correspond to Medieval Climatic Anomaly droughts identified in other records. In addition to these events, we identify a multi-centennial scale drought between 2700 and 2000 cal yr BP in Zaca Lake, corroborating evidence from across the Great Basin and extending the regional spread of this multi-centennial drought to southern California. Corresponding wetter conditions in the northwest indicate that the modern ENSO precipitation dipole also occurred during this persistent drought. Today this dipole is associated with La Niña conditions and we note a coincidence with intriguing evidence for a change in ENSO dynamics from marine records in the tropical Pacific. This dry period is remarkably persistent and has important implications for understanding the possible durations of drought conditions in the past in California.
Last nine-thousand years of temperature variability in Northern Europe
Directory of Open Access Journals (Sweden)
H. Seppä
2009-09-01
Full Text Available The threat of future global warming has generated a major interest in quantifying past climate variability on centennial and millennial time-scales. However, palaeoclimatological records are often noisy and arguments about past variability are only possible if they are based on reproducible features in several reliably dated datasets. Here we focus on the last 9000 years, explore the results of 36 Holocene pollen-based July mean and annual mean temperature reconstructions from Northern Europe by stacking them to create summary curves, and compare them with a high-resolution, summary chironomid-based temperature record and other independent palaeoclimate records. The stacked records show that the "Holocene Thermal Maximum" in the region dates to 8000 to 4800 cal yr BP and that the "8.2 event" and the "Little Ice Age" at 500–100 cal yr BP are the clearest cold episodes during the Holocene. In addition, a more detailed analysis of the last 5000 years pinpoints centennial-scale climate variability with cold anomalies at 3800–3000 and 500–100 cal yr BP, a long, warmer period around 2000 cal yr BP, and a marked warming since the mid 19th century. The colder (warmer anomalies are associated with increased (decreased humidity over the northern European mainland, consistent with the modern high correlation between cold (warm and humid (dry modes of summer weather in the region. A comparison with the key proxy records reflecting the main forcing factors does not support the hypothesis that solar variability is the cause of the late-Holocene centennial-scale temperature changes. We suggest that the reconstructed anomalies are typical of Northern Europe and their occurrence may be related to the oceanic and atmospheric circulation variability in the North Atlantic – North-European region.
Kurina, Irina V.; Blyakharchuk, Tatiana A.
2018-03-01
Our research is devoted to paleohydrological reconstruction in the swamp located in the river valley on the piedmont of the Altai Mountains in the south of Western Siberia. The reconstruction was carried out based on rhizopod analysis for the last 3100 cal yr. A large amount of different testate amoebae was found in the peat. Total 64 testate amoebae taxa were recorded in the peat core with the most abundant being: Trinema lineare, Centropyxis aculeata, C. aerophila, Euglypha rotunda, Cryptodifflugia sp. Decrease of surface wetness in the swamp are observed 2280, 2140, 1900–600 cal yr BP and increase – in 2700, 2500–1900, 230–215 cal yr BP. The results of our reconstruction of the swamp paleohydrology agrees well with the paleoclimatic data obtained earlier for the central area of the south of Western Siberia Plain. It indicates a high sensitivity of the swamp to climatic changes in the Holocene. The rhizopod analysis proved to be very effective when used for paleohydrology reconstruction in minerotrophic peat.
Neugebauer, Ina; Wulf, Sabine; Schwab, Markus J.; Serb, Johanna; Plessen, Birgit; Appelt, Oona; Brauer, Achim
2017-08-01
Here we report on the first findings of a cryptotephra in the Holocene lacustrine sediment records of the Dead Sea and Tayma palaeolake (NW Arabian Peninsula). The major element glass composition of this rhyolitic tephra is identical to the distal 'S1' tephra layer identified in the Yammoûneh palaeolake (Lebanon), in a marine sediment record from the SE Levantine basin and in the Sodmein Cave archaeological site in Egypt. The S1 tephra corresponds to the early Holocene 'Dikkartın' dome eruption of the Erciyes Dağ volcano in central Anatolia (Turkey) and has been dated in the marine record at 8830 ± 140 cal yr BP. We present new age estimates of the S1 tephra based on radiocarbon dating of terrestrial plant remains and pollen concentrates revealing ages of 8939 ± 83 cal yr BP in the Dead Sea sediments and 9041 ± 254 cal yr BP in Tayma. The precise date from the Dead Sea allows refining the early Holocene marine reservoir age in the SE Levantine Sea to ca. 320 ± 50 years. Synchronisation of marine and terrestrial palaeoclimate records in the eastern Mediterranean region using the S1 tephra further suggests a time-transgressive expansion of the early Holocene humid period.
Directory of Open Access Journals (Sweden)
M.A. Burrows
2014-08-01
Full Text Available Peat humification analysis is presented as a robust palaeoclimatic proxy, suitable for use on mid–late Holocene peat sequences situated in the Southern Hemisphere. The proxy is shown to permit the identification of wet and dry shifts in a peat sequence from the humid tropics of north-eastern Australia. A significant correlation is found between the humification record and other proxies indicative of past climate conditions such as pollen, δ13C, C/N and macrocharcoal. Sixteen wet shifts detected in the humification record for Bromfield Swamp occur at the following dates (with 2σ range: 3830 (3920–3740, 3560 (3640–3480, 3490 (3560–3420, 3380 (3450–3300, 3120 (3250–2970, 2950 (3100–2790, 2560 (2710–2450, 2430 (2600–2260, 2120 (2330–1910, 1750 (1980–1520, 1430 (1660–1200, 1170 (1390–960, 1010 (1220–820, 620 (770–500, 300 (400–200 and 100 (200–10 cal. yr BP. Eleven dry shifts are also identified in the record at 4220 (4330–4110, 3670 (3750–3590, 3330 (3420–3220, 3020 (3170–2870, 2350 (2530–2160, 2020 (2230–1800, 1730 (1980–1510, 1290 (1510–1070, 700 (870–560, 400 (470–300 and 260 (360–150 cal yr BP. Blechnum and Poaceae are identified by pollen analysis to be the dominant plants of the swamp surface over the past 4000 years. The ratio of these two plant taxa in the pollen record correlates well with identified wet and dry shifts. It is suggested that a ratio ≤1 possibly indicates dry conditions, a ratio of >1–3 indicates wet or dry conditions, and a ratio >3 implies wet conditions. Large macrocharcoal peaks are recorded during the initiation phase of the peat sequence at approximately 4090 cal. yr BP, and at 3700–3620 cal. yr BP, both of these time periods being coincident with dry phases. Isolated minor macrocharcoal peaks at ca. 2860, 2820, 2620, 2560, 2130, 1930, 1740 and 200 cal. yr BP are found to coincide with periods of average effective precipitation (based on the humification
Menking, Kirsten M.; Peteet, Dorothy M.; Anderson, Roger Y.
2012-01-01
Sediment cores from Lakes Minnewaska and Mohonk in the Shawangunk Mountains of southeastern New York were analyzed for pollen, plantmacrofossils, macroscopic charcoal, organic carbon content, carbon isotopic composition, carbon/nitrogen ratio, and lithologic changes to determine the vegetation and landscape history of the greater Catskill Mountain region since deglaciation. Pollen stratigraphy generally matches the New England pollen zones identified by Deevey (1939) and Davis (1969), with boreal genera (Picea, Abies) present during the late Pleistocene yielding to a mixed Pinus, Quercus and Tsuga forest in the early Holocene. Lake Minnewaska sediments record the Younger Dryas and possibly the 8.2 cal kyr BP climatic events in pollen and sediment chemistry along with an 1400 cal yr interval of wet conditions (increasing Tsuga and declining Quercus) centered about 6400 cal yr BP. BothMinnewaska andMohonk reveal a protracted drought interval in themiddle Holocene, 5700-4100 cal yr BP, during which Pinus rigida colonized the watershed, lake levels fell, and frequent fires led to enhanced hillslope erosion. Together, the records show at least three wet-dry cycles throughout the Holocene and both similarities and differences to climate records in New England and central New York. Drought intervals raise concerns for water resources in the New York City metropolitan area and may reflect a combination of enhanced La Niña, negative phase NAO, and positive phase PNA climatic patterns and/or northward shifts of storm tracks.
Malounguila-Nganga, Dieudonné; Giresse, Pierre; Boussafir, Mohammed; Miyouna, Timothée
2017-10-01
This region, comprised between the Kouilou estuary and Pointe-Noire, is characterised by a very specific morphological setting. On the continental side, the coastal sector is dominated by cliffs of sand over 100 m high, referred to as the Série des Cirques, whereas, on the ocean side, very active erosion is presently taking place which has resulted in a retreat of the shoreline of more than 100 m over the last hundred years. New 14C datings and different analyses of organic matter and clay minerals (X-Ray data) were performed in order to reconstruct the geological and ecological evolution of the area during the Late Holocene and replace it in the palaeoclimatic scheme deduced from previous regional studies. From 7 to 6000 yr cal BP, the accumulation of important beach barriers by the oceanic drift allowed the definition of a narrow swamp depression several tens of kilometres long. A dense ombrophile and hydromorphic forest, in spite of being very close to the oceanic coast, remained sheltered from any brackish influence and fed accumulations of peat and organic muds. The emersive trend of 3000-2000 yr BP, i.e. the passage from a vast forest swamp with a water body several metres deep to a wet zone with some emersions, is expressed by a large colluvial accumulation. High primary production is not clearly attested in this wet area. High HI values would indicate rather long-lasting conservation in a swampy environment, the lowest values indicating alternating episodes of emersion and immersion. In such peatlands, OM preservation is favoured by an anoxic environment and rapid burial. The δ 13C values of older peats dated ca. 7000 yr cal BP are -28 to -26‰, typical of a C3 origin. Thus, the ca. -16‰ value indicates the greatest opening of the cover, suggesting a forest-savanna mosaic ca. 2500 yr cal BP. At Kivesso, several proxies suggest a wetter trend towards 500 yr cal BP. An ultimate drier trend is observed during the last two centuries, which has been
Holocene Millennial Time Scale Hydrological Changes In Central-east Africa
Jolly, D.; Bonnefille, R.; Beaufort, L.
The Holocene hydrological changes of a tropical swamp is reconstructed using a high resolution pollen record (ca 50 yrs) from the Kuruyange valley (Burundi, Africa, 3°35'S, 29°41'E), at 2000 m elevation. The sequence was dated by 10 radiocarbon dates, allowing reconstruction between ca 12 500 and 1000 cal yr B.P. In the Kuruyange swamp, peat accumulated rapidly at a sedimentation rate varying from 0.73 (prior to 6200 cal yr B.P.) to 1.51 mm/yr (during the late Holocene). A pollen index of water table, based on a ratio of aquatic versus non-aquatic plants has been used in order to test the hypothesis of hydrological constraints on the swampy ecosystem. Eight arid phases are evidenced by the index minima at 12 200, 11 200, 9900, 8600, 6500, 5000, 3400, 1600 cal yr B.P. The good agreement existing between this index and independent data such as (i) low-resolution East-African lake level reconstruct ions (Gillespie et al., 1983) and (ii) ?18O analyses from Arabian Sea (Sirocko et al., 1993) suggests the water table level responds to the monsoon dynamic. The Index varies periodically with a combination of 1/1515, 1/880 and 1/431 years-1 frequencies, revealed by time series analyses (Blackman-Tukey and Maximum Entropy). The extrapolation of the composite curve based on these 3 periodicities show that two major climatic events defined in the high latitudes between 1000 and 660 cal yr B.P. (Medieval Warm Period) and between 500 and 100 cal yr B.P. (Little Ice Age) are recorded in our data and show respectively high and low stands of the water table. Our results support some previous pollen-derived climate estimates in Ethiopia done by Bonnefille and Umer (1994). Moreover, the "1500 year" cycle registered in our data from the tropics, already evidenced in higher latitudes (Wijmstra et al., 1984; Bondet al., 1997; Schulz et al., 1999; Bond et al., 2001) support the hypothesis of strong teleconnections between tropical/subtropical and polar climates during the deglaciation
Clement, Alastair J. H.; Fuller, Ian C.
2018-02-01
The Manawatu incised-valley estuary was rapidly infilled between 12,000-4700 cal. yr BP. A combination of empirical measurements of sedimentation rates, a reconstruction of relative sea-level (RSL) change, and digital elevation models of key surfaces within the Holocene sedimentary fill of the valley were integrated to produce a numerical model to investigate the influence of the system controls of sea-level change, sediment flux, and accommodation space on the rapid infilling history of the palaeo-estuary. The numerical model indicates that sediment flux into the palaeo-estuary was greatest during the Holocene marine transgression between 12,000-8000 years BP. The average rate of sediment deposition in the estuary during this period was 1.0 M m3 yr- 1. This rapid rate of sedimentation was controlled by the rate of accommodation space creation, as regulated by the rate of sea-level rise and the antecedent configuration of the valley. By the time sea levels stabilised c. 7500 cal. yr BP, the palaeo-estuary had been substantively infilled. Limited accommodation space resulted in rapid infilling of the central basin, though sediment flux into the estuary between 7100 and 4500 cal. yr BP was at a lower rate of 234,000 m3 yr- 1. The limited accommodation space also influenced hydrodynamic conditions in the estuarine central basin, driving export of fine-grained sediment from the estuary. Once the accommodation space of the estuarine basin was infilled sediment bypassed the system, with a consequent reduction in the sedimentation rate in the valley. More accurate partitioning of the sources of sediment driving the infilling is necessary to quantify sediment bypassing. Post-depositional lowering of RSL index points from the valley is driven by neotectonics and sediment compaction.
Halligan, Jessi J; Waters, Michael R; Perrotti, Angelina; Owens, Ivy J; Feinberg, Joshua M; Bourne, Mark D; Fenerty, Brendan; Winsborough, Barbara; Carlson, David; Fisher, Daniel C; Stafford, Thomas W; Dunbar, James S
2016-05-01
Stone tools and mastodon bones occur in an undisturbed geological context at the Page-Ladson site, Florida. Seventy-one radiocarbon ages show that ~14,550 calendar years ago (cal yr B.P.), people butchered or scavenged a mastodon next to a pond in a bedrock sinkhole within the Aucilla River. This occupation surface was buried by ~4 m of sediment during the late Pleistocene marine transgression, which also left the site submerged. Sporormiella and other proxy evidence from the sediments indicate that hunter-gatherers along the Gulf Coastal Plain coexisted with and utilized megafauna for ~2000 years before these animals became extinct at ~12,600 cal yr B.P. Page-Ladson expands our understanding of the earliest colonizers of the Americas and human-megafauna interaction before extinction.
Yansa, Catherine H.
2006-02-01
This paper revises the chronology for the northward migration of Picea glauca (white spruce) across the northern Great Plains, following the recession of the Laurentide Ice Sheet, and reinterprets the species composition and structure of the late-glacial vegetation on the basis of pollen and plant-macrofossil analysis. The timing of spruce migration is based on 26 14C ages obtained from Picea macrofossils. The date for the appearance of white spruce in southern South Dakota, USA, remains unchanged, 12,600 14C yr BP (ca 15,000 cal yr BP), but its arrival in southern Saskatchewan, Canada, by 10,300 14C yr BP (ca 12,100 cal yr BP) is about 1500 years later than previously estimated based on an organic sediment date. Picea glauca thus migrated northwards at an average rate of 0.38 km/ 14C year (0.30 km/calendar year), significantly slower than the previously published rate of 2 km/ 14C year. White spruce trees probably inhabited lake shorelines, whereas prairie, parkland, and boreal plants occupied both lowlands and uplands, forming an open white spruce parkland. This interpretation differs from a previous reconstruction of a boreal-type spruce forest and thus offers another paleoclimatic interpretation. Precipitation was probably low and summer temperatures relatively mild, averaging about 19 °C.
Kennett, James P; Kennett, Douglas J; Culleton, Brendan J; Aura Tortosa, J Emili; Bischoff, James L; Bunch, Ted E; Daniel, I Randolph; Erlandson, Jon M; Ferraro, David; Firestone, Richard B; Goodyear, Albert C; Israde-Alcántara, Isabel; Johnson, John R; Jordá Pardo, Jesús F; Kimbel, David R; LeCompte, Malcolm A; Lopinot, Neal H; Mahaney, William C; Moore, Andrew M T; Moore, Christopher R; Ray, Jack H; Stafford, Thomas W; Tankersley, Kenneth Barnett; Wittke, James H; Wolbach, Wendy S; West, Allen
2015-08-11
The Younger Dryas impact hypothesis posits that a cosmic impact across much of the Northern Hemisphere deposited the Younger Dryas boundary (YDB) layer, containing peak abundances in a variable assemblage of proxies, including magnetic and glassy impact-related spherules, high-temperature minerals and melt glass, nanodiamonds, carbon spherules, aciniform carbon, platinum, and osmium. Bayesian chronological modeling was applied to 354 dates from 23 stratigraphic sections in 12 countries on four continents to establish a modeled YDB age range for this event of 12,835-12,735 Cal B.P. at 95% probability. This range overlaps that of a peak in extraterrestrial platinum in the Greenland Ice Sheet and of the earliest age of the Younger Dryas climate episode in six proxy records, suggesting a causal connection between the YDB impact event and the Younger Dryas. Two statistical tests indicate that both modeled and unmodeled ages in the 30 records are consistent with synchronous deposition of the YDB layer within the limits of dating uncertainty (∼ 100 y). The widespread distribution of the YDB layer suggests that it may serve as a datum layer.
Núñez, Lautaro; Loyola, Rodrigo; Cartajena, Isabel; López, Patricio; Santander, Boris; Maldonado, Antonio; de Souza, Patricio; Carrasco, Carlos
2018-02-01
This paper presents an interdisciplinary study of the Miscanti-1 archaeological site, located in the Holocene terrace deposits accumulated on the eastern margin of Miscanti Lake (4120 m.a.s.l.), northern Chile (23.7° S, 67.7° W). The human response to environmental and climatic variability in the Mid-Holocene (9500-4500 cal yr BP) is discussed through the zooarchaeological, lithic and paleoenvironmental records. We propose that, due to the increased aridity of the period, Miscanti Lake became a brackish paleowetland that attracted discrete groups of hunter-gatherers from lower elevation Andean areas. In contrast with the high frequency of human occupations known for the humid Late Pleistocene and Early Holocene (12600-9500 yr cal BP), the Miscanti-1 site is one of the few occupations recorded in the Atacama Highlands during the Mid-Holocene period. Data analysis suggests logistic and short-term campsite use for hunting the wild camelids that were attracted by the wetlands and fresh water (8100-8300 yr cal BP). In contrast to previous proposals for this period, we propose that access to high altitude environments did not cease, but was made possible by a shift to highly scheduled mobility and a specialized bifacial technology. Finally, the temporal and spatial links of Miscanti-1 are discussed in a regional context.
Mid-late Holocene environments of Agua Buena locality (34050'S; 69056'W), Mendoza, Argentina
International Nuclear Information System (INIS)
Navarro, Diego; Paez, M M; Mehl, A; Zarate, M A
2010-01-01
In southern South America the acquisition of high-quality Holocene paleoclimate data is a priority due to the paucity of complete, continuous and well dated records. Here we report preliminary results from a combined sedimentological and palynological study of an alluvial fan sequence and the laterally connected sedimentary deposits of the Vega de la Cueva profile at Agua Buena east of the Andes in central Argentina. The main geomorphological units of the area were identified and mapped based on satellite image analysis and multiple field surveys. The sedimentological and pollen results allowed us to reconstruct the development of some environments. The Agua Buena record corresponds to the distal facies of the Arroyo Bayo alluvial fan starting the aggradation process prior to ca. 4100 cal yr BP. The organic-rich levels found were formed during the development of wetlands (vegas) dominated by Cyperaceae, Juncaceae and Poaceae. These highly productive environments with almost permanent water saturation were important between 4100 and 2800 cal yr BP, indicating more stable conditions. After 2800 cal yr BP, the organic content was comparatively lower with increasing sedimentation rates that are indicative of higher fluvial discharges. This information is fundamental to interpret both the pollen and charcoal records of the area and to evaluate their representativeness and potential to reconstruct past local and/or regional vegetation.
Four millennia of woodland structure and dynamics at the Arctic treeline of eastern Canada.
Auger, Sarah; Payette, Serge
2010-05-01
Paleoecological analysis using complementary indicators of vegetation and soil can provide spatially explicit information on ecological processes influencing trajectories of long-term ecosystem change. Here we document the structure and dynamics of an old-growth woodland before and after its inception 1000 years ago. We infer vegetation and soil characteristics from size and age distributions of black spruce (Picea mariana (Mill.) B.S.P.), soil properties, plant fossils, and paleosols. Radiocarbon ages of charcoal on the ground and in the soil indicate that the fire return interval was approximately 300 years between 2750 and 1000 cal. yr BP. No fire evidence was found before and after this period despite the presence of spruce since 4200 cal. yr BP. The size structures of living and dead spruce suggest that the woodland is in equilibrium with present climate in absence of fire. Tree establishment and mortality occurred regularly since the last fire event around 950 cal. yr BP. Both layering and occasional seeding have contributed to stabilize the spatial distribution of spruce over the past 1000 years. Since initial afforestation, soil development has been homogenized by the changing spatial distribution of spruce following each fire. We conclude that the history of the woodland is characterized by vegetation shifts associated with fire and soil disturbances and by millennial-scale maintenance of the woodland's structure despite changing climatic conditions.
Energy Technology Data Exchange (ETDEWEB)
Navarro, Diego; Paez, M M [Laboratorio de Paleoecologia y Palinologia, Departamento de Biologia, Universidad Nacional de Mar del Plata, Funes 3350, (B7602AYL) Mar del Plata, Buenos Aires (Argentina); Mehl, A; Zarate, M A, E-mail: dnavarro@mdp.edu.a, E-mail: navarro.dd@gmail.co [INCITAP - Instituto de Ciencias de la Tierra y Ambientales de La Pampa. CONICET- Universidad Nacional de La Pampa, Uruguay 151, (L6300CLB) Santa Rosa, La Pampa (Argentina)
2010-03-15
In southern South America the acquisition of high-quality Holocene paleoclimate data is a priority due to the paucity of complete, continuous and well dated records. Here we report preliminary results from a combined sedimentological and palynological study of an alluvial fan sequence and the laterally connected sedimentary deposits of the Vega de la Cueva profile at Agua Buena east of the Andes in central Argentina. The main geomorphological units of the area were identified and mapped based on satellite image analysis and multiple field surveys. The sedimentological and pollen results allowed us to reconstruct the development of some environments. The Agua Buena record corresponds to the distal facies of the Arroyo Bayo alluvial fan starting the aggradation process prior to ca. 4100 cal yr BP. The organic-rich levels found were formed during the development of wetlands (vegas) dominated by Cyperaceae, Juncaceae and Poaceae. These highly productive environments with almost permanent water saturation were important between 4100 and 2800 cal yr BP, indicating more stable conditions. After 2800 cal yr BP, the organic content was comparatively lower with increasing sedimentation rates that are indicative of higher fluvial discharges. This information is fundamental to interpret both the pollen and charcoal records of the area and to evaluate their representativeness and potential to reconstruct past local and/or regional vegetation.
A Holocene pollen and sediment record of Whangape Harbour, far northern New Zealand
International Nuclear Information System (INIS)
Horrocks, M.; Nichol, S.L.; Gregory, M.R.; Creese, R.; Augustinus, P.C.
2001-01-01
The sediment record of Whangape Harbour shows that there were significant fluctuations in depositional energy in the harbour during the period from c. >8000 cal. yr BP to some time within the last millenium, and that fluvial influences increased as the harbour infilled. The pollen record (highly discontinuous) from Whangape Harbour indicates that conifer-hardwood forest covered the hills surrounding the harbour during this period. The main canopy conifers were Dacrydium and Prumnopitys taxifolia, with some Libocedrus, Dacrycarpus, and Phyllocladus. Agathis was also present. Common canopy hardwoods were Metrosideros and, in the latter part of the period, Elaeocarpus. Ascarina and Cyathea were abundant in the sub-canopy. Leptospermum grew on disturbed areas fringing the estuary. Marsh or swamp environments probably never developed on a large scale in the harbour. Avicennia, extremely under-represented in the pollen flora, has been present on tidal flats in the harbour since at least c. 2500 cal. yr BP. Large-scale anthropogenic deforestation by burning commenced in the Whangape catchment some time during or since 700-430 cal. yr BP. The associated increase in erosion rates in the catchment resulted in a change towards a sandier sediment regime in the harbour which has continued to the present day. Weinmannia and Ackama, previously rare in the catchment, expanded in remaining forest. (author). 39 refs., 3 figs., 1 tab
Mora, Juan Carlos; Gardner, James Edward; Macías, José Luis; Meriggi, Lorenzo; Santo, Alba Patrizia
2013-07-01
San Antonio Volcano, in the Tacaná Volcanic Complex, erupted ~ 1950 yr. B.P., with a Pelean type eruption that produced andesitic pyroclastic surges and block-and-ash flows destroying part of the volcano summit and producing a horse-shoe shaped crater open to the SW. Between 1950 and 800 yr B.P. the eruption continued with effusive andesites followed by a dacite lava flow and a summit dome, all from a single magma batch. All products consist of phenocrysts and microphenocrysts of zoned plagioclase, amphibole, pyroxene, magnetite ± ilmenite, set in partially crystallized groundmass of glass and microlites of the same mineral phases, except for the lack of amphibole. Included in the andesitic blocks of the block-and-ash flow deposit are basaltic andesite enclaves with elongated and ellipsoidal forms and chilled margins. The enclaves have intersertal textures with brown glass between microphenocrysts of plagioclase, hornblende, pyroxene, and olivine, and minor proportions of phenocrysts of plagioclase, hornblende, and pyroxene. A compositional range obtained of blocks and enclaves resulted from mixing between andesite (866 °C ± 22) and basaltic andesite (enclaves, 932 °C ± 22), which may have triggered the explosive Pelean eruption. Vestiges of that mixing are preserved as complex compositional zones in plagioclase and clinopyroxene-rich reaction rims in amphibole in the andesite. Whole-rock chemistry, geothermometry, experimental petrology and modeling results suggest that after the mixing event the eruption tapped hybrid andesitic magma (≤ 900 °C) and ended with effusive dacitic magma (~ 825 °C), all of which were stored at ~ 200 MPa water pressure. A complex open-system evolution that involved crustal end-members best explains the generation of effusive dacite from the hybrid andesite. Amphibole in the dacite is rimmed by reaction products of plagioclase, orthopyroxene, and Fe-Ti oxides produced by decompression during ascent. Amphibole in the andesite
Pollen-based biome reconstruction for southern Europe and Africa 18,000 yr BP
Elenga, H; Peyron, O; Bonnefille, R; Jolly, D; Cheddadi, R; Guiot, J; Andrieu, [No Value; Bottema, S; Buchet, G; de Beaulieu, JL; Hamilton, AC; Maley, J; Marchant, R; Perez-Obiol, R; Reille, M; Riollet, G; Scott, L; Straka, H; Taylor, D; Van Campo, E; Vincens, A; Laarif, F; Jonson, H
Pollen data from 18,000 C-14 yr sp were compiled in order to reconstruct biome distributions at the last glacial maximum in southern Europe and Africa. Biome reconstructions were made using the objective biomization method applied to pollen counts using a complete list of dryland taxa wherever
Climatic and lacustrine morphometric controls of diatom paleoproductivity in a tropical Andean lake
Bao, R.; Hernández, A.; Sáez, A.; Giralt, S.; Prego, R.; Pueyo, J. J.; Moreno, A.; Valero-Garcés, B. L.
2015-12-01
The coupling of lake dynamics with catchment biogeochemistry is considered the key element controlling primary production in mountain lakes at time scales of a few decades to millennia, yet little is known on the impacts of the morphometry of lakes throughout their ontogeny. As Lake Chungará (Central Andean Altiplano, northern Chile) experienced long-term lake-level fluctuations that strongly modified its area:volume ratio, it is an ideal system for exploring the relative roles that long-term climatic shifts and lake morphometry play on biosiliceous lacustrine productivity. In this paper, we review previous data on the percent contents of total organic carbon, total inorganic carbon, total nitrogen, total biogenic silica, isotopic composition of organic matter, carbonates, and diatom frustules, as well as data on the abundance of the chlorophycean Botryococcus braunii in this lake for the period 12,400-1300 cal yr BP. We also include new data on organic carbon and biogenic silica mass accumulation rates and the diatom assemblage composition of an offshore core dated using 14C and U/Th. Biosiliceous productivity in Lake Chungará was influenced by shifts in allochthonous nutrient inputs related to variability in precipitation. Humid phases dated at approx. 12,400 to 10,000 and 9600 to 7400 cal yr BP coincide with periods of elevated productivity, whereas decreases in productivity were recorded during arid phases dated at approx. 10,000 to 9600 and 7400 to 3550 cal yr BP (Andean mid-Holocene Aridity Period). However, morphometry-related in-lake controls led to a lack of a linear response of productivity to precipitation variability. During the late Glacial to early Holocene, lowstands facilitated complete water column mixing, prompting episodic massive blooms of a large centric diatom, Cyclostephanos cf. andinus. Thus, moderate productivity could be maintained, regardless of aridity, by this phenomenon of morphometric eutrophy during the early history of the lake
Metcalfe, Sarah E.; Barron, John A.; Davies, Sarah J.
2015-01-01
Evidence for climatic change across the North American Monsoon (NAM) and adjacent areas is reviewed, drawing on continental and marine records and the application of climate models. Patterns of change at 12,000, 9000, 6000 and 4000 cal yr BP are presented to capture the nature of change from the Younger Dryas (YD) and through the mid-Holocene. At the YD, conditions were cooler overall, wetter in the north and drier in the south, while moving into the Holocene wetter conditions became established in the south and then spread north as the NAM strengthened. Until c. 8000 cal yr BP, the Laurentide Ice Sheet influenced precipitation in the north by pushing the Bermuda High further south. The peak extent of the NAM seems to have occurred around 6000 cal yr BP. 4000 cal yr BP marks the start of important changes across the NAM region, with drying in the north and the establishment of the clear differences between the summer-rain dominated south and central areas and the north, where winter rain is more important. This differentiation between south and north is crucial to understanding many climate responses across the NAM. This increasing variability is coincident with the declining influence of orbital forcing. 4000 cal yr BP also marks the onset of significant anthropogenic activity in many areas. For the last 2000 years, the focus is on higher temporal resolution change, with strong variations across the region. The Medieval Climate Anomaly (MCA) is characterised by centennial scale ‘megadrought’ across the southwest USA, associated with cooler tropical Pacific SSTs and persistent La Niña type conditions. Proxy data from southern Mexico, Central America and the Caribbean reveal generally wetter conditions, whereas records from the highlands of central Mexico and much of the Yucatan are typified by long -term drought. The Little Ice Age (LIA), in the north, was characterised by cooler, wetter winter conditions that have been linked with increased
Ruan, Jiaoyang; Kherbouche, Farid; Genty, Dominique; Cheng, Hai; Dewilde, Fabien; Blamart, Dominique
2015-04-01
Over the last decades, ancient civilizations during the Holocene were heavily studied at many places around the Mediterranean region such as Libya and Italy, and changes in the past social activities were widely assumed to be linked to regional climate variability. However, in many cases the climatic records were apart from the archaeological sites and the archaeological chronologies were not well constrained, which makes these links uncertain. Here we present a 230Th-dated decadal resolution climate record for 6034-3185yr BP based on the δ18O and δ13C analyses of two overlapping stalagmites from Gueldaman GLD1 Cave (36°26'N, 4°34'E, 507 m asl), N-Algeria. Recent archaeological work in this cave brought first information about the Neolithisation process since ca 7000yr cal BP in the region where little was known before. Together with new charcoal 14C dates from the digging sections we test the link between past climate change and human activities in the cave. GLD1 stalagmite records reveal a dry event at ca 5700-5500yr BP and a drying trend toward extreme aridity, since ca 4700yr BP, peaking at ca 4200yr BP. These climatic deteriorations in N-Algeria, within dating errors, are synchronous with dry phases observed on speleothem records from central (Corchia Cave and Renella Cave, Italy) and eastern (Soreq Cave, Israel) Mediterranean. Specifically, climatic condition was harsher at ca 4200yr BP than at ca 5700-5500yr BP in central and W-Mediterranean; while it was harsher at ca 5700-5500yr BP in E-Mediterranean. The new 14C dates relatively well anchor the age of sediment layers with the richest anthropogenic deposits (i.e. charcoal, bone and Neolithic pottery) to ca 4900-4400yr cal BP, coinciding with the wettest period inferred from the stalagmite records. Shortly following this period, archaeological remains were becoming very rare in the sediments, which might be the consequence of establishing extremely arid phase at ca 4200yr BP. This suggests a possible
Curry, B. Brandon; Filippelli, G.M.
2010-01-01
Low dissolved oxygen during the summer and early fall controls profundal continental ostracode distribution in Crystal Lake (McHenry County), Illinois, favoring Cypria ophthalmica and Physocypria globula at water depths from 6 to 13 m. These species also thrived in the lake's profundal zone from 14,165 to 9600 calendar year before present (cal yr b.p.) during the late Boiling, Allerod, and Younger Dryas chronozones, and early Holocene. Characterized by sand, cemented tubules, large aquatic gastropod shells, and littoral ostracode valves, thin (1-6 cm) tempestite deposits punctuate thicker deposits of organic gyttja from 16,080 to 11,900 cal yr b.p. The succeeding 2300 yr (11,900-9600 cal yr b.p.) lack tempestites, and reconstructed water depths were at their maximum. Deposition of marl under relatively well-oxygenated conditions occurred during the remainder of the Holocene until the arrival of Europeans, when the lake returned to a pattern of seasonally low dissolved oxygen. Such conditions are also indicated in the lake sediment by the speciation of phosphorus, high concentrations of organic carbon, and abundant iron and manganese occluded to mineral grains. Initial low dissolved oxygen was probably caused by the delivery of dissolved P and Fe in shallow groundwater, the chemistry of which was influenced by Spodosol pedogenesis under a spruce forest. The triggering may have been regionally warm and wet conditions associated with retreat of the Lake Michigan lobe (south-central Laurentide Ice Sheet). ?? 2010, by the American Society of Limnology and Oceanography Inc.
Capra, L.; Arce, J.; Macias, J.
2006-05-01
Approximately 21,700 yr B.P., after a period of quiescence of 4800 yr, Nevado de Toluca volcano erupted, producing the Lower Toluca Pumice deposit. The activity generated a 24-km-high Plinian column that lasted ~11 h and dispersed 2.3 km3 (0.8 km3 dense rock equivalent) of tephra toward the NE, blanketing the Lerma basin, an area occupied today by the city of Toluca, with up to 5 cm of ash. Subsequent eruptive pulses were sub-Plinian in style, accompanied by phreatomagmatic explosions that emplaced surge deposits. Finally, the column collapsed toward the NE with the emplacement of a pumice flow deposit. The high vesicularity of the pumice from the basal Plinian layer, up to 83% by volume, indicates that exsolution was dominantly magmatic, and that pressurization of the magma chamber was probably due to a magma mixing process. Evidence for this includes the compositional range of juvenile products (from 55 to 65 wt% SiO2), as well as the presence of two types of plagioclase, one in equilibrium and the other one with disequilibrium textures and reverse zoning. This suggests input of an andesitic liquid into the dacitic magma chamber. Based on the eruptive record, the most likely future eruptive activity at Nevado de Toluca volcano will be Plinian. Although quiet for more than 3250 yr, Plinian activity could occur after a long period of quiescence, and it could represent a hazard for the entire Toluca basin, where more than one million people live today.
Energy Technology Data Exchange (ETDEWEB)
Clark, Douglas Howe [Univ. of Washington, Seattle, WA (United States)
1995-01-01
Despite more than a century of study, scant attention has been paid to the glacial record in the northern end of the Sierra Nevada, and to the smaller moraines deposited after the retreat of the Tioga (last glacial maximum) glaciers. Equilibrium-line altitude (ELA) estimates of the ice fields indicate that the Tioga ELA gradients there are consistent with similar estimates for the southern half of the range, and with an intensification of the modern temperature/precipitation pattern in the region. The Recess Peak advance has traditionally been considered to be mid-Neoglacial age, about 2--3,000 yr B.P., on the basis of relative weathering estimates. Sediment cores of lakes dammed behind moraines correlative with Recess Peak in four widely spaced sites yields a series of high-resolution AMS radiocarbon dates which demonstrate that Recess Peak glaciers retreated before ~13,100 cal yr B.P.. This minimum limiting age indicates that the advance predates the North Atlantic Younger Dryas cooling. It also implies that there have been no advances larger than the Matthes in the roughly 12,000 year interval between it and the Recess Peak advance. This finding casts doubt on several recent studies that claim Younger Dryas glacier advances in western North America. The 13,100 cal yr B.P. date is also a minimum age for deglaciation of the sample sites used to calibrate the in situ production rates of cosmogenic 10Be and 26Al. The discrepancy between this age and the 11,000 cal yr B.P. exposure age assumed in the original calibration introduces a large (> 19%) potential error in late-Pleistocene exposure ages calculated using these production rates.
AMS measurement of C-14 concentration in a single-year ring of a 2500-yr-old tree
International Nuclear Information System (INIS)
Sakurai, H.; Gandou, T.; Kato, W.; Sawaki, Y.; Matsumoto, T.; Aoki, T.; Matsuzaki, H.; Gunji, S.; Tokanai, F.
2004-01-01
The 14 C concentration in rings of an old tree that date back approximately 2500 yr has been measured at single-year intervals with a highly accurate liquid scintillation counter (LSC) (0.2%) to investigate the 11-yr periodicity of solar activity. To investigate the applicability of AMS to accurate 14 C measurement, 16 graphite samples produced from the cellulose of a single-year tree ring of a 2500-yr-old cedar were measured with the micro analysis laboratory tandem (MALT) accelerator, at The University of Tokyo, and the results were compared with the 14 C age determined using LSC. The average 14 C age of the single-year tree ring calculated from 16 measurements was 2496 ± 23 yr BP, corresponding to the statistical accuracy of 0.26%. This was consistent with the age of 2514 ± 23 yr BP determined using LSC within the acceptable error range, which indicates that accelerator mass spectrometry (AMS) is applicable for accurate 14 C measurement using multi-graphite for the same single-year tree ring
Environmental change in the Limfjord, Denmark (ca 7500-1500 cal yrs BP): A multiproxy study
DEFF Research Database (Denmark)
Lewis, J. P.; Ryves, D.B.; Rasmussen, P.
2013-01-01
(and high productivity) between ca 7500–5000 BP, followed by a gradual transition to a shallow benthic system with more oceanic conditions (i.e. higher salinity, lower productivity, slower sedimentary accumulation rate and poorer fossil preservation) after ca 5000 BP and no stratification after ca 4400...
Yao, Qiang; Liu, Kam-Biu
2017-01-01
Sea level rise and the associated inland shift of the marsh-mangrove ecotone in south Florida have raised many scientific and management concerns in recent years. Holocene paleoecological records can provide an important baseline to shed light on the long-term dynamics of vegetation changes across this ecotone in the past, which is needed to predict the future. In this study, we present palynological, X-ray fluorescence, and loss-on ignition data from four sedimentary cores recovered from a 20-km marine-to-freshwater transect along the Shark River Estuary, southwest Everglades, to document the patterns and processes of coastal vegetation changes in response to sea level rise since the mid-Holocene. Our record indicates that freshwater marsh progressively replaced marl prairies at the Shark River Estuary between 5700 and 4400 cal yr BP. As marine transgression continued, marine influence reached the threshold necessary for mangroves to establish at the current mouth of the Shark River Slough at 3800 cal yr BP. During the next 3000 years, although sea level rise in the Western North Atlantic slowed down to 0.4 mm/yr, a spatial and temporal gradient was evident as the marsh-mangrove ecotone shifted inland by 20 km from 3800 to 800 cal yr BP, accompanied by a gradual landward replacement of freshwater marsh by mangrove forest. If sea level continues to rise at 2.33 mm/yr in the 21st century in south Florida, it is possible that marine influence will reach the threshold for mangroves to establish in the central Everglades, and we could expect a much more aggressive mangrove encroachment toward the northern and interior parts of south Florida in the next few centuries.
Directory of Open Access Journals (Sweden)
Abercrombie Jason M
2011-07-01
Full Text Available Abstract Background A number of innovations underlie the origin of rapid reproductive cycles in angiosperms. A critical early step involved the modification of an ancestrally short and slow-growing pollen tube for faster and longer distance transport of sperm to egg. Associated with this shift are the predominantly callose (1,3-β-glucan walls and septae (callose plugs of angiosperm pollen tubes. Callose synthesis is mediated by callose synthase (CalS. Of 12 CalS gene family members in Arabidopsis, only one (CalS5 has been directly linked to pollen tube callose. CalS5 orthologues are present in several monocot and eudicot genomes, but little is known about the evolutionary origin of CalS5 or what its ancestral function may have been. Results We investigated expression of CalS in pollen and pollen tubes of selected non-flowering seed plants (gymnosperms and angiosperms within lineages that diverged below the monocot/eudicot node. First, we determined the nearly full length coding sequence of a CalS5 orthologue from Cabomba caroliniana (CcCalS5 (Nymphaeales. Semi-quantitative RT-PCR demonstrated low CcCalS5 expression within several vegetative tissues, but strong expression in mature pollen. CalS transcripts were detected in pollen tubes of several species within Nymphaeales and Austrobaileyales, and comparative analyses with a phylogenetically diverse group of sequenced genomes indicated homology to CalS5. We also report in silico evidence of a putative CalS5 orthologue from Amborella. Among gymnosperms, CalS5 transcripts were recovered from germinating pollen of Gnetum and Ginkgo, but a novel CalS paralog was instead amplified from germinating pollen of Pinus taeda. Conclusion The finding that CalS5 is the predominant callose synthase in pollen tubes of both early-diverging and model system angiosperms is an indicator of the homology of their novel callosic pollen tube walls and callose plugs. The data suggest that CalS5 had transient expression
Directory of Open Access Journals (Sweden)
A. Simonneau
2013-03-01
Full Text Available High-resolution seismic profiles and sediment cores from Lake Ledro combined with soil and riverbed samples from the lake's catchment area are used to assess the recurrence of natural hazards (earthquakes and flood events in the southern Italian Alps during the Holocene. Two well-developed deltas and a flat central basin are identified on seismic profiles in Lake Ledro. Lake sediments have been finely laminated in the basin since 9000 cal. yr BP and frequently interrupted by two types of sedimentary events (SEs: light-coloured massive layers and dark-coloured graded beds. Optical analysis (quantitative organic petrography of the organic matter present in soil, riverbed and lacustrine samples together with lake sediment bulk density and grain-size analysis illustrate that light-coloured layers consist of a mixture of lacustrine sediments and mainly contain algal particles similar to the ones observed in background sediments. Light-coloured layers thicker than 1.5 cm in the main basin of Lake Ledro are synchronous to numerous coeval mass-wasting deposits remoulding the slopes of the basin. They are interpreted as subaquatic mass-movements triggered by historical and pre-historical regional earthquakes dated to AD 2005, AD 1891, AD 1045 and 1260, 2545, 2595, 3350, 3815, 4740, 7190, 9185 and 11 495 cal. yr BP. Dark-coloured SEs develop high-amplitude reflections in front of the deltas and in the deep central basin. These beds are mainly made of terrestrial organic matter (soils and lignocellulosic debris and are interpreted as resulting from intense hyperpycnal flood event. Mapping and quantifying the amount of soil material accumulated in the Holocene hyperpycnal flood deposits of the sequence allow estimating that the equivalent soil thickness eroded over the catchment area reached up to 5 mm during the largest Holocene flood events. Such significant soil erosion is interpreted as resulting from the combination of heavy rainfall and snowmelt. The
Kennett, James P.; Kennett, Douglas J.; Culleton, Brendan J.; Aura Tortosa, J. Emili; Bischoff, James L.; Bunch, Ted E.; Daniel, I. Randolph; Erlandson, Jon M.; Ferraro, David; Firestone, Richard B.; Goodyear, Albert C.; Israde-Alcántara, Isabel; Johnson, John R.; Jordá Pardo, Jesús F.; Kimbel, David R.; LeCompte, Malcolm A.; Lopinot, Neal H.; Mahaney, William C.; Moore, Andrew M. T.; Moore, Christopher R.; Ray, Jack H.; Stafford, Thomas W.; Tankersley, Kenneth Barnett; Wittke, James H.; Wolbach, Wendy S.; West, Allen
2015-01-01
The Younger Dryas impact hypothesis posits that a cosmic impact across much of the Northern Hemisphere deposited the Younger Dryas boundary (YDB) layer, containing peak abundances in a variable assemblage of proxies, including magnetic and glassy impact-related spherules, high-temperature minerals and melt glass, nanodiamonds, carbon spherules, aciniform carbon, platinum, and osmium. Bayesian chronological modeling was applied to 354 dates from 23 stratigraphic sections in 12 countries on four continents to establish a modeled YDB age range for this event of 12,835–12,735 Cal B.P. at 95% probability. This range overlaps that of a peak in extraterrestrial platinum in the Greenland Ice Sheet and of the earliest age of the Younger Dryas climate episode in six proxy records, suggesting a causal connection between the YDB impact event and the Younger Dryas. Two statistical tests indicate that both modeled and unmodeled ages in the 30 records are consistent with synchronous deposition of the YDB layer within the limits of dating uncertainty (∼100 y). The widespread distribution of the YDB layer suggests that it may serve as a datum layer. PMID:26216981
Schwarz, Anja; Turner, Falko; Lauterbach, Stefan; Plessen, Birgit; Krahn, Kim J.; Glodniok, Sven; Mischke, Steffen; Stebich, Martina; Witt, Roman; Mingram, Jens; Schwalb, Antje
2017-12-01
Arid Central Asia represents a key region for understanding climate variability and interactions in the Northern Hemisphere. Patterns and mechanisms of Holocene climate change in arid Central Asia are, however, only partially understood. Multi-proxy data combining diatom, ostracod, sedimentological, geochemical and stable isotope analyses from a ca. 6000-year-old lake sediment core from Son Kol (Central Kyrgyzstan) show distinct and repeated changes in species assemblages. Diatom- and ostracod-inferred conductivity shifts between meso-euhaline and freshwater conditions suggest water balance and regime shifts. Organism-derived data are corroborated by stable isotope, mineralogical and geochemical records, underlining that Son Kol was affected by strong lake level fluctuations of several meters. The δ13Ccarb/δ18Ocarb correlation shows repeated switchovers from a closed to an open lake system. From 6000 to 3800 and 3250 to 1950 cal. yr BP, Son Kol was a closed basin lake with higher conductivities, increased nutrient availability and a water level located below the modern outflow. Son Kol became again a hydrologically open lake at 3800 and 1950 cal. yr BP. Comparisons to other local and regional paleoclimate records indicate that these regime shifts were largely controlled by changing intensity and position of the Westerlies and the Siberian Anticyclone that triggered changes in the amount of winter precipitation. A strong influence of the Westerlies ca. 5000-4400, 3800-3250 and since 1950 cal. yr BP enhanced the amount of precipitation during spring, autumn and winter, whereas cold and dry winters prevailed during phases with a strong Siberian Anticyclone and southward shifted Westerlies at ca. 6000-5000, 4400-3800 and 3250-1950 cal. yr BP. Similarities between variations in winter precipitation at Son Kol and records of the predominant NAO-mode further suggest a teleconnection between wet (dry) winter climate in Central Asia and a positive (negative) NAO
Directory of Open Access Journals (Sweden)
LIDIA A. KUHN
2017-10-01
Full Text Available ABSTRACT This paper presents a paleoenvironmental reconstruction from palynological analyses of a sedimentary core of Holocene age, drilled at municipality of Garopaba (Santa Catarina, Southern Brazil. A total of 46 samples was collected for palynological analyses in the 450 cm-long core PCSC-3, as also three samples for radiocarbon dating and granulometric analyses. The palynological content includes 84 taxa related to pollen grains of angiosperms (38 and gimnosperm (3, spores of pteridophyta (16 and bryophyta (2, spores of fungi (8, algae (3, acritarchs (3, dinoflagellate cysts (2 and microforaminiferal linings (1. Three specimens of acritarchs are described and illustrated in detail. Three palynological phases were defined based on changes in assemblages: Phase I, Phase II and Phase III. The Phase I is characterized as a lagoonal paleoenvironment with marine influence from the beginning of the sedimentation (5390 cal yr BP, based on occurrences of acritarchs, dinoflagellate cysts and microforaminiferal linings. The Phase II (3032 yr BP until 858 cal yr BP also is characterized by a lagoonal paleoenvironment, however, presented decrease in percentage of marine elements and increase in freshwater algae record, suggesting less marine influence in the lagoonal body. In Phase III (last 856 years, underwater sedimentation prevailed, under swamp-like conditions.
Late Holocene climate variability from Lake Pupuke maar, Auckland, New Zealand
Striewski, B.; Shulmeister, J.; Augustinus, P. C.; Soderholm, J.
2013-10-01
Spectral analyses of quasi-annual organo-diatomaceous laminae couplets in an Auckland maar lake indicate brief (sub-decadal scale) episodes with strong spectral power and long periods of weak to no spectral power between c. 1700 to c. 550 cal. yr BP. Laminae couplet thickness appears to be a function of changes in wind flow over the basin, with enhanced wind flow deepening the mixing zone and providing additional nutrients for laminae formation. Aeolian dust from Australia amplifies the wind signal. Spectral signals in the high power episodes are focused in Auckland climate whereby strongly negative (positive) ENSO are associated with enhanced (diminished) SW airflow over Auckland. ENSO events interact in the modern climate and the spectral results indicate that this is the case when spectral power is strong in the laminae. These results highlight strong but intermittent ENSO activity between 600 and 1400 cal. yr BP.
McGann, Mary
2017-01-01
The pollen assemblage of a deep-sea core (15G) collected at lower bathyal depths (3491 m) on a levee of Monterey Canyon off central California was investigated to gain insights into the delivery processes of terrigenous material to submarine fans and the effect this transport has on the palynological record. Thirty-two samples were obtained down the length of the core, 19 from hemipelagic and mixed mud deposits considered to be the background record, and 13 others from displaced flow deposits. The pollen record obtained from the background samples documents variations in the terrestrial flora as it adapted to changing climatic conditions over the last 19,000 cal yrs BP. A Q-mode cluster analysis defined three pollen zones: a Glacial Pollen Zone (ca. 20,000–17,000 cal yr BP), an overlying Transitional Pollen Zone (ca. 17,000–11,500 cal yr BP), and an Interglacial Pollen Zone (ca. 11,500 cal yr BP to present). Another Q-mode cluster analysis, of both the background mud and flow deposits, also defined these three pollen zones, but four of the 13 turbiditic deposits were assigned to pollen zones older than expected by their stratigraphic position. This was due to these samples containing statistically significant fewer palynomorphs than the background muds as well as being enriched (∼10–35% in some cases) in hydraulically-efficient Pinus pollen. A selective bias in the pollen assemblage, such as demonstrated here, may result in incorrect interpretations (e.g., climatic shifts or environmental perturbations) based on the floral record, indicating turbiditic deposits should be avoided in marine palynological studies. Particularly in the case of fine-grained flow deposits that may not be visually distinct, granulometry and grain size frequency distribution curves may not be enough to identify these biased deposits. Determining the relative abundance and source of displaced shallow-water benthic foraminifera entrained in these sediments serves as an excellent
Late Holocene paleoseismicity of the Pahiatua section of the Wellington Fault, New Zealand
International Nuclear Information System (INIS)
Langridge, R.M.; Berryman, K.R.; Van Dissen, R.J.
2007-01-01
Six trenches and additional exposures have been investigated along a 23 km length of the Pahiatua section of the Wellington Fault. The sites show a consistent fault rupture record for the last four surface-faulting events along the Pahiatua section. This multi-site record of events, supported by 28 radiocarbon ages that span the last c. 4500 yr, is the most complete paleoseismic record for the Wellington Fault. From southwest to northeast, the trenches are called Death-1 and -2, Hughes-2 and -1, and Ebbett-2 and -1, named after local farmers. Additional data come from an exposure at the Army Depot northeast of Ebbett-1 and a stream cutting near the Death-1 trench. Earthquake events are recognised on the basis of upward terminations of faults and stratigraphic evidence (unconformities; scarp-derived colluvial deposits; 'co-seismically' generated, organic, poorly sorted units; and subsequent scarp-ponded units). On this basis, evidence for the most recent surface-faulting event is recognised at all sites (i.e., between Death-1 and the Army Depot site) and has a timing of AD 1670-1800 (150-280 cal. yr BP). The penultimate faulting event has been recognised at all six trenches and occurred between AD 690 and 1170 (780-1260 cal. yr BP). Clear evidence, and datable material associated with events III and IV, is observed only in the older records of the Ebbett-1 and Hughes trenches. Event III is bracketed by faulting and two ages on co-seismic deposits to the interval AD 65 to 400 BC (1885-2350 cal. yr BP). Event IV is bracketed by three key ages in the Hughes-1 trench to the interval 1600-2140 BC (3550-4090 cal. yr BP). The trench-derived recurrence interval based on these four events is c. 1200 ± 110 yr, which is consistent with, though longer than, an estimate of the recurrence interval based on slip rate (5.1-6.2 mm/yr) and single-event displacement (4.5 ± 1 m), which gave a range of 820 ± 260 yr. When the current paleoseismic data for the Wellington Fault are
Elvert, Marcus; Pohlman, John; Becker, Kevin W.; Gaglioti, Benjamin V.; Hinrichs, Kai-Uwe; Wooller, Matthew J.
2016-01-01
Arctic lakes and wetlands contribute a substantial amount of methane to the contemporary atmosphere, yet profound knowledge gaps remain regarding the intensity and climatic control of past methane emissions from this source. In this study, we reconstruct methane turnover and environmental conditions, including estimates of mean annual and summer temperature, from a thermokarst lake (Lake Qalluuraq) on the Arctic Coastal Plain of northern Alaska for the Holocene by using source-specific lipid biomarkers preserved in a radiocarbon-dated sediment core. Our results document a more prominent role for methane in the carbon cycle when the lake basin was an emergent fen habitat between ~12,300 and ~10,000 cal yr BP, a time period closely coinciding with the Holocene Thermal Maximum (HTM) in North Alaska. Enhanced methane turnover was stimulated by relatively warm temperatures, increased moisture, nutrient supply, and primary productivity. After ~10,000 cal yr BP, a thermokarst lake with abundant submerged mosses evolved, and through the mid-Holocene temperatures were approximately 3°C cooler. Under these conditions, organic matter decomposition was attenuated, which facilitated the accumulation of submerged mosses within a shallower Lake Qalluuraq. Reduced methane assimilation into biomass during the mid-Holocene suggests that thermokarst lakes are carbon sinks during cold periods. In the late-Holocene from ~2700 cal yr BP to the most recent time, however, temperatures and carbon deposition rose and methane oxidation intensified, indicating that more rapid organic matter decomposition and enhanced methane production could amplify climate feedback via potential methane emissions in the future.
Franco-Gaviria, F.; Correa-Metrio, A.; Cordero-Oviedo, C.; López-Pérez, M.; Cárdenes-Sandí, G. M.; Romero, F. M.
2018-06-01
Climate variability and human activities have shaped the vegetation communities of the Maya region of southern Mexico and Central America on centennial to millennial timescales. Most research efforts in the region have focused on the lowlands, with relatively little known about the environmental history of the regional highlands. Here we present data from two sediment sequences collected from lakes in the highlands of Chiapas, Mexico. Our aim was to disentangle the relative contributions of climate and human activities in the development of regional vegetation during the late Holocene. The records reveal a long-term trend towards drier conditions with superimposed centennial-scale droughts. A declining moisture trend from 3400 to 1500 cal yr BP is consistent with previously reported southward displacement of the Intertropical Convergence Zone, whereas periodic droughts were probably a consequence of drivers such as El Niño. These conditions, together with dense human occupation, converted the vegetation from forest to more open systems. According to the paleoecological records, cultural abandonment of the area occurred ca. 1500 cal yr BP, favoring forest recovery that was somewhat limited by low moisture availability. About 600 cal yr BP, wetter conditions promoted the establishment of modern montane cloud forests, which consist of a diverse mixture of temperate and tropical elements. The vegetation types that occupied the study area during the last few millennia have remained within the envelope defined by the modern vegetation mosaic. This finding highlights the importance of microhabitats in the maintenance biodiversity through time, even under scenarios of high climate variability and anthropogenic pressure.
Li, Kai; Liu, Xingqi; Wang, Yongbo; Herzschuh, Ulrike; Ni, Jian; Liao, Mengna; Xiao, Xiayun
2017-12-01
The Indian Summer Monsoon (ISM) is one of the most important climate systems, whose variability and driving mechanisms are of broad interest for academic and societal communities. Here, we present a well-dated high-resolution pollen analysis from a 4.82-m long sediment core taken from Basomtso, in the southeastern Tibetan Plateau (TP), which depicts the regional climate changes of the past millennium. Our results show that subalpine coniferous forest was dominant around Basomtso from ca. 867 to ca. 750 cal. yr BP, indicating a warm and semi-humid climate. The timberline in the study area significantly decreased from ca. 750 to ca. 100 cal. yr BP, and a cold climate, corresponding to the Little Ice Age (LIA) prevailed. Since ca. 100 cal. yr BP, the vegetation type changed to forest-meadow with rising temperatures and moisture. Ordination analysis reveals that the migration of vegetation was dominated by regional temperatures and then by moisture. Further comparisons between the Basomtso pollen record and the regional temperature reconstructions underscore the relevance of the Basomtso record from the southeastern TP for regional and global climatologies. Our pollen based moisture reconstruction demonstrates the strong multicentennial-scale link to ISM variability, providing solid evidence for the increase of monsoonal strengths over the past four centuries. Spectral analysis indicates the potential influence of solar forcing. However, a closer relationship has been observed between multicentennial ISM variations and Indian Ocean sea surface temperature anomalies (SSTs), suggesting that the variations in monsoonal precipitation over the southeastern TP are probably driven by the Indian Ocean Dipole on the multicentennial scale.
Directory of Open Access Journals (Sweden)
Lisa Öberg
2011-12-01
Full Text Available Climate warming during the past century has imposed recession of glaciers and perennial snow/ice patches along the entire Swedish Scandes. On the newly exposed forefields, subfossil wood remnants are being outwashed from beneath ice and snow bodies. In Scandinavia, this kind of detrital wood is a previously unused source of postglacial vegetation and climate history. The present study reports radiocarbon dates of a set of 78 wood samples, retrieved from three main sites, high above modern treelines and stretching along the Swedish Scandes. In accord with previous studies, pine (Pinus sylvestris colonized early emerging nunataks already during the Late Glacial. Around 9600-9500 cal. yr BP a first massive wave of tree establishment, birch and pine, took place in “empty” glacier cirques. Both species grew 400-600 m above their present-ay treeline position and the summer temperatures may have been 3.5 °C warmer than present. In respons to Neoglacial cooling, treelines of both birch and pine descended until their final disappearance from the record 4400 and 5900 cal. yr BP, respectively. During the entire interval 9600 to 4400 cal. yr BP, birch prospered in a 100-150 broad belt above the uppermost pines. The recent emergence of tree remnants in the current habitats relates to the contemporary episode of climate warming, possibly unprecedented for several past millennia. It is inferred, by an anology with the past, that in a future scenario with summers 3.5 ° warmer than present, the birch treeline may rise by 600 m or so.
Energy Technology Data Exchange (ETDEWEB)
Ascough, P.L. [School of Geography and Geosciences, Irvine Building, University of St. Andrews, St. Andrews, Fife KY16 9AL (United Kingdom)]. E-mail: pla1@st-andrews.ac.uk; Cook, G.T. [Scottish Universities Environmental Research Centre, Scottish Enterprise Technology Park, Rankine Avenue, East Kilbride G75 OQF (United Kingdom); Dugmore, A.J. [Institute of Geography, School of GeoSciences, University of Edinburgh, Edinburgh EH8 9XP (United Kingdom); Scott, E.M. [Department of Statistics, University of Glasgow, Glasgow G12 8QQ (United Kingdom)
2007-06-15
The marine reservoir effect (MRE) is a {sup 14}C age offset between the oceanic and atmospheric carbon reservoirs. The MRE is neither spatially nor temporally constant and values may deviate significantly from the global model average provided by the Marine04 curve. Such a deviation is calculated as a {delta}R value and modern (pre-bomb) values show considerable spatial variations. There is also considerable evidence for temporal variability linked to paleoenvironmental changes identified in paleoclimatic proxy records. Seven new {delta}R values are presented for the North Atlantic, relating to the period c. 8430-3890 cal. BP (c. 6480-1940 BC). These were obtained from {sup 14}C analysis of multiple samples of terrestrial and marine material derived from seven individual archaeological deposits from Mainland Scotland, the Outer Hebrides and the Orkney Isles. The {delta}R values vary between 143 {+-} 20 {sup 14}C yr and -100 {+-} 15 {sup 14}C yr with the positive values all occurring in the earlier period (8430-5060 cal. BP), and the negative values all coming from later deposits (4820-3890 cal. BP). The nature of MRE values and the potential for spatial and temporal variation in values is the subject of current research interest and these data are placed in the context of (i) other estimates for UK coastal waters and (ii) important questions concerning current approaches to quantifying the MRE.
Potts, Alastair J.; Midgley, Jeremy J.; Harris, Chris
2009-09-01
Late Quaternary terrestrial climate records from the semi-arid zone of the Western Cape of South Africa are rare. However, palaeoenvironmental information may be inferred from ancient termite mounds of the region. Calcrete lenses in these mounds have δ 13C and δ 18O values that show systematic changes with radiocarbon dates, which range from 33,629-36,709 to 21,676-23,256 cal yr BP. These dates confirm that these heuweltjies had been present in the landscape since the last glacial period. The decrease in δ 13C and δ 18O from 33,629-36,709 to 21,676-23,256 cal yr BP indicates that climate information is recorded by the calcretes. It is suggested that a progressive decline in air temperature and an increase in moisture availability, and a decline in abundance of C 4 or CAM plants, occurred in the region during the time heuweltjie calcite precipitated.
Ecotone shift and major droughts during the mid-late Holocene in the central Tibetan Plateau.
Shen, Caiming; Liu, Kam-Biu; Morrill, Carrie; Overpeck, Jonathan T; Peng, Jinlan; Tang, Lingyu
2008-04-01
A well-dated pollen record from a large lake located on the meadow-steppe ecotone provides a history of ecotone shift in response to monsoonal climate changes over the last 6000 years in the central Tibetan Plateau. The pollen record indicates that the ecotone shifted eastward during 6000-4900, 4400-3900, and 2800-1600 cal. yr BP when steppes occupied this region, whereas it shifted westward during the other intervals when the steppes were replaced by meadows. The quantitative reconstruction of paleoclimate derived from the pollen record shows that monsoon precipitation fluctuated around the present level over the last 6000 years in the central Tibetan Plateau. Three major drought episodes of 5600-4900, 4400-3900, and 2800-2400 cal. yr BP are detected by pollen signals and lake sediments. Comparison of our record with other climatic proxy data from the Tibetan Plateau and other monsoonal regions shows that these episodes are three major centennial-scale monsoon weakening events.
Directory of Open Access Journals (Sweden)
S. Joannin
2012-12-01
Full Text Available A high-resolution pollen record from Lago Trifoglietti in Calabria (southern Italy provides new insights into the paleoenvironmental and palaeoclimatic changes which characterise the Holocene period in the southern Italy. The chronology is based on 11 AMS radiocarbon dates from terrestrial organic material. The Holocene history of the vegetation cover shows the persistence of an important and relatively stable Fagus forest present over that entire period, offering a rare example of a beech woodstand able to withstand climate changes for more than 11 000 yr. Probably in relation with early Holocene dry climate conditions which affected southern Italy, the Trifoglietti pollen record supports a southward delay in thermophyllous forest expansion dated to ca. 13 500 cal BP at Monticchio, ca. 11 000 cal BP at Trifoglietti, and finally ca. 9800 cal BP in Sicily. Regarding the human impact history, the Trifoglietti pollen record shows only poor imprints of agricultural activities and anthopogenic indicators, apart from those indicating pastoralism activities beneath forest cover. The selective exploitation of Abies appears to have been the strongest human impact on the Trifoglietti surroundings. On the basis of (1 a specific ratio between hygrophilous and terrestrial taxa, and (2 the Modern Analogue Technique, the pollen data collected at Lago Trifoglietti led to the establishment of two palaeoclimatic records tracing changes in (1 lake depth and (2 annual precipitation. On a millennial scale, these records give evidence of increasing moisture from ca. 11 000 to ca. 9400 cal BP and maximum humidity from ca. 9400 to ca. 6200 cal BP, prior to a general trend towards the drier climate conditions that have prevailed up to the present. In addition, several successive centennial-scale oscillations appear to have punctuated the entire Holocene. The identification of a cold dry event around 11 300 cal BP, responsible for a marked decline in
Vescovi, E.; Ravazzi, C.; Arpenti, E.; Finsinger, W.; Pini, R.; Valsecchi, V.; Wick, L.; Ammann, B.; Tinner, W.
2007-01-01
We reconstruct the vegetational history of the southern side of the Alps at 18,000–10,000 cal yr BP using previous and new AMS-dated stratigraphic records of pollen, stomata, and macrofossils. To address potential effects of climatic change on vegetation, we compare our results with independent
Rudaya, Natalia; Nazarova, Larisa; Novenko, Elena; Babich, Valery; Kalugin, Ivan; Daryin, Andrei
2015-04-01
We report the first high-resolution (with intervals ca. 20-50 years) late-Holocene (4200 yr BP) pollen record from Lake Teletskoye, Altai Mountains, obtained from the underwater Ridge of Sofia Lepneva in 2006 (core Tel 2006). The study presents (i) the results of palynological analysis of Tel 2006; (ii) the results of spectral analysis of natural cycles based on the periodical fluctuation of taiga-biome curve; and (iii) quantitative reconstructions of the late-Holocene regional vegetation, woody coverage and climate in northern part of the Altai Mountains in order to define place of Northeast Altai on the map of the late-Holocene Central Asian environmental history. Late Holocene vegetation of the northeastern part of Altai recorded in Tel 2006 core is characterized by spread of dark-coniferous forest with structure similar to modern. Dominant trees, Siberian pine (Pinus sibirica) and Siberian fir (Abies sibirica), are the most ecological sensitive taxa between Siberian conifers (Shumilova, 1962), that as a whole suggests mild and humid climatic conditions during last 4200 years. However, changes of pollen taxa percentages and results of numerical analysis reveal pronounced fluctuation of climate and vegetation. Relatively cool and dry stage occurred prior to ca. 3500 cal yr BP. Open vegetation was widespread in the region with maximum deforestation and minimal July temperatures between 3800-3500 cal yr BP. Steppe-like communities with Artemisia, Chenopodiaceae and Cyperaceae could grow on the open sites around Lake Teletskoye. Reconstructed woody coverage is very low and varies between 29-35%. After ca. 3500 cal yr BP the area of dark-coniferous mountain taiga has significantly enlarged with maximums of woody coverages and taiga biome scores between ca. 2470-1040 cal yr BP. In the period of ~3500-2500 cal yr BP the averages July temperatures increased more than 1 0C. Climate became warmer and wetter. During last millennium (after 1040 cal yr BP) average July
Ramos-Román, María J.; Jiménez-Moreno, Gonzalo; Camuera, Jon; García-Alix, Antonio; Anderson, R. Scott; Jiménez-Espejo, Francisco J.; Carrión, José S.
2018-01-01
Holocene centennial-scale paleoenvironmental variability has been described in a multiproxy analysis (i.e., lithology, geochemistry, macrofossil, and microfossil analyses) of a paleoecological record from the Padul Basin in Sierra Nevada, southern Iberian Peninsula. This sequence covers a relevant time interval hitherto unreported in the studies of the Padul sedimentary sequence. The ˜ 4700-year record has preserved proxies of climate variability, with vegetation, lake levels, and sedimentological change during the Holocene in one of the most unique and southernmost wetlands in Europe. The progressive middle and late Holocene trend toward arid conditions identified by numerous authors in the western Mediterranean region, mostly related to a decrease in summer insolation, is also documented in this record; here it is also superimposed by centennial-scale variability in humidity. In turn, this record shows centennial-scale climate oscillations in temperature that correlate with well-known climatic events during the late Holocene in the western Mediterranean region, synchronous with variability in solar and atmospheric dynamics. The multiproxy Padul record first shows a transition from a relatively humid middle Holocene in the western Mediterranean region to more aridity from ˜ 4700 to ˜ 2800 cal yr BP. A relatively warm and humid period occurred between ˜ 2600 and ˜ 1600 cal yr BP, coinciding with persistent negative North Atlantic Oscillation (NAO) conditions and the historic Iberian-Roman Humid Period. Enhanced arid conditions, co-occurring with overall positive NAO conditions and increasing solar activity, are observed between ˜ 1550 and ˜ 450 cal yr BP (˜ 400 to ˜ 1400 CE) and colder and warmer conditions occurred during the Dark Ages and Medieval Climate Anomaly (MCA), respectively. Slightly wetter conditions took place during the end of the MCA and the first part of the Little Ice Age, which could be related to a change towards negative NAO conditions
Zimmerman, S. R.; Starratt, S.; Hemming, S. R.
2012-12-01
Mono Lake, California is a closed-basin lake on the east side of the Sierra Nevada, and inflow from snowmelt dominates the modern hydrology. Changes in wetness during the last glacial period (>12,000 years ago) and over the last 2,000 years have been extensively described, but are poorly known for the intervening period. We have recovered a 6.25 m-long core from ~3 m of water in the western embayment of Mono Lake, which is shown by initial radiocarbon dates to cover at least the last 10,000 years. The sediments of the core are variable, ranging from black to gray silts near the base, laminated olive-green silt through the center, to layers of peach-colored carbonate nodules interbedded with gray and olive silts and pea-green organic ooze. Volcanic tephras from Bodie and Adobe Hills to the north, east, and south. The rhyolitic tephras of the Mono-Inyo Craters are much lower in TiO2 than the bedrock (10,000 calibrated years before present (cal yr BP) higher in the core, and significant disruption of the fine layers, this interval likely indicates a relatively deep lake persisting into the early Holocene, after the initial dramatic regression from late Pleistocene levels. The finely laminated olive-green silt of the period ~10,700 to ~7500 cal yr BP is very homogenous chemically, probably indicating a stable, stratified lake and a relatively wet climate. This section merits mm-scale scanning and petrographic examination in the future. The upper boundary of the laminated section shows rising Ca/K and decreasing Ti and Si/K, marking the appearance of authigenic carbonate layers. After ~7500 cal yr BP, the sediment in BINGO becomes highly variable, with increased occurrence of tephra layers and carbonate, indicating a lower and more variable lake level. A short interval of olive-green, laminated fine sand/silt just above a radiocarbon date of 3870 ± 360 cal yr BP may record the Dechambeau Ranch highstand of Stine (1990; PPP v. 78 pp 333-381), and is marked by a distinct
Stansell, N.; Rodbell, D. T.; Moy, C. M.
2010-12-01
Pro-glacial lake sediments from the Cordillera Blanca, Peru contain continuous records of climate variability spanning the Last Glacial Maximum to present day. Here we present results from two alpine lake basins in the Queshgue Valley (9.8°S, 77.3°W) that contain high-resolution records of clastic sediment deposition for the last ~20,000 years. Radiocarbon-dated sediment cores were scanned at 0.5 to 1.0 cm resolution using a profiling x-ray fluorescence scanner for major and minor element distributions. In addition, we measured down-core variations in magnetic susceptibility, organic carbon, biogenic silica and calcium carbonate. Samples of bedrock and sediments from glacial moraines in the Queshgue watershed were analyzed using an ICP-MS in order to fingerprint and trace the source of glacial sediments deposited in the lakes. The bedrock is dominated by a combination of granodiorite with high Sr concentrations and meta-sedimentary rocks with high Zr values. Because the glacial sediments proximal to the modern glacier terminus are composed mostly of the granodiorite end-member, we interpret changes in Sr and clastic sediment concentrations in the lake sediment profiles as proxies for past glacial variability. Preliminary results indicate that glaciers retreated soon after ~14,500 cal yr BP and remained less extensive during the remaining late Glacial Stage and early Holocene. Gradually increasing clastic sediments through the middle and late Holocene indicate that glaciers became progressively larger, or more erosive towards present day. However, this overall Holocene trend of increasing glacier extent was interrupted by multiple periods of centennial- to millennial-scale ice margin retreat. For example, relative peaks in clastic sediments occurred from ~14,500 to 6000, 5600 to 5000, 4600 to 4200, 3600 to 3200, 2800 to 2700, 2400 to 2200, 1750 to 1550, 1100 to 900 cal yr BP, and during the Little Ice Age (~700 to 50 cal yr BP), while periods of low clastic
Bajard, Manon; Sabatier, Pierre; Poulenard, Jérôme; David, Fernand; Arnaud, Fabien; Develle, Anne-Lise; Reyss, Jean-Louis; Fanget, Bernard; Malet, Emmanuel; Crouzet, Christian
2015-04-01
Lake La Thuile in the Massif des Bauges (874 m a.s.l. French Alps) provides a 18 meters sedimentary sequence. Due to its mid-altitude position, this lake is one of the first to be formed through the glacial retreat and documents the evolution of its catchment since the Late Glacial Maximum. The first 6 meters of the core cover the last 12 000 years, and allowed to study human/climate/environment interactions in a carbonated environment. This study is the first one to investigate a mid-altitude lake in the French Alps for paleoenvironment reconstruction from lake sediment archive. Its altitudinal position presents the advantage to be very accessible to human activities and allows more developed agriculture than in higher altitude. This study aims to determined how and when is expressed the erosive response of such an environment to human settlement. High resolution multiproxy analysis of the first 6 meters including sedimentological, palynological and geochemical data associated to a well-constrained chronology over the Holocene period allows us to understand the respective impacts of both climate and human on the evolution of Lake La Thuile environment. Five major phases of evolution have been highlighted over this period. From 12 000 to 10 000 yr cal. BP, the vegetation is developing with the onset of hardwood species and the disappearance of Pinus. From 10 000 to 4500 yr cal. BP the warmer climatic conditions of the middle of the Holocene allows the forest to densify and the very low sedimentation rate indicates that the forest stabilizes slopes and prevents from the erosion on the watershed. The climate cooling of the Neoglacial period triggers a first erosive phase with a decreasing of the forest around 3300 cal. BP. Human settlements are suggested at La Thuile from 2500 yr cal. BP by palynological evidence of anthropic taxa. The triggered clearing is accompanied by a second erosive phase related to anthropic activities during the Roman period. Erosion
Sharifi, O.; Pourmand, A.; Canuel, E. A.; Peterson, L. C.
2011-12-01
The regional climate over West Asia, extending between Iran and the Arabian Peninsula to the eastern Mediterranean Sea, is governed by interactions between three major synoptic systems; mid-latitude Westerlies, the Siberian Anticyclone and the Indian Ocean Summer Monsoon. In recent years, a number of paleoclimate studies have drawn potential links between episodes of abrupt climate change during the Holocene, and the rise and fall of human civilizations across the "Fertile Crescent" of West Asia. High-resolution archives of climate variability from this region, however, are scarce, and at times contradicting. For example, while pollen and planktonic data from lakes in Turkey and Iran suggest that dry, continental conditions prevailed during the early-middle Holocene, oxygen isotope records indicate that relatively wet conditions dominated during this interval over West Asia. We present interannual to decadal multi-proxy records of climate variability from a peat complex in NW Iran to reconstruct changes in moisture and atmospheric dust content during the last 13000 years. Radiocarbon dating on 20 samples from a 775-cm peat core show a nearly constant rate of accumulation (1.7 mm yr-1, R2=0.99) since 13356 ± 116 cal yr B.P. Down-core X-ray fluorescence measurements of conservative lithogenic elements (e.g., Al, Zr, Ti) as well as redox-sensitive elements (e.g., Fe, K, Rb, Zn, Cu, and Co) at 2 mm intervals reveal several periods of elevated dust input to this region since the early Holocene. Down-core variations of total organic carbon and total nitrogen co-vary closely and are inversely correlated with conservative lithogenic elements (Al, Si, Ti), indicating a potential link between climate change and accumulation of organic carbon in the Neor peat mire. Major episodes of enhanced dust deposition (13000-12000, 11700-11200, 9200-8800, 7000-6000, 4200-3200, 2800-2200 and 1500-600 cal yr B.P) are in good agreement with other proxy records that document more arid
Reed, JM; Leng, MJ; Kuzucuoglu, C; Fontugne, M; Bertaux, J; Bottema, S; Black, S; Hunt, E; Karabiyikoglu, M; Woldring, H.
2001-01-01
This study presents results from a multi-proxy analysis of cores taken in a crater-lake sequence from Eski Acigol in central Turkey which cover the period from pre-c. 16000 cal. yr BP to the present. The sediments comprise an upper unit of generally non-laminated, banded to massive silts and peats
DEFF Research Database (Denmark)
Larsen, Michael Holm; Leinsdorff, Torben; Madsen, Claus
1999-01-01
For almost a decade, Business Process Reengineering (BPR) has met a high degree of criticism as project implementations have failed to succeed in industry and public organisations. A vast majority of the reengineering literature recommends that information technology (IT) should enhance the effic......For almost a decade, Business Process Reengineering (BPR) has met a high degree of criticism as project implementations have failed to succeed in industry and public organisations. A vast majority of the reengineering literature recommends that information technology (IT) should enhance...... the likelihood of BPR success. Firstly, CALS contributes to process orientation and process organising in a BPR project. This is partly because CALS satisfies the increased information need of the process team members and partly because CALS breaks down information-based barriers. Secondly, CALS contributes...
Morus planting and silk production in Oxus civilization (2000 BC), Transoxiana
Zhou, X.; Li, X.; Wang, J.
2017-12-01
Silk is the most important luxury in ancient trade, which promoted communications between east and west civilizations that facilitated the development of them. Currently, probably more than 99% of the silk in commerce in the world today comes from a single species called the silkworm or mulberry silk moth, Bombyx mori (L.), of the family Bombycidae. At present, a list of occurrences of unearthed early silk thread, textile and terracotta figures of China suggests that wild silk has been widely used for weave in Yangtze river and Yellow River basin at least 5000 cal yr BP. On the other hand, the earliest silk fabric out China is from the earliest civilization Harappa site (4500-4000 cal a BP) that confirmed the early use of wild silkworms in South Asia.. In addition, in the Egyptian Deir al Medina relics site, the unearthed silk also as old as nearly 3000 cal a BP, and a serials of pre-han silk also unearthed 3000-2500 cal a BP in Europe. But, the appearance of these out-China silk is usually considered to be the result of the early trade or wild silkmoth products. Here we present a synthesis study of chronology, entomology, protein group, the paleoethnobotany form three Bronze Age site (Sapalli, Jarzgudan, Molleli) concerning on the paleo environment, agriculture gardening, and the possible mulberry silkworm utilization in Bronze Age Tensoxiana 4000 cal a BP. Together with archaeobotany and chronology data from Xinjiang, Hexi corridor and the Loess Plateau in China, we analysis the status of the mulberry silk factory in Bronze Age in Transoxiana and it possible connection to ancient China.
Feurdean, Angelica; Veski, Siim; Florescu, Gabriela; Vannière, Boris; Pfeiffer, Mirjam; O'Hara, Robert B.; Stivrins, Normunds; Amon, Leeli; Heinsalu, Atko; Vassiljev, Jüri; Hickler, Thomas
2017-08-01
Disturbances by fire are essential for the functioning of boreal/hemiboreal forests, but knowledge of long-term fire regime dynamics is limited. We analysed macrocharcoal morphologies and pollen of a sediment record from Lake Lielais Svētiņu (eastern Latvia), and in conjunction with fire traits analysis present the first record of Holocene variability in fire regime, fuel sources and fire types in boreal forests of the Baltic region. We found a phase of moderate to high fire activity during the cool and moist early (mean fire return interval; mFRI of ∼280 years; 11,700-7500 cal yr BP) and the late (mFRI of ∼190 years; 4500-0 cal yr BP) Holocene and low fire activity (mFRI of ∼630 years) during the Holocene Thermal Optimum (7500-4500 cal yr BP). Charcoal morphotypes and the pollen record show the predominance of frequent surface fires, occasionally transitioning to the crown during Pinus sylvestris-Betula boreal forests and less frequent surface fires during the dominance of temperate deciduous forests. In contrast to the prevailing opinion that fires in boreal forests are mostly low to moderate severity surface fires, we found evidence for common occurrence of stand-replacing crown fires in Picea abies canopy. Our results highlight that charcoal morphotypes analysis allows for distinguishing the fuel types and surface from crown fires, therefore significantly advancing our interpretation of fire regime. Future warmer temperatures and increase in the frequency of dry spells and abundant biomass accumulation can enhance the fire risk on the one hand, but will probably promote the expansion of broadleaf deciduous forests to higher latitudes, on the other hand. By highlighting the capability of broadleaf deciduous forests to act as fire-suppressing landscape elements, our results suggest that fire activity may not increase in the Baltic area under future climate change.
The Glacial and Relative Sea Level History of Southern Banks Island, NT, Canada
Vaughan, Jessica Megan
The mapping and dating of surficial glacial landforms and sediments across southern Banks Island document glaciation by the northwest Laurentide Ice Sheet (LIS) during the last glacial maximum. Geomorphic landforms confirm the operation of an ice stream at least 1000 m thick in Amundsen Gulf that was coalescent with thin, cold-based ice crossing the island's interior, both advancing offshore onto the polar continental shelf. Raised marine shorelines across western and southern Banks Island are barren, recording early withdrawal of the Amundsen Gulf Ice Stream prior to the resubmergence of Bering Strait and the re-entry of Pacific molluscs ~13,750 cal yr BP. This withdrawal resulted in a loss of ~60,000 km2 of ice --triggering drawdown from the primary northwest LIS divide and instigating changes in subsequent ice flow. The Jesse moraine belt on eastern Banks Island records a lateglacial stillstand and/or readvance of Laurentide ice in Prince of Wales Strait (13,750 -- 12,750 cal yr BP). Fossiliferous raised marine sediments that onlap the Jesse moraine belt constrain final deglaciation to ~12,600 cal yr BP, a minimum age for the breakup of the Amundsen Gulf Ice Stream. The investigation of a 30 m thick and 6 km wide stratigraphic sequence at Worth Point, southwest Banks Island, identifies an advance of the ancestral LIS during the Mid-Pleistocene (sensu lato), substantially diversifying the glacial record on Banks Island. Glacial ice emplaced during this advance has persisted through at least two glacial-interglacial cycles, demonstrating the resilience of circumpolar permafrost. Pervasive deformation of the stratigraphic sequence also records a detailed history of glaciotectonism in proglacial and subglacial settings that can result from interactions between cold-based ice and permafrost terrain. This newly recognized history rejects the long-established paleoenvironmental model of Worth Point that assumed a simple 'layer-cake' stratigraphy.
Curry, B Brandon; Henne, Paul; Mezquita-Joanes, Francesc; Marrone, Federico; Pieri, Valentina; La Mantia, Tommaso; Calo, Camilla; Tinner, Willy
2016-01-01
Marked uncertainties persist regarding the climatic evolution of the Mediterranean region during the Holocene. For instance, whether moisture availability gradually decreased, remained relatively constant, or increased during the last 7000 years remains a matter of debate. To assess Holocene limnology, hydrology and moisture dynamics, the coastal lakes Lago Preola and Gorgo Basso, located in southwestern Sicily, were investigated through several stratigraphic analyses of ostracodes, including multivariate analyses of assemblages, transfer functions of salinity, and biochemical analyses of valves (Sr/Ca, δ18O and δ13C). During the early Holocene, the Gorgo Basso and Lago Preola ostracode records are similar. After an initial period of moderate salinity (1690–6100 mg/l from ca. 10,000–8190 cal yr BP), syndepositional or diagenetic dissolution of ostracode valves suggests that salinity declined to Greek civilization took root in Sicily (2600 cal yr BP), and it completely dominates the record during Roman occupation (roughly 2100 to 1700 cal yr BP). These freshwater conditions at Gorgo Basso suggest high effective moisture when evergreen olive-oak forests collapsed in response to increased Greco-Roman land use and fire. Ostracode valve geochemistry (Sr/Ca, δ18O) suggests significant changes in early vs. late Holocene hydrochemistry, either as changes in salinity or in the seasonality of precipitation. Harmonizing the autecological and geochemical data from Gorgo Basso suggests the latter was more likely, with relatively more late Holocene precipitation falling during the spring, summer, and fall, than winter compared to the early Holocene. Our ostracode-inferred paleosalinity data indicate that moisture availability did not decline during the late Holocene in the central Mediterranean region. Instead, moisture availability was lowest during the early Holocene, and most abundant during the late Holocene.
Late Glacial and Holocene Climate Change in the subantarctic Auckland Islands
Gilmer, G.; Moy, C. M.; Vandergoes, M.; Gadd, P.; Riesselman, C. R.; Jacobsen, G. E.; Wilson, G. S.; Visinand, C.
2017-12-01
Situated within the core of the Southern Hemisphere westerly winds, and between the subtropical and subantarctic fronts, the New Zealand subantarctic islands are uniquely positioned to evaluate past ocean and atmospheric change in the middle to high southern latitudes. We collected a series of sediment cores from Auckland Island fjords to produce a high-resolution record of climate change following the Last Glacial Maximum. Physical property and organic geochemical data, Itrax XRF, and visual core descriptions indicate the cores capture several phases of sedimentation. From these studies, we identify four primary sedimentary facies: 1) a deglacial facies exhibiting mm-scale laminae defined by magnetic susceptibility and density contrasts and high counts of elements associated with terrigenous sources; 2) a lacustrine facies defined by very low density, high organic carbon concentrations and low counts of lithophilic elements; 3) a marine transgression facies with moderate density, moderate bioturbation and alternating marine and lacustrine sedimentary components; 4) a marine facies that contains biogenic carbonate. Radiocarbon results indicate deglacial sedimentation was underway in the basin by approximately 19,000 cal yr BP. Lacustrine deposition in ice-free conditions began around 15,600 cal yr BP and continued until marine transgression at approximately 9,500 cal yr BP. During the early Holocene between 11 and 9.5 ka, we observe elevated n-alkane δD values and an overall increase in redox-sensitive elements that signal a combination of warmer atmospheric temperatures and reduced westerly wind strength that drives fjord stratification. Poleward-shifted westerlies south of the Auckland Islands could accommodate these results, but there are few records to corroborate this interpretation. We will discuss these results within the context of developing New Zealand and subantarctic paleoclimate records in order to provide a more comprehensive record of past change.
Lacustrine evidence of Holocene environmental change from three Faroese lakes:
DEFF Research Database (Denmark)
Olsen, Jesper; Björck, Svante; Leng, Melanie
2010-01-01
,000 cal yr BP when grasses, sedges and finally shrubs began to dominant the islands. Here we present data from three lake sediment cores and show a much more detailed history from geochemical and isotope data. These data show that the Faroe Islands were deglaciated by the end of Younger Dryas (11,700 e 10...
A Late Glacial to Holocene record of environmental change from Lake Dojran (Macedonia, Greece
Directory of Open Access Journals (Sweden)
A. Francke
2013-02-01
Full Text Available A Late Glacial to Holocene sediment sequence (Co1260, 717 cm from Lake Dojran, located at the boarder of the F.Y.R. of Macedonia and Greece, has been investigated to provide information on climate variability in the Balkan region. A robust age-model was established from 13 radiocarbon ages, and indicates that the base of the sequence was deposited at ca. 12 500 cal yr BP, when the lake-level was low. Variations in sedimentological (H2O, TOC, CaCO3, TS, TOC/TN, TOC/TS, grain-size, XRF, δ18Ocarb, δ13Ccarb, δ13Corg data were linked to hydro-acoustic data and indicate that warmer and more humid climate conditions characterised the remaining period of the Younger Dryas until the beginning of the Holocene. The Holocene exhibits significant environmental variations, including the 8.2 and 4.2 ka cooling events, the Medieval Warm Period and the Little Ice Age. Human induced erosion processes in the catchment of Lake Dojran intensified after 2800 cal yr BP.
CalSimHydro Tool - A Web-based interactive tool for the CalSim 3.0 Hydrology Prepropessor
Li, P.; Stough, T.; Vu, Q.; Granger, S. L.; Jones, D. J.; Ferreira, I.; Chen, Z.
2011-12-01
CalSimHydro, the CalSim 3.0 Hydrology Preprocessor, is an application designed to automate the various steps in the computation of hydrologic inputs for CalSim 3.0, a water resources planning model developed jointly by California State Department of Water Resources and United States Bureau of Reclamation, Mid-Pacific Region. CalSimHydro consists of a five-step FORTRAN based program that runs the individual models in succession passing information from one model to the next and aggregating data as required by each model. The final product of CalSimHydro is an updated CalSim 3.0 state variable (SV) DSS input file. CalSimHydro consists of (1) a Rainfall-Runoff Model to compute monthly infiltration, (2) a Soil moisture and demand calculator (IDC) that estimates surface runoff, deep percolation, and water demands for natural vegetation cover and various crops other than rice, (3) a Rice Water Use Model to compute the water demands, deep percolation, irrigation return flow, and runoff from precipitation for the rice fields, (4) a Refuge Water Use Model that simulates the ponding operations for managed wetlands, and (5) a Data Aggregation and Transfer Module to aggregate the outputs from the above modules and transfer them to the CalSim SV input file. In this presentation, we describe a web-based user interface for CalSimHydro using Google Earth Plug-In. The CalSimHydro tool allows users to - interact with geo-referenced layers of the Water Budget Areas (WBA) and Demand Units (DU) displayed over the Sacramento Valley, - view the input parameters of the hydrology preprocessor for a selected WBA or DU in a time series plot or a tabular form, - edit the values of the input parameters in the table or by downloading a spreadsheet of the selected parameter in a selected time range, - run the CalSimHydro modules in the backend server and notify the user when the job is done, - visualize the model output and compare it with a base run result, - download the output SV file to be
Cong, Jinxin; Gao, Chuanyu; Zhang, Yan; Zhang, Shaoqing; He, Jiabao; Wang, Guoping
2016-01-01
Dating the start of intensive anthropogenic influence on ecosystems is important for identifying the conditions necessary for ecosystem recovery. However, few studies have focused on determining when anthropogenic influences on wetland began through sedimentary archives. To fill this critical gap in our knowledge, combustion sources and emission intensities, reconstructed via black carbon (BC) and polycyclic aromatic hydrocarbons (PAHs) were analyzed in two wetlands in the Sanjiang Plain in Northeast China. 14C provided age control for the sedimentary records. By combining previous sedimentary and archaeological studies, we attempt to date the beginning of intensive anthropogenic influences on the Sanjiang Plain. Our results showed that BC deposition fluxes increased from 0.02 to 0.7 g C/m2.yr during the last 10,000 years. An upward trend was apparent during the last 500 years. Before 1200 cal yr BP, human activities were minor, such that the wetland ecosystem in the Sanjiang Plain before this period may represent the reference conditions that for the recovery of these wetlands. As the human population increased after 1200 cal yr BP, combustion sources changed and residential areas became a major source of BC and PAHs. In this way, the wetland ecosystem gradually became more heavily influenced by human activities. PMID:26907560
Cong, Jinxin; Gao, Chuanyu; Zhang, Yan; Zhang, Shaoqing; He, Jiabao; Wang, Guoping
2016-02-01
Dating the start of intensive anthropogenic influence on ecosystems is important for identifying the conditions necessary for ecosystem recovery. However, few studies have focused on determining when anthropogenic influences on wetland began through sedimentary archives. To fill this critical gap in our knowledge, combustion sources and emission intensities, reconstructed via black carbon (BC) and polycyclic aromatic hydrocarbons (PAHs) were analyzed in two wetlands in the Sanjiang Plain in Northeast China. 14C provided age control for the sedimentary records. By combining previous sedimentary and archaeological studies, we attempt to date the beginning of intensive anthropogenic influences on the Sanjiang Plain. Our results showed that BC deposition fluxes increased from 0.02 to 0.7 g C/m2.yr during the last 10,000 years. An upward trend was apparent during the last 500 years. Before 1200 cal yr BP, human activities were minor, such that the wetland ecosystem in the Sanjiang Plain before this period may represent the reference conditions that for the recovery of these wetlands. As the human population increased after 1200 cal yr BP, combustion sources changed and residential areas became a major source of BC and PAHs. In this way, the wetland ecosystem gradually became more heavily influenced by human activities.
Ramos-Román, María J.; Jiménez-Moreno, Gonzalo; Camuera, Jon; García-Alix, Antonio; Anderson, R. Scott; Jiménez-Espejo, Francisco J.; Sachse, Dirk
2017-04-01
The Iberian Peninsula, located in the Mediterranean area, is an interesting location for paleoclimate studies due to its geographic situation between arid and humid climates. Sediments from peat bogs and lakes from Sierra Nevada, in southeastern Iberian Peninsula, have been very informative in terms of how vegetation and wetland environments were impacted by Holocene climate change. These studies are essential if we want to understand the past climate change in the area, which is the key to identify the possible environmental response of the Sierra Nevada ecosystems to future climate scenarios. Padul basin, located in the southwest of the Sierra Nevada mountain range, contains a ca. 100 m-thick peat bog sedimentary sequence that was deposited during the past 1 Ma making this area interesting for paleoenvironmental and paleoclimatic reconstructions. A new 43 m-long sedimentary record has recently been retrieved from the Padul peat bog. In this study we have developed a multiproxy analysis of the Holocene part of the Padul-15-05 core including pollen analysis, XRF-core scanner, magnetic susceptibility and organic geochemistry, supported by an age control based on AMS radiocarbon dates, providing with information about vegetation and climate variability during the past 9.9 cal ka BP. This multiproxy reconstruction of the Padul-15-05 evidences the Mediterranean as a sensitive area with respect to global-scale climate system, showing relevant climate episodes such as the ca. 8, 7.5, 6.5 and 5.5 cal ka BP events during the early and middle Holocene. The trend to aridification to the late Holocene is interrupted by more arid and humid periods as the Iberian Roman Humid Period (from ca. 3 to 1.6 cal ka BP), the Dark Ages (from ca. 1.5 to 1.1 cal ka BP), the Medieval Climate Anomaly (from ca. 1.1 to 1.3 cal ka BP) and the Little Ice Age period (from ca. 500 to 100 cal yr BP).
Timing of Late Holocene surface rupture of the Wairau Fault, Marlborough, New Zealand
International Nuclear Information System (INIS)
Zachariasen, J.; Berryman, K.R.; Langridge, R.M.; Prentice, C.; Rymer, M.; Stirling, M.W.; Villamor, P.
2006-01-01
Three trenches excavated across the central portion of the right-lateral strike-slip Wairau Fault in South Island, New Zealand, exposed a complex set of fault strands that have displaced a sequence of late Holocene alluvial and colluvial deposits. Abundant charcoal fragments provide age control for various stratigraphic horizons dating back to c. 5610 yr ago. Faulting relations from the Wadsworth trench show that the most recent surface rupture event occurred at least 1290 yr and at most 2740 yr ago. Drowned trees in landslide-dammed Lake Chalice, in combination with charcoal from the base of an unfaulted colluvial wedge at Wadsworth trench, suggest a narrower time bracket for this event of 1811-2301 cal. yr BP. The penultimate faulting event occurred between c. 2370 and 3380 yr, and possibly near 2680 ± 60 cal. yr BP, when data from both the Wadsworth and Dillon trenches are combined. Two older events have been recognised from Dillon trench but remain poorly dated. A probable elapsed time of at least 1811 yr since the last surface rupture, and an average slip rate estimate for the Wairau Fault of 3-5 mm/yr, suggests that at least 5.4 m and up to 11.5 m of elastic shear strain has accumulated since the last rupture. This is near to or greater than the single-event displacement estimates of 5-7 m. The average recurrence interval for surface rupture of the fault determined from the trench data is 1150-1400 yr. Although the uncertainties in the timing of faulting events and variability in inter-event times remain high, the time elapsed since the last event is in the order of 1-2 times the average recurrence interval, implying that the Wairau Fault is near the end of its interseismic period. (author). 44 refs., 10 figs., 1 tab
Stroup, J. S.; Kelly, M. A.; Lowell, T. V.; Beal, S. A.; Smith, C. A.; Baranes, H. E.
2012-12-01
The past fluctuations of Quelccaya Ice Cap, (QIC; 13°S, 70°W, 5200 m asl) located in the southeastern Peruvian Andes, provide a record of tropical climate since the last glacial-interglacial transition. A detailed surficial geomorphic record of past glacial extents developed over the last several decades (e.g. Mercer and Palacios 1977; Buffen et al. 2009; Kelly et al. 2012 accepted) demonstrates that QIC is a dynamic glacial system. These records show that the ice cap was larger than present and retreating by ~11,500 yr BP, and smaller than present between ~7,000 and ~4,600 yr BP. The most recent advance occurred during the late Holocene (Little Ice Age;LIA), dated with 10Be surface exposure ages (510±90 yrs (n = 8)) (Stroup et al. in prep.). This overrode earlier deposits obscuring a complete Holocene record; we aim to address the gaps in glacial chronology using the sedimentary record archived in lakes. We retrieved two sets cores (8 and 5 m-long) from Laguna Challpacocha (13.91°S, 70.86°W, 5040 m asl), a lake that currently receives meltwater from QIC. Four radiocarbon ages from the cores suggest a continuous record dating to at least ~10,500 cal. yr BP. Variations in magnetic susceptibility, percent organic and inorganic carbon, bulk density, grayscale and X-ray fluorescence chemistry indicate changes in the amount of clastic sediment deposition. We interpret clastic sediments to have been deposited from ice cap meltwater, thus indicating more extensive ice. Clastic sediments compose the top of the core from 4 to 30 cm depth, below there is a sharp transition to organic sediments radiocarbon dated to (500±30 and 550±20 cal. yr BP). The radiocarbon ages are similar to the 10Be dated (LIA) glacial position. At least three other clastic units exist in the core; dating to ~2600-4300, ~4800-7300 and older then ~10,500 cal. yr BP based on a linear age model with four radiocarbon dates. We obtained two, ~4 m long, cores from Laguna Yanacocha (13.95°S,70.87
Holocene Evolution of Qing'ao Embayment, Southern China
Switzer, A. D.; Yu, F.; Chen, B.; Zheng, Z.; Wang, D.
2012-12-01
The Holocene evolution of the Qing'ao embayment, Nan'ao Island, southern China, is primarily the result of the interaction of tectonic activity, climate variation and changes in relative sea level. Characterizing the evolutionary history of the relatively small Qing'ao embayment during the Holocene will help improve our understanding of the driving mechanisms of coastal evolution in the area. To reconstruct the Holocene evolution history we analyzed the grain size, loss on ignition (LOI) and carbonate content of modern and core samples. Modern environmental analogs were examined in surface samples ranging from the coastal sand dunes through to offshore. The results of these modern samples suggest that dune sand (mean size of ~2.33Phi) are slightly finer than beach sand (mean size of 2.13Phi), and nearshore sediment is much coarser than offshore sediment (mean size of 5.90Phi). This modern analogs were then applied to 8 percussion cores from the Qing'ao embayment. A chronological framework obtained from 11 radiocarbon samples suggests that the embayment started to accept deposition since early Holocene, ~8500 cal. yr. BP. Three main phases of Holocene evolution were identified. A basin wide shell-rich sand sheet forms the basal Holocene facies and overlies clay rich presumably Pleistocene sediments or bedrock. This facies records an initial sedimentation phase associated with the early Holocene transgression into the embayment (~8500-6000 cal. yr. BP). The basal facies grades upward to a mixed sandy-mud facies which includes lagoonal clayey-silts, flood tide delta sands and records an estuarine phase lasting from ~6000-1000 cal. yr. BP that appears coincident with falling regional sea levels. Coincident with the estuarine phase is a period of coastal dune building recorded as yet undated massive sands that are found in the upper fill. Toward the end of the estuarine phase it is apparent that dune migration has restricted the lagoon entrance and that this was
Human (Clovis)-gomphothere (Cuvieronius sp.) association ∼13,390 calibrated yBP in Sonora, Mexico
Sanchez, Guadalupe; Holliday, Vance T.; Gaines, Edmund P.; Arroyo-Cabrales, Joaquín; Martínez-Tagüeña, Natalia; Kowler, Andrew; Lange, Todd; Hodgins, Gregory W. L.; Mentzer, Susan M.; Sanchez-Morales, Ismael
2014-07-01
The earliest known foragers to populate most of North America south of the glaciers [∼11,500 to ≥ ∼10,800 14C yBP; ∼13,300 to ∼12,800 calibrated (Cal) years] made distinctive "Clovis" artifacts. They are stereotypically characterized as hunters of Pleistocene megamammals (mostly mammoth) who entered the continent via Beringia and an ice-free corridor in Canada. The origins of Clovis technology are unclear, however, with no obvious evidence of a predecessor to the north. Here we present evidence for Clovis hunting and habitation ∼11,550 yBP (∼13,390 Cal years) at "El Fin del Mundo," an archaeological site in Sonora, northwestern Mexico. The site also includes the first evidence to our knowledge for gomphothere (Cuvieronius sp.) as Clovis prey, otherwise unknown in the North American archaeological record and terminal Pleistocene paleontological record. These data (i) broaden the age and geographic range for Clovis, establishing El Fin del Mundo as one of the oldest and southernmost in situ Clovis sites, supporting the hypothesis that Clovis had its origins well south of the gateways into the continent, and (ii) expand the make-up of the North American megafauna community just before extinction.
DEFF Research Database (Denmark)
Noe-Nygaard, Nanna; Milàn, Jesper; Hede, Mikkel Ulfeldt
2005-01-01
,000 to around 8,000 cal yr BP years. The basin sedimentation starts with old melt water deposits just below the Bølling Interstadial (GI 1-e), followed by older Dryas (GI 1-d), Allerød, (GI 1-c, 1-b, 1-a) and Younger Dryas (GS 1) which terminates the Late Glacial succession. Preboreal algal gyttja and near...
Roverato, M.; Capra, L.; Sulpizio, R.; Norini, G.
2011-10-01
Throughout its history, Colima Volcano has experienced numerous partial edifice collapses with associated emplacement of debris avalanche deposits of contrasting volume, morphology and texture. A detailed stratigraphic study in the south-eastern sector of the volcano allowed the recognition of two debris avalanche deposits, named San Marcos (> 28,000 cal yr BP, V = ~ 1.3 km 3) and Tonila (15,000-16,000 cal yr BP, V = ~ 1 km 3 ). This work sheds light on the pre-failure conditions of the volcano based primarily on a detailed textural study of debris avalanche deposits and their associated pyroclastic and volcaniclastic successions. Furthermore, we show how the climate at the time of the Tonila collapse influenced the failure mechanisms. The > 28,000 cal yr BP San Marcos collapse was promoted by edifice steep flanks and ongoing tectonic and volcanotectonic deformation, and was followed by a magmatic eruption that emplaced pyroclastic flow deposits. In contrast, the Tonila failure occurred just after the Last Glacial Maximum (22,000-18,000 cal BP) and, in addition to the typical debris avalanche textural characteristics (angular to sub-angular clasts, coarse matrix, jigsaw fit) it shows a hybrid facies characterized by debris avalanche blocks embedded in a finer, homogenous and partially cemented matrix, a texture more characteristic of debris flow deposits. The Tonila debris avalanche is directly overlain by a 7-m thick hydromagmatic pyroclastic succession. Massive debris flow deposits, often more than 10 m thick and containing large amounts of tree trunk logs, represent the top unit in the succession. Fluvial deposits also occur throughout all successions; these represent periods of highly localized stream reworking. All these lines of evidence point to the presence of water in the edifice prior to the Tonila failure, suggesting it may have been a weakening factor. The Tonila failure appears to represent an anomalous event related to the particular climatic
International Nuclear Information System (INIS)
Horrocks, M.; Nichol, S.L.; Jones, M.D.; Shane, P.A.; Sutton, D.G.
2001-01-01
We present preliminary results of a pollen study examining spatial variability using the 665 14 C yr BP Kaharoa tephra as the key stratigraphic marker. Our aim is to highlight potential differences in pollen and charcoal profiles from adjacent sites, and to point out the implications of these differences for the interpretation of pollen records. Three sediment cores were taken from swampy ground behind foredunes at Harataonga Bay, a small catchment on Great Barrier Island. Core 1 provides a c. 5000 14 C yr record of the swamp and is typical of northern New Zealand pollen profiles in that the deforestation signal appears immediately after Kaharoa tephra. Cores 2 and 3, however, show this signal at least 1 m below the tephra layer. Also, artefact pollen of gourd Lagenaria, an introduced Polynesian cultigen, was found 80 cm below the tephra layer in Core 2. This apparent difference in the timing of the human signal may be explained by the occurrence of small-scale, highly localised fires that are not recorded at adjacent sites. This has implications for inferring date of human presence in extensive areas, such as regions or large catchments, from a small number of pollen cores taken from within those areas. An alternative explanation is that sediments in cores 2 and 3 have been reworked to a much greater extent than those in Core 1. This has implications for the use of tephra as critical data for events, particularly when using recent tephra such as Kaharoa for dating human presence when the necessary resolution is to decades or centuries rather than millenia. (author). 18 refs., 6 figs., 2 tabs
Johnson, Christopher S.; Miller, Kenneth G.; Browning, James V.; Kopp, Robert E.; Khan, Nicole S.; Fan, Ying; Stanford, Scott D.; Horton, Benjamin P.
2018-02-01
The rate of relative sea-level (RSL) rise at Sandy Hook, NJ (4.0 ± 0.5 mm/yr) was higher than The Battery, NY (3.0 ± 0.3 mm/yr) from 1900 to 2012 despite being separated by just 26 km. The difference cannot be explained by differential glacial isostatic adjustment (GIA; 1.4 ± 0.4 and 1.3 ± 0.4 mm/yr RSL rise, respectively) alone. We estimate the contribution of sediment compaction to subsidence at Sandy Hook using high-resolution grain size, percent organic matter, and porosity data from three upper Quaternary (≤13,350 cal yr) cores. The organic matter content (indicates that compaction of deglacial silts likely reduced the column thickness by 10-20% over the past 13,350 cal yrs. While compaction rates were high immediately after the main silt deposition (13,350-13,150 cal yrs BP), rates decreased exponentially after deposition to an average 20th century rate of 0.16 mm/yr (90% Confidence Interval (C.I.), 0.06-0.32 mm/yr). The remaining ∼0.7 mm/yr (90% C.I. 0.3-1.2 mm/yr) difference in subsidence between Sandy Hook and The Battery is likely due to anthropogenic groundwater withdrawal. Historical data from Fort Hancock wells (2 km to the southeast of the Sandy Hook tide gauge) and previous regional work show that local and regional water extraction lowered the water levels in the aquifers underlying Sandy Hook. We suggest that the modern order of contribution to subsidence (highest to lowest) appears to be GIA, local/regional groundwater extraction, and compaction of thick Quaternary silts.
Human (Clovis)–gomphothere (Cuvieronius sp.) association ∼13,390 calibrated yBP in Sonora, Mexico
Sanchez, Guadalupe; Holliday, Vance T.; Gaines, Edmund P.; Arroyo-Cabrales, Joaquín; Martínez-Tagüeña, Natalia; Kowler, Andrew; Lange, Todd; Hodgins, Gregory W. L.; Mentzer, Susan M.; Sanchez-Morales, Ismael
2014-01-01
The earliest known foragers to populate most of North America south of the glaciers [∼11,500 to ≥ ∼10,800 14C yBP; ∼13,300 to ∼12,800 calibrated (Cal) years] made distinctive “Clovis” artifacts. They are stereotypically characterized as hunters of Pleistocene megamammals (mostly mammoth) who entered the continent via Beringia and an ice-free corridor in Canada. The origins of Clovis technology are unclear, however, with no obvious evidence of a predecessor to the north. Here we present evidence for Clovis hunting and habitation ∼11,550 yBP (∼13,390 Cal years) at “El Fin del Mundo,” an archaeological site in Sonora, northwestern Mexico. The site also includes the first evidence to our knowledge for gomphothere (Cuvieronius sp.) as Clovis prey, otherwise unknown in the North American archaeological record and terminal Pleistocene paleontological record. These data (i) broaden the age and geographic range for Clovis, establishing El Fin del Mundo as one of the oldest and southernmost in situ Clovis sites, supporting the hypothesis that Clovis had its origins well south of the gateways into the continent, and (ii) expand the make-up of the North American megafauna community just before extinction. PMID:25024193
A New Appraisal of Northern Peatlands and Global Atmospheric Methane Over the Holocene
MacDonald, G. M.; Holmquist, J. R.; Kremenetski, K.; Loisel, J.
2015-12-01
Use of large databases of peat cores to examine linkages between northern peatlands and atmospheric CH4 over the Holocene has been prone to uncertainties regarding 1. comparability of radiocarbon techniques and material dated, 2. appropriate summed probability distributions, 3. spatial representativeness of the sites, particularly in capturing sites south of the subarctic, 4. potential impacts of local lateral peatland expansion versus continental-scale peatland initiation, particularly in the late Holocene, and 5. impacts of changes in the proportion of high methane-producing fens vs Sphagnum bogs. We present a comparison of radiocarbon measurements from conventional counts, atomic mass spectrometry and differing peat materials to demonstrate a general compatibility of the various types of dates. We compare and apply several summed probability distribution methods to minimize any statistical bias in our analysis. We then present our analysis of a new data set of 7571 peatland cores from 4420 sites that extend into the temperate zone. Of these, 3732 cores inform on lateral expansion and 329 dates constrain the timing of fen-bog transition. Based on these data in original and gridded form we show that widespread peat initiation commenced at 16 kcal yr BP and reached a maximum rate at 11-8 kcal yr BP. Most sites began as fens, and peak transition to bogs occurred between 5 and 3 kcal yr BP, with a 1000 year lag between Eurasia and North America. There is no global late Holocene increase in lateral expansion. Based on modeled northern peatland area and ratio of fen/bog sites, CH4 production from northern peatlands increased rapidly from 11 to 9 cal yr BP, followed by slower increase until reaching a maximum at 5 kcal yr BP at 25 Tg per yr. From 4 kcal yr BP to Present, bogs become a dominant feature in the northern peatland landscape and CH4 production decreased to reach modern-day levels at about 20 Tg per yr. Northern peatlands have been a key infleunce on global
Sottile, G. D.; Echeverria, M. E.; Mancini, M. V.; Bianchi, M. M.; Marcos, M. A.; Bamonte, F. P.
2015-06-01
The Southern Hemisphere Westerly Winds (SWW) constitute an important zonal circulation system that dominates the dynamics of Southern Hemisphere mid-latitude climate. Little is known about climatic changes in the Southern South America in comparison to the Northern Hemisphere due to the low density of proxy records, and adequate chronology and sampling resolution to address environmental changes of the last 2000 years. Since 2009, new pollen and charcoal records from bog and lakes in northern and southern Patagonia at the east side of the Andes have been published with an adequate calibration of pollen assemblages related to modern vegetation and ecological behaviour. In this work we improve the chronological control of some eastern Andean previously published sequences and integrate pollen and charcoal dataset available east of the Andes to interpret possible environmental and SWW variability at centennial time scales. Through the analysis of modern and past hydric balance dynamics we compare these scenarios with other western Andean SWW sensitive proxy records for the last 2000 years. Due to the distinct precipitation regimes that exist between Northern (40-45° S) and Southern Patagonia (48-52° S) pollen sites locations, shifts on latitudinal and strength of the SWW results in large changes on hydric availability on forest and steppe communities. Therefore, we can interpret fossil pollen dataset as changes on paleohydric balance at every single site by the construction of paleohydric indices and comparison to charcoal records during the last 2000 cal yrs BP. Our composite pollen-based Northern and Southern Patagonia indices can be interpreted as changes in latitudinal variation and intensity of the SWW respectively. Dataset integration suggest poleward SWW between 2000 and 750 cal yrs BP and northward-weaker SWW during the Little Ice Age (750-200 cal yrs BP). These SWW variations are synchronous to Patagonian fire activity major shifts. We found an in phase
Collins, S. V.; Reinhardt, E. G.; Rissolo, D.; Chatters, J. C.; Nava Blank, A.; Luna Erreguerena, P.
2015-09-01
The skeletal remains of a Paleoamerican (Naia; HN5/48) and extinct megafauna were found at -40 to -43 mbsl in a submerged dissolution chamber named Hoyo Negro (HN) in the Sac Actun Cave System, Yucatan Peninsula, Mexico. The human remains were dated to between 12 and 13 Ka, making these remains the oldest securely dated in the Yucatan. Twelve sediment cores were used to reconstruct the Holocene flooding history of the now phreatic cave passages and cenotes (Ich Balam, Oasis) that connect to HN. Four facies were found: 1. bat guano and Seed (SF), 2. lime Mud (MF), 3. Calcite Rafts (CRF) and 4. Organic Matter/Calcite Rafts (OM/CRF) which were defined by their lithologic characteristics and ostracod, foraminifera and testate amoebae content. Basal radiocarbon ages (AMS) of aquatic sediments (SF) combined with cave bottom and ceiling height profiles determined the history of flooding in HN and when access was restricted for human and animal entry. Our results show that the bottom of HN was flooded at least by 9850 cal yr BP but likely earlier. We also found, that the pit became inaccessible for human and animal entry at ≈8100 cal yr BP, when water reaching the cave ceiling effectively prevented entry. Water level continued to rise between ≈6000 and 8100 cal yr BP, filling the cave passages and entry points to HN (Cenotes Ich Balam and Oasis). Analysis of cave facies revealed that both Holocene sea-level rise and cave ceiling height determined the configuration of airways and the deposition of floating and bat derived OM (guano and seeds). Calcite rafts, which form on the water surface, are also dependent on the presence of airways but can also form in isolated air domes in the cave ceiling that affect their loci of deposition on the cave bottom. These results indicated that aquatic cave sedimentation is transient in time and space, necessitating extraction of multiple cores to determine a limit after which flooding occurred.
International Nuclear Information System (INIS)
Gibert, E.; Massault, M.; Travi, Y.; Chernet, T.
2002-01-01
Due to the sensitivity of its regional climate to the African monsoon seasonal shifting, Ethiopia has been designated as a key site for palaeoenvironmental reconstructions mainly within the IGBP-PAGES-PEPIII programme. Under the French-Ethiopian ERICA project, we focused on Lake Abiyata located in the Ziway-Shala basin (Central Ethiopia) which has experienced several lacustrine highstands during the Late Pleistocene and Holocene. At present, Lake Abiyata is a closed lake with a very flat catchment area, and corresponds to a half, deep graben infilled by 600-m of sedimentary deposits. In 1995, a 12.6-m-long sequence ABII was cored in Lake Abiyata. A reliable 14 C-AMS chronology was defined on both organic matter and inorganic carbonates. Both the modern hydrologeological and geochemical balances of the 'groundwater-lake' system indicate that (i) carbonate cristallization mainly occurs at the water-sediment interface via the mixing of lake water and 14 C-depleted groundwaters, and that (ii) modern algae form in equilibrium with the atmospheric reservoir. Phytoplankton is thus considered as an authigenic material, and Core ABII has registered 13,500 cal. yr B.P. of environmental history. The evidence of calcite precipitation at the water-sediment interface calls into question the direct palaeoclimatic reconstruction based on inorganic carbonates. Since the evolution of isotopic contents of carbonates might be linked to the variable proportion of the 'lake/groundwater' end-members in the mixing, calculations based on isotopic mass balance models may allow for the reconstruction of δ 18 O composition of the lake water. Two major changes can be highlighted: (i) the ∼12,000-5500 cal. yr B.P. period is associated to low 18 O contents of lake water, and corresponds to an open hydrological system, with a high lacustrine phytoplanktonic productivity, and (ii) from ∼5500 cal. yr B.P. to Present, regressive conditions are suggested by the δ 18 O enrichment of the lake
Cosmin Diaconu, Andrei; Feurdean, Angelica; Lamentowicz, Mariusz; Gałka, Mariusz; Tanţǎu, Ioan
2016-04-01
Knowledge of past local vs. regional hydro-climate variability is a priority in climate research. This is because ecosystems and human depend on local climatic conditions and the magnitude of these climate changes is more variable at local and regional rather than at global scales. Ombrotrophic bogs are highly suitable for hydro-climate reconstructions as they are entirely dependent on the water from precipitation. We used stratigraphy, radiocarbon dating, testate amoebae (TA) and plant macrofossils on a peat profile from an ombrotrophic bog (Tǎul Muced) located in the Biosphere Reserve of the Rodna National Park Romania. We performed quantitative reconstruction of the depth to water table (DWT) and pH over the last 8000 years in a continental area of CE Europe. We identified six main stages in the development of the bog based on changes in TA assemblages in time. Wet conditions and pH between 2 and 4.5 were recorded between 4600-2750 and 1300-400 cal. yr BP, by the occurrence of Archerella flavum, Amphitrema wrightianum and Hyalosphenia papilio. This was associated to a local vegetation primarily composed of Sphagnum magellanicum and S. angustifolium. Dry stages and pH of 2.5 to 5 were inferred between 7550-4600, 2750-1300 and -50 cal. yr BP, by the dominance of Nebela militaris, Difflugia pulex and Phryganella acropodia. These overall dry conditions were also connected with increased abundance of Eriophorum vaginatum. The period between 400 and -50 cal. yr BP was characterized by a rapid shift from dry to wet conditions on the surface of the bog. Vegetation shifted from Sphagnum magellanicum to Sphagnum russowii dominated community. Our reconstruction remains in relatively good agreement with other palaeohydrological records from Central Eastern Europe. However, it shows contrasting conditions to others particularly with records from NW Europe. The valuable information regarding bog hydrology offered by our record puts an accent on the need of more regional TA
DEFF Research Database (Denmark)
Olsen, Jesper; Kjær, Kurt H.; Funder, Svend Visby
2012-01-01
, Peary Land, Greenland. The early Holocene (10 850–10 480 cal. a BP) is characterized by increased erosion and gradually more marine conditions. Full marine conditions developed from 10 480 cal. a BP until the lake was isolated at 7220 cal. a BP. From its marine isolation at 7220 cal. a BP Bliss Lake...... becomes a lacustrine environment. Evidence from geochemical proxies (δ13C and total organic carbon) suggests that warmer conditions prevailed between 7220 and 6500 cal. a BP, corresponding to the Holocene thermal maximum, and from 3300 until 910 cal. a BP. From 850 to 500 cal. a BP colder climate...
Energy Technology Data Exchange (ETDEWEB)
Velasquez, Celestino; Cheng, Erdong; Shuda, Masahiro; Lee-Oesterreich, Paula J.; Pogge von Strandmann, Lisa; Gritsenko, Marina A.; Jacobs, Jon M.; Moore, Patrick S.; Chang, Yuan
2016-07-11
mTOR-directed 4E-BP1 phosphorylation promotes cap-dependent translation and tumorigen-esis. During mitosis, CDK1 substitutes for mTOR and fully phosphorylates 4E-BP1 at canoni-cal as well a non-canonical S83 site resulting in a mitosis-specific hyperphosphorylated δ isoform. Colocalization studies with a phospho-S83 specific antibody indicate that 4E-BP1 S83 phosphorylation accumulates at centrosomes during prophase, peaks at metaphase, and decreases through telophase. While S83 phosphorylation of 4E-BP1 does not affect in vitro cap-dependent translation, nor eIF4G/4E-BP1 cap-binding, expression of an alanine substitution mutant 4E-BP1.S83A partially reverses rodent cell transformation induced by Merkel cell polyomavirus (MCV) small T (sT) antigen viral oncoprotein. In contrast to inhibitory mTOR 4E-BP1 phosphorylation, these findings suggest that mitotic CDK1-directed phosphorylation of δ-4E-BP1 may yield a gain-of-function, distinct from translation regulation, that may be important in tumorigenesis and mitotic centrosome function.
Peros, Matthew; Collins, Shawn; G'Meiner, Anna Agosta; Reinhardt, Eduard; Pupo, Felipe Matos
2017-07-01
We use sediments from a flooded sinkhole (Cenote Jennifer) in northern Cuba to provide new, well-dated, high-resolution evidence for the 8.2 kyr event. From 7600 to 8700 cal yr B.P. the sinkhole contained shallow, low-salinity water, which supported a marsh dominated by cattail and grass. Peaks in Cl and Br—occurring at 8150, 8200, and 8250 cal yr B.P.—are attributable to increased evaporation due to regional drying associated with the 8.2 kyr event. The three peaks in these elements also closely correspond to the greyscale record from the Cariaco Basin, indicative of increased upwelling in the southern Caribbean Sea at this time, supporting the notion of a multistage 8.2 kyr event. Our work provides new data that help to clarify the initiation, behavior, and impacts of the 8.2 kyr event in the northern tropics.
Barnett, Elizabeth; Sherrod, Brian; Hughes, Jonathan F.; Kelsey, Harvey M.; Czajkowski, Jessica L.; Walsh, Timothy J.; Contreras, Trevor A.; Schermer, Elizabeth R.; Carson, Robert J.
2015-01-01
Trench and wetland coring studies show that northeast‐striking strands of the Saddle Mountain fault zone ruptured the ground about 1000 years ago, generating prominent scarps. Three conspicuous subparallel fault scarps can be traced for 15 km on Light Detection and Ranging (LiDAR) imagery, traversing the foothills of the southeast Olympic Mountains: the Saddle Mountain east fault, the Saddle Mountain west fault, and the newly identified Sund Creek fault. Uplift of the Saddle Mountain east fault scarp impounded stream flow, forming Price Lake and submerging an existing forest, thereby leaving drowned stumps still rooted in place. Stratigraphy mapped in two trenches, one across the Saddle Mountain east fault and the other across the Sund Creek fault, records one and two earthquakes, respectively, as faulting juxtaposed Miocene‐age bedrock against glacial and postglacial deposits. Although the stratigraphy demonstrates that reverse motion generated the scarps, slip indicators measured on fault surfaces suggest a component of left‐lateral slip. From trench exposures, we estimate the postglacial slip rate to be 0.2 mm/yr and between 0.7 and 3.2 mm/yr during the past 3000 years. Integrating radiocarbon data from this study with earlier Saddle Mountain fault studies into an OxCal Bayesian statistical chronology model constrains the most recent paleoearthquake age of rupture across all three Saddle Mountain faults to 1170–970 calibrated years (cal B.P.), which overlaps with the nearby Mw 7.5 1050–1020 cal B.P. Seattle fault earthquake. An earlier earthquake recorded in the Sund Creek trench exposure, dates to around 3500 cal B.P. The geometry of the Saddle Mountain faults and their near‐synchronous rupture to nearby faults 1000 years ago suggest that the Saddle Mountain fault zone forms a western boundary fault along which the fore‐arc blocks migrate northward in response to margin‐parallel shortening across the Puget Lowland.
Peñaranda García, Pilar
2012-01-01
En el presente trabajo se estudian el mortero de cal hidráulica y el mortero mixto de cal aérea y cemento Portland, siendo este último el más utilizado en la actualidad, ya que la cal ha pasado a un segundo plano en la construcción debido a los grandes avances en la producción de cemento a lo largo del siglo XX. Estos avances han desplazado a la cal, un material utilizado desde hace milenios, olvidando su alta resistencia al paso del tiempo, cuya prueba es el gran volumen de ...
Directory of Open Access Journals (Sweden)
E. A.A. Garcea
2013-03-01
Full Text Available The Sahara is more connected to the Mediterranean than often assumed and palynology, in particular, has provided evidence of past interrelations between the Mediterranean and the Sahara with pollen spectra from prehistoric Saharan deposits including Mediterranean taxa. In order to show human-environment relationships and populations’ strategies in response to changing environments, this paper presents a case study from the southern Sahara. This region offered a natural laboratory for the study of human/climate interaction as the range of environmental change extended from flood to drought, forcing people to cope with periodic environmental instability. When the tropical rainfall belt migrated northward, watertable outcropped in interdunal depressions and formed permanent lakes, which alternated with severe arid spells. As a case study, this paper presents the results of interdisciplinary investigations on climate changes, human adaptations and subsistence strategies at Gobero, in the southern Sahara of Niger. Gobero is a restricted archaeological area comprising 8 sites that surround the shores of a palaeolake. It was intermittently occupied between about 9500 cal years BP and 4500 BP. Due to alternating environmental conditions it could only be occupied at the beginning and at the end of the most humid periods.
Bischoff, James L.; Cummins, Kathleen
2001-01-01
Chemical analyses of the clay-sized fractions of 564 continuous sediment samples (200-yr resolution) from composite core OL90/92 allow quantification of an abundance of glacial rock flour. Rock flour produced during glacier advances is represented by clay-sized plagioclase, K-feldspar, and biotite in homogeneous internal composition. The abundance of rock flour is deemed proportional to the intensity of glacies advances. Age control for the composite section is provided by combining previously published radiocarbon dates on organics, U/Th dates on ostracode shells, and U/Th dates on saline minerals from nearby Searles Lake correlated to OL92 by pollen. The rock flour record displays three levels of variability: (1) a dominant one of about 20,000 yr related to summer insolation and precipitation; (2) an intermediate one of 3000-5000 yr, perhaps related to North Atlantic Heinrich events; and (3) a minor one of 1000-2000 yr, perhaps related to North Atlantic thermohaline-driven air-temperature variation.
El Niño Variability in the Coastal Desert of Southern Peru during the Mid-Holocene
Fontugne, Michel; Usselmann, Pierre; Lavallée, Danièle; Julien, Michèle; Hatté, Christine
1999-09-01
Fourteen organic-rich sedimentary layers in the deposits at Quebrada de los Burros, in coastal southern Peru (Tacna department), lie between two debris-flow units, interpreted to result from El Niño events, at 8980 cal yr B.P. and after 3380 cal yr B.P., respectively. The accumulation of the fine-grained and low-energy sediments of this deposit during the mid-Holocene is incompatible with the occurrence of El Niño events in this region, as these would produce catastrophic flood deposits. The occurrence of organic-rich sediments and evidence of an enhancement of upwelling strength at this time imply the existence of a permanent water supply resulting from an increased condensation of fog at mid-altitudes. These results suggest a lower intensity and, perhaps, a lower frequency of occurrence of the El Niño phenomenon during the mid-Holocene. It is precisely during this period that the most important human settlements are found at this site, probably indicating the presence of reliable supply of fresh water. The chronologies for wetlands in the central south altiplano are out of phase with those indicating increased soil moisture episodes on the coast, implying a long-term difference in climate between these two regions.
Dudová, Lydie; Hájková, Petra; Opravilová, Věra; Hájek, Michal
2014-07-01
We discovered the first peat section covering the entire Holocene in the Hrubý Jeseník Mountains, representing an island of unique alpine vegetation whose history may display transitional features between the Hercynian and Carpathian regions. We analysed pollen, plant macrofossils (more abundant in bottom layers), testate amoebae (more abundant in upper layers), peat stratigraphy and chemistry. We found that the landscape development indeed differed from other Hercynian mountains located westward. This is represented by Pinus cembra and Larix during the Pleistocene/Holocene transition, the early expansion of spruce around 10,450 cal yr BP, and survival of Larix during the climatic optimum. The early Holocene climatic fluctuations are traced in our profile by species compositions of both the mire and surrounding forests. The mire started to develop as a calcium-rich percolation fen with some species recently considered to be postglacial relicts (Meesia triquetra, Betula nana), shifted into ombrotrophy around 7450 cal yr BP by autogenic succession and changed into a pauperised, nutrient-enriched spruce woodland due to modern forestry activities. We therefore concluded that its recent vegetation is not a product of natural processes. From a methodological viewpoint we demonstrated how using multiple biotic proxies and extensive training sets in transfer functions may overcome taphonomic problems.
Directory of Open Access Journals (Sweden)
A. A. Andreev
2012-08-01
Full Text Available Frozen sediments from three cores bored in the permafrost surrounding the El'gygytgyn Impact Crater Lake have been studied for pollen, non-pollen palynomorphs, plant macrofossils and rhizopods. The palynological study of these cores contributes to a higher resolution of time intervals presented in a poor temporal resolution in the lacustrine sediments; namely the Allerød and succeeding periods. Moreover, the permafrost records better reflect local environmental changes, allowing a more reliable reconstruction of the local paleoenvironments. The new data confirm that shrub tundra with dwarf birch, shrub alder and willow dominated the lake surroundings during the Allerød warming. Younger Dryas pollen assemblages reflect abrupt changes to grass-sedge-herb dominated environments reflecting significantly drier and cooler climate. Low shrub tundra with dwarf birch and willow dominate the lake vicinity at the onset of the Holocene. The find of larch seeds indicate its local presence around 11 000 cal yr BP and, thus a northward shift of treeline by about 100 km during the early Holocene thermal optimum. Forest tundra with larch and shrub alder stands grew in the area during the early Holocene. After ca. 3500 cal yr BP similar-to-modern plant communities became common in the lake vicinity.
Contrasting pollen histories of MIS 5e and the Holocene from Lake Titicaca (Bolivia/Peru)
Hanselman, Jennifer A.; Gosling, William D.; Paduano, Gina M.; Bush, Mark B.
2005-10-01
Two long sediment records (cores LTO1-2B and LT01-3B) from Lake Titicaca, Bolivia/Peru, are compared with a previously analysed Holocene record from this lake (core NE98-1PC). The Holocene records of LT01-2B and NE98-1PC are similar. There are striking differences, however, between the MIS 5e sections of the long cores and the Holocene records. In these records, temperature is probably the dominant parameter that determines the total fossil pollen concentration and is used to time the onset and termination of deglaciation. In contrast, the relative and absolute abundance of specific taxa (e.g. Polylepis/Acaena, Chenopodiaceae) are indicators of relative moisture availability. Although the Holocene contains a period of aridity between ca. 8000 cal. yr BP and 4300 cal. yr BP, it is a minor event compared with the more extreme aridity of MIS 5e. Core LT01-3B showed similar trends during MIS 5e when compared to LT01-2B, as did NE98-1PC when comparing Holocene records. MIS 5e and the Holocene are markedly different interglacials, depicted by shifts in pollen concentration and taxa representation over time.
Late Holocene environmental reconstruction using cave sediments from Belize
Polk, Jason S.; van Beynen, Philip E.; Reeder, Philip P.
2007-07-01
Cave sediments collected from Reflection Cave on the Vaca Plateau, Belize show variations in the δ13C values of their fulvic acids (FAs), which indicate periods of vegetation change caused by climatic and Maya influences during the late Holocene. The δ13C values range from - 27.11‰ to - 21.52‰, a shift of ˜ 5.59‰, which suggests fluctuating contributions of C 3 and C 4 plants throughout the last 2.5 ka, with C 4 plant input reflecting periods of Maya agriculture. Maya activity in the study area occurred at different intensities from ˜ 2600 cal yr BP until ˜ 1500 cal yr BP, after which agricultural practices waned as the Maya depopulated the area. These changes in plant assemblages were in response to changes in available water resources, with increased aridity leading to the eventual abandonment of agricultural areas. The Ix Chel archaeological site, located in the study area, is a highland site that would have been among the first agricultural settlements to be affected during periods of aridity. During these periods, minimal water resources would have been available in this highly karstified, well-drained area, and supplemental groundwater extraction would have been difficult due to the extreme depth of the water table.
CALS - What are the Potentials for SMEs ?
DEFF Research Database (Denmark)
Bilberg, Arne; Larsen, Michael holm; Langer, Gilad
1996-01-01
The Danish CALS Center initiative, aims at making CALS operational in Danish industry. The center consists of three Danish companies, Bang & Olufsen, Odense Steel Shipyard, Nilfisk besides from the Technical University of Denmark and the Danish Technological Institute. The objective is to demonst...
δ13Catm and [CO2] measurements in Antarctic ice cores, 160 kyrBP - present
Eggleston, Sarah; Schmitt, Jochen; Schneider, Robert; Joos, Fortunat; Fischer, Hubertus
2014-05-01
Measurements from Antarctic ice cores allow us to reconstruct atmospheric concentrations of climatically important gases including CO2 over the past 800 kyr. Such measurements show that [CO2] has varied in parallel with Antarctic temperatures on glacial-interglacial timescales. Knowledge of the variations of the stable carbon isotope of CO2, δ13Catm, can help us better understand the processes involved in these fluctuations. Here, we present a first complete δ13Catmrecord extending from 160 kyrBP to the present accompanied by δ15N2 measurements during Marine Isotope Stage 3 (MIS 3, 57 - 29 kyrBP). The present record, measured primarily on ice from the EPICA Dome C and Talos Dome ice cores, has an average resolution of 500 yr, focused mainly on the Last Glacial Maximum and termination (180 yr; Schmitt et al., 2012), MIS 3 (660 yr), and Termination II through MIS 5.4 (590 yr; Schneider et al., 2013). Throughout the record, δ13Catm varies between approximately -6.8 and -6.4‰Following a period of relatively constant δ13Catm at the end of MIS 6 (around -6.8), the boundaries of MIS 5 correspond roughly with the beginning and end of a gradual enrichment in this isotope. In comparison, the more recent record depicts three more abrupt excursions to lighter values around 63 - 59, 46, and 17 kyrBP, in each case followed by a slower return (0.4o over the course of 5 - 15 kyr) to more enriched isotopic values. These coincide with Heinrich events 6, 5, and 1, respectively. No direct correlation is observed between the concentration and carbon isotope of CO2 over the last 160 kyr. The data indicate rather that numerous processes, such as uptake and release of atmospheric CO2 by the ocean and land biosphere, perhaps influenced by regions of growing permafrost during MIS 3 and 4, acting on a variety of timescales must be considered in explaining the evolution of δ13Catm on glacial-interglacial timescales. References: Schmitt, J. et al. Science 336, 711-714 (2012) Schneider
Directory of Open Access Journals (Sweden)
Angelica Feurdean
2001-09-01
Full Text Available High resolution analyses of pollen, mineral magnetic properties, loss of ignition, lithostratigraphy and AMS 14C measurements of lake sediments and peat deposits accumulated in the former crater lake of Steregoiu (Gutâiului Mts., NW Romania, gave new and important information about vegetation and climate changes from the period GS-2 to the present. During the Lateglacial, three cold events were recorded: before 14,700 cal. years BP (GS-2, 14,050–13,800 cal. years BP (GI-1d, 12,900-11,500 cal. years BP (GS-1, and a warm climatic event between 13,800-12,950 cal. years BP (GI-1c to GL-1a. The Late Glacial/Holocene transition around 11,500 cal. years BP, was determined by an expansion of Betula, Alnus and Picea, followed by a rapid and strong expansion of Ulmus. At 10,700 cal. years BP, dense and highly diverse forests with Ulmus, Quercus, Tilia, Fraxinus and a few Acer and Corylus individuals dominated the area. Corylus and Picea were the dominant species in the forests from 10,150 to 8,500 cal. years BP. The first occurrence of single Fagus pollen grains was around 8,000 cal years BP. Only at 4,700 cal year BP Fagus and Carpinus became widespread and established trees in the local woodlands.
Hirsch, Florian; Schneider, Anna; Nicolay, Alexander; Błaszkiewicz, Mirosław; Kordowski, Jarosław; Noryskiewicz, Agnieszka M.; Tyszkowski, Sebastian; Raab, Alexandra; Raab, Thomas
2015-04-01
In Central Europe, Late Quaternary landscapes experienced multiple phases of geomorphologic activity. In this study,we used a combined geomorphological, pedological, sedimentological and palynological approach to characterize landscape development after the Last Glacial Maximum (LGM) near Lake Wygonin in Northern Poland. The pedostratigraphical findings from soil pits and drillings were extrapolated using ground-penetrating radar (GPR) and electric resistivity tomography (ERT). During the Pomeranian phase, glacial and fluvioglacial processes dominated the landscape near Lake Wygonin. At the end of the glacial period, periglacial processes became relevant and caused the formation of ventifacts and coversands containing coated sand grains. At approximately 15,290-14,800 cal yr BP, a small pond formed in a kettle hole (profile BWI2). The lacustrine sediments lack eolian sand components and therefore indicate the decline of eolian processes during that time. The increase of Juniperus and rock-rose (Helianthemum) in the pollen diagram is a prominent marker of the Younger Dryas. At the end of the Younger Dryas, a partial reshaping of the landscape is indicated by abundant charcoal fragments in disturbed lake sediments. No geomorphologic activity since the beginning of the Holocene is documented in the terrestrial and wetland archives. The anthropogenic impact is reflected in the pollen diagram by the occurrence of rye pollen grains (Cerealia type, Secale cereale) and translocated soil sediments dated to 1560-1410 cal yr BP, proving agricultural use of the immediate vicinity. With the onset of land use, gully incision and the accumulation of colluvial fans reshaped the landscape locally. Since 540-460 cal yr BP, further gully incision in the steep forest tracks has been associated with the intensification of forestry. Outside of the gully catchments, the weakly podzolized Rubic Brunic Arenosols show no features of Holocene soil erosion. Reprinted from CATENA, Volume 124
Directory of Open Access Journals (Sweden)
N. Combourieu-Nebout
2013-09-01
Full Text Available The high-resolution multiproxy study of the Adriatic marine core MD 90-917 provides new insights to reconstruct vegetation and regional climate changes over the southcentral Mediterranean during the Younger Dryas (YD and Holocene. Pollen records show the rapid forest colonization of the Italian and Balkan borderlands and the gradual installation of the Mediterranean association during the Holocene. Quantitative estimates based on pollen data provide Holocene precipitations and temperatures in the Adriatic Sea using a multi-method approach. Clay mineral ratios from the same core reflect the relative contributions of riverine (illite and smectite and eolian (kaolinite contributions to the site, and thus act as an additional proxy with which to evaluate precipitation changes in the Holocene. Vegetation climate reconstructions show the response to the Preboreal oscillation (PBO, most likely driven by changes in temperature and seasonal precipitation, which is linked to increasing river inputs from Adriatic rivers recorded by increase in clay mineral contribution to marine sediments. Pollen-inferred temperature declines during the early–mid Holocene, then increases during the mid–late Holocene, similar to southwestern Mediterranean climatic patterns during the Holocene. Several short vegetation and climatic events appear in the record, indicating the sensitivity of vegetation in the region to millennial-scale variability. Reconstructed summer precipitation shows a regional maximum (170–200 mm between 8000 and 7000 similar to the general pattern across southern Europe. Two important shifts in vegetation occur at 7700 cal yr BP (calendar years before present and between 7500 and 7000 cal yr BP and are correlated with increased river inputs around the Adriatic Basin respectively from the northern (7700 event and from the central Adriatic borderlands (7500–7000 event. During the mid-Holocene, the wet summers lead to permanent moisture all year
Directory of Open Access Journals (Sweden)
M. Taviani
2013-07-01
Full Text Available The geo-biological exploration of a pockmark field located at ca. 800 m below sea level in the Gela basin (Strait of Sicily, Central Mediterranean provided a relatively diverse chemosymbiotic community and methane-imprinted carbonates. To date, this is the first occurrence of such a type of specialised deep-water cold-seep communities recorded from this key region, before documented in the Mediterranean as rather disjunct findings in its eastern and westernmost basins. The thiotrophic chemosymbiotic organisms recovered from this area include empty tubes of the vestimentiferan Lamellibrachia sp., loose and articulated shells of lucinids (Lucinoma kazani, Myrtea amorpha, vesicomyids (Isorropodon perplexum, and gastropods (Taranis moerchii. A callianassid decapod (Calliax sp. was consistently found alive in large numbers in the pockmark mud. Their post-mortem calcified parts mixed with molluscs and subordinately miliolid foraminifers form a distinct type of skeletal assemblage. Carbonate concretions display δ13C values as low as −40‰ PDB suggesting the occurrence of light hydrocarbons in the seeping fluids. Since none of the truly chemosymbiotic organisms was found alive, although their skeletal parts appear at times very fresh, some specimens have been AMS-14C dated to shed light on the historical evolution of this site. Lamellibrachiav and Lucinoma are two of the most significant chemosymbiotic taxa reported from various Mediterranean cold seep sites (Alboran Sea and Eastern basin. Specimens from station MEDCOR78 (pockmark #1, Lat. 36°46´10.18" N, Long. 14°01´31.59" E, 815 m below sea level provided ages of 11736 ± 636 yr cal BP (Lamellibrachia sp., and 9609.5 ± 153.5 yr cal BP (L. kazani. One shell of M. amorpha in core MEDCOR81 (pockmark #6, Lat 36°45´38.89" N, Long 14°00´07.58" E, 822 m below sea level provided a sub-modern age of 484 ± 54 yr cal BP. These ages document that fluid seepage at this pockmark site has been
Papadopolos, Zorka; Kasner, Gerald
This chapter is devoted to the coverings of the two quasiperiodic canonical tilings MATH {cal T}(*(A_4)) -> T^*(A4) and MATH {cal T}(*(D_6)) equiv {cal T}(*(2F)) -> T^*(D6) T^*(2F), obtained by projection from the root lattices A4 and D6, respectively. In the first major part of this chapter, in Sect. 5.2, we shall introduce a Delone covering MATH {cal C}(s_{{cal) T}(*(A_4)}) -> C^sT^*(A4) of the 2-dimensional decagonal tiling MATH {cal T}(*(A_4)) -> T^*(A4). In the second major part of this chapter, Sect. 5.3, we summarize the results related to the Delone covering of the icosahedral tiling MATH {cal T}(*(D_6)) -> T^*(D6), MATH {cal C}_{{cal T}(*(D_6)}) -> CT^*(D6) and determine the zero-, single-, and double- deckings and the resulting thickness of the covering. In the conclusions section, we give some suggestions as to how the definition of the Delone covering might be changed in order to reach some real (full) covering of the icosahedral tiling MATH {cal T}(*(D_6)) -> T^*(D6). In Section 5.2 the definition of the Delone covering is also changed in order to avoid an unnecessary large thickness of the covering.
International Nuclear Information System (INIS)
Rawlence, N.J.; Cooper, A.
2013-01-01
The extinction date of the giant flightless New Zealand ratite bird, the crested moa (Pachyornis australis), is of considerable interest because the youngest verified remains are dated to the Pleistocene–Holocene transition c. 10,000 yr BP, which was characterised by severe climatic and habitat change, and are considerably earlier than the late Holocene extinctions of the other eight moa species. Analysis of a partial crested moa skeleton (NMNZ S23569) from Castle Keep Entrance, Bulmer Cave System, Mount Owen, South Island, generated a radiocarbon date of 564±26 yr BP (544-508 cal yr BP; 95.4% AD 1396-1442). As a result the Bulmer Cave specimen represents the youngest moa yet found from a natural site in New Zealand. Combined with additional crested moa remains dated to the late Holocene from Cheops Cave (Mount Arthur) and Magnesite Quarry (Cobb Valley), this indicates that crested moa did not go extinct during the Pleistocene–Holocene transition but survived until after Polynesian colonisation in c. AD 1280. The new radiocarbon dates reported here have important implications for the timing of moa extinction and the late survival of moa in alpine areas of New Zealand. (author). 47 refs., 2 figs., 1 tab.
Finkenbinder, M. S.; Abbott, M.; Stoner, J. S.; Dorfman, J. M.
2012-12-01
Here we present a new multi-proxy geochemical analysis of paleoenvironmental change inferred from sediment cores recovered from Burial Lake (68.434° N, 159.174° W; 430 m ASL) in northwest Alaska. Previous work on cores from 7.9 m water depth sampled at comparatively low resolution revealed basal sediments date to ~ 40,000 cal yr BP and an unconformity during a period of aridity around the Last Glacial Maximum (LGM). We therefore collected multiple overlapping Livingston cores from the lake depocenter (21.5 m water depth) in the summer of 2010 in an effort to develop a temporally continuous, high resolution record spanning prior to the LGM to the present. We focus our interpretations on a 6.51 m core developed through wiggle matching proxy data from core sites A10 and C10. We use traditional laboratory methods and investigate new approaches to assess changes in sedimentation and productivity. We are measuring dry bulk density, organic matter via Loss-on-ignition at 550° C, biogenic silica, magnetic susceptibility, grain size via laser diffractometry, and elemental abundances via scanning x-ray fluorescence (XRF). Future research seeks to test the reliability of two commonly used XRF proxies, for organic matter (incoherence/coherence ratios) and aquatic productivity (Si/Ti ratios). Age control is provided by 12 Accelerator Mass Spectrometry radiocarbon dates of discrete terrestrial macrofossils. Results from these analyses indicate that the depocenter core is continuous and the sediment record spans the last ~ 38,000 cal yr BP and most importantly contains sediments spanning the LGM. Preliminary geochemical results demonstrate substantial cyclicity in organic matter and aquatic productivity beginning in the late-glacial. We seek to analyze the periodicity of these proxies through spectral analysis, although initial observations suggest multi-century to millennial scale variability. In addition, we note the presence of two abrupt, non-linear transitions in organic
U.S. Environmental Protection Agency — Observations made during the 2010 CalNex measurement campaign. This dataset is associated with the following publication: Woody , M., K. Baker , P. Hayes, J....
Andrews, Benjamin J.; Dufek, Josef; Ponomareva, Vera
2018-05-01
Deposits and pumice from the 1400 cal BP eruption of Opala volcano record activity that occurred at the explosive-effusive transition, resulting in intermittent, or stop-start, behavior, where explosive activity resumed following a pause. The eruption deposited distinctive, biotite-bearing rhyolite tephra across much of Kamchatka, and its stratigraphy consists of a lithic-rich pumice fall, overlain by pumice falls and pyroclastic density deposits, with the proportion of the latter increasing with height. This sequence repeats such that the middle of the total deposit is marked by a lithic-rich fall with abundant obsidian clasts. Notably, the eruptive pumice are poorly vesiculated, with vesicle textures that record fragmentation of a partially collapsed magmatic foam. The eruption vent, Baranii Amphitheater is filled with obsidian lavas of the same composition as the rhyolite tephra. Based upon the stratigraphic and compositional relations, we divide the eruption into four phases. Phase I initiated with eruption of a lithic-rich pumice fall, followed by eruption of Plinian falls and pyroclastic density currents. During Phase II, the eruption paused for at least 5-6 h; in this time, microlites nucleated and began to grow in the magma. Phase III essentially repeated the Phase I sequence. Obsidian lavas were emplaced during Phase IV. The pumice textures suggest that the magma ascended very near the threshold decompression rate for the transition between explosive (fast) and effusive (slow) behavior. The pause during Phase II likely occurred as decompression slowed enough for the magma to develop sufficient permeability for gas to escape resulting in collapse of the magmatic foam, stopping the eruption and temporarily sealing the conduit. After about 5-6 h, eruption resumed with, once again, magma decompressing very near the explosive-effusive transition. Phase III ended when the decompression rate slowed and lava dome emplacement began. Distributions of pumice and
Wang, Haipeng; Chen, Jianhui; Zhang, Shengda; Zhang, David D.; Wang, Zongli; Xu, Qinghai; Chen, Shengqian; Wang, Shijin; Kang, Shichang; Chen, Fahu
2018-03-01
Long-term, high-resolution temperature records which combine an unambiguous proxy and precise dating are rare in China. In addition, the societal implications of past temperature change on a regional scale have not been sufficiently assessed. Here, based on the modern relationship between chironomids and temperature, we use fossil chironomid assemblages in a precisely dated sediment core from Gonghai Lake to explore temperature variability during the past 4000 years in northern China. Subsequently, we address the possible regional societal implications of temperature change through a statistical analysis of the occurrence of wars. Our results show the following. (1) The mean annual temperature (TANN) was relatively high during 4000-2700 cal yr BP, decreased gradually during 2700-1270 cal yr BP and then fluctuated during the last 1270 years. (2) A cold event in the Period of Disunity, the Sui-Tang Warm Period (STWP), the Medieval Warm Period (MWP) and the Little Ice Age (LIA) can all be recognized in the paleotemperature record, as well as in many other temperature reconstructions in China. This suggests that our chironomid-inferred temperature record for the Gonghai Lake region is representative. (3) Local wars in Shanxi Province, documented in the historical literature during the past 2700 years, are statistically significantly correlated with changes in temperature, and the relationship is a good example of the potential societal implications of temperature change on a regional scale.
International Nuclear Information System (INIS)
Berryman, K.R.; Marden, M.; Palmer, A.; Litchfield, N.J.
2009-01-01
The Repongaere Fault is one of a series of active normal faults within the Raukumara Peninsula, eastern North Island, New Zealand. These faults appear to form in response to rapid uplift of the Raukumara Range and related extensional strain. However, the activity of these normal faults is poorly constrained. This paper presents new mapping of the active surface trace of the Repongaere Fault, c. 18 km northwest of Gisborne, and the results of two paleoseismic trenches. These results are then used to assess the seismic hazard posed by this fault and impacts on the Waipaoa Sedimentary System in which the fault is situated. Active traces can be mapped for c. 4.5 km, but we infer the surface rupture length to be at least 9 km. Tephras within the trenches constrain the timing of the most recent surface rupture event to have occurred during deposition of the Waimihia Tephra (c. 3400 cal. yr BP), and at least one event in the period c. 13 800-C5470 cal. yr BP, with single-event displacements of ≥0.4-1.1 m. From these data a mean dip-slip rate of c. 0.1 mm/yr and a maximum recurrence interval of 4490-6900 yr, can be calculated. If the Repongaere Fault is representative of other Raukumara Peninsula normal faults, then this relatively low rate of activity supports the interpretation that these faults are not contributing significantly to the deformation of the Raukumara Peninsula. The low rate of activity is also consistent with the very localised evidence for landscape impacts, a calculated moderate M w of 6.3-6.7, and the fault's location within the lower part of the Waipaoa River catchment. Together, these observations suggest that Repongaere Fault earthquakes have minimal, localised impact on the Waipaoa Sedimentary System. (author). 64 refs., 4 figs., 2 tabs.
Ekdahl, E. J.; Fritz, S. C.; Baker, P. A.; Burns, S. J.; Coley, K.; Rigsby, C. A.
2005-12-01
Numerous sites in the Northern Hemisphere show multi-decadal to millennial scale climate variation during the Holocene, many of which have been correlated with changes in atmospheric radiocarbon production or with changes in North Atlantic oceanic circulation. The manifestation of such climate variability in the hydrology of the Southern Hemisphere tropics of South America is unclear, because of the limited number of records at suitably high resolution. In the Lake Titicaca drainage basin of Bolivia and Peru, high-resolution lacustrine records reveal the overall pattern of Holocene lake-level change, the influence of precessional forcing of the South American Summer Monsoon, and the effects of high-frequency climate variability in records of lake productivity and lake ecology. Precessional forcing of regional precipitation is evident in the Lake Titicaca basin as a massive (ca. 85 m) mid-Holocene decline in lake level beginning about 7800 cal yr BP and a subsequent rise in lake level after 4000 cal yr BP. Here we show that multi-decadal to millennial-scale climate variability, superimposed upon the envelope of change at orbital time scales, is similar in timing and pattern to the ice-rafted debris record of Holocene Bond events in the North Atlantic. A high-resolution carbon isotopic record from Lake Titicaca that spans the entire Holocene suggests that cold intervals of Holocene Bond events are periods of increased precipitation, thus indicating an anti-phasing of precipitation variation on the Altiplano relative to the Northern Hemisphere tropics. A similar pattern of variation is also evident in high-resolution (2-30 yr spacing) diatom and geochemical records that span the last 7000 yr from two smaller lakes, Lagos Umayo and Lagunillas, in the Lake Titicaca drainage basin.
National Oceanic and Atmospheric Administration, Department of Commerce — Fish egg counts and standardized counts for eggs captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets], and...
Beam Tests of a Multilayer LumiCal Prototype
Borysov, O
2018-01-01
LumiCal is a sampling electromagnetic calorimeter designed for the precise measurement of in- tegrated luminosity in electron positron linear collider experiments. The present report contains a description and results of the first beam test of a multilayer LumiCal prototype with four sili- con detector planes. A 5 GeV electron beam from the CERN PS T9 facility was used to study the performance of the LumiCal prototype. Presented results are mainly focused on the trans- verse structure of the observed electromagnetic shower and the Molière radius measurement. A comparison with MC simulation is also discussed.
International Nuclear Information System (INIS)
Wolfe, B.B.; Aravena, R.; Gibson, J.J.; Abbott, M.B.; Seltzer, G.O.
2002-01-01
Cellulose-inferred lake water δ 18 O (δ 18 O lw ) records from Lago Potosi, a seasonally-closed lake in a watershed that is not currently glaciated, and Lago Taypi Chaka Kkota, an overflowing lake in a glaciated watershed, provide the basis for late Pleistocene and Holocene paleoclimatic reconstruction in the Bolivian Andes. Deconvolution of the histories of changing evaporative isotopic enrichment from source water δ 18 O in the lake sediment records is constrained by comparison to the Sajama ice core oxygen isotope profile. At Lago Potosi, the δ 18 O lw record appears to be dominantly controlled by evaporative 18 O-enrichment, reflecting shifts in local effective moisture. Using an isotope-mass balance model, a preliminary quantitative reconstruction of summer relative humidity spanning the past 11,500 cal yr is derived from the Lago Potosi Π 18 O lw record. Results indicate that the late Pleistocene was moist with summer relative humidity values estimated at 10-20% greater than present. Increasing aridity developed in the early Holocene with maximum prolonged dryness spanning 7500 to 6000 cal yr BP at Lago Potosi, an interval characterized by summer relative humidity values that may have been 20% lower than present. Highly variable but dominantly arid conditions persist in the mid- to late Holocene, with average summer relative humidity values estimated at 15% below present, which then increase to about 10-20% greater than present by 2000 cal yr BP. Slightly more arid conditions characterize the last millennium with summer relative humidity values ranging from 5-10% lower than present. Similar long-term variations are evident in the Lago Taypi Chaka Kkota δ 18 O lw profile, except during the early Holocene when lake water evaporative 18 Oenrichment in response to low relative humidity appears to have been offset by enhanced inflow from 18 O-depleted snowmelt or groundwater from the large catchment. Close correspondence occurs between the isotope
Dating the Lascaux cave gour formation
International Nuclear Information System (INIS)
Genty, D.; Touma, M.; Konik, S.; Konik, S.; Valladas, H.; Hellstrom, J.; Moreau, C.; Dumoulin, J.P.; Nouet, J.; Dauphin, Y.; Weil, R.
2011-01-01
Lascaux Cave is renowned for its outstanding prehistoric paintings, strikingly well-preserved over about 18,000 yr. While stalagmites and stalactites are almost absent in the cave, there is an extensive calcite flow-stone that covered a large part of the cave until its opening for tourists during the 1950's. The deposit comprises a succession of calcite rims, or 'gours', which allowed seepage water to pond in large areas in the cave. Their possible role in preservation of the cave paintings has often been evoked, but until now this deposit has not been studied in detail. Here, we present 24 new radiocarbon accelerator mass spectrometry (AMS) and 6 uranium-thorium (U-Th) analyses from the calcite of the gours, 4 AMS 14 C dates from charcoals trapped in the calcite, and 4 AMS 14 C analyses on organic matter extracted from the calcite. Combining the calibrated 14 C ages obtained on charcoals and organic matter and U-Th ages from 14 C analyses made on the carbonate, has allowed the calculation of the dead carbon proportion (dcp) of the carbonate deposits. The latter, used with the initial atmospheric 14 C activities reconstructed with the new IntCal09 calibration data, allows high-resolution age estimation of the gour calcite samples and their growth rates. The carbonate deposit grew between 9530 and 6635 yr cal BP (for dcp = 10.7 ± 1.8%; 2 s) or between 8518 and 5489 yr cal BP (for dcp = 20.5 ± 1.9%; 2 s). This coincides with humid periods that can be related to the Atlantic period in Europe and to Sapropel 1 in the eastern Mediterranean Sea. However, geomorphological changes at the cave entrance might also have played a role in the gour development. In the 1940's, when humans entered the cave for the first time since its prehistoric occupation, the calcite gours had already been inactive for several thousand years. (authors)
Windows Calorimeter Control (WinCal) program computer software design description
International Nuclear Information System (INIS)
Pertzborn, N.F.
1997-01-01
The Windows Calorimeter Control (WinCal) Program System Design Description contains a discussion of the design details for the WinCal product. Information in this document will assist a developer in maintaining the WinCal system. The content of this document follows the guidance in WHC-CM-3-10, Software Engineering Standards, Standard for Software User Documentation
Tyring, Stephen; Bukhalo, Michael; Alonso-Llamazares, Javier; Olesen, Martin; Lowson, David; Yamauchi, Paul
2016-01-01
Objective: To evaluate the efficacy of fixed combination aerosol foam calcipotriene 0.005% (Cal) plus betamethasone dipropionate 0.064% (BD). Design: Patients were randomized (100:101:101) to receive Cal/BD foam, Cal foam, or BD foam once daily for four weeks. Setting: Twenty-eight United States centers. Participants: 302 patients (≥18 years) with Psoriasis vulgaris (plaque Psoriasis; ≥mild disease severity by physicians global assessment). Measurements: Treatment success of the body (“clear”/”almost clear” from baseline moderate/severe disease; “clear” from baseline mild disease). Involved scalp treatment success was an additional endpoint. Results: Most patients (76%) had moderate Psoriasis of the body (66% for scalp). At Week 4, 45 percent of Cal/BD foam patients achieved treatment success, significantly more than Cal foam (14.9%; OR 4.34 [95%CI 2.16,8.72] Pfoam (30.7%; 1.81 [1.00,3.26] P=0.047). Fifty-three percent of Cal/BD foam patients achieved treatment success of the scalp, significantly greater than Cal foam (35.6%; 1.91 [1.09,3.35] P=0.021), but not BD foam (47.5%; 1.24 [0.71,2.16] P=0.45). Mean modified Psoriasis area and severity index (population baseline 7.6) improved in all groups, with statistically significant differences in Week 4 Cal/BD foam score (2.37) versus Cal foam (4.39; mean difference -2.03 [-2.63][-1.43] Pfoam (3.37; -1.19 [-1.80][-0.59] Pfoam was significantly more effective than Cal foam and BD foam in providing treatment success at Week 4 and effective on involved scalp. Trial registration: NCT01536938. PMID:27313822
Finished Genome Sequence of Collimonas arenae Cal35
Wu, Je-Jia; de Jager, Victor; Deng, Wen-ling; Leveau, Johan
2015-01-01
We announce the finished genome sequence of soil forest isolate Collimonas arenae Cal35, which comprises a 5.6-Mbp chromosome and 41-kb plasmid. The Cal35 genome is the second one published for the bacterial genus Collimonas and represents the first opportunity for high-resolution comparison of
Revel, Marie; Colin, Christophe; Bernasconi, Stephano; Combourieu-Nebout, Nathalie; Ducassou, Emmanuelle; Rolland, Yann; Bosch, Delphine
2014-05-01
The Nile delta sedimentation constitutes a continuous high resolution (1.6 mm/year) record of Ethiopian African monsoon regime intensity. Multiproxy analyses performed on core MS27PT recovered in hemipelagic Nile sediment margin (Blue/White Nile River suspended matter frequency fluctuations during the last 21 cal. ka BP. The radiogenic Sr and Nd isotopes, clay mineralogy, bulk elemental composition and palynological analyses reveal large changes in source components, oscillating between a dominant aeolian Saharan contribution during the LGM and the Late Holocene (~4 to 2 cal. ka BP), a dominant Blue/Atbara Nile River contribution during the early Holocene (15 to 8.4 cal. ka BP) and a probable White Nile River contribution during the Middle Holocene (8.4 to 4 cal. ka BP). The following main features are highlighted: 1. The rapid shift from the LGM arid conditions to the African Humid Period (AHP) started at about 15 cal. ka BP. AHP extends until 8.4 cal. ka BP, and we suggest that the Ethiopian African Monsoon maximum between 12 and 8 cal. ka BP is responsible for a larger Blue/Atbara Nile sediment load and freshwater input into the Eastern Mediterranean Sea. 2. The transition between the AHP and the arid Late Holocene is gradual and occurs in two main phases between 8.4 and 6.5 cal. ka BP and 6.5 to 3.2 cal. ka BP. We suggest that the main rain belt shifted southward from 8.4 to ~4 cal. ka BP and was responsible for progressively reduced sediment load and freshwater input into the eastern Mediterranean Sea. 3. The aridification along the Nile catchments occurred from ~4 to 2 cal. ka BP. A dry period, which culminates at 3.2 cal. ka BP, and seems to coincide with a re-establishment of increased oceanic primary productivity in the western Mediterranean Sea. We postulate that the decrease in thermo-haline water Mediterranean circulation could be part of a response to huge volumes of fresh-water delivered principally by the Nile River from 12 to 8.4 cal. ka BP in the
Starratt, Scott W.; Pinter, N.; Anderson, Robert S.; Jass, R.B.
2009-01-01
The long-term history of vegetation and fire was investigated at two locations – Soledad Pond (275 m; from ca. 12 000 cal. a BP) and Abalone Rocks Marsh (0 m; from ca. 7000 cal. a BP) – on Santa Rosa Island, situated off the coast of southern California. A coastal conifer forest covered highlands of Santa Rosa during the last glacial, but by ca. 11 800 cal. a BP Pinus stands, coastal sage scrub and grassland replaced the forest as the climate warmed. The early Holocene became increasingly drier, particularly after ca. 9150 cal. a BP, as the pond dried frequently, and coastal sage scrub covered the nearby hillslopes. By ca. 6900 cal. a BP grasslands recovered at both sites. Pollen of wetland plants became prominent at Soledad Pond after ca. 4500 cal. a BP, and at Abalone Rocks Marsh after ca. 3465 cal. a BP. Diatoms suggest freshening of the Abalone Rocks Marsh somewhat later, probably by additional runoff from the highlands. Introduction of non-native species by ranchers occurred subsequent to AD 1850. Charcoal influx is high early in the record, but declines during the early Holocene when minimal biomass suggests extended drought. A general increase occurs after ca. 7000 cal. a BP, and especially after ca. 4500 cal. a BP. The Holocene pattern closely resembles population levels constructed from the archaeological record, and suggests a potential influence by humans on the fire regime of the islands, particularly during the late Holocene.
Ager, Thomas A.; Rosenbaum, Joseph G.
2009-01-01
A radiocarbon-dated history of vegetation development since late Wisconsin deglaciation has been reconstructed from pollen evidence preserved in a sediment core from Pass Lake on Prince of Wales Island, southeastern Alaska. The shallow lake is in the south-central part of the island and occupies a low pass that was filled by glacial ice of local origin during the late Wisconsin glaciation. The oldest pollen assemblages indicate that pine woodland (Pinus contorta) had developed in the area by ~13,715 cal yr B.P. An abrupt decline in the pine population, coinciding with expansion of alder (Alnus) and ferns (mostly Polypodiaceae) began ~12,875 yr B.P., and may have been a response to colder, drier climates during the Younger Dryas climatic interval. Mountain hemlock (Tsuga mertensiana) began to colonize central Prince of Wales Island by ~11,920 yr B.P. and was soon followed by Sitka spruce (Picea sitchensis). Pollen of western hemlock (Tsuga heterophylla) began to appear in Pass Lake sediments soon after 11,200 yr B.P. The abundance of western hemlock pollen in the Pass Lake core during most of the Holocene appears to be the result of wind transport from trees growing at lower altitudes on the island. The late Holocene pollen record from Pass Lake is incomplete because of one or more unconformities, but the available record suggests that a vegetation change occurred during the late Holocene. Increases in pollen percentages of pine, cedar (probably yellow cedar, Chamaecyparis nootkatensis), and heaths (Ericales) suggest an expansion of muskeg vegetation occurred in the area during the late Holocene. This vegetation change may be related to the onset of cooler, wetter climates that began as early as ~3,774 yr B.P. in the region. This vegetation history provides the first radiocarbon-dated Late Glacial-Holocene terrestrial paleoecological framework for Prince of Wales Island. An analysis of magnetic properties of core sediments from Pass Lake suggests that unconformities
Identification of contrasting seasonal sea ice conditions during the Younger Dryas
Cabedo-Sanz, P.; Belt, S. T.; Knies, J.
2012-12-01
The presence of the sea ice diatom biomarker IP25 in Arctic marine sediments has been used in previous studies as a proxy for past spring sea ice occurrence and as an indicator of wider palaeoenvironmental conditions for different regions of the Arctic over various timescales [e.g. 1, 2]. The current study focuses on high-resolution palaeo sea ice reconstructions for northern Norway during the last ca. 15 cal. kyr BP. Within this study, particular emphasis has been placed on the identification of the sea ice conditions during the Younger Dryas and the application of different biomarker-based proxies to both identify and quantify seasonal sea ice conditions. Firstly, the appearance of the specific sea ice diatom proxy IP25 at ca. 12.9 cal. kyr BP in a marine sediment core (JM99-1200) obtained from Andfjorden has provided an unambiguous but qualitative measure of seasonal sea ice and thus the onset of the Younger Dryas stadial. The near continuous occurrence of IP25 for the next ca. 1400 yr demonstrates seasonal sea ice during this interval, although variable abundances suggest that the recurrent conditions in the early-mid Younger Dryas (ca. 12.9 - 11.9 cal. kyr BP) changed significantly from stable to highly variable sea ice conditions at ca. 11.9 cal. kyr BP and this instability in sea ice prevailed for the subsequent ca. 400 yr. At ca. 11.5 cal. kyr BP, IP25 disappeared from the record indicating ice-free conditions that signified the beginning of the Holocene. Similarly, a high resolution record from the Kveithola Through, western Barents Sea, showed clearly higher IP25 concentrations during the Younger Dryas stadial compared to the Holocene. For both marine records, the IP25 concentrations were also combined with those of the open water phytoplankton biomarker brassicasterol to generate PBIP25 data from which more quantitative measurements of sea ice were determined. The contrasting seasonal sea ice conditions during the Younger Dryas were further verified
Late Neolithic Mondsee Culture in Austria: living on lakes and living with flood risk?
Directory of Open Access Journals (Sweden)
T. Swierczynski
2013-07-01
Full Text Available Neolithic and Bronze Age lake dwellings in the European Alps became recently protected under the UNESCO World Heritage. However, only little is known about the cultural history of the related pre-historic communities, their adaptation strategies to environmental changes and particularly about the almost synchronous decline of many of these settlements around the transition from the Late Neolithic to the Early Bronze Age. For example, there is an ongoing debate whether the abandonment of Late Neolithic lake dwellings at Lake Mondsee (Upper Austria was caused by unfavourable climate conditions or a single catastrophic event. Within the varved sediments of Lake Mondsee, we investigated the occurrence of intercalated detrital layers from major floods and debris flows to unravel extreme surface runoff recurrence during the Neolithic settlement period. A combination of detailed sediment microfacies analysis and μXRF element scanning allows distinguishing debris flow and flood deposits. A total of 60 flood and 12 debris flow event layers was detected between 7000 and 4000 varve years (vyr BP. Compared to the centennial- to millennial-scale average, a period of increased runoff event frequency can be identified between 5900 and 4450 vyr BP. Enhanced flood frequency is accompanied by predominantly siliciclastic sediment supply between ca. 5500 and 5000 vyr BP and enhanced dolomitic sediment supply between 4900 and 4500 vyr BP. A change in the location and the construction technique of the Neolithic lake dwellings at Lake Mondsee can be observed during the period of higher flood frequency. While lake dwellings of the first settlement period (ca. 5800–5250 cal. yr BP were constructed directly on the wetlands, later constructions (ca. 5400–4700 cal. yr BP were built on piles upon the water, possibly indicating an adaptation to either increased flood risk or a general increase of the lake level. However, our results also indicate that other than
Implementació d'una Intranet pel Restaurant "Cal Fesu"
Maldonado Rubio, Lluís Manel
2007-01-01
Aquest projecte consisteix en el disseny i implementació d'una intranet amb zona privada pel restaurant "Cal Fesu", utilitzant una tecnologia puntera com és J2EE (struts). Este proyecto consiste en el diseño e implementación de una intranet con zona privada para el restaurante "Cal Fesu", utilizando una tecnología puntera como es J2EE (struts). This project consists of design and implementation of an intranet with a private area for the restaurant "Cal Fesu", using a leading technology ...
Reviewing the Mid-First Millennium BC {sup 14}C 'warp' using {sup 14}C/bristlecone pine data
Energy Technology Data Exchange (ETDEWEB)
Taylor, R.E., E-mail: retaylor@ucr.edu [Department of Anthropology, University of California, Riverside, Riverside, CA (United States); Cotsen Institute of Archaeology, University of California, Los Angeles, CA (United States); Keck Carbon Cycle Accelerator Mass Spectrometry Laboratory, University of California, Irvine, CA (United States); Southon, John [Keck Carbon Cycle Accelerator Mass Spectrometry Laboratory, University of California, Irvine, CA (United States)
2013-01-15
AMS-based {sup 14}C measurements have been obtained on 53 dendrochronologically-dated Bristlecone pine (Pinus longaeva) wood samples in decadal increments spanning 2300-2750 cal BP with particular interest focused on the decades centered on 2405 cal BP and 2625 cal BP. In general, there is overall agreement with the current IntCal04/09 consensus calibration curve for this period. For the 2400-2410 cal BP interval, our Bristlecone-based {sup 14}C value is consistent with the {sup 14}C value obtained by Belfast on Irish oak for that decade but not on German oak values obtained by Seattle. Our {sup 14}C value for the 2620-2630 cal BP interval is consistent with the German oak (Heidelberg)-based {sup 14}C decadal value. The {sup 10}Be-based reconstruction of {sup 14}C variations over the 2620-2630 cal BP interval also supports the Heidelberg data although clearly additional clarifications are required before the current tree ring-based {sup 14}C and ice core-based {sup 10}Be data for this interval can be accurately interpreted and valid inferences obtained.
Applied CAL on Problem Based Learning Using Gagne’s Instructional Design
Directory of Open Access Journals (Sweden)
Sri Sundari Purbohadi
2014-10-01
Full Text Available Abstract— In the Problem-Based Learning (PBL model, students are expected to study independently. One of the methods that can improve the ability or skill of learners is using Computer Assisted Learning (CAL. Implementation of CAL in PBL should be able to create Self-Directed Learning (SDL culture through appropriate instructional design and interesting modules. In this paper, the CAL software is developed using multimedia learning principles, convenient appearance, and user-friendly navigation. The CAL’s learning content is designed using Gagne's instructional design. The experiment proved the CAL was able to give effect size 0.89 and developed self-directed learning culture. From the interviews, students were very glad and interested to use the CAL modules because they can learn anytime and can reach the course objectives without a lecturer.
A late Holocene pollen record from proglacial Oblong Tarn, Mount Kenya.
Directory of Open Access Journals (Sweden)
Colin J Courtney Mustaphi
Full Text Available High-elevation ecosystems, such as those on Mount Kenya are undergoing significant changes, with accelerated glacial ice losses over the twentieth century creating new space for alpine plants to establish. These ecosystems respond rapidly to climatic variability and within decades of glacial retreat, Afroalpine pioneering taxa stabilize barren land and facilitate soil development, promoting complex patches of alpine vegetation. Periglacial lake sediment records can be used to examine centennial and millennial scale variations in alpine and montane vegetation compositions. Here we present a 5300-year composite pollen record from an alpine tarn (4370 m asl in the Hausberg Valley of Mount Kenya. Overall, the record shows little apparent variation in the pollen assemblage through time with abundant montane forest taxa derived and transported from mid elevations, notably high abundances of aerophilous Podocarpus pollen. Afroalpine taxa included Alchemilla, Helichrysum and Dendrosenecio-type, reflecting local vegetation cover. Pollen from the ericaceous zone was present throughout the record and Poaceae percentages were high, similar to other high elevation pollen records from eastern Africa. The Oblong Tarn record pollen assemblage composition and abundances of Podocarpus and Poaceae since the late Holocene (~4000 cal yr BP-present are similar to pollen records from mid-to-high elevation sites of nearby high mountains such as Mount Elgon and Kilimanjaro. These results suggest a significant amount of uphill pollen transport with only minor apparent variation in local taxa. Slight decreasing trends in alpine and ericaceous taxonomic groups show a long-term response to global late Holocene cooling and a step decrease in rate of change estimated from the pollen assemblages at 3100 cal yr BP in response to regional hydroclimatic variability. Changes in the principal component axis scores of the pollen assemblage were coherent with an independent mid
van Geel, B.; Zazula, G.D.; Schweger, C.E.
2007-01-01
Based on the analysis of pollen and macrofossils Zazula et al. [Zazula, G.D., Froesne, D.G., Elias, S.A., Kuzmina, S., la Farge, C., Reyes, A.V., Sanborn, P.T., Schweger, C.E., Smith, C.A.S., Mathewes, R.W., 2006. Vegetation buried under Dawson tephra (25,300 14C yr BP) and locally diverse late
A 6900-year history of landscape modification by humans in lowland Amazonia
Bush, M. B.; Correa-Metrio, A.; McMichael, C. H.; Sully, S.; Shadik, C. R.; Valencia, B. G.; Guilderson, T.; Steinitz-Kannan, M.; Overpeck, J. T.
2016-06-01
A sedimentary record from the Peruvian Amazon provided evidence of climate and vegetation change for the last 6900 years. Piston cores collected from the center of Lake Sauce, a 20 m deep lake at 600 m elevation, were 19.7 m in length. The fossil pollen record showed a continuously forested catchment within the period of the record, although substantial changes in forest composition were apparent. Fossil charcoal, found throughout the record, was probably associated with humans setting fires. Two fires, at c. 6700 cal BP and 4270 cal BP, appear to have been stand-replacing events possibly associated with megadroughts. The fire event at 4270 cal BP followed a drought that caused lowered lake levels for several centuries. The successional trajectories of forest recovery following these large fires were prolonged by smaller fire events. Fossil pollen of Zea mays (cultivated maize) provided evidence of agricultural activity at the site since c. 6320 cal BP. About 5150 years ago, the lake deepened and started to deposit laminated sediments. Maize agriculture reached a peak of intensity between c. 3380 and 700 cal BP. Fossil diatom data provided a proxy for lake nutrient status and productivity, both of which peaked during the period of maize cultivation. A marked change in land use was evident after c. 700 cal BP when maize agriculture was apparently abandoned at this site. Iriartea, a hyperdominant of riparian settings in western Amazonia, increased in abundance within the last 1100 years, but declined markedly at c. 1070 cal BP and again between c. 80 and -10 cal BP.
Longman, Jack; Veres, Daniel; Ersek, Vasile; Salzmann, Ulrich; Hubay, Katalin; Bormann, Marc; Wennrich, Volker; Schäbitz, Frank
2017-07-01
Reconstructions of dust flux have been used to produce valuable global records of changes in atmospheric circulation and aridity. These studies have highlighted the importance of atmospheric dust in marine and terrestrial biogeochemistry and nutrient cycling. By investigating a 10 800-year-long paleoclimate archive from the Eastern Carpathians (Romania) we present the first peat record of changing dust deposition over the Holocene for the Carpathian-Balkan region. Using qualitative (X-ray fluorescence (XRF) core scanning) and quantitative inductively coupled plasma optical emission spectrometer(ICP-OES) measurements of lithogenic (K, Si, Ti) elements, we identify 10 periods of major dust deposition between 9500-9200, 8400-8100, 7720-7250, 6350-5950, 5450-5050, 4130-3770, 3450-2850, 2000-1450, 800-620, and 60 cal yr BP to present. In addition, we used testate amoeba assemblages preserved within the peat to infer local palaeohydroclimatic conditions. Our record highlights several discrepancies between eastern and western European dust depositional records and the impact of highly complex hydrological regimes in the Carpathian region. Since 6100 cal yr BP, we find that the geochemical indicators of dust flux have become uncoupled from the local hydrology. This coincides with the appearance of millennial-scale cycles in the dust input and changes in geochemical composition of dust. We suggest that this is indicative of a shift in dust provenance from local-regional (likely loess-related) to distal (Saharan) sources, which coincide with the end of the African Humid Period and the onset of Saharan desertification.
van der Bilt, W. G. M.; Bakke, J.; Werner, J.; Paasche, O.; Rosqvist, G. N.; Vatle, S. S.
2016-12-01
Southern Ocean climate is rapidly changing. Yet beyond the instrumental period (± 100 years), our comprehension of climate variability in the region is restricted by a lack of high-resolution paleoclimate records. Alpine glaciers, ubiquitous on Southern Ocean islands, may provide such data as they rapidly respond to climate shifts, recording attendant changes in extent by variations in glacial erosion. Rock flour, the fine-grained fraction of this process, is suspended in meltwater streams and transfers this signal to the sediments of downstream lakes, continuously recording glacier history. Here, we use this relationship and present the first reconstruction of the Late Holocene (1250 cal. yr BP - present) glacier history of the Southern Ocean island of South Georgia, using sediments from the glacier-fed Middle Hamberg lake. Variations are resolved on multi-centennial scales due to robust chronological control. To fingerprint a glacial erosion signal, we employed a set of routinely used physical, geochemical and magnetic parameters. Using Titanium counts, validated against changes in sediment density and grain size distribution, we continuously reconstruct glacier variations over the past millennium. Refining local moraine evidence and supporting evidence from other Southern Hemisphere sites, this study shows a progressive diminishing of consecutive Late Holocene advances. These include a two-stage Little Ice Age, in agreement with other Southern Hemisphere glacier evidence. The presented record furthermore captures an unreported retreat phase behind present limits around 500 cal. yr BP.
Radiocarbon dating of large termite mounds of the miombo woodland of Katanga, DR Congo
Erens, Hans; Boudin, Mathieu; Mees, Florias; Dumon, Mathijs; Mujinya, Basile; Van Strydonck, Mark; Baert, Geert; Boeckx, Pascal; Van Ranst, Eric
2015-04-01
The miombo woodlands of South Katanga (D.R. Congo) are characterized by a high spatial density of large conic termite mounds built by Macrotermes falciger (3 to 5 ha-1, ~5 m high, ~15 m in diameter). The time it takes for these mounds to attain this size is still largely unknown. In this study, the age of four of these mounds is determined by 14C-dating the acid-insoluble organic carbon fraction of samples taken along the central vertical axis of two active and two abandoned mounds. The age sequence in the active mounds is erratic, but the results for the abandoned mounds show a logical increase of 14C-age with depth. The ages measured at 50 cm above ground level were 2335 - 2119 cal yr BP for the large abandoned mound (630 cm high), and 796 - 684 cal yr BP for the small abandoned mound (320 cm high). Cold-water-extractable organic carbon (CWEOC) measurements combined with spectroscopic analysis revealed that the lower parts of the active mounds may have been contaminated with recent carbon that leached from the active nest. Nonetheless, this method appears to provide reliable age estimates of large, abandoned termite mounds, which are older than previously estimated. Furthermore, historical mound growth rates seem to correspond to past temperature changes, suggesting a relation between past environmental conditions and mound occupancy. Keywords : 14C, water-extractable carbon, low-temperature combustion
Shore displacement in northern Uppland during the last 6500 calender years
Energy Technology Data Exchange (ETDEWEB)
Hedenstroem, Anna; Risberg, Jan [Stockholm Univ. (Sweden). Dept. of Physical Geography and Quaternary Geology
2003-10-01
This report describes the shore displacement in northern Uppland, Sweden. Four lake basins were investigated regarding elevation and age of their isolation events. The methods applied were diatom stratigraphy and AMS radiocarbon datings of terrestrial macrofossils, together with analysis of water, organic carbon and calcium carbonate in the sediment. Lake Barsjoe (22.5 masl -meters above sea level) was isolated 3,200 cal yrs BP, Lake Landholmssjoen (16.0 masl) 2,200 cal yrs BP, Lake Soedra Aassjoen (10.8 masl) 1,400 cal yrs BP and Lake Eckarfjaerden (5.5 masl) 850 cal yrs BP. Combined with six basins located at approximately the 70 m Litorina Limit isobase it was concluded that the shore displacement during the last 6500 calendar years was regressive in nature. The isolation processes, however, seem to have been prolonged at 4750-4150 cal yrs BP, 2500-2200 cal yrs Bp and 1100-850 cal yrs BP. These events can be correlated with eustatic sea level rises recorded in the Stockholm area. The diatom succession during the formation of the oligotrophic hardwater Lakes Barsjoe, Landholmssjoen and Eckarfjaerden differs from the brownwater Lake Soedra Aasjoen. Short pre-isolation sequences indicate that erosion has affected the four basins investigated. Accumulation rates in the lake basins vary between 0.5 mm/year in Lake Barsjoe and 1.5 mm/year in Lake Soedra Aasjoen.
Shore displacement in northern Uppland during the last 6500 calender years
International Nuclear Information System (INIS)
Hedenstroem, Anna; Risberg, Jan
2003-10-01
This report describes the shore displacement in northern Uppland, Sweden. Four lake basins were investigated regarding elevation and age of their isolation events. The methods applied were diatom stratigraphy and AMS radiocarbon datings of terrestrial macrofossils, together with analysis of water, organic carbon and calcium carbonate in the sediment. Lake Barsjoe (22.5 masl -meters above sea level) was isolated 3,200 cal yrs BP, Lake Landholmssjoen (16.0 masl) 2,200 cal yrs BP, Lake Soedra Aassjoen (10.8 masl) 1,400 cal yrs BP and Lake Eckarfjaerden (5.5 masl) 850 cal yrs BP. Combined with six basins located at approximately the 70 m Litorina Limit isobase it was concluded that the shore displacement during the last 6500 calendar years was regressive in nature. The isolation processes, however, seem to have been prolonged at 4750-4150 cal yrs BP, 2500-2200 cal yrs Bp and 1100-850 cal yrs BP. These events can be correlated with eustatic sea level rises recorded in the Stockholm area. The diatom succession during the formation of the oligotrophic hardwater Lakes Barsjoe, Landholmssjoen and Eckarfjaerden differs from the brownwater Lake Soedra Aasjoen. Short pre-isolation sequences indicate that erosion has affected the four basins investigated. Accumulation rates in the lake basins vary between 0.5 mm/year in Lake Barsjoe and 1.5 mm/year in Lake Soedra Aasjoen
On the correspondence between CAL and lagged cohort life expectancy
Directory of Open Access Journals (Sweden)
Michel Guillot
2011-04-01
Full Text Available It has been established that under certain mortality assumptions, the current value of the Cross-sectional Average length of Life (CAL is equal to the life expectancy for the cohort currently reaching its life expectancy. This correspondence is important, because the life expectancy for the cohort currently reaching its life expectancy, or lagged cohort life expectancy (LCLE, has been discussed in the tempo literature as a summary mortality measure of substantive interest. In this paper, we build on previous work by evaluating the extent to which the correspondence holds in actual populations. We also discuss the implications of the CAL-LCLE correspondence (or lack thereof for using CAL as a measure of cohort life expectancy, and for understanding the connection between CAL, LCLE, and underlying period mortality conditions.
L’Observatoire numérique Nouvelle-Calédonie
Directory of Open Access Journals (Sweden)
Charlotte Ullmann
2013-06-01
Full Text Available Ses missions consistent à observer le développement numérique et favoriser l’animation territoriale des acteurs en Nouvelle-Calédonie. Parrainée par l’association calédonienne pour les technologies de l’information et de la communication (ACTIC et le ministère en charge de l’économie numérique du Gouvernement de Nouvelle-Calédonie nommé depuis mai 2009, une mission d’étude a été menée depuis juin 2010 pour définir les contours d’un Observatoire numérique. A travers cette étude, il s’agissai...
Energy Technology Data Exchange (ETDEWEB)
Stannard, Sandra [California Polytechnic State Univ., San Luis Obispo, CA (United States)
2016-06-15
The target budget of INhouse was about $650,000 for all materials and student expenses of the Solar Decathlon competition. In order to reach our goal, Cal Poly students and faculty worked with the College of Architecture and Environmental Design’s External Relations office to actively fundraise for INhouse. Students connected with Cal Poly alumni through phone calls, postal mail, email, and live presentations to reach as many alumni in the state of California as possible. Before construction begun, students and faculty met on a weekly basis to determine what brands of materials for the home to use and who would be responsible for reaching out to the company to seek a donation. Our College of Architecture and Environmental Design’s administration was essential in helping us fundraise. For some time, the college was hoping to depend on about half of our fundraising expenses to be covered through the sale of INhouse. However, plans to sell the home fell through during the design development phase; the college turned to the sale of a different asset in to help us meet our goal. If we were to do this project again, completing the design concept and securing a future location of our home sooner would have enhanced our fundraising activities.
Digital Repository Service at National Institute of Oceanography (India)
Kurian, S.; Agnihotri, R.; Borole, D.V.; Naqvi, S.W.A.; Ferreira, A.M.; Vale, C.
. In addition to two conventional productivity indicators viz. sedimentary organic carbon (C org ) and CaCO 3 , we also employ, for the first time in the region, four biomarkers (dinosterol, phytol, stigmasterol and β-sitosterol) for this purpose. 2. Core... of ~13 years. The AMS 14 C dating of bulk organic matter from the 97-99 cm level yielded an age of 900±66 (1σ) Cal yr BP (Agnihotri et al., in press, b). The radiocarbon age was converted to the calendar age using CALIB radiocarbon calibration program...
Carbon storage and long-term rate of accumulation in high-altitude Andean peatlands of Bolivia
Directory of Open Access Journals (Sweden)
J.A. Hribljan
2015-11-01
Full Text Available (1 The high-altitude (4,500+ m Andean mountain range of north-western Bolivia contains many peatlands. Despite heavy grazing pressure and potential damage from climate change, little is known about these peatlands. Our objective was to quantify carbon pools, basal ages and long-term peat accumulation rates in peatlands in two areas of the arid puna ecoregion of Bolivia: near the village of Manasaya in the Sajama National Park (Cordillera Occidentale, and in the Tuni Condoriri National Park (Cordillera Real. (2 We cored to 5 m depth in the Manasaya peatland, whose age at 5 m was ca. 3,675 yr. BP with a LARCA of 47 g m-2 yr-1. However, probing indicated that the maximum depth was 7–10 m with a total estimated (by extrapolation carbon stock of 1,040 Mg ha-1. The Tuni peat body was 5.5 m thick and initiated ca. 2,560 cal. yr. BP. The peatland carbon stock was 572 Mg ha-1 with a long-term rate of carbon accumulation (LARCA of 37 g m-2 yr-1. (3 Despite the dry environment of the Bolivian puna, the region contains numerous peatlands with high carbon stocks and rapid carbon accumulation rates. These peatlands are heavily used for llama and alpaca grazing.
Holocene reef accretion: southwest Molokai, Hawaii, U.S.A.
Engels, Mary S.; Fletcher, Charles H.; Field, Michael E.; Storlazzi, Curt D.; Grossman, Eric E.; Rooney, John J.B.; Conger, Christopher L.; Glenn, Craig
2004-01-01
Two reef systems off south Molokai, Hale O Lono and Hikauhi (separated by only 10 km), show strong and fundamental differences in modern ecosystem structure and Holocene accretion history that reflect the influence of wave-induced near-bed shear stresses on reef development in Hawaii. Both sites are exposed to similar impacts from south, Kona, and trade-wind swell. However, the Hale O Lono site is exposed to north swell and the Hikuahi site is not. As a result, the reef at Hale O Lono records no late Holocene net accretion while the reef at Hikauhi records consistent and robust accretion over late Holocene time. Analysis and dating of 24 cores from Hale O Lono and Hikauhi reveal the presence of five major lithofacies that reflect paleo-environmental conditions. In order of decreasing depositional energy they are: (1) coral-algal bindstone; (2) mixed skeletal rudstone; (3) massive coral framestone; (4) unconsolidated floatstone; and (5) branching coral framestone-bafflestone. At Hale O Lono, 10 cores document a backstepping reef ranging from ∼ 8,100 cal yr BP (offshore) to ∼ 4,800 cal yr BP (nearshore). A depauperate community of modern coral diminishes shoreward and seaward of ∼ 15 m depth due to wave energy, disrupted recruitment activities, and physical abrasion. Evidence suggests a change from conditions conducive to accretion during the early Holocene to conditions detrimental to accretion in the late Holocene. Reef structure at Hikauhi, reconstructed from 14 cores, reveals a thick, rapidly accreting and young reef (maximum age ∼ 900 cal yr BP). Living coral cover on this reef increases seaward with distance from the reef crest but terminates at a depth of ∼ 20 m where the reef ends in a large sand field. The primary limitation on vertical reef growth is accommodation space under wave base, not recruitment activities or energy conditions. Interpretations of cored lithofacies suggest that modern reef growth on the southwest corner of Molokai, and by
International Nuclear Information System (INIS)
Kitamura, Yoshinori; Muroo, Yoji; Hamanaka, Isao
2003-01-01
A new type of burnable poison (BP) volume reduction system is currently being developed. Many BP rods, a subcomponent of spent fuel assemblies are discharged from nuclear power reactors. This new system reduces the overall volume of BP rods. The main system consists of BP rod cutting equipment, equipment for the recovery of BP cut pieces, and special transport equipment for the cut rods. The equipment is all operated by hydraulic press cylinders in water to reduce operator exposure to radioactivity. (author)
The Pace of CalWORKs Implementation
National Research Council Canada - National Science Library
Klerman, Jacob
2000-01-01
...) and Greater Avenues to Independence (GAIN) with the California Work Responsibility to Kids (CalWORKs) program. Following an open and competitive bidding process, the California Department of Social Services...
The Pace of CalWORKS Implementation
National Research Council Canada - National Science Library
Klerman, Jacob
1999-01-01
...) and Greater Avenues to Independence (GAIN) with the California Work Responsibility to Kids (CalWORKs) program. Following an open and competitive bidding process, the California Department of Social Services...
Estrategias de desarrollo para la empresa Cal del Centro S.A.C.
Bautista Antón, Yovanni Patricia; Mendoza Rojas, Miguel Ángel
2015-01-01
Cal del Centro S.A.C. es una sociedad anónima cerrada cuyo negocio gira en torno a la actividad económica de la fabricación de cemento, cal y yeso. El objetivo del presente trabajo es evaluar la posibilidad de éxito de un proyecto de inversión en una planta de cal, a través de Cal del Centro S.A.C. –como empresa autosuficiente–, para asegurar el cien por ciento del suministro de óxido de calcio en cantidad y calidad para el procesamiento de concentrados de cobre y el tratamiento de aguas indu...
Ortega-Rosas, C. I.; Guiot, J.; Peñalba, M. C.; Ortiz-Acosta, M. E.
2008-04-01
6 ka. Climate Dynamics 12, 185-194), we modified the pollen-PFT and PFT-biomes assignation of Thompson and Anderson (Thompson, R.S., Anderson, K.H., 2000. Biomes of western North America at 18,000; 6000 and 0 14C yr BP reconstructed from pollen and packrat midden data. Journal of Biogeography 27, 555-584) for a better representation of the modern vegetation of NW Mexico. The biome reconstruction method was validated with the modern pollen sites and applied to the fossil sites. Our results show that, during the early Holocene, a cool conifer forest extended at least down to 1700 m, while today this biome is present above 2000 m in the Chihuahua state. The Younger Dryas event was recorded in one site with cold and dry conditions. The reconstructed annual temperature for this period was 3°-6 °C colder than today, and annual precipitation was 250 mm lower than at present (900 mm/yr). The middle Holocene after 9200 cal yr BP was marked by a warming trend, reaching temperatures 2 °C warmer than today at 7000 cal yr BP, and by the installation of a warm mixed forest, the present day biome, at 1700 m elevation, while at higher elevations (1900 m) the cool conifer forest was still present. Summer precipitation was 200 mm/yr above the early Holocene values, suggesting that monsoon-like conditions strengthened since 9200 cal yr BP at this region. During the last 4000 yr, the same warm mixed forest was reconstructed below 1700 m and a conifer forest above 1700 m. A great variability of vegetation and climate patterns was recorded for the last 3000 yr particularly at high elevation sites, where warming and cooling trends would be coeval of the Medieval warm period and Little Ice Age, likely related to ENSO variability.
Digital Repository Service at National Institute of Oceanography (India)
Sijinkumar, A.V.; Nath, B.N.; Possnert, G.; Aldahan, A.
abundance, and which matches well with the Pacific records influenced by the Kuroshio Current. Additionally, two significant minimum events of P. obliquiloculata are also seen during the Younger Dryas (YD) and late Last Glacial Maximum (LGM, 20-18 cal ka... (LGM, 20-18 cal ka BP, Younger Dryas (YD, 13-10.5 cal ka BP) and late Holocene (4.5-3 cal ka BP). Northern core SK 168 shows distinctive minimum events and the intensity of variation reduces towards the south. The Holocene PME is a little longer...
Design de calçado do processo criativo à produção
Rolo, Margarida Filipa Gonçalves Araújo
2016-01-01
O seguinte projeto tem como tema principal o Design de calçado, pois foi com base nesse tema que foi feito todo o enquadramento teórico de modo a fundamentar a criação da coleção final de calçado a que este projeto se pretende. Logo, foi realizada uma pesquisa sobre a história do calçado, os seus materiais e componentes, tipos de sapatos e saltos, a indústria do calçado em Portugal e seus principais designers, entre outros. Este projeto consiste na criação de uma coleção cápsula de calçado...
Draganits, Erich; Gier, Susanne; Hofmann, Christa-Ch.; Janda, Christoph; Bookhagen, Bodo; Grasemann, Bernhard
2014-08-01
300 MW Baspa II is India's largest private hydroelectric facility, located at the Baspa River which is an important left-hand tributary to the Sutlej River in the NW Himalaya (India). In this valley the Sangla palaeo-lake has been dammed around 8200 yr BP behind a rock-avalanche dam and Baspa II is located exactly on top of this palaeo-lake. This special location represents a very rare possibility to evaluate the short-term, river load and hydrological parameters measured during the planning and operational stages of Baspa II with the long-term parameters gained from the palaeo-lake sediments from the catchment. Sedimentological and geomorphological investigations of the lacustrine sediments have been used to reconstruct environmental changes during >2500 years of its existence. The Mid-Holocene erosion rates of the Baspa catchment estimated from the volume and duration of deposition of the exposed lake sediments are at 0.7-1.0 mm yr-1, almost identical with the modern erosion rates calculated from river gauge data from Baspa II. Several charcoal layers and charcoal pieces from the uppermost palaeo-lake levels around 5000 cal yr BP might be related to woodland clearance and they possibly represent one of the oldest evidences for human presence in the Baspa Valley during Neolithic time.
CalCOFI Larvae Counts Positive Tows
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for eggs captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Egg Counts Positive Tows
National Oceanic and Atmospheric Administration, Department of Commerce — Fish egg counts and standardized counts for eggs captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets], and...
Holocene fire activity and vegetation response in South-Eastern Iberia
Gil-Romera, Graciela; Carrión, José S.; Pausas, Juli G.; Sevilla-Callejo, Miguel; Lamb, Henry F.; Fernández, Santiago; Burjachs, Francesc
2010-05-01
Since fire has been recognized as an essential disturbance in Mediterranean landscapes, the study of long-term fire ecology has developed rapidly. We have reconstructed a sequence of vegetation dynamics and fire changes across south-eastern Iberia by coupling records of climate, fire, vegetation and human activities. We calculated fire activity anomalies (FAAs) in relation to 3 ka cal BP for 10-8 ka cal BP, 6 ka cal BP, 4 ka cal BP and the present. For most of the Early to the Mid-Holocene uneven, but low fire events were the main vegetation driver at high altitudes where broadleaved and coniferous trees presented a highly dynamic post-fire response. At mid-altitudes in the mainland Segura Mountains, fire activity remained relatively stable, at similar levels to recent times. We hypothesize that coastal areas, both mountains and lowlands, were more fire-prone landscapes as biomass was more likely to have accumulated than in the inland regions, triggering regular fire events. The wet and warm phase towards the Mid-Holocene (between ca 8 and 6 ka cal BP) affected the whole region and promoted the spread of mesophytic forest co-existing with Pinus, as FAAs appear strongly negative at 6 ka cal BP, with a less important role of fire. Mid and Late Holocene landscapes were shaped by an increasing aridity trend and the rise of human occupation, especially in the coastal mountains where forest disappeared from ca 2 ka cal BP. Mediterranean-type vegetation (evergreen oaks and Pinus pinaster- halepensis types) showed the fastest post-fire vegetation dynamics over time.
An Interaction of Screen Colour and Lesson Task in CAL
Clariana, Roy B.
2004-01-01
Colour is a common feature in computer-aided learning (CAL), though the instructional effects of screen colour are not well understood. This investigation considers the effects of different CAL study tasks with feedback on posttest performance and on posttest memory of the lesson colour scheme. Graduate students (n=68) completed a computer-based…
Views of a Cal/OSHA Inspector.
Oudiz, Jack
2009-01-01
Retiring CAL/OSHA Industrial Hygienist and Senior Safety Engineer Jack Oudiz offers his thoughts in the nature of a voluntary "exit interview" on his years working for the agency and its performance in its mission.
Directory of Open Access Journals (Sweden)
K. Antonsson
2008-10-01
Full Text Available Climate reconstructions from central Scandinavia suggest that annual and summer temperatures were rising during the early Holocene and reached their maximum after 8000 cal yr BP. The period with highest temperatures was characterized by increasingly low lake-levels and dry climate, with driest and warmest conditions at about 7000 to 5000 cal yr BP. We compare the reconstructed climate pattern with simulations of a climate model for the last 9000 years and show that the model, which is predominantly driven by solar insolation patterns, suggests less prominent mid-Holocene dry and warm period in Scandinavia than the reconstructions. As an additional explanation for the reconstructed climate, we argue that the trend from the moist early Holocene towards dry and warm mid-Holocene was caused by a changing atmospheric circulation pattern with a mid-Holocene dominance of summer-time anticyclonic circulation. An extreme case of the anticyclonic conditions is the persistent blocking high, an atmospheric pressure pattern that at present often causes long spells of particularly dry and warm summer weather, or "Indian summers". The argument is tested with daily instrumental temperature and precipitation records in central Sweden and an objective circulation classification based on surface air pressure over the period 1900–2002. We conclude that the differences between the precipitation and temperature climates under anticyclonic and non-anticyclonic conditions are significant. Further, warm and dry combination, as indicated by mid-Holocene reconstructions, is a typical pattern under anticyclonic conditions. These results indicate that the presented hypothesis for the mid-Holocene climate is likely valid.
Fitch, E. P.; Meyer, G. A.
2017-12-01
A major influence of wildfire on long-term erosion in the western USA is strongly suggested by extreme postfire debris flows and floods, where fire severity has increased in recent decades due to climate change and land use. Roughly 30% of the ponderosa-mixed conifer forests of the Jemez Mountains has burned in the last 20 yr, much at high severity, whereas tree-ring data indicate mostly lower-severity burns from 1600-1900 CE, before fire suppression and grazing. Fire-related alluvial deposits proximal to hillslopes reflect mostly small to moderate erosional events over the last 4000 yr, compared to thick, bouldery debris-flow deposits from recent severe fires; some modern postfire debris flows appear truly extreme in comparison to Holocene deposits. Recognizable fire-related deposits make up 77% of fans from moist north aspects, as relatively dense vegetation and thick soil yield minor surface runoff unless severely burned. Only 39% of fan sediments from drier south aspects are fire-related, however, as sparser vegetation and exposed bedrock can produce runoff and sediment when unburned. Peaks in fire-related sedimentation at 1800, 650, 410, and 300 cal yr BP coincide with severe droughts, often preceded by wetter decades that could suppress fire activity and promote denser stands. Although the Medieval Climatic Anomaly (MCA, 1050-700 cal yr BP) was marked by generally warmer temperatures and multidecadal episodes of widespread, severe drought in the western USA, fire-related sedimentation was relatively minor in the Jemez Mountains. In contrast, dense subalpine forests of Yellowstone and central Idaho burned less frequently and more severely in the late Holocene, and produced major debris flows in the MCA. Fire accounts for only 30-50% of Holocene fan deposition in these areas, as steep unburned basins also produce large debris flows in extreme storms. The relative importance of fire in erosion depends on topography, bedrock, soil cover, and forest composition
Muscheler, Raimund; Adolphi, Florian; Bronk Ramsey, Christopher; Rasmussen, Sune; Hughen, Konrad; Cooper, Alan; Turney, Chris
2017-04-01
The production rates of cosmogenic radionuclides (such as 10Be and 14C) are modulated by the solar and geomagnetic shielding of galactic cosmic rays. In addition, 14C and 10Be are influenced by the carbon cycle and the atmospheric transport and deposition, respectively. Isolating and identifying the common production signal allows us to synchronize ice core 10Be and tree ring 14C records during the Holocene (Adolphi and Muscheler, 2016), thereby connecting ice core climate records with 14C-dated records. Extending this comparison further back in time is challenging due to deteriorating quality of the 14C calibration record, IntCal13, (Reimer et al., 2013) and possible unidentified climate influences on the ice-core 10Be records. Nevertheless, by focusing on the most prominent production-rate features this comparison can be extended far back into the last glacial where, for example, the linkage of tree-ring based Kauri 14C data and the Greenland ice-core time scale (GICC05) suggested unresolved data and/or time scale differences around the period of the Laschamp geomagnetic field minimum at about 42000 yrs BP (Muscheler et al., 2014). Here we show that the data underlying the IntCal13 14C record and the ice-core 10Be records exhibit common variability that allows us to tentatively link the ice core GICC05 time scale to the radiocarbon time scale for almost the complete radiocarbon dating range. The observed time scale differences could be related to uncertainties in both the U/Th-based dating of the IntCal13 calibration data set and the GICC05 time scale, and we show that the two can be reconciled within the uncertainties of the ice-core layer counting. This direct comparison between IntCal13 and 10Be also suggests that the 14C differences shown in (Muscheler et al., 2014) around the Laschamp geomagnetic field minimum can be reduced by moderate adjustments to the GICC05 time scale. References: Adolphi, F., and Muscheler, R., 2016, Synchronizing the Greenland ice
The impact of BeamCal performance at different international linear ...
Indian Academy of Sciences (India)
The ILC accelerator parameters and detector concepts are still under discussion in the world-wide community. As will be shown, the performance of the BeamCal, the calorimeter in the very forward area of the ILC detector, is very sensitive to the beam parameter and crossing angle choices. We propose here BeamCal ...
International Nuclear Information System (INIS)
Chan, J.G.
2000-01-01
Full text: A monograph for Fluorodeoxyglucose F-18 Injection (FDG) was first released in Supplement 1 of the United States Pharmacopoeia 1990 (USP 90) on 1 November 1989 to become effective on 1 January 1990. As this was the only monograph available until recently it served as the applicable standard to be followed. The Therapeutic Goods Act states that the British Pharmacopoeia (BP) is the precedent to be followed in Australia and implies that if a monograph exists for a finished product then this needs to be applied to achieve a certain standard of quality. If the monograph does not exist in the BP then other pharmacopoeia monographs can be sourced starting with the European Pharmacopoeia (Ph Eur) then the USP. A monograph for FDG first appeared in the Ph Eur in a 1999 Supplement (effective 1 January 1999 and now included in the Ph Eur 2000) and then in the BP 1999 (effective 1 December 1999). The Commonwealth Government Gazette (Notice 48, 1/12/99) published that the BP 99 was adopted on the 1st December 1999. Since then manufacturers have been required to comply with the monograph for FDG in the BP 99. This presentation looks at the content of the BP 99 monograph and compares it with that in the USP. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc
Progress Report on an Ultra-compact LumiCal
Borysov, O
2018-01-01
A new design of a detector module of submillimeter thickness for an electromagnetic calorimeter is presented. It is aimed to be used in the luminometers LumiCal and BeamCal in future linear e+e− collider experiments. The module prototypes were produced utilizing novel connectivity schemes technologies. They are installed in a compact prototype of the calorimeter and tested at DESY with an electron beam of 1 GeV – 6 GeV. The performance of eight detector modules and the possibility of electron and photon identification is studied.
Cal-Bridge and CAMPARE: Engaging Underrepresented Students in Physics and Astronomy
Rudolph, Alexander L.; Cal-Bridge and CAMPARE Teams
2018-01-01
We describe two programs, Cal-Bridge and CAMPARE, with the common mission of increasing participation of groups traditionally underrepresented in astronomy, through summer research opportunities, in the case of CAMPARE, scholarships in the case of Cal-Bridge, and significant mentoring in both programs, creating a national impact on their numbers successfully pursuing a PhD in the field.In 8 years, the CAMPARE program has sent 112 students, >80% from underrepresented groups, to conduct summer research at one of 14 major research institutions throughout the country. Of the CAMPARE scholars who have graduated with a Bachelor’s degree, almost two-thirds (65%) have completed or are pursuing graduate education in physics, astronomy, or a related field, at institutions including UCLA, UC Riverside, UC Irvine, UC Santa Barbara, USC, Stanford, Univ. of Arizona, Univ. of Washington, Univ. of Rochester, Michigan State Univ., Georgia Tech, Georgia State Univ., Kent State, Indiana Univ., Univ. of Oregon, Syracuse Univ., Montana State Univ., and the Fisk-Vanderbilt Master’s-to-PhD program.Now entering its fourth year, the Cal-Bridge program is a CSU-UC Bridge program comprised of >140 physics and astronomy faculty from 9 University of California (UC), 15 California State University (CSU), and 30 California Community College (CCC) campuses throughout California. In the first four years, 34 Cal-Bridge Scholars have been selected, including 22 Hispanic, 3 African-American and 13 women students, 10 of whom are from URM groups. Thirty (30) of the 34 Cal-Bridge Scholars are first generation college students. In the last two years, 11 of 13 Cal-Bridge Scholars have begun PhD programs in physics or astronomy at top PhD programs nationally. Three (3) of these 11 scholars have won NSF Graduate Research Fellowships; one more received an Honorable Mention. The next cohort applies this fall.Cal-Bridge provides much deeper mentoring and professional development experiences over the last
Balzano, Rita; Lindblad, Ylva Tranaeus; Vavilis, Georgios; Jogestrand, Tomas; Berg, Ulla B; Krmar, Rafael T
2011-09-01
In adult hypertensive patients, increased cIMT and LVH are independent risk factors for cardiovascular events. We have previously observed that in pediatric RTRs with tight control of BP, cIMT did not progress over time. This investigation is an extension of the aforementioned study aimed at re-examining cIMT and also reporting serial echocardiography results. Twenty-two RTRs aged 9.4 ± 3.3 yr at their baseline carotid scan underwent two additional vascular ultrasounds during a follow-up of 9.1 ± 0.9 yr. Carotid scan and echocardiography examinations were carried out simultaneously with ABPM. Antihypertensive therapy was determined according to the recipient's ABPM results, which were performed at yearly intervals. Baseline cIMT was significantly greater in RTRs than in healthy controls. There was no statistical evidence of systematic changes in cIMT over time. At the last examination, 14 of 17 RTRs with treated hypertension had controlled hypertension (prevalence 82%; 95% CI, 56.5-96.2), and the overall prevalence of LVH was 4.5% (95% CI, -0.01 to 23.5). The lack of progression of cIMT over time and the low prevalence of LVH might reflect the effect of long-standing BP control. © 2011 John Wiley & Sons A/S.
DEFF Research Database (Denmark)
Wirth, S. B.; Gilli, A.; Niemann, H.
2013-01-01
reducing conditions and subsequent rapid precipitation of Mn-(oxyhydr) oxide minerals during episodic and short-term water-column mixing events mainly due to flood-induced underflows. At 9800 +/- 130 cal yr BP, a rapid transition to fully sulfidic conditions is indicated by the marked enrichment of Mo......-transition period beginning shortly after the lake formation similar to 12.5 kyr ago. The oxic period is characterized by low sedimentary Mn and Mo concentrations, as well as by the absence of any remnants of anoxygenic phototrophic sulfur bacteria. Enhanced accumulation/preservation of Mn (up to 5.6 wt...
Reconstructing Holocene vegetation on the island of Gran Canaria before and after human colonization
DEFF Research Database (Denmark)
de Nascimento, Lea; Nogué, Sandra; Criado, Constantino
2016-01-01
, 400 years before the earliest archaeological evidence of human presence in the island (c. 1900 cal. yr BP). Our data show an increased frequency of fires at that time, coinciding with the decline of palms and the increase of grasses, indicating that humans were present and were transforming vegetation......, thus showing that the demise of Gran Canaria’s forest began at an early point in the prehistoric occupation of the island. In the following centuries, there were no signs of forest recovery. Pollen from cultivated cereals became significant, implying the introduction of agriculture in the site, by 1800...
Sharma, Shruti; Mora, G.; Johnston, J.W.; Thompson, T.A.
2005-01-01
Beach ridges along the coastline of Lake Superior provide a long-term and detailed record of lake level fluctuations for the past 4000 cal BP. Although climate change has been invoked to explain these fluctuations, its role is still in debate. Here, we reconstruct water balance by employing peat samples collected from swale deposits present between beach ridge sequences at two locations along the coastline of Lake Superior. Carbon isotope ratios for Sphagnum remains from these peat deposits are used as a proxy for water balance because the presence or absence of water films on Sphagnum controls the overall isotope discrimination effects. Consequently, increased average water content in Sphagnum produces elevated ??13C values. Two maxima of Sphagnum ??13C values interpreted to reflect wetter conditions prevailed from 3400 to 2400 cal BP and from about 1900 to 1400 cal BP. There are two relatively short drier periods as inferred from low Sphagnum ??13C values: one is centered at about 2300 cal BP, and one begins at 1400 cal BP. A good covariance was found between Sphagnum ??13C values and reconstructed lake-levels for Lake Michigan in which elevated carbon isotope values correlate well with higher lake levels. Based on this covariance, we conclude that climate exerts a strong influence on lake levels in Lake Superior for the past 4000 cal BP. ?? 2005 Elsevier Ltd. All rights reserved.
Jia, Feifei; Lu, Ruijie; Liu, Xiaokang; Zhao, Chao; Lv, Zhiqiang; Gao, Shangyu
2018-05-01
A high-resolution lacustrine-peat record from the desert-loess transitional zone in Northern China was obtained to reconstruct Holocene environmental change in the region. AMS 14C dates are used to provide a chronology. The results indicate that the site was a desert environment before 12.2 cal kyr BP, and was then occupied by a paleolake which started to shrink, with a wetland occurring from 6.2 to 3.0 cal kyr BP. Subsequently, the site became a seasonally water-filled depression. Based on the lithology and measurements of grain size and total organic carbon content, the climate changed from arid to humid at 12.2 cal kyr BP, and became more humid after 8.3 cal kyr BP. From 6.2 to 3.0 cal kyr BP, precipitation decreased but the climate remained at an optimum. After 3.0 cal kyr BP, the climate was dry overall but with several humid intervals. A comparison of paleoclimatic records from lacustrine and aeolian deposits from the region reveals a discrepancy about the nature of the early Holocene climate, and we conclude that this is because lacustrine sediments responded more sensitively to precipitation than aeolian deposits when the temperature was low. The environmental evolution of the region was synchronous with changes in the Asian summer monsoon (ASM), but temperature also played a key role in the early Holocene.
Windows Calorimeter Control (WinCal) program computer software test plan
International Nuclear Information System (INIS)
Pertzborn, N.F.
1997-01-01
This document provides the information and guidelines necessary to conduct all the required testing of the Windows Calorimeter Control (WinCal) system. The strategy and essential components for testing the WinCal System Project are described in this test plan. The purpose of this test plan is to provide the customer and performing organizations with specific procedures for testing the specified system's functions
Haga, Monika; Gísladóttír, Thórdís; Sigmundsson, Hermundur
2015-12-01
Developing motor competence and physical fitness can affect the maintenance of a sufficient level of physical activity in children and adolescents. This study assesses the relationship between motor competence and physical fitness from childhood through early adolescence. A cross-sectional sample of 194 participants from 4 to 16 years old were divided into three groups; 4-6 yr. (n=42, M age=5.2, SD 0.6), 11-12 yr. (n=58, M age=12.4, SD=0.3), and 15-16 yr. (n=94, M age=15.9, SD=0.4). To assess motor competence, each child completed the Movement Assessment Battery for Children (MABC). To measure physical fitness, three tasks (strength, speed, and endurance) were selected from the Test of Physical Fitness (TPF). To analyze the significance of the difference between the correlation coefficient in the three age groups (samples) (4-6, 11-12, and 15-16 yr.), Fischer r-to-z transformation was used. The correlation (Pearson's) between motor competence and physical fitness in the age groups was statistically higher for the youngest age groups (4-6 and 11-12 yr.) and the adolescent group (age 15-16). The differences between the two youngest age groups were not statistically significant. The results demonstrate that the correlation between motor competence and physical fitness decreases with age.
Cal-Bridge and CAMPARE: Engaging Underrepresented Students in Physics and Astronomy
Rudolph, Alexander L.; Smecker-Hane, Tammy A.; Cal-Bridge Team; CAMPARE Team
2018-06-01
We describe two programs, Cal-Bridge and CAMPARE, with the common mission of increasing participation of groups traditionally underrepresented in astronomy, through summer research opportunities, in the case of CAMPARE, scholarships in the case of Cal-Bridge, and significant mentoring in both programs, creating a national impact on their numbers successfully pursuing a PhD in the field. In 9 years, the CAMPARE program has sent 150 students, >80% from underrepresented groups, to conduct summer research at one of 14 major research institutions throughout the country. Of the CAMPARE scholars who have graduated with a Bachelor’s degree, almost two-thirds (65%) have completed or are pursuing graduate education in physics, astronomy, or a related field, at institutions including UCLA, UC Riverside, UC Irvine, UC Santa Barbara, USC, Stanford, Univ. of Arizona, Univ. of Washington, Univ. of Rochester, Michigan State Univ., Georgia Tech, Georgia State Univ., Kent State, Indiana Univ., Univ. of Oregon, Syracuse Univ., Montana State Univ., and the Fisk- Vanderbilt Master’s-to-PhD program. Now in its fourth year, the Cal-Bridge program is a CSU-UC Bridge program comprised of physics and astronomy faculty from 9 University of California (UC), 15 California State University (CSU), and more than 30 California Community College (CCC) campuses throughout California. In the first four years, 34 Cal-Bridge Scholars have been selected, including 22 Hispanic, 3 African-American and 13 women students, 10 of whom are from URM groups. Thirty (30) of the 34 Cal-Bridge Scholars are first generation college students. In the last three years, 17 of 21 Cal-Bridge Scholars have begun or been accepted PhD programs in physics or astronomy at top PhD programs nationally. Three (3) of these scholars have won NSF Graduate Research Fellowships; one more received an Honorable Mention. Once selected, Cal-Bridge Scholars benefit from substantial financial support, intensive, joint mentoring by CSU
CALS and the Product State Model - Methodology and Supporting Schools and Paradigms
DEFF Research Database (Denmark)
Larsen, Michael Holm
1998-01-01
incorporates relevant information about each stage of the production process.The paper will describe the research object, the model object and discuss a part of the methodology in developing a Product State Model. The project is primarily technological, however, organisational and human aspects......This paper address the preliminary considerations in a research project, initiated February 1997, regarding Continuous Acquisition and Life-cycle Support (CALS) which is a part of the activities in CALS Center Denmark. The CALS concept is presented focusing on the Product State Model (PSM). The PSM...... will be developed upon, will be discussed. Also, the parameters for evaluating the PSM will be considered. In establishing the theoretical body of knowledge with respect to CALS, an identification of schools and paradigms within the research area of applying information technology in a manufacturing environment...
Wündsch, Michael; Haberzettl, Torsten; Cawthra, Hayley C.; Kirsten, Kelly L.; Quick, Lynne J.; Zabel, Matthias; Frenzel, Peter; Hahn, Annette; Baade, Jussi; Daut, Gerhard; Kasper, Thomas; Meadows, Michael E.; Mäusbacher, Roland
2018-04-01
This study investigates Holocene sediments from Eilandvlei, a coastal lake located within the Wilderness embayment at the southern Cape coast of South Africa. The evolution of the present estuarine/coastal lake system is reconstructed based on seismic data as well as a multi-proxy approach on a 30.5 m sediment core spanning the last 8.9 kyr. Geochemical (Ca, TOC/S, Br/TOC) and micropalaeontological data (diatoms, foraminifera) reflect changes in the degree of marine influence at the core site. The embayment likely developed via distinct phases of connectivity to the Indian Ocean caused by sea level changes and dune progradation. Marine conditions prevailed at the core site from 8900 to 4700 cal BP. The rapid sea level rise during the early Holocene caused the inundation of a palaeovalley that most likely had formed at lower sea levels during the Pleistocene. Towards the mid-Holocene the sea level exceeded its present height around 7500 cal BP creating a marine embayment. At 4700 cal BP, the embayment became distinctly more disconnected from the ocean turning into a lagoon system that persisted until 1200 cal BP. Subsequently, the marine influence further decreased and the present estuarine/coastal lake system was established. Grain size and geochemical data (Fe, Si/Al, chemical index of alteration (CIA)) further reflect changes in the deposition of terrigenous sediments at the core site. While the sedimentation of fine-grained (climatic conditions than today from 8900 to 7900 cal BP and 6400 to 3000 cal BP. In contrast, the periods between 7900-6400 cal BP and 3000 cal BP-present were likely characterized by high river discharge and thus, generally more rainfall. The reconstructed palaeoclimatic variations are discussed within the context of e.g., shifts in the position of the Antarctic sea ice extent and the mid-latitude westerly wind belt as well as changes in the El Niño-Southern Oscillation (ENSO).
Leunda, Maria; González-Sampériz, Penélope; Gil-Romera, Graciela; Aranbarri, Josu; Moreno, Ana; Oliva-Urcia, Belén; Sevilla-Callejo, Miguel; Valero-Garcés, Blas
2017-10-01
This paper presents the environmental, climate and vegetation changes reconstructed for the last 14.6 kyr cal BP from the Marboré Lake sedimentary sequence, the highest altitude record (2612 m a.s.l.) in the Pyrenees studied up to date. We investigate the sensitivity of this high altitude site to vegetational and climate dynamics and altitudinal shifts during the Holocene by comparing palynological spectra of the fossil sequence and pollen rain content from current moss pollsters. We hypothesize that the input of sediments in lakes at such altitude is strongly controlled by ice phenology (ice-free summer months) and that during cold periods Pollen Accumulation Rate (PAR) and Pollen Concentration (PC) reflect changes in ice-cover and thus is linked to temperature changes. Low sedimentation rates and low PC and PAR occurred during colder periods as the Younger Dryas (GS-1) and the Holocene onset (12.6-10.2 kyr cal BP), suggesting that the lake-surface remained ice-covered for most of the year during these periods. Warmer conditions are not evident until 10.2 kyr cal BP, when an abrupt increase in sedimentation rate, PC and PAR occur, pointing to a delayed onset of the Holocene temperature increase at high altitude. Well-developed pinewoods and deciduous forest dominated the mid montane belt since 9.3 kyr cal BP until mid-Holocene (5.2 kyr cal BP). A downwards shift in the deciduous forest occurred after 5.2 kyr cal BP, in agreement with the aridity trend observed at a regional and Mediterranean context. The increase of herbaceous taxa during the late-Holocene (3.5 kyr cal BP-present) reflects a general trend to reduced montane forest, as anthropogenic disturbances were not evident until 1.3 kyr cal BP when Olea proportions from lowland areas and other anthropogenic indicators clearly expand. Our study demonstrates the need to perform local experimental approaches to check the effect of ice phenology on high altitude lakes sensitivity to vegetation changes to obtain
Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?
Directory of Open Access Journals (Sweden)
K. M. Usrey
2014-01-01
Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.
GPR identification of an early monument at Los Morteros in the Peruvian coastal desert
Sandweiss, Daniel H.; Kelley, Alice R.; Belknap, Daniel F.; Kelley, Joseph T.; Rademaker, Kurt; Reid, David A.
2010-05-01
Los Morteros (8˚39'54″S, 78˚42 '00″W) is located in coastal, northern Peru, one of the six original centers of world civilization. The site consists of a large, sand-covered, isolated prominence situated on a Mid-Holocene shoreline, ˜ 5 km from the present coast. Preceramic archaeological deposits (4040 ± 75 to 4656 ± 60 14C yr BP or ˜ 3600-5500 cal yr BP) cap this feature, which has been identified by prior researchers as a sand-draped, bedrock-cored landform or a relict dune deposit. Because neither explanation is geomorphologically probable, we used ground-penetrating radar (GPR) and high-resolution mapping to assess the mound's interior structure. Our results indicate an anthropogenic origin for Los Morteros, potentially placing it among the earliest monumental structures in prehistoric South America. The extremely arid setting raises new questions about the purpose and the logistics of early mound construction in this region. This work demonstrates the value of an integrated Quaternary sciences approach to assess long-term landscape change and to understand the interaction between humans and the environment.
Holocene vegetation, environment, and tephra recorded from Lake Pupuke, Auckland, New Zealand
International Nuclear Information System (INIS)
Horrocks, M.; Augustinus, P.; Deng, Y.; Shane, P.; Andersson, S.
2005-01-01
Lake Pupuke provides a near-complete, high-resolution environmental record of the Holocene from northern New Zealand. Tephra beds constrain the timing of a range of proxy indicators of environmental change, and demonstrate errors in a radiocarbon chronology. Agathis australis forest progressively increases from c. 7000 yr BP and, in conjunction with indicators of reduced biomass productivity, support a model of long-term climate change to drier conditions over the Holocene. However, except for Agathis, conifer-hardwood forest dominated mainly by Dacrydium cupressinum shows little change throughout the pre-human Holocene, suggesting environmental stability. Dramatic vegetation change occurred only within the last millennium as a result of large-scale Polynesian deforestation by fire. This happened a short time before the local eruption of c. 638 cal. yr BP Rangitoto Tephra. The identification of two eruptions of tephra from Rangitoto volcano has implications for future hazard planning in the Auckland region, because the volcanoes were previously considered single event centres. Changes in atmospheric circulation since the Late Glacial, possibly causing lower frequency of distal ashfall in Auckland during the Holocene, complicates the use of long-term records in hazard frequency assessment. (author). 39 refs., 7 figs., 2 tabs
LumiCal alignment system - Status report
Daniluk, W.; Lesiak, T.; Moszczyński, A.; Pawlik, B.; Wojtoń, T.; Zawiejski, L.
2015-01-01
The paper describes the status of the laser-based alignment-system for the luminosity detector, LumiCal, taking into considerations the conditions of the International Large Detector in the International Linear Collider project. The design of the system comprises two parts: the first one containing semi-transparent silicon sensors used to deliver simultaneous position measurements in the X,Y directions of the monitored object, and the second one in which the interferometric technique, i.e. the Frequency Scanning Interferometry (FSI), is proposed. Two laboratory prototypes for both components of the system were built and the preliminary measurements of the DUT displacements demonstrated their utility in the design of the final alignment system. The alignment of the LumiCal detector will allow us to monitor the detector displacements and possible deformations in its internal structure. Lack of information of the displacements will introduce a systematic effect which will have an impact on the accuracy of the fi...
International Nuclear Information System (INIS)
Nunn, P.D.; Petchey, F.
2013-01-01
80 radiocarbon dates are presented for Lapita-era sites on the Rove Peninsula, southwest Viti Levu Island, Fiji. Of these, 67 are from the Bourewa site which is the largest and probably the earliest in the area. Of these, 10 are rejected as not being demonstrably associated with its Lapita occupation. Constraints on date interpretation arising from sample materials are highlighted. In particular, charcoals that have not been identified to short-lived tree species, twigs or seeds are evaluated according to observed contextual associations and established understanding of inbuilt age offsets using Bayesian outlier analysis. It is concluded that many of the dates on charcoal are imprecise indicators of settlement age and have an average offset of 149 years. Shell radiocarbon results are similarly evaluated and it is concluded that the majority have 14 C values that are in equilibrium with the marine radiocarbon reservoir and therefore yield ages that are accurate indicators of Lapita occupation of Bourewa. Results suggest that initial occupation at Bourewa occurred 2816 ± 25 cal BP (2838-2787 cal BP [68.2% prob.]; 2866-2771 cal BP [95.4% prob.]) and ended 2654 ± 21 cal BP (2675-2640 cal BP [68.2% prob.]; 2689-2613 cal BP [95.4% prob.]). Similar analyses applied to other dated Lapita sites in Fiji shows that, while Bourewa is among the earliest, the Matanamuani (VL 21/5) site on Naigani Island remains the earliest to be securely dated. (author)
International Nuclear Information System (INIS)
Victor, David G.; House, Joshua C.
2006-01-01
Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate
Directory of Open Access Journals (Sweden)
Lixia Gou
2017-11-01
Full Text Available Calcimycin is a unique ionophoric antibiotic that is widely used in biochemical and pharmaceutical applications, but the genetic basis underlying the regulatory mechanisms of calcimycin biosynthesis are unclear. Here, we identified the calR3 gene, which encodes a novel TetR family transcriptional regulator and exerts a negative effect on calcimycin biosynthesis. Disruption of calR3 in Streptomyces chartreusis NRRL 3882 led to significantly increased calcimycin and its intermediate cezomycin. Gene expression analysis showed that the transcription of calR3 and its adjacent calT gene were dramatically enhanced (30- and 171-fold, respectively in GLX26 (ΔcalR3 mutants compared with the wild-type strains. Two CalR3-binding sites within the bidirectional calR3-calT promoter region were identified using a DNase I footprinting assay, indicating that CalR3 directly repressed the transcription of its own gene and the calT gene. In vitro electrophoretic mobility shift assays suggested that both calcimycin and cezomycin can act as CalR3 ligands to induce CalR3 to dissociate from its binding sites. These findings indicate negative feedback for the regulation of CalR3 in calcimycin biosynthesis and suggest that calcimycin production can be improved by manipulating its biosynthetic machinery.
Data Management Standards in Computer-aided Acquisition and Logistic Support (CALS)
Jefferson, David K.
1990-01-01
Viewgraphs and discussion on data management standards in computer-aided acquisition and logistic support (CALS) are presented. CALS is intended to reduce cost, increase quality, and improve timeliness of weapon system acquisition and support by greatly improving the flow of technical information. The phase 2 standards, industrial environment, are discussed. The information resource dictionary system (IRDS) is described.
Dommain, R.; Couwenberg, J.; Cobb, A.; Gandois, L.; Kai, F.; Su'ut, N.; Abu Salim, K.; Harvey, C. F.; Glaser, P. H.; Joosten, H.
2012-12-01
Tropical peatlands are recognized as a significant sink of carbon dioxide and an important source of methane. Low latitude peatlands contain an estimated pool of 90 Pg C, of which ca. 70 Pg C is stored in Southeast Asian peatlands. However, the Holocene development of this carbon reservoir is poorly established. Here we provide a synthesis of carbon uptake rates by tropical peatlands in Southeast Asia across millennial timescales for the past 11,000 years. Our reconstruction of the carbon accumulation history for Borneo, Sumatra and Peninsular Malaysia is based on a synthesis of radiocarbon dated peat profiles, modeling of peatland extent, and a new carbon accumulation record from Brunei (NW-Borneo). During the early Holocene the first peatlands formed in southern Borneo under the influence of a strong monsoon and rapid rise in sea-level. The carbon accumulation rate (CAR) in these peatlands was on average 60 g C m-2 yr-1 at this time. Peatlands started to spread across the coastal lowlands of Borneo, Sumatra and Peninsular Malaysia after 8000 cal BP only when the rate of rising sea-level decreased. The major phase of coastal peatland initiation lasted from 7000 to 4000 cal BP. This period was marked by a Holocene precipitation maximum, suppressed El Niño activity, and the Holocene maximum in sea-level on the Sunda Shelf. The mean CAR of coastal peatlands at this time was 80 g C m-2 yr-1, with a Holocene peak of ~100 g C m-2 yr-1 from 4900 to 4500 cal BP. Significantly, atmospheric CO2 concentrations measured in the Taylor Dome Antarctic ice core indicate a plateau during this period of otherwise rising CO2 concentrations. During the Late Holocene CAR declined both in coastal peatlands (ca. 70 g C m-2 yr-1) and in southern Borneo (ca. 20 g C m-2 yr-1) in response to falling sea-levels and increased El Niño frequency and intensity. In fact, several peatlands in southern Borneo have stopped accumulating peat-carbon under higher El Niño activity. These results
Remapping of the stripe rust resistance gene Yr10 in common wheat.
Yuan, Cuiling; Wu, Jingzheng; Yan, Baiqiang; Hao, Qunqun; Zhang, Chaozhong; Lyu, Bo; Ni, Fei; Caplan, Allan; Wu, Jiajie; Fu, Daolin
2018-02-23
Yr10 is an important gene to control wheat stripe rust, and the search for Yr10 needs to be continued. Wheat stripe rust or yellow rust is a devastating fungal disease caused by Puccinia striiformis f. sp. tritici (Pst). Host disease resistance offers a primary source for controlling wheat stripe rust. The stripe rust resistance gene Yr10 confers the race-specific resistance to most tested Pst races in China including CYR29. Early studies proposed that Yr10 was a nucleotide-binding site, leucine-rich repeat gene archived as GenBank accession AF149112 (hereafter designated the Yr10 candidate gene or Yr10 CG ). In this study, we revealed that 15 Chinese wheat cultivars positive for Yr10 CG are susceptible to CYR29. We then expressed the Yr10 CG cDNA in the common wheat 'Bobwhite'. The Yr10 CG -cDNA positive transgenic plants were also susceptible to CYR29. Thus, it is highly unlikely that Yr10 CG corresponds to the Yr10 resistance gene. Using the Yr10 donor 'Moro' and the Pst-susceptible wheat 'Huixianhong', we generated two F 3 populations that displayed a single Mendelian segregation on the Yr10 gene, and used them to remap the Yr10 gene. Six markers were placed in the Yr10 region, with the Yr10 CG gene now mapping about 1.2-cM proximal to the Yr10 locus and the Xsdauw79 marker is completely linked to the Yr10 locus. Apparently, the Yr10 gene has not yet been identified. Fine mapping and positional cloning of Yr10 is important for gene pyramiding for stripe rust resistance in wheat.
Toscano, Marguerite A.
2016-06-01
Sample elevations corrected for tectonic uplift and assessed relative to local modeled sea levels provide a new perspective on paleoenvironmental history at Cobbler's Reef, Barbados. Previously, 14C-dated surface samples of fragmented Acropora palmata plotted above paleo sea level based on their present (uplifted) elevations, suggesting supratidal rubble deposited during a period of extreme storms (4500-3000 cal BP), precipitating reef demise. At several sites, however, A. palmata persisted, existing until ~370 cal BP. Uplift-corrected A. palmata sample elevations lie below the western Atlantic sea-level curve, and ~2 m below ICE-6G-modeled paleo sea level, under slow rates of sea-level rise, negating the possibility that Cobbler's Reef is a supratidal storm ridge. Most sites show limited age ranges from corals likely damaged/killed on the reef crest, not the mixed ages of rubble ridges, strongly suggesting the reef framework died off in stages over 6500 yr. Reef crest death assemblages invoke multiple paleohistoric causes, from ubiquitous hurricanes to anthropogenic impacts. Comparison of death assemblage ages to dated regional paleotempestological sequences, proxy-based paleotemperatures, recorded hurricanes, tsunamis, European settlement, deforestation, and resulting turbidity, reveals many possible factors inimical to the survival of A. palmata along Cobbler's Reef.
Tests with beam setup of the TileCal Phase-II upgrade electronics
Hlaluku, Dingane Reward; The ATLAS collaboration
2017-01-01
The LHC has planned a series of upgrades culminating in the High Luminosity LHC (HL-LHC) which will have an average luminosity 5-7 times larger than the nominal Run-2 value. The ATLAS Tile Calorimeter (TileCal) will undergo an upgrade to accommodate to the HL-LHC parameters. The TileCal electronics both on- and off-detector will be completely redesigned and a new readout architecture will be adopted. The photomultiplier signals will be digitised and transferred to the TileCal PreProcessors (PPr) located off-detector for every bunch crossing. Then, the PPr will provide preprocessed digital data to the first level trigger with improved spatial granularity and energy resolution with respect to the current analog trigger signals. We plan to insert one TileCal module instrumented with the new electronics in the real detector to evaluate and qualify the new readout and trigger concepts in the overall ATLAS data acquisition system. This new drawer, so-called Hybrid Demonstrator, must provide analog trigger signal fo...
Gabriel, J. J.; Reinhardt, E. G.; Peros, M. C.; Davidson, D. E.; van Hengstum, P. J.; Beddows, P. A.
2008-12-01
A 61-cm core was obtained from 4 metres below the water table in Cenote Aktun Ha, on the Yucatan Peninsula, Mexico. The cenote is 8.6 km from the Caribbean coast and its formation and evolution have been largely affected by sea-level change. The base of the core dates to 6940 - 6740 cal yr BP and overlying sediments were deposited rapidly over the subsequent ~200 years. The pollen record shows that the cenote evolved from a marsh dominated by red mangrove (Rhizophora mangle) and fern (Polypodiaceae) to an open-water system. These vegetation changes were controlled by water level and salinity and are thus useful indicators of past sea level. At the base, the d13C isotopic ratios reveal the influence of terrestrial vegetation (-29‰), but shift to more negative values up-core (-33‰), indicating an influence from particulate matter in the flooded cenote pool. Although microfossil populations were nearly absent through most of the core, the microfossil assemblage in the upper 6 cm of the core is dominated by juvenile Ammonia tepida and the thecamoebian genus Centropyxis. These populations indicate open-water conditions in the cenote and a major environmental shift around 6600 cal yr BP, which is related to sea-level rise in the Caribbean basin. These data fit well with previously established sea-level curves for the Caribbean Sea. Our reconstruction of the environmental history of Cenote Aktun Ha helps elucidate the floral and hydrological history of the region, and highlights the utility of cenote sediments for studying the Holocene sea-level history of the Caribbean Sea.
Directory of Open Access Journals (Sweden)
Heikki Seppä
2012-08-01
Full Text Available Tilting of large lakes due to differential isostatic uplift in the glaciated regions of the Northern Hemisphere is a well-documented process. With the help of accurate digital elevation models and spatial GIS analysis techniques, the resulting hydrological changes, including shifts in the outlets and changes in the size and configuration of lakes, can now be mapped and calculated more precisely than before. As a case study to highlight the magnitude of such changes in Fennoscandia, we investigated and reinterpreted the Holocene palaeogeography and palaeohydrology of Lake Pielinen in eastern Finland. This lake is currently 99 km long and located parallel to the direction of land uplift, being thus particularly sensitive to the impacts of tilting. Our results show that the lake was formed at the end of the regional deglaciation, following drainage of a local ice-dammed lake. In its initial stage until 10 200 cal yr BP, the outlet of the newly-formed lake was located in its northwestern end, but the tilting led to a major water level transgression in the basin, eventually causing formation of a new outlet over the southeastern threshold. The lake area was 143 km long and its area was 1998 km2 at the time of formation of the southeastern outlet at 10 200 cal yr BP. The lake level has been regressive throughout the basin during the last 10 200 years. This regression will continue for approximately another 10 000 years until all the glacial isostatic adjustment has occurred, after which Lake Pielinen will be only 89 km long and 565 km2 in area.
Mario Luiz Bimbatti
2007-01-01
A competição no mercado internacional com os produtores mundiais, pode ser uma fonte de excelentes oportunidades ou de perigosas armadilhas, como o desafio de difícil solução, representado pelos produtores mundiais de calçados com baixos custos de mão-de-obra, por exemplo, os chineses. A grande maioria dos produtores brasileiros de calçados está estabelecida em clusters, como na Europa os produtores italianos de calçados estão estabelecidos nos \\"distretti\\". Essas concentrações geográficas d...
' "~w.ith ~a'~nd"Atypz'cal Features
African Journals Online (AJOL)
2006-09-11
}? While there have been reports of ' this syndrome from ' Ibadan,' the exact incidence 1\\_Iigeria is It probably rare but it is alsoylikely that 'some. cases are missed in chm', 'cal due to poor awareness -and constraints' '.
Computer-aided acquisition and logistics support (CALS): Concept of Operations for Depot Maintenance
Energy Technology Data Exchange (ETDEWEB)
Bourgeois, N.C.; Greer, D.K.
1993-04-01
This CALS Concept of Operations for Depot Maintenance provides the foundation strategy and the near term tactical plan for CALS implementation in the depot maintenance environment. The user requirements enumerated and the overarching architecture outlined serve as the primary framework for implementation planning. The seamless integration of depot maintenance business processes and supporting information systems with the emerging global CALS environment will be critical to the efficient realization of depot user's information requirements, and as, such will be a fundamental theme in depot implementations.
Lifescience Database Archive (English)
Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m
Lifescience Database Archive (English)
Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show BP91801...is mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiant...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap
Graehl, Nicholas A; Kelsey, Harvey M.; Witter, Robert C.; Hemphill-Haley, Eileen; Engelhart, Simon E.
2015-01-01
The Sallys Bend swamp and marsh area on the central Oregon coast onshore of the Cascadia subduction zone contains a sequence of buried coastal wetland soils that extends back ∼4500 yr B.P. The upper 10 of the 12 soils are represented in multiple cores. Each soil is abruptly overlain by a sandy deposit and then, in most cases, by greater than 10 cm of mud. For eight of the 10 buried soils, times of soil burial are constrained through radiocarbon ages on fine, delicate detritus from the top of the buried soil; for two of the buried soils, diatom and foraminifera data constrain paleoenvironment at the time of soil burial.We infer that each buried soil represents a Cascadia subduction zone earthquake because the soils are laterally extensive and abruptly overlain by sandy deposits and mud. Preservation of coseismically buried soils occurred from 4500 yr ago until ∼500–600 yr ago, after which preservation was compromised by cessation of gradual relative sea-level rise, which in turn precluded drowning of marsh soils during instances of coseismic subsidence. Based on grain-size and microfossil data, sandy deposits overlying buried soils accumulated immediately after a subduction zone earthquake, during tsunami incursion into Sallys Bend. The possibility that the sandy deposits were sourced directly from landslides triggered upstream in the Yaquina River basin by seismic shaking was discounted based on sedimentologic, microfossil, and depositional site characteristics of the sandy deposits, which were inconsistent with a fluvial origin. Biostratigraphic analyses of sediment above two buried soils—in the case of two earthquakes, one occurring shortly after 1541–1708 cal. yr B.P. and the other occurring shortly after 3227–3444 cal. yr B.P.—provide estimates that coseismic subsidence was a minimum of 0.4 m. The average recurrence interval of subduction zone earthquakes is 420–580 yr, based on an ∼3750–4050-yr-long record and seven to nine interearthquake
Windows Calorimeter Control (WinCal) system configuration control board (SCCB) operating procedure
International Nuclear Information System (INIS)
Westsik, G.A.
1997-01-01
This document describes the operating procedure for the System Configuration Control Board (SCCB) performed in support of the Windows Calorimeter Control (WinCal) system. This board will consist of representatives from Babcock and Wilcox Hanford Company Babcock and Wilcox Protec, Inc.; and Lockheed Martin Services, Inc. In accordance with agreements for the joint use of the Babcock and Wilcox Hanford Company calorimeters located in the Hanford Site Plutonium Finishing Plant (PFP) Nondestructive Assay Laboratory, concurrence regarding changes to the WinCal system will be obtained from the International Atomic Energy Agency (IAEA). Further, changes to the WinCal software will be communicated to Los Alamos National Laboratory
2018-01-01
Black phosphorus (bP) has been recently investigated for next generation nanoelectronic multifunctional devices. However, the intrinsic instability of exfoliated bP (the bP nanoflakes) toward both moisture and air has so far overshadowed its practical implementation. In order to contribute to fill this gap, we report here the preparation of new hybrid polymer-based materials where bP nanoflakes (bPn) exhibit a significantly improved stability. The new materials have been prepared by different synthetic paths including: (i) the mixing of conventionally liquid-phase exfoliated bP (in dimethyl sulfoxide, DMSO) with poly(methyl methacrylate) (PMMA) solution; (ii) the direct exfoliation of bP in a polymeric solution; (iii) the in situ radical polymerization after exfoliating bP in the liquid monomer (methyl methacrylate, MMA). This last methodology concerns the preparation of stable suspensions of bPn–MMA by sonication-assisted liquid-phase exfoliation (LPE) of bP in the presence of MMA followed by radical polymerization. The hybrids characteristics have been compared in order to evaluate the bP dispersion and the effectiveness of the bPn interfacial interactions with polymer chains aimed at their long-term environmental stabilization. The passivation of the bPn is particularly effective when the hybrid material is prepared by in situ polymerization. By using this synthetic methodology, the nanoflakes, even if with a gradient of dispersion (size of aggregates), preserve their chemical structure from oxidation (as proved by both Raman and 31P-solid state NMR studies) and are particularly stable to air and UV light exposure. The feasibility of this approach, capable of efficiently exfoliating bP while protecting the bPn, has been then verified by using different vinyl monomers (styrene and N-vinylpyrrolidone), thus obtaining hybrids where the nanoflakes are embedded in polymer matrices with a variety of intriguing thermal, mechanical, and solubility characteristics.
Lifescience Database Archive (English)
Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show BP911801...is mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000
Recuperación de morteros romanos de cal y chamota en aplicaciones actuales
González Cortina, Mariano
2000-01-01
La tesis se fundamenta en la utilización de residuos de fábricas cerámicas para su aprovechamiento y reutilización mediante una trituración, para posteriormente mezclarlos con cal aérea y obtener así un conglomerante capaz de fraguar, endurecer y adquirir resistencias tanto al aire como sumergido en agua. La cal, como conglomerante hidráulico, no se fabrica actualmente en España debido al uso de los cementos Pórtland. Sin embargo, las propiedades que tienen los morteros realizados con cal, co...
CALS Baseline Architecture Analysis of Weapons System. Technical Information: Army, Draft. Volume 8
1989-09-01
This effort was performed to provide a common framework for analysis and planning of CALS initiatives across the military services, leading eventually to the development of a common DoD-wide architecture for CALS. This study addresses Army technical ...
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001
Lifescience Database Archive (English)
Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D05 407 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D05. BP921000 - Show BP921000...is mRNA. clone: YMU001_000144_D05. Accession BP921000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum cap...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum capillus-veneris mRN
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C12 350 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C12. BP920995 - Show BP92099...is mRNA. clone: YMU001_000144_C12. Accession BP920995 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show BP91801...is mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP91801...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show BP912801...is mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912801...es. 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0
New tree-ring evidence for the Late Glacial period from the northern pre-Alps in eastern Switzerland
Reinig, Frederick; Nievergelt, Daniel; Esper, Jan; Friedrich, Michael; Helle, Gerhard; Hellmann, Lena; Kromer, Bernd; Morganti, Sandro; Pauly, Maren; Sookdeo, Adam; Tegel, Willy; Treydte, Kerstin; Verstege, Anne; Wacker, Lukas; Büntgen, Ulf
2018-04-01
The rate and magnitude of temperature variability at the transition from the Last Glacial Maximum into the early Holocene represents a natural analog to current and predicted climate change. A limited number of high-resolution proxy archives, however, challenges our understanding of environmental conditions during this period. Here, we present combined dendrochronological and radiocarbon evidence from 253 newly discovered subfossil pine stumps from Zurich, Switzerland. The individual trees reveal ages of 41-506 years and were growing between the Allerød and Preboreal (∼13‧900-11‧300 cal BP). Together with previously collected pines from this region, this world's best preserved Late Glacial forest substantially improves the earliest part of the absolutely dated European tree-ring width chronology between 11‧300 and 11‧900 cal BP. Radiocarbon measurements from 65 Zurich pines between ∼12‧320 and 13‧950 cal BP provide a perspective to prolong the continuous European tree-ring record by another ∼2000 years into the Late Glacial era. These data will also be relevant for pinpointing the Laacher See volcanic eruption (∼12‧900 cal BP) and two major Alpine earthquakes (∼13‧770 and ∼11‧600 cal BP). In summary, this study emphasizes the importance of dating precision and multi-proxy comparison to disentangle environmental signals from methodological noise, particularly during periods of high climate variability but low data availability, such as the Younger Dryas cold spell (∼11‧700 and 12‧900 cal BP).
Hou, G.; Li, F.; Zhu, Y.
2017-12-01
XDW2 is an important microlithic cultural relics with continuous stratum that is located in the the Tibetan plateau at above 4,000 masl, wich is a window of revealing the evolution of early human activities and the response and adaptation to extreme environmental in the principal part of Tibetan plateau. So it has important research significance. The analysis on human activity indicator(stoneware, potsherds) and environmental indicators(magnetic susceptibility, color, granularity and pollen) showed: the winter wind and dust storm intensity is weak in this area during 7.0-6 cal. Ka BP, pedogenesis is strong, the climate is humid, environment is suitable relatively, when is Holocene Megathermal; the active phase of microlithic human activities occurred during 7.2-6 cal. ka BP, and quickly weakened after 6 cal. ka BP. The number of stone tools reveal that human activities are concentrated before and after 7-6.2 cal. ka BP, charcoal fragmental concentration indicates that microlithic human activity reached the peak at around 6.7 cal. ka BP. Thus relatively suitable environment during Holocene Megathermal is the important motivating factor of active hunter-gatherer activities in the principal part of Tibetan plateau. After 6 cal. ka BP, summer monsoon weakened rapidly, agricultural growers in the Loess Plateau began to expand towards the plateau, under the effect of environmental degradation and new technologies, microlithic hunter-gatherers in the principal part of plateau moved towards the river valley at low altitude, and learnt settlement and plantation, microlithic activity in the main plateau began to decline.
Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Constantin, F; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Nedos, M; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrella, A; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Voss, H; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A
2012-01-01
The ratio of branching fractions of the radiative $B$ decays $B^0\\to K^{*0}\\gamma$ and $B^0_s\\to \\phi\\gamma$ has been measured using $0.37\\,$fb$^{-1}$ of $pp$ collisions at a centre of mass energy of $\\sqrt{s}=7\\,$TeV, collected by the LHCb experiment. The value obtained is \\begin{equation} \\frac{{\\cal B}(B^0\\to K^{*0}\\gamma)}{{\\cal B}(B^0_s\\to \\phi\\gamma)} = 1.12 \\pm 0.08^{+0.06}_{-0.04}\\phantom{.}^{+0.09}_{-0.08},\
California Cooperative Oceanic Fisheries Investigations (CalCOFI)Database
National Oceanic and Atmospheric Administration, Department of Commerce — This database contains icthyoplankton data collected as part of the California Cooperative Oceanic Fisheries Investigations (CalCOFI) program and other cruises...
CryoSat/SIRAL Cal1 Calibration Orbits
Scagliola, Michele; Fornari, Marco; Bouffard, Jerome; Parrinello, Tommaso
2017-04-01
The main payload of CryoSat is a Ku band pulsewidth limited radar altimeter, called SIRAL (Synthetic interferometric radar altimeter), that transmits pulses at a high pulse repetition frequency thus making the received echoes phase coherent and suitable for SAR processing. This allows to reach an along track resolution that is significantly improved with respect to traditional pulse-width limited altimeters. Due to the fact that SIRAL is a phase coherent pulse-width limited radar altimeter, a proper calibration approach has been developed. In fact, not only corrections for transfer function, gain and instrument path delay have to be computed (as in previous altimeters), but also corrections for phase (SAR/SARIn) and phase difference between the two receiving chains (SARIN only). Recalling that the CryoSat's orbit has a high inclination of 92° and it is non-sun-synchronous, the temperature of the SIRAL changes continuously along the orbit with a period of about 480 days and it is also function of the ascending/descending passes. By analysis of the CAL1 calibration corrections, it has been verified that the internal path delay and the instrument gain variation measured on the SIRAL are affected by the thermal status of the instrument and as a consequence they are expected to vary along the orbit. In order to gain knowledge on the calibration corrections (i.e. the instrument behavior) as function of latitude and temperature, it has been planned to command a few number of orbits where only CAL1 calibration acquisitions are continuously performed. The analysis of the CAL1 calibration corrections produced along the Calibration orbits can be also useful to verify whether the current calibration plan is able to provide sufficiently accurate corrections for the instrument acquisitions at any latitude. In 2016, the CryoSat/SIRAL Cal1 Calibration Orbits have been commanded two times, a first time the 20th of July 2016 and a second time the 24th of November 2016, and they
Directory of Open Access Journals (Sweden)
Kristen K Beck
Full Text Available A Holocene lake sediment record spanning the past 7300 years from Wishart Lake in the Turkey Lakes Watershed in the Hemi-Boreal of central Ontario, Canada, was used to evaluate the potential drivers of long-term change in diatom assemblages at this site. An analysis of diatom assemblages found that benthic and epiphytic taxa dominated the mid-Holocene (7300-4000 cal yr BP, indicating shallow, oligotrophic, circum-neutral conditions, with macrophytes present. A significant shift in diatom assemblages towards more planktonic species (mainly Cyclotella sensu lato, but also several species of Aulacoseira, and Tabellaria flocculosa occurred ~4000 cal yr BP. This change likely reflects an increase in lake level, coincident with the onset of a more strongly positive moisture balance following the drier climates of the middle Holocene, established by numerous regional paleoclimate records. Pollen-inferred regional changes in vegetation around 4000 yrs BP, including an increase in Betula and other mesic taxa, may have also promoted changes in diatom assemblages through watershed processes mediated by the chemistry of runoff. A more recent significant change in limnological conditions is marked by further increases in Cyclotella sensu lato beginning in the late 19th century, synchronous with the Ambrosia pollen rise and increases in sediment bulk density, signaling regional and local land clearance at the time of Euro-Canadian settlement (1880 AD. In contrast to the mid-Holocene increase in planktonic diatoms, the modern increase in Cyclotella sensu lato likely indicates a response to land use and vegetation change, and erosion from the watershed, rather than a further increase in water level. The results from Wishart Lake illustrate the close connection between paleoclimate change, regional vegetation, watershed processes, and diatom assemblages and also provides insight into the controls on abundance of Cyclotella sensu lato, a diatom taxonomic group
Laser measurement of the LumiCal detector displacement
International Nuclear Information System (INIS)
Blocki, J.; Daniluk, W.; Gil, M.; Karbowiak, M.; Moszczynski, A.; Oliwa, K.; Pawlik, B.; Wierba, W.; Zawiejski, L.; Slominski, W.; Suszycki, L.
2006-12-01
The silicon-tungsten calorimeter LumiCal, located in very forward region of the future detector at the International Linear Collider, is proposed for precisely luminosity measurement. One of the requirements to fulfil this task is available information on the actual position of the calorimeter relative to the beam interaction area which should be known with accuracy of a few micrometers. In this paper we discuss the possible solutions for the positioning of the LumiCal electron detector by optical method. The results of the displacement measurement using a laser beam and a CCD camera are described. The measurements were performed on a proof-of-principle basis and achieved the accuracy of about ± 1 μm in x, y and ± μm in z direction. (author)
Herrera, D. A.; Ortega, B.; Caballero, M.; Lozano, S.; Pi, T.; Brown, E. T.
2010-12-01
Chalco lake is located SE of the outskirts of Mexico City, at the central part of the Trans Mexican Volcanic Belt. Previous studies show the importance of this lacustrine sequence as an archive of paleoenvironmental and paleoclimatic changes. A set of five cores up to 122 m depth were drilled in the basin, in order to analyze the sedimentary record and to extent the previous knowledge of past environmental changes in central Mexico. As an initial step, in this work we present the identification and classification of sedimentary facies. Preliminary paleomagnetism analyses recognize the possible record of the Blake Event (ca. 120 kyr BP), and suggest that the sequence might span the last 240 kyr. In this case, variations in sedimentary facies could reflect the conditions of the MIS 1-7. The facies are mostly diatom ooze, carbonate mud, organic rich silt and volcaniclastic, both massive and laminated, and massive dark gray to reddish brown silt. From 1 to 8 m depth dominates the organic rich silt facies, which correlates with the MIS 1. Intercalations of reddish brown and grayish brown silt facies, between 8 to 60 m depth, indicate changes occurred during MIS 2 to 5d. Between 60-75 m depth the sequence is characterized by dark grayish silty clay facies, which possibly coincide with the MIS 5e. At 79 m depth (ca. 130 kyr BP) we found struvite (MgNH4PO4.6H2O), which may be related to dry conditions. The laminated diatom ooze facies dominates between 90 to 122 m depth and indicates rhythmic changes in the sediment deposition of the basin. The volcaniclastic facies is represented by lapilli and ash deposits in more than 100 individual tephra layers of both mafic and felsic composition. Some of them correspond to main volcanic eruptions, as the Upper Toluca Pumice (13,500 cal yr BP), from the Nevado de Toluca volcano and the Pómez con Andesita (17,700 cal yr BP) from the Popocatépetl volcano. The carbonate mud facies is composed of calcite and siderite, with frequent
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:
Lifescience Database Archive (English)
Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433
Lifescience Database Archive (English)
Full Text Available YMU001_000015_B05 315 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B05. BP912099 - Show BP912099...is mRNA. clone: YMU001_000015_B05. Accession BP912099 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099|Adiantum capillus-vene
Lifescience Database Archive (English)
Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show BP918801...is mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca
Lifescience Database Archive (English)
Full Text Available YMU001_000105_F04 280 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F04. BP917801 - Show BP917801...is mRNA. clone: YMU001_000105_F04. Accession BP917801 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-veneris mRNA, clone: YMU001_000105_F04.
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show BP91801...is mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26
Lifescience Database Archive (English)
Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show BP915801...is mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A
Directory of Open Access Journals (Sweden)
Anca GEANTĂ
2014-11-01
Full Text Available Macroscopic charcoal particles, magnetic susceptibility and AMS C14 dates were performed on a sediment sequence from a small subalpine lake (Buhaescu Mare, Rodnei Mts. in order to reconstruct fire regimes in the area. Specifically we aim to distinguish between natural fire activity and human driven fires. Buhaescu Mare lake, also known as Rebra lake (0.4 ha; 1920 m a.s.l., is today surrounded by mire vegetation, Ericaceae, Carex and Pinus mugo patches further away, being situated just above the current tree line. The sedimentary profile, with a total length of 98 cm is composed of clayey silt (98-80 cm and gyttja (80-0 cm. Magnetic susceptibility was used to support the charcoal results, this parameter being expected to rise during episodes of intense fire and subsequent erosive events.The results from the charcoal record indicate periods of high charcoal activity at about 4200 cal. BP, 3000 cal. BP, 2700 cal BP, 2000 cal BP and 1350 cal BP. and point to a succession of warm/dry and cold/wet periods. The increase in charcoal particles over the last 2000 years was probably related to human impact, but this remains to be documented through the analysis of pollen and coprophilous fungi record.
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52
Lifescience Database Archive (English)
Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM
Lifescience Database Archive (English)
Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show BP91801...is mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1
Directory of Open Access Journals (Sweden)
Guoliang ZHANG
2014-07-01
Full Text Available Objective: To study the effect of Lactobacillus sp. A-2 metabolites on viability of CAL-27 cells and apoptosis in CAL-27 cells. Methods: Lactobacillus sp. A-2 metabolites 1 and 2 (LM1 and LM2 were obtained by culturing Lactobacillus sp. A-2 in reconstituted whey medium and whey-inulin medium; the cultured CAL-27 cells were treated with different concentrations of LM1 and LM2 (0, 3, 6, 12, 24, 48 mg/mL and assayed by methyl thiazolyltetrazolium (MTT method; morphological changes of apoptotic cell were observed under fluorescence microscopy by acridine orange (Ao fluorescent staining; flow cytometry method (FCM and agarose gel electrophoresis were used to detect the apoptosis of CAL-27 cells treated LM1 and LM2. Results: The different concentrations of LM1 and LM2 could restrain the growth of CAL-27 cells, and in a dose-dependent manner; the apoptosis of CAL-27 cells was obviously induced and was time-dependent. Conclusions: Viability of CAL-27 cells was inhibited by Lactobacillus sp. A-2 metabolites; Lactobacillus sp. A-2 metabolites could induce CAL-27 cells apoptosis; study on the bioactive compounds in the Lactobacillus sp. A-2 metabolites and their molecular mechanism is in progress.
Lifescience Database Archive (English)
Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406
Lifescience Database Archive (English)
Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,
Lifescience Database Archive (English)
Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801
Lifescience Database Archive (English)
Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0
Lifescience Database Archive (English)
Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-
International Nuclear Information System (INIS)
Kunikita, Dai; Yoshida, Kunio; Miyazaki, Yumiko; Saito, Keita; Endo, Aya; Matsuzaki, Hiroyuki; Ito, Shinji; Kobayashi, Tatsuo; Fujimoto, Tsuyoshi; Kuznetsov, A.M.; Krupyanko, A.A.; Tabarev, A.M.
2007-01-01
In order to obtain precise and accurate calibrated radiocarbon chronologies for archaeological sites, it is necessary to determine the provenance of the carbon material being dated. Of particular note is determining the provenance and radiocarbon age of charcoal remains on pottery. In this context, we discuss the decipherment of dates on the Ustinovka-8 site in the Russian Far East. Using δ 13 C, δ 15 N and C:N it is possible to ascribe charcoal provenance to terrestrial and marine origins. Our data show radiocarbon age difference that are clearly associated with carbon origin, and a maximum estimated ΔR of approximately 400 years during the Zaisanovskaya culture, 4400 cal BP. A combination of pottery analysis and 14 C dating at this site determined the Zaisanovskaya cultural period to be 4000-5000 cal BP, the Boismanskaya and the Late Rudninskaya cultural period 5800-6500 cal BP, and the Early Rudninskaya cultural period of 6800-7100 cal BP
Wagner, Bernd; Wennrich, Volker; Viehberg, Finn; Junginger, Annett; Kolvenbach, Anne; Rethemeyer, Janet; Schaebitz, Frank; Schmiedl, Gerhard
2018-04-01
A 12 m long sediment sequence was recovered from the eastern Dendi Crater lake, located on the central Ethiopian Plateau and in the region of the Blue Nile headwaters. 24 AMS radiocarbon dates from bulk organic carbon samples indicate that the sediment sequence spans the last ca. 12 cal kyr BP. Sedimentological and geochemical data from the sediment sequence that were combined with initial diatom information show only moderate change in precipitation and catchment runoff during that period, probably due to the elevated location of the study region in the Ethiopian highlands. Less humid conditions prevailed during the Younger Dryas (YD). After the return to full humid conditions of the African Humid Period (AHP), a 2 m thick tephra layer, probably originating from an eruption of the Wenchi crater 12 km to the west of the lake, was deposited at 10.2 cal kyr BP. Subsequently, single thin horizons of high clastic matter imply that short spells of dry conditions and significantly increased rainfall, respectively, superimpose the generally humid conditions. The end of the AHP is rather gradual and precedes relatively stable and less humid conditions around 3.9 cal kyr BP. Subsequently, slightly increasing catchment runoff led to sediment redeposition, increasing nutrient supply, and highest trophic states in the lake until 1.5 cal kyr BP. A highly variable increase in clastic matter indicates fluctuating and increasing catchment runoff over the last 1500 years. The data from Lake Dendi show, in concert with other records from the Nile catchment and the Eastern Mediterranean Sea (EMS), that the Blue Nile discharge was relatively high between ca. 10.0 and 8.7 cal kyr BP. Subsequent aridification peaked with some regional differences between ca. 4.0 and 2.6 cal kyr BP. Higher discharge in the Blue Nile hydraulic regime after 2.6 cal kyr BP is probably triggered by more local increase in rainfall, which is tentatively caused by a change in the influence of the Indian Ocean
Moa fossils and chronology of a Pleistocene terrace sequence, Tauweru, Wairarapa, New Zealand
International Nuclear Information System (INIS)
Collen, J.D.; Grapes, R.H.; Eager, S.H.
2000-01-01
The fortuitous preservation of bones of the medium-sized moa Euryapteryx geranoides (Owen) in Pleistocene colluvial sediments near Tauweru, Wairarapa, has allowed radiocarbon dating of a terrace sequence along the lower Tauweru River. The bones were in a shelly, conglomeratic sandstone on an erosion surface cut into mid-Pliocene (Waipipian) siltstone, and were overlain by loess and situated immediately adjacent to onlapping fluvial gravels. Most of the bones are from a single skeleton buried articulated and apparently nearly complete, and there is also a single left tibiotarsus from a slightly larger bird. Bone from the right femur gave a radiocarbon age of 14 262 +/- 87 yr BP by accelerator mass spectrometry. The material was slightly chalky and had a low collagen yield with a relatively large amount of humic material; contamination which would lower the measured age is thus possible. However, an amino acid profile characteristic of collagen makes it unlikely that high contaminant levels are present. The radiocarbon age for the bone is likely to be 14-18 ka (16-22 000 cal. yr) or possibly older, with the lower limit being set by the radiocarbon age and the upper limit inferred from the amount of humic contamination. This is thus the oldest moa skeleton reported from Wairarapa. Loess overlying the bones contains disseminated shards of clear rhyolitic glass with a composition identical to that of the 22.6 ka (24 500 cal. yr) Kawakawa Tephra, and gave an age by optical dating of 26 +/- 2 ka. A thicker tephra deposit within loess on a higher, deeply dissected surface may also be partly reworked; optical dating of a sample of loess from 2 m beneath it gave an age of 22 +/- 2 ka. Thermoluminescence dating of two samples of the conglomeratic deposits surrounding the bones gave ages of 52 +/- 13.2 and 102 +/- 18 ka, respectively, indicating redeposition of these sediments without resetting of the thermoluminescence signal. One of these samples was also dated by optical
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000133_E12 401 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E12. BP92014...6 CL388Contig1 Show BP920146 Clone id YMU001_000133_E12 Library YMU01 Length 401 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_E12. Accession BP920146 Tissue type prothallium Developmental stage...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum ca...rams, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum capillus-veneris mRNA, clone: YMU001_000133_
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000133_F03 624 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F03. BP92014...9 CL2860Contig1 Show BP920149 Clone id YMU001_000133_F03 Library YMU01 Length 624 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F03. Accession BP920149 Tissue type prothallium Developmental stag...ic Acids Res. 25:3389-3402. Query= BP920149|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F03. (624 l...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi
Lifescience Database Archive (English)
Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c
Lifescience Database Archive (English)
Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406
Lifescience Database Archive (English)
Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D04 588 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D04. BP92099...9 CL317Contig1 Show BP920999 Clone id YMU001_000144_D04 Library YMU01 Length 588 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D04. Accession BP920999 Tissue type prothallium Developmental stage...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D01. BP92099...6 CL262Contig1 Show BP920996 Clone id YMU001_000144_D01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D01. Accession BP920996 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920996|Adiantum capillus-ve
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C06 517 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C06. BP92099...3 CL547Contig1 Show BP920993 Clone id YMU001_000144_C06 Library YMU01 Length 517 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_C06. Accession BP920993 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum capillus-veneris mRNA, clone: YMU001_0001...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C05. BP92099...2 CL2523Contig1 Show BP920992 Clone id YMU001_000144_C05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C05. Accession BP920992 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C05. (525 lett...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_00014
Lifescience Database Archive (English)
Full Text Available YMU001_000129_C11 513 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C11. BP919801... CL1Contig3 Show BP919801 Clone id YMU001_000129_C11 Library YMU01 Length 513 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000129_C11. Accession BP919801 Tissue type prothallium Developmental stage -...es. 25:3389-3402. Query= BP919801|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C11. (435 letters) Da...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919801|Adiantum capil
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show BP91801...is mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801
Lifescience Database Archive (English)
Full Text Available YMU001_000063_A07 396 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A07. BP914801... CL1121Contig1 Show BP914801 Clone id YMU001_000063_A07 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000063_A07. Accession BP914801 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801|Adiantum capillus-veneris mRNA, clone:
Kennett, Douglas J; Thakar, Heather B; VanDerwarker, Amber M; Webster, David L; Culleton, Brendan J; Harper, Thomas K; Kistler, Logan; Scheffler, Timothy E; Hirth, Kenneth
2017-08-22
The first steps toward maize ( Zea mays subspecies mays ) domestication occurred in the Balsas region of Mexico by ∼9,000 calendar years B.P. (cal B.P.), but it remains unclear when maize was productive enough to be a staple grain in the Americas. Molecular and microbotanical data provide a partial picture of the timing and nature of morphological change, with genetic data indicating that alleles for some domestication traits were not yet fixed by 5,300 cal B.P. in the highlands of Mexico. Here, we report 88 radiocarbon dates on the botanical remains from El Gigante rockshelter (Honduras) to establish a Bayesian chronology over the past ∼11,000 y spanning the transition to maize-based food production. Botanical remains are remarkably well preserved and include over 10,000 maize macrofossils. We directly dated 37 maize cobs to establish the appearance and local change of maize at the site. Cobs are common in deposits dating between 4,340 and 4,020 cal B.P., and again between 2,350 and 980 cal B.P. The earliest cobs appear robustly domesticated, having 10-14 rows, suggesting strong selection for increased yield. The later cobs are comparable to these earliest ones, but show clear emergence of diverse traits, including increased cob width, rachis segment length, and cupule width. Our results indicate that domesticated landraces of maize productive enough to be a staple grain existed in Central America by 4,300 cal B.P.
Shirataki obsidian exploitation and circulation in prehistoric northern Japan
Directory of Open Access Journals (Sweden)
Miyuki Yakushige
2014-03-01
Full Text Available Presently, the total number of archaeological obsidian sources in Japan is more than 80, and among them, 21 are in Hokkaido, northern part of the Japanese archipelago (Izuho and Sato 2007. Obsidian was the dominant of lithic raw material in the Upper Paleolithic Hokkaido (35-10 ka cal BP. Out of 21 archaeological obsidian sources in Hokkaido, 4 sources: Shirataki, Oketo, Tokachi, and Akaigawa are the major obsidian sources and the others are minor sources. Shirataki is one of the largest obsidian sources in Northeast Asia and it is well known that Shirataki obsidian was transported outside Hokkaido to Sakhalin and the Paleo-Honshu Island from the Late Upper Paleolithic period.We compiled data of obsidian source analyses conducted to artefacts from Paleolithic sites in Hokkaido, and it became clear that the ratio of Shirataki obsidian in all analyzed materials is more than half (Sato and Yakushige in press.We examined how far Shirataki obsidian was transported in each period: the Early Upper Paleolithic (35-25 ka cal BP and the Late Upper Paleolithic (25-10 ka cal BP. The Late Upper Paleolithic is divided into three stage, the early Early Microblade Industry (Stage 1: 25-21 ka cal BP, the late Early Microblade Industry (Stage 2: 19-16 ka cal BP, and the Late Microblade Industry (Stage 3: 16-10 ka cal BP. As a result, it is revealed that the distribution areas of Shirataki obsidian did not expand gradually over time, but are different in different lithic industries. In the background of this situation lay the difference of ecological adaptation strategies adopted by the prehistoric people of the time and their movement behavioral strategies.
International Nuclear Information System (INIS)
Kattel, G.R.; Augustinus, P.C.
2010-01-01
Subfossil cladocerans have rarely been used for paleoenvironmental reconstruction from New Zealand lake sediments, and here we detail the first examination of the response of cladocerans to past environments from an Auckland maar paleolake. Cladoceran remains were examined in the upper 230 cm of the lacustrine sediments spanning c. 9-31 cal. ka BP from Onepoto maar during which time the lake underwent significant changes. Lake level was relatively high during the Last Glacial Coldest Period (c. 28-18 cal. ka BP), with limited forest in the catchment, shoreline vegetation and low water temperature indicated by the presence of a planktonic taxon, Bosmina meridionalis, and a cold tolerant chydorid cladoceran Alona sp. (affinis type). However, the climate during the last glacial termination after c. 17.9 cal. ka BP changed abruptly, perhaps becoming extremely dry and windy, resulting in increased production of cladoceran resting eggs. Between c. 17.6 and 14.1 cal. ka BP, a gradually ameliorating climate with sustained windiness and dryness might have been unfavourable for hatching of chydorid cladoceran eggs and their recolonisation. After c. 14.1 cal. ka BP, continued climatic amelioration was accompanied by reduced lake levels inferred from high cladoceran littoral: planktonic ratios as well as increased cladoceran diversity and abundance of less cold tolerant chydorid taxa: Alona guttata, Alona sp. (intermedia type) and Alonella excisa. At c. 9 cal. ka BP, the maar crater rim was breached by the marine waters commensurate with postglacial sea-level rise, resulting in degraded water quality and production of a large number of cladoceran ephippia in the sediments. (author). 67 refs., 3 figs., 2 tabs.
CubiCal - Fast radio interferometric calibration suite exploiting complex optimisation
Kenyon, J. S.; Smirnov, O. M.; Grobler, T. L.; Perkins, S. J.
2018-05-01
It has recently been shown that radio interferometric gain calibration can be expressed succinctly in the language of complex optimisation. In addition to providing an elegant framework for further development, it exposes properties of the calibration problem which can be exploited to accelerate traditional non-linear least squares solvers such as Gauss-Newton and Levenberg-Marquardt. We extend existing derivations to chains of Jones terms: products of several gains which model different aberrant effects. In doing so, we find that the useful properties found in the single term case still hold. We also develop several specialised solvers which deal with complex gains parameterised by real values. The newly developed solvers have been implemented in a Python package called CubiCal, which uses a combination of Cython, multiprocessing and shared memory to leverage the power of modern hardware. We apply CubiCal to both simulated and real data, and perform both direction-independent and direction-dependent self-calibration. Finally, we present the results of some rudimentary profiling to show that CubiCal is competitive with respect to existing calibration tools such as MeqTrees.
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C10 322 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C10. BP92099...4 CL2871Contig1 Show BP920994 Clone id YMU001_000144_C10 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C10. Accession BP920994 Tissue type prothallium Developmental stag...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C03. BP92099...0 CL4123Contig1 Show BP920990 Clone id YMU001_000144_C03 Library YMU01 Length 445 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C03. Accession BP920990 Tissue type prothallium Developmental stag...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9209...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099
Lifescience Database Archive (English)
Full Text Available YMU001_000144_C04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C04. BP92099...1 CL3173Contig1 Show BP920991 Clone id YMU001_000144_C04 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C04. Accession BP920991 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (521 letters) Dat...ucleic Acids Res. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (5
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F04 434 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F04. BP91801...6 CL3779Contig1 Show BP918016 Clone id YMU001_000108_F04 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000108_F04. Accession BP918016 Tissue type prothallium Developmental stag..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...ic Acids Res. 25:3389-3402. Query= BP918016|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F04. (434 l
Synergistic suppression of the PI3K inhibitor CAL-101 with bortezomib on mantle cell lymphoma growth
International Nuclear Information System (INIS)
Qu, Fu-Lian; Xia, Bing; Li, Su-Xia; Tian, Chen; Yang, Hong-Liang; Li, Qian; Wang, Ya-Fei; Yu, Yong; Zhang, Yi-Zhuo
2015-01-01
To investigate the effects of CAL-101, particularly when combined with bortezomib (BTZ) on mantle cell lymphoma (MCL) cells, and to explore its relative mechanisms. MTT assay was applied to detect the inhibitory effects of different concentrations of CAL-101. MCL cells were divided into four groups: control group, CAL-101 group, BTZ group, and CAL-101/BTZ group. The expression of PI3K-p110σ, AKT, ERK, p-AKT and p-ERK were detected by Western blot. The apoptosis rates of CAL-101 group, BTZ group, and combination group were detected by flow cytometry. The location changes of nuclear factor kappa-B (NF-κB) of 4 groups was investigated by NF-κB Kit exploring. Western blot was applied to detect the levels of caspase-3 and the phosphorylation of AKT in different groups. CAL-101 dose- and time-dependently induced reduction in MCL cell viability. CAL-101 combined with BTZ enhanced the reduction in cell viability and apoptosis. Western blot analysis showed that CAL-101 significantly blocked the PI3K/AKT and ERK signaling pathway in MCL cells. The combination therapy contributed to the inactivation of NF-κB and AKT in MCL cell lines. However, cleaved caspase-3 was up-regulated after combined treatment. Our study showed that PI3K/p110σ is a novel therapeutic target in MCL, and the underlying mechanism could be the blocking of the PI3K/AKT and ERK signaling pathways. These findings provided a basis for clinical evaluation of CAL-101 and a rationale for its application in combination therapy, particularly with BTZ
Lifescience Database Archive (English)
Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID
Zheng, X.; Money, S.; Hope, G.
2017-12-01
There are relatively few quantitative palaeo-hydrological records available in eastern Australia, and those that are available, for example from dendroclimatology and the reconstruction of lake level, are often relatively short or have a relatively coarse temporal resolution (e.g. Wilkins et al. 2013; Palmer et al. 2015). Testate amoebae, a widely used hydrological proxy in the Northern Hemisphere, were used here to reconstruct depth to water table (DWT) at Snowy Flat, which is a Sphagnum-Richea-Empodismahigh altitude (1618 m asl) shrub bog in the Australian Capital Territory, Australia. Testate amoebae were quantified in a Snowy Flat core representing 4,200 cal Y BP and the community composition was used to reconstruct DWT based on our recently established transfer functions. Results from three different types of transfer functions (Fig. 1) consistently show there was a decreasing DWT (wetter) period centred on about 3350 cal Y BP, a trend towards increased dryness from about 3300 to 2200 cal Y BP and a distinctly drier period 850 to 700 cal Y BP which was immediately followed by a wetter period from 700 to 500 cal Y BP. We discuss these episodes and trends in relation to the drivers of climatic variability in this region and in particular, by comparing our results with other south-eastern Australia records, comment on the history of the southern annular mode.
Directory of Open Access Journals (Sweden)
Yang Du
2017-11-01
Full Text Available Ultraviolet (UV-absorbing chemicals (UV filters are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3 and benzophenone-4 (BP-4 on Chlorella vulgaris, Daphnia magna, and Brachydanio rerio were analyzed in the present study. The EC50 values (96 h of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris, D. magna, and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10−3 and 0.47 mg/L, respectively, by assessment factor (AF method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.
de Melo França, Lucas; Trindade Dantas, Mário André; Bocchiglieri, Adriana; Cherckinsky, Alexander; de Souza Ribeiro, Adauto; Bocherens, Hervé
2014-09-01
In Brazilian Intertropical Region (BIR) fossil remains of the giant ground sloth Eremotherium laurillardi (Lund, 1842) and of the proboscidean Notiomastodon platensis (Ameghino, 1888) are the most abundant among megaherbivores. However, the paleoecology of both species needs to be better understood to enlighten why these species disappear in the end of the Pleistocene, an issue that is still debated. During the last decades, the carbon and oxygen stable isotopes have been increasingly being used to obtain paleoecological information about extinct animals, although this information is in most cases dissociated from chronological data. Thus, the main objective of this study is to contribute to the knowledge about feeding ecology and chronology of E. laurillardi and N. platensis within BIR. For each fossil sample we performed stable isotopes analyses (δ13C/δ18O) and radiocarbon dating (14C with AMS). The results showed that N. platensis occurred between 12,125 and 19,594 cal yr BP and exhibited a grazer diet (δ13C = -1.1‰-1.3‰), while E. laurillardi lived between 11,084 and 27,690 cal yr BP, with a mixed feeder diet (C3/C4 plants; values ratio δ13C = -7.7‰ to -3.3‰). The δ18O values of N. platensis ranged between 2.20‰ and 3.60‰, while the values of E. laurillardi ranged between -3.10‰ and -1.10‰. Neither species did exhibit differences in its diet through time, which suggests that the vegetational composition of this locality did not vary in the late Pleistocene. Both species were living in an open environment, rich in herbaceous plants (C4 plants) and with tree and shrub with disjoint distribution, maybe similar to some parts of recent Caatinga, where they have partitioned the spatial and feeding niches.
Wooller, Matthew J.; Gaglioti, Benjamin; Fulton, Tara L.; Lopez, Andres; Shapiro, Beth
2015-07-01
The biogeography of freshwater fish species during and after late-Pleistocene glaciations relate to how these species are genetically organized today, and the management of these often disjunct populations. Debate exists concerning the biogeography and routes of dispersal for Northern pike (Esox lucius) after the last glaciation. A hypothesis to account for the relatively low modern genetic diversity for E. lucius is post-glacial radiation from refugia, including lakes from within the un-glaciated portions of eastern Beringia. We report the remains of a Northern pike (E. cf. lucius) skull, including bones, teeth, bone collagen and ancient DNA. The remains were preserved at a depth of between 440 and 446 cm in a 670 cm long core of sediment from Quartz Lake, which initiated at ˜11,200 cal yr BP in interior Alaska. A calibrated accelerator mass spectrometer (AMS) radiocarbon age of the collagen extracted from the preserved bones indicated that the organism was dated to 8820 cal yr BP and is bracketed by AMS values from analyses of terrestrial plant macrofossils, avoiding any potential aquatic reservoir effect that could have influenced the radiocarbon age of the bones. Scanning electron microscope images of the specimen show the hinged tooth anatomy typically of E. lucius. Molar C:N (3.5, 1σ = 0.1) value of the collagen from the specimen indicated well-preserved collagen and its mean stable nitrogen isotope value is consistent with the known predatory feeding ecology of E. lucius. Ancient DNA in the bones showed that the specimen was identical to modern E. lucius. Our record of E. lucius from interior Alaska is consistent with a biogeographic scenario involving rapid dispersal of this species from glacial refugia in the northern hemisphere after the last glaciation.
Edwards, Mary E.; Grosse, Guido; Jones, Benjamin M.; McDowell, Patricia F.
2016-01-01
Thermokarst processes characterize a variety of ice-rich permafrost terrains and often lead to lake formation. The long-term evolution of thermokarst landscapes and the stability and longevity of lakes depend upon climate, vegetation and ground conditions, including the volume of excess ground ice and its distribution. The current lake status of thermokarst-lake landscapes and their future trajectories under climate warming are better understood in the light of their long-term development. We studied the lake-rich southern marginal upland of the Yukon Flats (northern interior Alaska) using dated lake-sediment cores, observations of river-cut exposures, and remotely-sensed data. The region features thick (up to 40 m) Quaternary deposits (mainly loess) that contain massive ground ice. Two of three studied lakes formed ~ 11,000–12,000 cal yr BP through inferred thermokarst processes, and fire may have played a role in initiating thermokarst development. From ~ 9000 cal yr BP, all lakes exhibited steady sedimentation, and pollen stratigraphies are consistent with regional patterns. The current lake expansion rates are low (0 to drainage, nor of multiple lake generations within a basin. However, LiDAR images reveal linear “corrugations” (> 5 m amplitude), deep thermo-erosional gullies, and features resembling lake drainage channels, suggesting that highly dynamic surface processes have previously shaped the landscape. Evidently, widespread early Holocene permafrost degradation and thermokarst lake initiation were followed by lake longevity and landscape stabilization, the latter possibly related to establishment of dense forest cover. Partial or complete drainage of three lakes in 2013 reveals that there is some contemporary landscape dynamism. Holocene landscape evolution in the study area differs from that described from other thermokarst-affected regions; regional responses to future environmental change may be equally individualistic.
CALS - what are the potentials for SME’s ?
DEFF Research Database (Denmark)
Bilberg, Arne; Thomsen, Finn Tang; Larsen, Michael Holm
1997-01-01
the potentials for improvingbusiness processes by effective information management. The threecompanies involved will demonstrate practical and innovativeapplications of CALS solutions, that will serve as examples for awide variety of SMEs. The paper will focus on the industrial results and the CALSengineering...
Directory of Open Access Journals (Sweden)
D. Wong
2013-01-01
Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.
The location of cemento enamel junction for CAL measurement: A clinical crisis
Directory of Open Access Journals (Sweden)
Vandana K
2009-01-01
Full Text Available Background: We face various problems while measuring the Clinical attachment level (CAL from Cemento-enamel junction (CEJ. This study aims to record and compare the CEJ location measurements using a xed reference point (FRP [Custom made stent] before and after ap elevation. Materials and Methods: A custom made stent and UNC-15 probe were used. Recording of CEJ location was made using a UNC-15 (Hu-Friedy probe, before (close CEJ and after (Open CEJ the reflection of the flap from the lower edge of the stent in those subjects who were indicated for flap surgery, at baseline. Results: We used statistical analysis involving intra-group comparison done by Paired-′t′ test. The close and the open CEJ measurements demonstrated a, statistically, non-significant difference. The equi-measurements of close and open CEJ numerical data were remarkably lower than the under and overestimation of measurements. Thus, despite certain disadvantages of stent, the FRP provides a simple solution for CAL measurement. Conclusion: The results of this study confirms the objective of the study and strongly suggests that CAL measurements done without FRP is subjected to great variation and the diagnostic and prognostic interpretation of CAL should be viewed seriously in periodontics.
Radiocarbon analysis of halophilic microbial lipids from an Australian salt lake
Bray, P. Sargent; Jones, Claudia M.; Fallon, Stewart J.; Brocks, Jochen J.; George, Simon C.
2012-01-01
Assigning accurate dates to hypersaline sediments opens important terrestrial records of local and regional paleoecologies and paleoclimatology. However, as of yet no conventional method of dating hypersaline systems has been widely adopted. Biomarker, mineralogical, and radiocarbon analyses of sediments and organic extracts from a shallow (13 cm) core from a hypersaline playa, Lake Tyrrell, southeastern Australia, produce a coherent age-depth curve beginning with modern microbial mats and extending to ~ 7500 cal yr BP. These analyses are furthermore used to identify and constrain the timing of the most recent change in hydrological regime at Lake Tyrrell, a shift from a clay deposit to the precipitation of evaporitic sands occurring at some time between ~ 4500 and 7000 yr. These analyses show the potential for widespread dating of hypersaline systems integrating the biomarker approach, reinforce the value of the radiocarbon content of biomarkers in understanding the flow of carbon in modern ecologies, and validate the temporal dimension of data provided by biomarkers when dating late Quaternary sediments.
Lifescience Database Archive (English)
Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;
Lifescience Database Archive (English)
Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI
Lifescience Database Archive (English)
Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000131_G09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G09. BP919999... CL2968Contig1 Show BP919999 Clone id YMU001_000131_G09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_G09. Accession BP919999 Tissue type prothallium Developmental stag...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generatio...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919999|Adiantum capillus-ve
Lifescience Database Archive (English)
Full Text Available YMU001_000144_D02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D02. BP92099...7 CL10Contig1 Show BP920997 Clone id YMU001_000144_D02 Library YMU01 Length 534 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_D02. Accession BP920997 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920997|Adian...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2
Jones, Samantha Elsie; Burjachs, Francesc; Ferrer-García, Carlos; Giralt, Santiago; Schulte, Lothar; Fernández-López de Pablo, Javier
2018-03-01
This article focuses on a former salt lake in the upper Vinalopó Valley in south-eastern Spain. The study spans the Late Pleistocene through to the Late Holocene, although with particular focus on the period between 11 ka cal BP and 3000 ka cal BP (which spans the Mesolithic and part of the Bronze Age). High resolution multi-proxy analysis (including pollen, non pollen palynomorphs, grain size, X-ray fluorescence and X-ray diffraction) was undertaken on the lake sediments. The results show strong sensitivity to both long term and small changes in the evaporation/precipitation ratio, affecting the surrounding vegetation composition, lake-biota and sediment geochemistry. To summarise the key findings the main general trends identified include: 1) Hyper-saline conditions and low lake levels at the end of the Late Glacial 2) Increasing wetness and temperatures which witnessed an expansion of mesophilic woodland taxa, lake infilling and the establishment of a more perennial lake system at the onset of the Holocene 3) An increase in solar insolation after 9 ka cal BP which saw the re-establishment of pine forests 4) A continued trend towards increasing dryness (climatic optimum) at 7 ka cal BP but with continued freshwater input 5) An increase in sclerophyllous open woody vegetation (anthropogenic?), and increasing wetness (climatic?) is represented in the lake record between 5.9 and 3 ka cal BP 6) The Holocene was also punctuated by several aridity pulses, the most prominent corresponding to the 8.2 ka cal BP event. These events, despite a paucity of well dated archaeological sites in the surrounding area, likely altered the carrying capacity of this area both regionally and locally, particularly during the Mesolithic-Neolithic transition, in terms of fresh water supply for human/animal consumption, wild plant food reserves and suitable land for crop growth.
He, Lei; Xue, Chunting; Ye, Siyuan; Laws, Edward Allen; Yuan, Hongming; Yang, Shixiong; Du, Xiaolei
2018-02-01
The Liaohe Delta in Northeast China is one of the ecologically important estuarine deltas in China. It has been formed via the accumulation of sediment discharged by four rivers in the Liaohe Plain that enter Liaodong Bay. Twenty-seven 30-40 m long cores recovered from the Liaohe Plain and Liaodong Bay were analyzed for sedimentary characteristics, grain size, foraminifera species, and ages determined by accelerator mass spectrometry (AMS) 14C to document the stratigraphical sequence and the spatio-temporal evolution of the Liaohe Delta. Our results revealed that the sedimentary environments have evolved from fluvial, tidal flat/estuarine, to neritic and finally to a deltaic environment since the Late Pleistocene. The Holocene transgression arrived at the present coastline at ∼8500 cal a BP and flooded the maximum area of land at ∼7000 cal a BP. A deltaic environment prevailed in this area after 7000 cal a BP. Bounded by the modern Liaohe River mouth, the present deltaic sedimentary system can be divided into the eastern and western components. The rate of seaward progradation of the eastern paleocoastline was estimated to be ∼8.6 m/a since 7000 cal a BP; the eastern cores in the present coastline began receiving the deltaic sediments at ∼5000 cal a BP. The rate of seaward progradation of the western paleocoastline was estimated to be only ∼2.8 m/a since 7000 cal a BP. The coastline on the western side began accumulating deltaic sediments about 2000 years later than the eastern coastline. Depocenter shifting was hypothesized to be the reason for the spatial differences in the sedimentary processes. However, the change of sediment fluxes of the western rivers due to climate changes and ancient human impacts might be the reason for the differences of the temporal evolution of the eastern and western sedimentary systems in the Liaohe Delta.
High resolution Holocene paleomagnetic secular variation records from Bay of Bengal
Digital Repository Service at National Institute of Oceanography (India)
Usapkar, A.; Dewangan, P.; Badesab, F.K.; Mazumdar, A.; Ramprasad, T.; Krishna, K.S.; Basavaiah, N.
/8 probably due to local effects. Paleoinclination records of MD161/8, MD161/11 and MD161/13 show a low between ~2.4 and 2.0 cal. kyr BP, an increase between 2.0 and 1.4 cal. kyr BP and a decrease towards the present. To varying degrees these trends can...
DOSAR/CalLab Operations Manual
International Nuclear Information System (INIS)
Bogard, J.S.
2000-01-01
The Life Sciences Division (LSD) of Oak Ridge National Laboratory (ORNL) has a long record of radiation dosimetry research, primarily using the Health Physics Research Reactor (HPRR) and the Dosimetry Applications Research (DOSAR) Program Calibration Laboratory (CalLab), referred to formerly as the Radiation Calibration Laboratory. These facilities have been used by a broad segment of the research community to perform a variety of experiments in areas including, but not limited to, radiobiology, radiation dosimeter and instrumentation development and calibration, and the testing of materials in a variety of radiation environments
ATLAS TileCal Read Out Driver production
International Nuclear Information System (INIS)
Valero, A; Abdallah, J; Castillo, V; Cuenca, C; Ferrer, A; Fullana, E; Gonzalez, V; Higon, E; Poveda, J; Ruiz-MartInez, A; Saez, M A; Salvachua, B; SanchIs, E; Solans, C; Valls, J A
2007-01-01
The production tests of the 38 ATLAS TileCal Read Out Drivers (RODs) are presented in this paper. The hardware specifications and firmware functionality of the RODs modules, the test-bench and the test procedure to qualify the boards are described. Finally the performance results, the temperature studies and high rate tests are shown and discussed
CAMPARE and Cal-Bridge: Two Institutional Networks Increasing Diversity in Astronomy
Rudolph, Alexander L.; Impey, Chris David; Phillips, Cynthia B.; Povich, Matthew S.; Prather, Edward E.; Smecker-Hane, Tammy A.
2015-01-01
We describe two programs, CAMPARE and Cal-Bridge, with the common mission of increasing participation of groups traditionally underrepresented in astronomy, particularly underrepresented minorities and women, through summer research opportunities, in the case of CAMPARE, scholarships in the case of Cal-Bridge, and significant mentoring in both programs, leading to an increase in their numbers successfully pursuing a PhD in the field.CAMPARE is an innovative REU-like summer research program, currently in its sixth year, comprising a network of comprehensive universities and community colleges in Southern California and Arizona (most of which are minority serving institutions), and ten major research institutions (University of Arizona Steward Observatory, the SETI Institute, JPL, Caltech, and the five Southern California UC campuses, UCLA, UCI, UCSD, UCR, and UCSB).In its first five summers, CAMPARE sent a total of 49 students from 10 different CSU and community college campuses to 5 research sites of the program. Of these 49 participants, 25 are women and 24 are men; 22 are Hispanic, 4 are African American, and 1 is Native American, including 6 female Hispanic and 2 female African-American participants. Twenty-one (21) CAMPARE participants have graduated from college, and more than half (11) have attended or are attending a graduate program, including 8 enrolled in PhD or Master's-to-PhD programs. Over twenty CAMPARE students have presented at the AAS and other national meetings.The Cal-Bridge program is a diverse network of higher education institutions in Southern California, including 5 UC campuses, 8 CSU campuses, and 7 community colleges dedicated to the goal of increasing the number of underrepresented minority and female students attending graduate school in astronomy or related fields. We have recently selected our inaugural group of five 2014 Cal-Bridge Scholars, including four women (two Hispanic and one part Native American), and one Hispanic man
CalCOFI Larvae Counts, Scientific Names CI to CO
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names DH to EC
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names TF to U
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names HJ to ID
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names AN to AR
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names SJ to ST
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names CP to DE
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names C to CE
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names EV to GN
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names V to Z
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names ED to EU
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names SD to SI
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names MB to MO
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names LJ to MA
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names AS to BA
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names SB to SC
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names MP to NA
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names SU to TE
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names PL to PO
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names IE to LA
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names A to AM
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names HB to HI
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names OM to OX
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names Q to SA
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names PP to PZ
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names GO to HA
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names NB to OL
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names LB to LI
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names BCE to BZ
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names CD to CH
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names OY to PI
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
International Nuclear Information System (INIS)
Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia
2012-01-01
Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.
Holocene glaciation of the central Sierra Nevada, California
Bowerman, Nicole D.; Clark, Douglas H.
2011-05-01
Sediment cores from two bedrock-dammed lakes in North Fork Big Pine Creek, Sierra Nevada, California, preserve the most detailed and complete record of Holocene glaciation yet recovered in the region. The lakes are fed by outwash from the Palisade Glacier, the largest (˜1.3 km 2) and presumably longest-lived glacier in the range, and capture essentially all of the rock flour it produces. Distinct late-Holocene (Matthes) and late-Pleistocene (Recess Peak) moraines lie between the modern glacier and the lakes. The lakes have therefore received continuous sedimentation from the basin since the retreat of the Tioga glacier (Last Glacial Maximum) and capture rock flour related to all post-LGM advances. A total of eight long cores (up to 5.5 m sediment depth) and one short surface sediment short core preserve a coherent record of fluctuating rock flour flux to the lakes through the Holocene. Age constraints on rock flour spikes in First and Second lakes based on 31 14C-dated macrofossils indicate Holocene glaciation began ˜3200 cal yr B P, followed by a possible glacier maximum at ˜2800 cal yr B P and four distinct glacier maxima at ˜2200, ˜1600, ˜700 and ˜250-170 cal yr. B.P., the most recent maximum being the largest. Reconstruction of the equilibrium-line altitudes (ELA) associated with each distinct advance recorded in the moraines (Recess Peak, Matthes, and modern) indicates ELA depressions (relative to modern) of ˜250 m and 90 m for Recess Peak and Matthes advances, respectively. These differences represent decreases in summer temperatures of 1.7-2.8 °C (Recess Peak) and 0.2-2° (Matthes), and increases in winter precipitation of 22-34 cm snow water equivalent (s.w.e.) (Recess Peak) and 3-26 cm s.w.e. (Matthes) compared to modern conditions. Although small, these changes are significant and similar to those noted in the Cascade Range to the north, and represent a significant departure from historical climate trends in the region.
Lifescience Database Archive (English)
Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show BP91212...is mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show BP91212...is mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa
Lifescience Database Archive (English)
Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812|Adiant...um capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum
Lifescience Database Archive (English)
Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot
Lifescience Database Archive (English)
Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412
Lifescience Database Archive (English)
Full Text Available YMU001_000019_D01 513 Adiantum capillus-veneris mRNA. clone: YMU001_000019_D01. BP912512... CL17Contig1 Show BP912512 Clone id YMU001_000019_D01 Library YMU01 Length 513 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000019_D01. Accession BP912512 Tissue type prothallium Developmental stage ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP912512|Adiantum capillus-veneris mRNA, clone: YMU0...01_000019_D01. (489 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, clo...ne: YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett
Lifescience Database Archive (English)
Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI
Directory of Open Access Journals (Sweden)
S. Joannin
2013-04-01
Full Text Available Adding to the on-going debate regarding vegetation recolonisation (more particularly the timing in Europe and climate change since the Lateglacial, this study investigates a long sediment core (LL081 from Lake Ledro (652 m a.s.l., southern Alps, Italy. Environmental changes were reconstructed using multiproxy analysis (pollen-based vegetation and climate reconstruction, lake levels, magnetic susceptibility and X-ray fluorescence (XRF measurements recorded climate and land-use changes during the Lateglacial and early–middle Holocene. The well-dated and high-resolution pollen record of Lake Ledro is compared with vegetation records from the southern and northern Alps to trace the history of tree species distribution. An altitude-dependent progressive time delay of the first continuous occurrence of Abies (fir and of the Larix (larch development has been observed since the Lateglacial in the southern Alps. This pattern suggests that the mid-altitude Lake Ledro area was not a refuge and that trees originated from lowlands or hilly areas (e.g. Euganean Hills in northern Italy. Preboreal oscillations (ca. 11 000 cal BP, Boreal oscillations (ca. 10 200, 9300 cal BP and the 8.2 kyr cold event suggest a centennial-scale climate forcing in the studied area. Picea (spruce expansion occurred preferentially around 10 200 and 8200 cal BP in the south-eastern Alps, and therefore reflects the long-lasting cumulative effects of successive boreal and the 8.2 kyr cold event. The extension of Abies is contemporaneous with the 8.2 kyr event, but its development in the southern Alps benefits from the wettest interval 8200–7300 cal BP evidenced in high lake levels, flood activity and pollen-based climate reconstructions. Since ca. 7500 cal BP, a weak signal of pollen-based anthropogenic activities suggest weak human impact. The period between ca. 5700 and ca. 4100 cal BP is considered as a transition period to colder and wetter conditions (particularly during
A Mathematica-based CAL matrix-theory tutor for scientists and engineers
Directory of Open Access Journals (Sweden)
M. A. Kelmanson
1993-12-01
Full Text Available Under the TLTP initiative, the Mathematics Departments at Imperial College and Leeds University are jointly developing a CAL method directed at supplementing the level of mathematics of students entering science and engineering courses from diverse A-level (or equivalent backgrounds. The aim of the joint project is to maintain – even increase - the number of students enrolling on such first-year courses without lowering the courses' existing mathematical standards. A CAL tutor for matrix theory is presented in this paper, in the form of Mathematica Notebooks. This constitutes one of a list of specific A-level mathematics core options required by science and engineering departments. The module has been written so as to recognize students' errors and advise accordingly. Questions are generated randomly, at run time, in order to preclude copying between users. The module incorporates automated performance indicators so as to impinge minimally on existing staff resources. As an aid to other CAL authors considering the use of Mathematica Notebooks, idiosyncratic difficulties encountered within Mathematica Notebooks are catalogued and discussed in detail.
Relatiivinen solmisaatio käyrätorven alkeisopinnoissa
Laine, Aino
2009-01-01
Tämän työn aiheena on relatiivisen solmisaation hyödyntäminen käyrätorven alkeisopinnoissa. Työn tarkoituksena on selvittää, miten relatiivista solmisaatiota voidaan käyttää aloittelevien 8-9-vuotiaiden soitto-oppilaiden opetuksessa ensimmäisen vuoden aikana. Työssä pohditaan, miten Colourwinds-menetelmän periaatteita voidaan soveltaa käyrätorven alkeisopetuksessa. Colourwinds-soitinkouluja verrataan Hulda Horns första spelbok -alkeissoittovihkoon. Solmisaatiolle pohjautuvaa suomenkielist...
Wang, Jingzhong; Wu, Jinglu; Pan, Baotian; Jia, Hongjuan; Li, Xiao; Wei, Hao
2018-05-01
The origin and evolution of lakes in the Hetao Plain, northern China, were influenced by climate variation, channel migration, and human activity. We analyzed a suite of sediment cores from the region to investigate Yellow River channel migration and environmental change in this region over the Holocene. Short sediment cores show that environmental indicators changed markedly around CE 1850, a time that corresponds to flood events, when large amounts of river water accumulated in the western part of the Hetao Plain, giving rise to abundant small lakes. Multiple sediment variables (environmental proxies) from two long cores collected in the Tushenze Paleolake area show that sediments deposited between 12.0 and 9.0 cal ka BP were yellow clay, indicative of fluvial deposition and channel migration. From 9.0 to 7.5 cal ka BP, sand was deposited, reflecting a desert environment. From 7.5 to 2.2 cal ka BP, however, the sediments were blue-gray clay that represents lacustrine facies of Lake Tushenze, which owes its origin to an increase in strength of the East Asian monsoon. At about 2.2 cal ka BP, the north branch of the Yellow River was flooded, and the Tushenze Paleolake developed further. Around 2.0 cal ka BP, the paleolake shrank and eolian sedimentation was recorded. The analyzed sediment records are consistent with the written history from the region, which documents channel migration and environmental changes in the Hetao Plain over the Holocene.
Hot deformation behaviors and processing maps of B{sub 4}C/Al6061 neutron absorber composites
Energy Technology Data Exchange (ETDEWEB)
Li, Yu-Li [School of Materials Science and Engineering, Taiyuan University Of Technology, Taiyuan 030024 (China); Key Laboratory of Interface Science and Engineering in Advanced Materials, Ministry of Education, Taiyuan University of Technology, Taiyuan 030024 (China); Wang, Wen-Xian, E-mail: Wangwenxian@tyut.edu.cn [School of Materials Science and Engineering, Taiyuan University Of Technology, Taiyuan 030024 (China); Key Laboratory of Interface Science and Engineering in Advanced Materials, Ministry of Education, Taiyuan University of Technology, Taiyuan 030024 (China); Zhou, Jun [School of Materials Science and Engineering, Taiyuan University Of Technology, Taiyuan 030024 (China); Department of Mechanical Engineering, Pennsylvania State University Erie, The Behrend College, Erie, PA 16563 (United States); Chen, Hong-Sheng [School of Materials Science and Engineering, Taiyuan University Of Technology, Taiyuan 030024 (China); Key Laboratory of Interface Science and Engineering in Advanced Materials, Ministry of Education, Taiyuan University of Technology, Taiyuan 030024 (China)
2017-02-15
In this study, the hot deformation behaviors of 30 wt.% B{sub 4}C/Al6061 neutron absorber composites (NACs) have been investigated by conducting isothermal compression tests at temperatures ranging from 653 K to 803 K and strain rates from 0.01 to 10 s{sup −1}. It was found that, during hot compression, the B{sub 4}C/Al6061 NACs exhibited a steady flow characteristic which can be expressed by the Zener-Hollomon parameter as a hyperbolic-sine function of flow stress. High average activation energy (185.62 kJ/mol) of B{sub 4}C/Al6061 NACs is noted in current study owing to the high content of B{sub 4}C particle. The optimum hot working conditions for B{sub 4}C/Al6061 NACs are found to be 760–803 K/0.01–0.05 s{sup −1} based on processing map and microstructure evolution. Typical material instabilities are thought to be attributed to void formation, adiabatic shear bands (ASB), particle debonding, and matrix cracking. Finally, the effect of the plastic deformation zones (PDZs) on the microstructure evolution in this 30 wt.% B{sub 4}C/Al6061 composite is found to be very important. - Highlights: •The hot deformation behavior of the 30 wt.% B{sub 4}C/Al6061 NACs was first analyzed. •The 3D efficiency map and the instability map are developed. •The optimum hot working conditions were identified and validated by SEM and TEM. •The hot deformation schematic diagram of 30 wt.% B{sub 4}C/Al6061 NACs is developed.
Alpert, Bruce S
2011-04-01
We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.
Lifescience Database Archive (English)
Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show BP913939...is mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP
Lifescience Database Archive (English)
Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi
Lifescience Database Archive (English)
Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show BP912112...is mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765
OxCal: versatile tool for developing paleoearthquake chronologies--a primer
Lienkaemper, J.J.; Ramsey, C.B.
2009-01-01
Ages of paleoearthquakes (events), i.e., evidence of earthquakes inferred from the geologic record, provide a critical constraint on estimation of the seismic hazard posed by an active fault. The radiocarbon calibration program OxCal (4.0.3 and above; Bronk Ramsey 2007, 2001) provides paleoseismologists with a straightforward but rigorous means of estimating these event ages and their uncertainties. Although initially developed for the chronologic modeling of archaeological data from diverse sources (e.g., radiocarbon, historical knowledge, etc.), OxCal is readily adaptable to other disciplines requiring chronological modeling, such as paleoseismology (Fumal et al. 2002; Lindvall et al. 2002; Kelson et al. 2006; Noriega et al. 2006; Lienkaemper and Williams 2007; Yen et al. 2008).
Energy Technology Data Exchange (ETDEWEB)
Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others
2012-06-15
Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity
Directory of Open Access Journals (Sweden)
Azamat Aslanukov
2006-10-01
Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.
Aslanukov, Azamat; Bhowmick, Reshma; Guruju, Mallikarjuna; Oswald, John; Raz, Dorit; Bush, Ronald A; Sieving, Paul A; Lu, Xinrong; Bock, Cheryl B; Ferreira, Paulo A
2006-10-01
The Ran-binding protein 2 (RanBP2) is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s) of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI) via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/-) are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/-) mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.
TileCal TDAQ/DCS communication
Solans, C; Arabidze, G; Carneiro Ferreira, B; Sotto-Maior Peralva, B
2007-01-01
This document describes the communication between the TDAQ and DCS systems of the Hadronic Tile Calorimeter detector of the ATLAS experiment, currently under commissioning phase at CERN. It is a further step on the TDAQ and DCS communication for TileCal operation. The aim of the implementation is to increase the robustness and understanding of the detector from the two systems involved. The basic principle observed is that the two systems operate independently in parallel. Hence, the knowledge of the status of the whole detector from each of the two systems is required for further analysis of the archived data.
International Nuclear Information System (INIS)
Sutherland, R.; Norris, R.J.
1995-01-01
A 400 ± 100 m offset of Lake McKerrow, South Westland, New Zealand, combined with dated (15.6 ka) glacial lake silts, requires an Alpine Fault displacement rate of 26 ± 7 mm/yr. Moraines associated with Hokuri Creek (assumed to be 17 ± 2 ka) are offset by 440 ± 40 m and require a displacement rate on the Alpine Fault of 26 ± 6 mm/yr. Slickensides, fault exposure, and offset topography are consistent with an almost pure dextral sense of movement on a vertical or subvertical fault. Locally, a small vertical component of up-to-the-west movement is observed. Folding in late Quaternary sediments indicates active tilting of sediments at up to 0.4 degrees/ka and variations in local uplift/subsidence rates of up to 4 mm/yr. At one locality c.1 km northwest of the Alpine Fault and near the core of an anticline, uplifted shells require an uplift rate of 1.4 ± 0.5 mm/yr relative to sea level. Displaced river channels provide estimates of the last two coseismic displacements on the fault of 9 m (penultimate) and 8 m. This suggests characteristic earthquake behaviour with a recurrence interval of 330 ± 90 yr and probable M w > 7.5. Radiocarbon dating suggests the last coseismic displacement occurred just after 370 ± 150 cal yr B.P. (author). 34 refs., 10 figs., 3 tabs
Frontline CALS - Extranet Enabled Support of Customer Relations Based on Product State Information
DEFF Research Database (Denmark)
Larsen, Michael Holm; Franck, Lesley Robert; Pedersen, Mogens Kühn
1999-01-01
commerce called Frontline CALS. Frontline CALS integrate three bodies of knowledge, i.e. Continuous Acquisition and Lifecycle Support, Electronic Commerce, and the Customer Consumption Chain in order to construct a concept that enhances the service quality for customers with time critical operations....... The essence of Frontline CALS is that it combines a product and a customer view with the aim of enhancing the service quality offered by the dealers in collaboration with the producer. The article further provides empirical insight from an early prototype implementation of a Web Service System intended......The electronic economy has proliferated during the past decade. Many initiatives are launched in order to support customer's interaction with the company, however, often fragmented. A more holistic approach is provided in this article. The article suggests a business model in the era of electronic...
The age of the Yanuca Lapita site, Viti Levu, Fiji
International Nuclear Information System (INIS)
Clark, G.; Anderson, A.
2000-01-01
The Yanuca site, excavated by Lawrence and Helen Birks in 1965-66, contained a Lapita ceramic assemblage that is often considered one of the earliest in Fiji. Atempts to date the site by radiocarbon in the 1960s and with thermoluminescence in the 1980s failed to provide an accurate time frame for the Lapita deposits. Five new shell dates run on samples collected by the Birks from levels containing dentate-stamped pottery suggest an early Lapita presence at the site that might pre-date 2900 cal BP and a later occupation at 2800-2700 cal BP. If so, then the most restrictive Lapita period of 2800-2700 cal BP suggested by Anderson and Clark (1999) would require broadening. (author). 37 refs., 3 figs., 2 tabs
An IPMI-compliant control system for the ATLAS TileCal Phase-II Upgrade PreProcessor module
Zuccarello, Pedro Diego; The ATLAS collaboration
2016-01-01
Abstract–The electronics of the hadronic calorimeter of the ATLAS detector (TileCal) is being redesigned as part of the works that will lead to the High Luminosity Large Hadron Collider (HL-LHC). TileCal electronics is divided in front and back-end subsystems. While the front-end is inside the detector, the back-end is located off-detector inserted in an ATCA shelf. The main objective of this paper is to describe the work being carried out in the hardware management aspects of the back-end electronics of TileCal.
Cal Poly Apparel Manufacturing Demonstration - Year 3 Final Technical Report
National Research Council Canada - National Science Library
2000-01-01
.... Since the Southern California apparel industry is primarily small businesses producing low volume fashion products, the Cal Poly Demo factory needed to reflect the size and capability of its customer...
Levine, R.; Meyer, G. A.
2013-12-01
Creek. On all GYE streams investigated, beaver have promoted deposition of a large volume of fine-grained organic-rich sediment, but valley-floor aggradation (vertical rise) due to beaver damming is limited to beaver dams, except in glacial depressions where filling occurs without damming. Initial beaver-stick deposit ages for CV streams show notable clustering ca. 5200-5000, 3800-3600, and 900-550 cal yr BP, in part consistent with other GYE sites, where ages tend to cluster in colder-wetter intervals. Beaver-stick deposits from 900-550 cal yr BP, however, overlap the drought-prone Medieval Climate Anomaly (MCA) (~1050-650 cal yr BP), a time of major fire-related debris-flow activity in Yellowstone, and minimal beaver-pond sedimentation in smaller GYE streams. The presence of beaver-stick deposits during the MCA may indicate the importance of larger streams like Odell and Red Rock Creeks in maintaining riparian zones and beaver refugia in drought-prone episodes, a critical concern with current and future warming. Overall, the long-term perspective on beaver occupancy in the GYE across a variety of stream scales provides insight into the effects of climate on ecologically critical riparian zones.
Azevedo, André Luis Cairo de
2010-01-01
Visando ampliar o conhecimento sobre a estabilização dos solos com adição de cal, este estudo pretende demonstrar que as reações do solo argiloso com cal podem ser reversíveis. Esta análise simula uma mistura de solo e cal sendo executada inicialmente numa usina, quando do início da obra, antes mesmo da terraplenagem concluída, armazenada durante um período de tempo determinado e posteriormente sendo executada como camada de pavimento. Para isso foram feitos moldados corpos de prova com amost...
Posibilidades estructurales de materiales a base de cal como conglomerante: primeros resultados
Estrada, Enrique; Barbero, José Miguel
1986-01-01
La cal es un material abundante y cuya producción suma a una tecnología muy accesible la ventaja de poder materializarse en pequeñas plantas dispersas, para poder reducir al mínimo la componente de costo debida al transporte. En el presente trabajo se ha planteado la posibilidad de obtener hormigones con fines estructurales, para viviendas de baja altura y que sean de fácil obtención, a base de cal y cenizas volantes o cenizas de cascara de arroz, variando sus proporciones, grados de finur...
Holocene reef building on eastern St. Croix, US Virgin Islands: Lang Bank revisited
Hubbard, D. K.; Gill, I. P.; Burke, R. B.
2013-09-01
New core and seismic data suggest that widespread reef building started on Lang Bank by 8,900 CalBP and was dominated by Acropora palmata for the next three millennia. Accretion rates averaged 5.81 m ky-1, a rate that was sufficient for reefs to keep pace with rising sea level on the bank throughout their history. Seismic data show a deep platform interior that was flooded well in advance of reef building along the elevated rim. As a result, those reefs were buffered from sediment stress by their higher positions and active water flow to the west. A. palmata disappeared from the shallow margin by 6,350 yr ago, and reef building on Lang Bank largely ceased by 5,035 CalBP. The reasons for these dramatic events are unclear. Water depth over the reefs was generally shallower than when they started to build, and sea level was slowing dramatically. The new data described here show that reefs flourished on Lang Bank throughout the hiatus suggested by earlier studies (10-7 kyrs BP), and the ultimate demise of shelf-edge reefs is clearly not associated with either poor water quality or sudden sea-level rise. In addition, accretion rates from eastern St. Croix and throughout the Caribbean were well below the high values (≥10 m ky-1) that have been widely assumed. These data collectively argue against models that require extreme environmental or oceanographic phenomena to drown reefs on Lang Bank where reef building was too fast to be outpaced by Holocene sea-level rise. This also bears on more generalized Caribbean models that depend on the presumed reef history on eastern St. Croix.
Final Report Feasibility Study for the California Wave Energy Test Center (CalWavesm)
Energy Technology Data Exchange (ETDEWEB)
Blakeslee, Samuel Norman [California Polytechnic State Univ. (CalPoly), San Luis Obispo, CA (United States). Inst. for Advanced Technology and Public Policy; Toman, William I. [Protean Wave Energy Ltd., Los Osos, CA (United States); Williams, Richard B. [Leidos Maritime Solutions, Reston, VA (United States); Davy, Douglas M. [CH2M, Sacramento, CA (United States); West, Anna [Kearns and West, Inc., San Francisco, CA (United States); Connet, Randy M. [Omega Power Engineers, LLC, Anaheim, CA (United States); Thompson, Janet [Kearns and West, Inc., San Francisco, CA (United States); Dolan, Dale [California Polytechnic State Univ. (CalPoly), San Luis Obispo, CA (United States); Baltimore, Craig [California Polytechnic State Univ. (CalPoly), San Luis Obispo, CA (United States); Jacobson, Paul [Electric Power Research Inst. (EPRI), Knoxville, TN (United States); Hagerman, George [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Potter, Chris [California Natural Resources Agency, Sacramento, CA (United States); Dooher, Brendan [Pacific Gas and Electric Company, San Francisco, CA (United States); Wendt, Dean [California Polytechnic State Univ. (CalPoly), San Luis Obispo, CA (United States); Sheppard, Colin [Humboldt State Univ., Arcata, CA (United States); Harris, Andrew [Humboldt State Univ., Arcata, CA (United States); Lawson, W. Graham [Power Delivery Consultants, Inc., Albany, NY (United States)
2017-07-31
The California Wave Energy Test Center (CalWave) Feasibility Study project was funded over multiple phases by the Department of Energy to perform an interdisciplinary feasibility assessment to analyze the engineering, permitting, and stakeholder requirements to establish an open water, fully energetic, grid connected, wave energy test center off the coast of California for the purposes of advancing U.S. wave energy research, development, and testing capabilities. Work under this grant included wave energy resource characterization, grid impact and interconnection requirements, port infrastructure and maritime industry capability/suitability to accommodate the industry at research, demonstration and commercial scale, and macro and micro siting considerations. CalWave Phase I performed a macro-siting and down-selection process focusing on two potential test sites in California: Humboldt Bay and Vandenberg Air Force Base. This work resulted in the Vandenberg Air Force Base site being chosen as the most favorable site based on a peer reviewed criteria matrix. CalWave Phase II focused on four siting location alternatives along the Vandenberg Air Force Base coastline and culminated with a final siting down-selection. Key outcomes from this work include completion of preliminary engineering and systems integration work, a robust turnkey cost estimate, shoreside and subsea hazards assessment, storm wave analysis, lessons learned reports from several maritime disciplines, test center benchmarking as compared to existing international test sites, analysis of existing applicable environmental literature, the completion of a preliminary regulatory, permitting and licensing roadmap, robust interaction and engagement with state and federal regulatory agency personnel and local stakeholders, and the population of a Draft Federal Energy Regulatory Commission (FERC) Preliminary Application Document (PAD). Analysis of existing offshore oil and gas infrastructure was also performed
Energy Technology Data Exchange (ETDEWEB)
J Amacher; P Cushing; J Weiner; D Madden
2011-12-31
Cystic fibrosis (CF) is associated with loss-of-function mutations in the CF transmembrane conductance regulator (CFTR), which regulates epithelial fluid and ion homeostasis. The CFTR cytoplasmic C-terminus interacts with a number of PDZ (PSD-95/Dlg/ZO-1) proteins that modulate its intracellular trafficking and chloride-channel activity. Among these, the CFTR-associated ligand (CAL) has a negative effect on apical-membrane expression levels of the most common disease-associated mutant {Delta}F508-CFTR, making CAL a candidate target for the treatment of CF. A selective peptide inhibitor of the CAL PDZ domain (iCAL36) has recently been developed and shown to stabilize apical expression of {Delta}F508-CFTR, enhancing net chloride-channel activity, both alone and in combination with the folding corrector corr-4a. As a basis for structural studies of the CAL-iCAL36 interaction, a purification protocol has been developed that increases the oligomeric homogeneity of the protein. Here, the cocrystallization of the complex in space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 35.9, b = 47.7, c = 97.3 {angstrom}, is reported. The crystals diffracted to 1.4 {angstrom} resolution. Based on the calculated Matthews coefficient (1.96 {angstrom}{sup 3} Da{sup -1}), it appears that the asymmetric unit contains two complexes.
Directory of Open Access Journals (Sweden)
Sílvio Fernandes Lopes
1961-12-01
Full Text Available A honra de ocupar uma cadeira numa instituição cientí-fica de renome, não é maior, decerto, do que aquela de o fazer à sombra de um vulto de primeira grandeza, a lhe servir de patrono. Dupla honra e dupla responsabilidade, portanto, o que neste momento me toca, pois se a Cadeira pertence ao Instituto Histórico e Geográfico de Santos, entidade que digni-fica a cultura da nossa terra e da nossa gente em vinte e dois anos de trajetória científica e social, a invocação pertence a uma das maiores figuras do Brasil República, o grande Caló-geras, que Afonso de Taunay chamou de "gigante do pensa-mento brasileiro", quando, em discurso de saudação a Rodol-fo Garcia na Academia Brasileira de Letras, verberava que, naquela Academia ilustre, não estivessem três gigantes do pen-samento brasileiro: Pandiá Calógeras, Martim Francisco e Ca-pistrano de Abreu.
ATLAS TileCal LVPS Upgrade Hardware and Testing
Hibbard, Michael James; The ATLAS collaboration; Hadavand, Haleh Khani
2018-01-01
UTA (University of Texas at Arlington) has been designing and producing new testing stations to ensure the reliability and quality of new TileLVPS (Low Voltage Power Supplies), also produced at UTA, which will power the next generation of upgraded hardware in the TileCal (Tile Calorimeter) system of ATLAS at CERN. UTA has produced two new types of testing stations, which build upon the previous generation of testing stations used in the initial production of the TileCal system. The first station is the Initial Test Station, and quickly quantifies a multitude of performance metrics of a LVPS. We have developed our own PC based program which graphically display and records onto file these metrics. A few notable metrics we are measuring are the system clock and its jitter. Excessive clock jitter in LVPS can affect system stability and derate the working range of the system duty cycle. This station also verifies protection circuitry of LVPS, which protects it from over temperature, current and voltage. The second...
Tunneling in BP-MoS2 heterostructure
Liu, Xiaochi; Qu, Deshun; Kim, Changsik; Ahmed, Faisal; Yoo, Won Jong
Tunnel field effect transistor (TFET) is considered to be a leading option for achieving SS mV/dec. In this work, black phosphorus (BP) and molybdenum disulfide (MoS2) heterojunction devices are fabricated. We find that thin BP flake and MoS2 form normal p-n junctions, tunneling phenomena can be observed when BP thickness increases to certain level. PEO:CsClO4 is applied on the surface of the device together with a side gate electrode patterned together with source and drain electrodes. The Fermi level of MoS2 on top of BP layer can be modulated by the side gating, and this enables to vary the MoS2-BP tunnel diode property from off-state to on-state. Since tunneling is the working mechanism of MoS2-BP junction, and PEO:CsClO4\\ possesses ultra high dielectric constant and small equivalent oxide thickness (EOT), a low SS of 55 mV/dec is obtained from MoS2-BP TFET. This work was supported by the Global Research Laboratory and Global Frontier R&D Programs at the Center for Hybrid Interface Materials, both funded by the Ministry of Science, ICT & Future Planning via the National Research Foundation of Korea (NRF).
Holocene Tree Line and Climate Change on the Queen Charlotte Islands, Canada
Pellatt, Marlow G.; Mathewes, Rolf W.
1997-07-01
Palynological study of two subalpine ponds on the Queen Charlotte Islands reveals changes in tree line and climate during the Holocene. The findings agree with previous reconstructions, from nearby Louise Pond on the Queen Charlotte Islands, that suggest a warmer-than-present climate and higher-than-present tree lines in the early Holocene (ca. 9600-6600 14C yr B.P.). Basal ages at SC1 Pond and Shangri-La Bog indicate that the basins did not hold permanent water before 7200 14C yr B.P., consistent with a warmer and drier early Holocene previously inferred from Louise Pond. Pollen and plant macrofossils indicate the initial establishment of subalpine conditions by 6090 ± 90 14C yr B.P., similar to the 5790 ± 130 14C yr B.P. age for cooling inferred from Louise Pond. Conditions similar to present were established at SC1 Pond by 3460 ± 100 14C yr B.P., confirming the previous estimate of 3400 14C yr B.P. at Louise Pond. This 3400 14C yr B.P. vegetation shift on the Queen Charlotte Islands corresponds with the beginning of the Tiedemann glacial advance in the south-coastal mountains of British Columbia (ca. 3300 14C yr B.P.), the Peyto and Robson glacial advances between 3300 and 2800 14C yr B.P. in the Rocky Mountains, and climatic cooling inferred from palynological studies throughout southern British Columbia, northern Washington, and southeast Alaska. These findings confirm that changes in regional climate influenced changes in vegetation in coastal British Columbia.
Cal/Val activities for DubaiSat-2 performance assessment
Bushahab, A.; Al-Mansoori, S.; Al-Suwaidi, K.; Al Matroushi, Hessa; Al-Tunaiji, E.; Al Shamsi, Meera
2014-10-01
Emirates Institution for Advanced Science and Technology (EIAST) was established by the Dubai Government in 2006. After three years of working together with Satrec Initiative (South Korea), EIAST was able to launch DubaiSat-1 on the 29th of July 2009. Building on the success of DubaiSat-1 and the roll out of the knowledge transfer program, UAE engineers were involved in almost 70% of the total build and design of DubaiSat-2. Targeting the commercial market, DubaiSat-2 was launched on the 21st of November 2013 for capturing 1-meter resolution images. The 1st Cal/Val phase was the most critical phase in the satellite life-time, where most of the initial measurements took place. This phase extended over the period of 25/11/2013 till 12/12/2013. Moreover, this phase included most of the relative calibration tasks, color balancing and band matching. 2nd Cal/Val phase included most of the debugging and the pointing accuracy calibration tests. This phase extended over the period of 11/02/2014 till 09/03/2014. This phase emphasized on the calibration of the pointing accuracy. The 3rd Cal/Val phase included fine tuning for the Gyro system to further increase the stability of the satellite and thus improve the pointing accuracy. Moreover, new techniques were implemented to the Pan-Sharpening and to the MTF compensation procedures to enhance the final product. This phase extended over the period of 04/05/2014 till 21/05/2014.
The Arrival of Homo sapiens into the Southern Cone at 14,000 Years Ago.
Politis, Gustavo G; Gutiérrez, María A; Rafuse, Daniel J; Blasi, Adriana
The Arroyo Seco 2 site contains a rich archaeological record, exceptional for South America, to explain the expansion of Homo sapiens into the Americas and their interaction with extinct Pleistocene mammals. The following paper provides a detailed overview of material remains found in the earliest cultural episodes at this multi-component site, dated between ca. 12,170 14C yrs B.P. (ca. 14,064 cal yrs B.P.) and 11,180 14C yrs B.P. (ca. 13,068 cal yrs B.P.). Evidence of early occupations includes the presence of lithic tools, a concentration of Pleistocene species remains, human-induced fractured animal bones, and a selection of skeletal parts of extinct fauna. The occurrence of hunter-gatherers in the Southern Cone at ca. 14,000 cal yrs B.P. is added to the growing list of American sites that indicate a human occupation earlier than the Clovis dispersal episode, but posterior to the onset of the deglaciation of the Last Glacial Maximum (LGM) in the North America.
The Arrival of Homo sapiens into the Southern Cone at 14,000 Years Ago.
Directory of Open Access Journals (Sweden)
Gustavo G Politis
Full Text Available The Arroyo Seco 2 site contains a rich archaeological record, exceptional for South America, to explain the expansion of Homo sapiens into the Americas and their interaction with extinct Pleistocene mammals. The following paper provides a detailed overview of material remains found in the earliest cultural episodes at this multi-component site, dated between ca. 12,170 14C yrs B.P. (ca. 14,064 cal yrs B.P. and 11,180 14C yrs B.P. (ca. 13,068 cal yrs B.P.. Evidence of early occupations includes the presence of lithic tools, a concentration of Pleistocene species remains, human-induced fractured animal bones, and a selection of skeletal parts of extinct fauna. The occurrence of hunter-gatherers in the Southern Cone at ca. 14,000 cal yrs B.P. is added to the growing list of American sites that indicate a human occupation earlier than the Clovis dispersal episode, but posterior to the onset of the deglaciation of the Last Glacial Maximum (LGM in the North America.
Energy Technology Data Exchange (ETDEWEB)
Baucom, P.C.; Rigsby, C.A. [East Carolina Univ., Greenville, NC (United States). Dept. of Geology
1999-05-01
Strata exposed in terraces and modern cutbanks along the Rio Desaguadero contain a variety of lithofacies that were deposited in four distinct facies associations. These facies associations document a history of aggradation and downcutting that is linked to Holocene climate change on the Altiplano. Braided-stream, meandering-stream, deltaic and shoreline, and lacustrine sediments preserved in multi-level terraces in the northern Rio Desaguadero valley record two high-water intervals: one between 4,500 and 3,900 yr BP and another between 2,000 and 2,200 yr BP. These wet periods were interrupted by three periods of fluvial downcutting, centered at approximately 4,000 yr BP, 3,600 yr BP, and after 2,000 yr BP. Braided-river sediments preserved in a single terrace level in the southern Rio Desaguadero valley record a history of nearly continuous fluvial sedimentation from at least 7,000 yr BP until approximately 3,200 yr BP that was followed by a single episode (post-3,210 yr BP) of down-cutting and lateral migration. The deposition and subsequent fluvial downcutting of the northern strata was controlled by changes in effective moisture that can be correlated to Holocene water-level fluctuations of Lake Titicaca. The deposition and dissection of braided-stream sediments to the south are more likely controlled by a combination of base-level change and sediment input from the Rio Mauri.
Climate in the Western Cordillera of the Central Andes over the last 4300 years
Engel, Zbyněk; Skrzypek, Grzegorz; Chuman, Tomáš; Šefrna, Luděk; Mihaljevič, Martin
2014-09-01
The Distichia peat core obtained in the Carhuasanta valley near Nevado Mismi, Cordillera Chila, provides information on climatic and environmental conditions over the last ˜4300 years. The relative changes in the stable carbon isotope composition of plant remains preserved in the core reflect major temperature fluctuations in the Western Cordillera of the southern Peruvian Andes. These temperature variations can be additionally linked with the changes in precipitation patterns by analysing C% and C/N ratio in the core. Relatively warm and moist conditions prevailed from 4280 to 3040 cal. yrs BP (BC 2330-1090) with a short colder dry episode around 3850 cal. yrs BP (BC 1900). The most prominent climate changes recorded in the peat occurred between 3040 and 2750 cal. yrs BP (BC 1090-800) when the initial warming turned to a rapid cooling to temperatures at least 2 °C lower than the mean for the Late Holocene. Initially drier conditions within this event turned to a short wet phase after 2780 cal. yrs BP (BC 830) when the temperature increased again. This event coincides with significant changes in peat and ice core records in the Central Andes matching the timing of the global climate event around 2.8 cal. ka BP. Climatic conditions in the study area became relatively dry and stable after the event for about 800 years. Highly variable temperatures and humidity prevailed during the last 2000 years when an extended warm and relatively humid period occurred between 640 and 155 cal. yrs BP (AD 1310-1795) followed by predominantly colder and drier conditions. The established δ13C peat record represents the first continuous proxy for the temperature in the southern Peruvian Andes dated by the AMS 14C. Distichia peat is wide spread in the Andes and the proposed approach can be applied elsewhere in high altitudes, where no other traditional climate proxies are available.
Jennings, A. E.; Andrews, J. T.
2008-12-01
A complex sequence of abrupt glacial advances and retreats punctuate the late phases of Laurentide Ice Sheet deglaciation. These episodes have been reconstructed from interpretation and mapping of glacial deposits on land and in marine basins proximal to the former ice margins in Hudson Strait, Hudson Bay, and the SE Baffin Island shelf. As these events likely produced pulses of freshwater discharge into the North Altantic, which may be responsible for rapid climate change, their timing and magnitude need to be understood. The timing of these events is well constrained by radiocarbon ages, but the ocean reservoir age in ice proximal areas is subject to very large uncertainties, making it difficult to determine calibrated ages for the glacial events so that they can be compared to other climate records. We suggest that the sequence of high detrital carbonate peaks in Holocene and Late Glacial sediments in the Cartwright Saddle of the Labrador shelf provides a template of the abrupt glacial events of the NE margin of the Laurentide Ice Sheet, particularly events that issued from Hudson Strait and Hudson Bay, but possibly including events in Baffin Bay. Once the Labrador Shelf was deglaciated and the local ice had retreated inland, the Cartwright Saddle was a distal trap for sediments released from Hudson Strait and other ice sheet outlets farther north as their sediments and meltwater were carried southwards by surface currents. Core MD99-2236 contains a sediment record beginning c. 13.9 cal ka. We assume a marine reservoir age for the Cartwright Saddle of 450 yrs, which is reasonable given the ice distal and oceanic position of the site. Carbonate was measured on average at a 30 yr time resolution. Carbonate values are elevated between 11.7 and 7 cal kyr BP, with six spikes exceeding 30 percent. Each spike corresponds to a light isotope spike in foraminifers, suggesting that each major spike is associated with a pulse of glacial meltwater. Elevated IRD counts
ATLAS TileCal submodule B-field measurement
International Nuclear Information System (INIS)
Budagov, Yu.A.; Fedorenko, S.B.; Kalinichenko, V.V.; Lomakin, Yu.F.; Vorozhtsov, S.B.; Nessi, M.
1997-01-01
The work was done to cross check of the previous measurement done at CERN and to simulate the magnetic structure in the vicinity of the symmetry plane of the TileCal. To perform magnetic measurements for submodule the magnet E2 was chosen. The magnetometer used in the magnetic test of the submodule consists of Hall current supply and Hall voltage measuring device. The indium antimonide Hall probe used in this measurement is a model PKhE 606. Experimental set-up provides a true measurement accuracy of order ± 1%. External magnetic field measurements were conducted at the outer surface of the submodule. Two levels of the external field were applied: 108 Gs and 400 Gs. The result of this measurement in general confirms the data, obtained at CERN, but the shielding capability of the submodule under consideration was ∼ 20% higher than there. The field at the tile location is < 150 Gs up to the external field level 500 Gs and the tile field grows much less than the external field level in this range. The data obtained in this measurement could be used as a benchmark when producing a computer model of the TileCal magnetic field distribution
Kublitskiy, Iurii; Subetto, Dmitriy; Druzhinina, Olga; Kulkova, Marianna; Arslanov, Khikmatula
2016-04-01
The main goal of our research is the high-resolution reconstruction of environmental and climatic changes in SE Baltic region since the Last Glacial Maximum by palaeolimnological data. The 6 objects - lakes and peat-bogs, were studied since 2009 in the Kaliningrad region, Russian Federation. According to palaeolimnological studies of bottom sediments of the Kamyshovoe Lake (N 54°22,6`; E22°42,8`, 189 m a.s.l.), located in the Vishtynets Highland, the south-east part of Kaliningrad district, the environmental and climatic changes after the late glacial have been reconstructed. At that moment the radiocarbon and loss-on-ignition (LOI) data, geochemistry and diatom analysis for the whole sediment core, and pollen analyze for the bottom part of the core have been completed. According to the pollen data the Alleröd interstadial starts at 13 200 cal. yrs BP and is marked by the rising of birch and pine pollen. The transition to the Younger Dryas around 12 700 cal. yrs BP corresponds with the development of patches of shrublands in which light-demanding species, such as juniper, flourished and communities of steppe herbs. The late Preboreal is marked by the appearance of Populus and an increase of the role of grasses in the vegetation cover 11 300-11 100 cal. yrs BP (Druzinina et al., 2015). The Holocene climatic zones have been identified by LOI and geochemistry analyses. The Boreal period started about 10 200 cal. yrs BP, Atlantic around 9100 cal. yrs BP, Subboreal 5800 cal. yrs BP, and Subatlantic 3200 cal. yrs BP (Kublitskiy et al., 2015). During the conference the new palaeolimnological data of environmental variability during the late Pleistocene and Holocene in SE Baltic region will be presented. Acknowledgements The investigations have been granted by the Russian Fund for Basic Research (12-05-33013, 13-05-41457, 15-35-50721). References Druzhinina, O., Subetto, D., Stančikaitė, M., Vaikutienė, G., Kublitsky, J., Arslanov, Kh., 2015. Sediment record from the
Wagner, B.; Viehberg, F. A.; Wennrich, V.; Junginger, A.; Kolvenbach, A.; Rethemeyer, J.; Schaebitz, F.; Schmiedl, G. H.
2015-12-01
A 12 m long sediment sequence from Dendi Crater lakes, located on the central Ethiopian Plateau, was analysed with sedimentological and geochemical methods to reconstruct the regional environmental history. Bulk organic carbon samples from 23 horizons throughout the sequence were used for AMS radiocarbon dating and indicate that the sediment sequence spans the last ca. 12 cal kyr BP. Microscope analyses and sedimentological data reveal three tephra layers, of which the most prominent layer with a thickness of ~2 m was deposited at 10.2 cal kyr BP and probably originates from an eruption of the Wenchi crater 12 km to the west of the Dendi lakes. Sedimentological data of the pelagic deposits indicate shifts in erosion and rainfall throughout the record. A decrease in Ca and Sr at 11.6 cal kyr BP is related to the shift of less humid condition during the Younger Dryas (YD) to the return to full humid conditions of the African Humid Period (AHP). Single thin horizons with high carbonate content or high Ti and K imply that short spells of dry conditions and significantly increased rainfall superimpose the generally more humid conditions during the AHP. The end of the AHP is gradual. Relatively stable and less humid conditions characterised the Dendi Crater lakes until around 3.9 cal kyr BP. A highly variable increase in clastic matter over the last 1500 years indicates higher erosion due to short-term variations in precipitation within the Dendi catchment. Overall, the sediment record suggests moderate change of precipitation during the Holocene, which is probably due to their exposed location in the Ethiopian highlands. The data from the Dendi Crater lakes show, in concert with other records from the Nile catchment and the Eastern Mediterranean Sea (EMS), that the Blue Nile provided the main freshwater source for maintaining EMS stratification and sapropel S1 formation between ca. 10.0 and 8.7 cal kyr BP. Subsequent aridification is recorded from equatorial East Africa
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-08-15
This report documents a test transfer of three Air Force technical procurement bid sets to one large and twelve small businesses, using the Department of Defense (DoD) Continuous Acquisition and Life-cycle Support (CALS) and ANSI ASC X12 Electronic Data Interchange (EDI) standards. The main goal of the test was to evaluate the effectiveness of using CALS technical data within the context of the DoD`s EDI-based standard approach to electronic commerce in procurement, with particular emphasis on receipt and use of the data by small contractors. Air Force procurement data was provided by the Sacramento Air Logistics Center at McClellan Air Force Base; the manufacturing participants were selected from among McClellan`s ``Blue Ribbon`` contractors, located throughout the US. The test was sponsored by the Air Force CALS Test Network, headquartered at Wright-Patterson Air Force Base. The test successfully demonstrated the technical feasibility of including CALS MIL-R-28002 (Raster) engineering data in an EDI Specification/Technical Information transaction set (ANSI ASC X12 841) when issuing electronic requests for quotation to small businesses. In many cases, the data was complete enough for the contractor participant to feel comfortable generating a quote. Lessons learned from the test are being fed back to the CALS and EDI standards organizations, and to future implementors of CALS-EDI based acquisition or contracting systems, which require the transfer of technical information, such as engineering data, manufacturing process data, quality test data, and other product or process data, in the form of a CALS or other digital datafile.
BP180 dysfunction triggers spontaneous skin inflammation in mice.
Zhang, Yang; Hwang, Bin-Jin; Liu, Zhen; Li, Ning; Lough, Kendall; Williams, Scott E; Chen, Jinbo; Burette, Susan W; Diaz, Luis A; Su, Maureen A; Xiao, Shengxiang; Liu, Zhi
2018-06-04
BP180, also known as collagen XVII, is a hemidesmosomal component and plays a key role in maintaining skin dermal/epidermal adhesion. Dysfunction of BP180, either through genetic mutations in junctional epidermolysis bullosa (JEB) or autoantibody insult in bullous pemphigoid (BP), leads to subepidermal blistering accompanied by skin inflammation. However, whether BP180 is involved in skin inflammation remains unknown. To address this question, we generated a BP180-dysfunctional mouse strain and found that mice lacking functional BP180 (termed Δ NC16A ) developed spontaneous skin inflammatory disease, characterized by severe itch, defective skin barrier, infiltrating immune cells, elevated serum IgE levels, and increased expression of thymic stromal lymphopoietin (TSLP). Severe itch is independent of adaptive immunity and histamine, but dependent on increased expression of TSLP by keratinocytes. In addition, a high TSLP expression is detected in BP patients. Our data provide direct evidence showing that BP180 regulates skin inflammation independently of adaptive immunity, and BP180 dysfunction leads to a TSLP-mediated itch. The newly developed mouse strain could be a model for elucidation of disease mechanisms and development of novel therapeutic strategies for skin inflammation and BP180-related skin conditions.
BP - bisnis põhjas? / Erik Aru
Aru, Erik
2010-01-01
Seoses Mehhiko lahe naftareostusega ootab BP-d kuni 21 mld. dollari suurune trahv, kahjude hüvitamiseks peab BP müüma osa oma varast. Ekspertide hinnangul tähendavad Mehhiko lahe sündmused suuri muutusi kogu naftaäris
Diseño del sistema para extracción de gases de un horno para cal
Vega Basurto, Carlos W.; Martinez Lozano, Ernesto Rolando
2009-01-01
Esta tesis es realizada en una empresa distribuidora de material no metálico ubicada en la ciudad de Guayaquil en el kilómetro 12 ½ Vía a la costa. Es una planta que tiene dos procesos fundamentales que son obtención de Cal y de procesamiento de áridos (piedra y arena). Este trabajo se enfoca en la parte del proceso de obtención de Cal que tiene una gran demanda en estos momentos en el país. La empresa posee un horno de una capacidad de 80 Toneladas Por Día de Cal pero no logra cubrir to...
Multivalent display of the antimicrobial peptides BP100 and BP143
Directory of Open Access Journals (Sweden)
Imma Güell
2012-12-01
Full Text Available Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100 and KKLfKKILKYL-NH2 (BP143 attached to the carbohydrate template cyclodithioerythritol (cDTE or α-D-galactopyranoside (Galp. The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling to an aminooxy-functionalized carbohydrate template. After purification, the multivalent display systems were obtained in high purities (90–98% and in good yields (42–64%. These compounds were tested against plant and human pathogenic bacteria and screened for their cytotoxicity on eukaryotic cells. They showed lower MIC values than the parent peptides against the bacteria analyzed. In particular, the carbopeptides derived from cDTE and Galp, which contained two or four copies of BP100, respectively, were 2- to 8-fold more active than the monomeric peptide against the phytopathogenic bacteria. These results suggest that preassembling antimicrobial peptides to multimeric structures is not always associated with a significant improvement of the activity. In contrast, the carbopeptides synthesized were active against human red blood cells pointing out that peptide preassembly is critical for the hemolytic activity. Notably, peptide preassembly resulted in an enhanced bactericidal effect.
Volcanic Processes and Geology of Augustine Volcano, Alaska
Waitt, Richard B.; Beget, James E.
2009-01-01
Augustine Island (volcano) in lower Cook Inlet, Alaska, has erupted repeatedly in late-Holocene and historical times. Eruptions typically beget high-energy volcanic processes. Most notable are bouldery debris avalanches containing immense angular clasts shed from summit domes. Coarse deposits of these avalanches form much of Augustine's lower flanks. A new geologic map at 1:25,000 scale depicts these deposits, these processes. We correlate deposits by tephra layers calibrated by many radiocarbon dates. Augustine Volcano began erupting on the flank of a small island of Jurassic clastic-sedimentary rock before the late Wisconsin glaciation (late Pleistocene). The oldest known effusions ranged from olivine basalt explosively propelled by steam, to highly explosive magmatic eruptions of dacite or rhyodacite shed as pumice flows. Late Wisconsin piedmont glaciers issuing from the mountainous western mainland surrounded the island while dacitic eruptive debris swept down the south volcano flank. Evidence is scant for eruptions between the late Wisconsin and about 2,200 yr B.P. On a few south-flank inliers, thick stratigraphically low pumiceous pyroclastic-flow and fall deposits probably represent this period from which we have no radiocarbon dates on Augustine Island. Eruptions between about 5,350 and 2,200 yr B.P. we know with certainty by distal tephras. On Shuyak Island 100 km southeast of Augustine, two distal fall ashes of Augustinian chemical provenance (microprobe analysis of glass) date respectively between about 5,330 and 5,020 yr B.P. and between about 3,620 and 3,360 yr B.P. An Augustine ash along Kamishak Creek 70 km southwest of Augustine dates between about 3,850 and 3,660 yr B.P. A probably Augustinian ash lying within peat near Homer dates to about 2,275 yr B.P. From before 2,200 yr B.P. to the present, Augustine eruptive products abundantly mantle the island. During this period, numerous coarse debris avalanches swept beyond Augustine's coast, most
Directory of Open Access Journals (Sweden)
Nebojša Čokorilo
2007-05-01
Full Text Available The re se arch was con duc ted on the sam ple of 222 pa rents of ele men tary school - girls, aged 6-7 years from No vi Sad, Som bor, Srem ska Mi tro vi ca, Bač ka Pa lan ka and Zre nja nin. Physi cal ac ti vi ti es of ma le chil dren and the ir pa rents we re al so eva lu a ted by the ir pa rents. That is the ti me when chil dren can con sti tu te ha bits for physi cal exer ci ses. Pas si ve at ti tu de of fe ma le chil dren to wards physi cal exer ci ses are the con se qu en ces of the sa me at ti tu des sha red by pa rents. Wit hin re se arch it is fo und out that the re is a hu ge im por tan ce of pa rents’ par ti ci pa tion in chil dren’s ac ti vi ti es. That in clu des how much chil dren are physi cal ac ti ve per we ek.
Gray, S.C.; Hein, J.R.; Hausmann, R.; Radtke, U.
1992-01-01
Eustatic sea-level cycles superposed on thermal subsidence of an atoll produce layers of high sea-level reefs separated by erosional unconformities. Coral samples from these reefs from cores drilled to 50 m beneath the lagoons of Pukapuka and Rakahanga atolls, northern Cook Islands give electron spin resonance (ESR) and U-series ages ranging from the Holocene to 600,000 yr B.P. Subgroups of these ages and the stratigraphic position of their bounding unconformities define at least 5 periods of reef growth and high sea-level (0-9000 yr B.P., 125,000-180,000 yr B.P., 180,000-230,000 yr B.P., 300,000-460,000 yr B.P., 460,000-650,000 yr B.P.). Only two ages fall within error of the last interglacial high sea-level stand (???125,000-135,000 yr B.P.). This paucity of ages may result from extensive erosion of the last intergracial reef. In addition, post-depositional isotope exchange may have altered the time ages of three coral samples to apparent ages that fall within glacial stage 6. For the record to be preserved, vertical accretion during rising sea-level must compensate for surface lowering from erosion during sea-level lowstands and subsidence of the atoll; erosion rates (6-63 cm/1000 yr) can therefore be calculated from reef accretion rates (100-400 cm/1000 yr), subsidence rates (2-6 cm/1000 yr), and the duration of island submergence (8-15% of the last 600,000 yr). The stratigraphy of coral ages indicates island subsidence rates of 4.5 ?? 2.8 cm/1000 yr for both islands. A model of reef growth and erosion based on the stratigraphy of the Cook Islands atolls suggests average subsidence and erosion rates of between 3-6 and 15-20 cm/1000 yr, respectively. ?? 1992.
Energy Technology Data Exchange (ETDEWEB)
Hunn, B. D.; Diamond, S. C.; Bennett, G. A.; Tucker, E. F.; Roschke, M. A.
1977-10-01
A set of computer programs, called Cal-ERDA, is described that is capable of rapid and detailed analysis of energy consumption in buildings. A new user-oriented input language, named the Building Design Language (BDL), has been written to allow simplified manipulation of the many variables used to describe a building and its operation. This manual provides the user with information necessary to understand in detail the Cal-ERDA set of computer programs. The new computer programs described include: an EXECUTIVE Processor to create computer system control commands; a BDL Processor to analyze input instructions, execute computer system control commands, perform assignments and data retrieval, and control the operation of the LOADS, SYSTEMS, PLANT, ECONOMICS, and REPORT programs; a LOADS analysis program that calculates peak (design) zone and hourly loads and the effect of the ambient weather conditions, the internal occupancy, lighting, and equipment within the building, as well as variations in the size, location, orientation, construction, walls, roofs, floors, fenestrations, attachments (awnings, balconies), and shape of a building; a Heating, Ventilating, and Air-Conditioning (HVAC) SYSTEMS analysis program capable of modeling the operation of HVAC components including fans, coils, economizers, humidifiers, etc.; 16 standard configurations and operated according to various temperature and humidity control schedules. A plant equipment program models the operation of boilers, chillers, electrical generation equipment (diesel or turbines), heat storage apparatus (chilled or heated water), and solar heating and/or cooling systems. An ECONOMIC analysis program calculates life-cycle costs. A REPORT program produces tables of user-selected variables and arranges them according to user-specified formats. A set of WEATHER ANALYSIS programs manipulates, summarizes and plots weather data. Libraries of weather data, schedule data, and building data were prepared.
Antarctic Surface Reflectivity Measurements from the ANITA-3 and HiCal-1 Experiments
Gorham, P. W.; Allison, P.; Banerjee, O.; Beatty, J. J.; Belov, K.; Besson, D. Z.; Binns, W. R.; Bugaev, V.; Cao, P.; Chen, C.; Chen, P.; Clem, J. M.; Connolly, A.; Dailey, B.; Dasgupta, P.; Deaconu, C.; Cremonesi, L.; Dowkontt, P. F.; Fox, B. D.; Gordon, J.; Hill, B.; Hupe, R.; Israel, M. H.; Jain, P.; Kowalski, J.; Lam, J.; Learned, J. G.; Liewer, K. M.; Liu, T. C.; Matsuno, S.; Miki, C.; Mottram, M.; Mulrey, K.; Nam, J.; Nichol, R. J.; Novikov, A.; Oberla, E.; Prohira, S.; Rauch, B. F.; Romero-Wolf, A.; Rotter, B.; Ratzlaff, K.; Russell, J.; Saltzberg, D.; Seckel, D.; Schoorlemmer, H.; Stafford, S.; Stockham, J.; Stockham, M.; Strutt, B.; Tatem, K.; Varner, G. S.; Vieregg, A. G.; Wissel, S. A.; Wu, F.; Young, R.
The primary science goal of the NASA-sponsored ANITA project is measurement of ultra-high energy neutrinos and cosmic rays, observed via radio-frequency signals resulting from a neutrino or cosmic ray interaction with terrestrial matter (e.g. atmospheric or ice molecules). Accurate inference of the energies of these cosmic rays requires understanding the transmission/reflection of radio wave signals across the ice-air boundary. Satellite-based measurements of Antarctic surface reflectivity, using a co-located transmitter and receiver, have been performed more-or-less continuously for the last few decades. Our comparison of four different reflectivity surveys, at frequencies ranging from 2 to 45GHz and at near-normal incidence, yield generally consistent maps of high versus low reflectivity, as a function of location, across Antarctica. Using the Sun as an RF source, and the ANITA-3 balloon borne radio-frequency antenna array as the RF receiver, we have also measured the surface reflectivity over the interval 200-1000MHz, at elevation angles of 12-30∘. Consistent with our previous measurement using ANITA-2, we find good agreement, within systematic errors (dominated by antenna beam width uncertainties) and across Antarctica, with the expected reflectivity as prescribed by the Fresnel equations. To probe low incidence angles, inaccessible to the Antarctic Solar technique and not probed by previous satellite surveys, a novel experimental approach (“HiCal-1”) was devised. Unlike previous measurements, HiCal-ANITA constitute a bi-static transmitter-receiver pair separated by hundreds of kilometers. Data taken with HiCal, between 200 and 600MHz shows a significant departure from the Fresnel equations, constant with frequency over that band, with the deficit increasing with obliquity of incidence, which we attribute to the combined effects of possible surface roughness, surface grain effects, radar clutter and/or shadowing of the reflection zone due to Earth
Woodson, Anna Lee; Leorri, Eduardo; Culver, Stephen J.; Mallinson, David J.; Parham, Peter R.; Thunell, Robert C.; Vijayan, V. R.; Curtis, Scott
2017-06-01
To test whether low latitude shallow shelf deposits can provide high resolution paleoclimatic records, we utilized two cores from the Holocene sedimentary fill of incised valleys on the Sunda Shelf off Sarawak, Malaysia. We developed a new sea-surface temperature (SST) record based on planktonic foraminiferal Mg/Ca for the last 7200 years. This record reveals several significant shifts between warmer and colder conditions. Temperatures averaged 27.5 °C ca. 7200 cal. years BP, then climbed to 28.2 °C from 6500 to 5500 cal. years BP. At 5500-4500 cal. years BP we identified the coldest period (26.8 °C) of the analyzed period. For the last 4500 years SST again averaged 27.5 °C but the profile is rather variable. The last ca. 1000 years recorded the warmest SST averaging 28.5 °C. We record, for the first time in this region, a cool interval, ca. 1000 years in duration, centered on 5000 cal years BP concomitant with a wet period recorded in Borneo. The record also reflects a warm interval from ca. 1000 to 500 cal years BP that may represent the Medieval Climate Anomaly. Variations in the East Asian Monsoon (EAM) and solar activity are considered as potential drivers of SST trends. However, hydrology changes related to the El Niño-Southern Oscillation (ENSO) variability, shifts of the Western Pacific Warm Pool and migration of the Intertropical Convergence Zone are more likely to have impacted our SST temporal trend. Our findings indicate that climatic patterns in the region might be in phase with ENSO and out of phase with the EAM.
Ouyang, Tingping; Li, Mingkun; Zhao, Xiang; Zhu, Zhaoyu; Tian, Chengjing; Qiu, Yan; Peng, Xuechao; Hu, Qiao
2016-05-01
Magnetic property has been proved to be a sensitive proxy to climate change for both terrestrial and marine sediments. Based on the schedule frame established by AMS 14C dating of foraminifera, detail magnetic analyses were performed for core PC24 sediments at sampling intervals of 2 cm to discuss magnetic sensitivity of marine sediment to climate during Holocene for the northern South China Sea. The results indicated that: 1) Concentration dependent magnetic parameters are positive corresponding to variation of temperature. The frequency dependent susceptibility coefficient basically reflected the variation in humidity; 2) XARM/SIRM was more sensitive to detrital magnetite particles and SIRM/X was more effective to biogenic magnetite particles. Variations of XARM/SIRM and SIRM/X are corresponding to precipitation and temperature, respectively; 3) the Holocene Megathermal in the study area was identified as 7.5-3.4 cal. ka BP. The warmest stage of Holocene for the study area should be during 6.1 to 3.9 cal. ka BP; 4) The 8 ka cold event was characterized as cold and dry during 8.55 to 8.25 cal. ka BP; 5) During early and middle Holocene, the climate combinations were warm dry and cold wet. It turned to warm and wet after 2.7 cal. ka BP.
Directory of Open Access Journals (Sweden)
Tingping eOuyang
2016-05-01
Full Text Available Magnetic property has been proved to be a sensitive proxy to climate change for both terrestrial and marine sediments. Based on the schedule frame established by AMS 14C dating of foraminifera, detail magnetic analyses were performed for core PC24 sediments at sampling intervals of 2 cm to discuss magnetic sensitivity of marine sediment to climate during Holocene for the northern South China Sea. The results indicated that: 1 Concentration dependent magnetic parameters are positive corresponding to variation of temperature. The frequency dependent susceptibility coefficient basically reflected the variation in humidity; 2 XARM/SIRM was more sensitive to detrital magnetite particles and SIRM/X was more effective to biogenic magnetite particles. Variations of XARM/SIRM and SIRM/X are corresponding to precipitation and temperature, respectively; 3 the Holocene Megathermal in the study area was identified as 7.5-3.4 cal. ka BP. The warmest stage of Holocene for the study area should be during 6.1 to 3.9 cal. ka BP; 4 The 8 ka cold event was characterized as cold and dry during 8.55 to 8.25 cal. ka BP; 5 During early and middle Holocene, the climate combinations were warm dry and cold wet. It turned to warm and wet after 2.7 cal. ka BP.
BP report of the business year 1979
Energy Technology Data Exchange (ETDEWEB)
1980-01-01
The paper presents a survey about the development of the energy- and petroleum market during the year 1979. A commentary of the German BP A.G. and its activities is given here: personnel- and management policy, exploration, supply, refining and distribution, investigation, and development. After a survey about the business situation of the German BP A.G. the detailed annual balance sheets of 1979 of the German BP and of the whole enterprise are given.
Impact of CALS on Electronic Publishing Systems and Users.
Beazley, William G.
1990-01-01
The U.S. Department of Defense has begun using its buying power to enforce standards on the vendors and contractors of automatic data processing hardware and software. An example of this, the Computer-Aided Acquisition and Logistic Support (CALS) program, is described, and how it will affect electronic publishing systems is discussed. (five…
Face recognition based on improved BP neural network
Directory of Open Access Journals (Sweden)
Yue Gaili
2017-01-01
Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.
Burnside, Rachel D; Pasion, Romela; Mikhail, Fady M; Carroll, Andrew J; Robin, Nathaniel H; Youngs, Erin L; Gadi, Inder K; Keitges, Elizabeth; Jaswaney, Vikram L; Papenhausen, Peter R; Potluri, Venkateswara R; Risheg, Hiba; Rush, Brooke; Smith, Janice L; Schwartz, Stuart; Tepperberg, James H; Butler, Merlin G
2011-10-01
The proximal long arm of chromosome 15 has segmental duplications located at breakpoints BP1-BP5 that mediate the generation of NAHR-related microdeletions and microduplications. The classical Prader-Willi/Angelman syndrome deletion is flanked by either of the proximal BP1 or BP2 breakpoints and the distal BP3 breakpoint. The larger Type I deletions are flanked by BP1 and BP3 in both Prader-Willi and Angelman syndrome subjects. Those with this deletion are reported to have a more severe phenotype than individuals with either Type II deletions (BP2-BP3) or uniparental disomy 15. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes that are not imprinted. Reports of mutations or disturbed expression of these genes appear to impact behavioral and neurological function in affected individuals. Recently, reports of deletions and duplications flanked by BP1 and BP2 suggest an association with speech and motor delays, behavioral problems, seizures, and autism. We present a large cohort of subjects with copy number alteration of BP1 to BP2 with common phenotypic features. These include autism, developmental delay, motor and language delays, and behavioral problems, which were present in both cytogenetic groups. Parental studies demonstrated phenotypically normal carriers in several instances, and mildly affected carriers in others, complicating phenotypic association and/or causality. Possible explanations for these results include reduced penetrance, altered gene dosage on a particular genetic background, or a susceptibility region as reported for other areas of the genome implicated in autism and behavior disturbances.
Profile of NF-κBp(65/NFκBp50) among prostate specific antigen sera levels in prostatic pathologies.
Bouraoui, Y; Ben Jemaa, A; Rodriguez, G; Ben Rais, N; Fraile, B; Paniagua, R; Sellemi, S; Royuela, M; Oueslati, R
2012-10-01
The aim of this work was to characterise the immunoexpression of NF-κB (p50/p65) in human prostatic pathologies and to study its profiles of activation among sera prostate specific antigen antigen (PSA) according the three groups: 0-4ng/mL, 4-20ng/mL and >20ng/mL. Twenty-four men with benign prostate hyperplasia (BPH); 19 men with prostate cancer (PC) and five men with normal prostates (NP). Immunohistochemical and western blot analysis was performed. Serum levels of PSA were assayed by immulite autoanalyser. In BPH and PC samples, immunoexpressions were observed for NF-κBp65 and NF-κBp50; while in NP samples, only were detected NF-κBp50. PC samples showed immunoreactions to NF-κBp65 and NF-κBp50 more intense (respectively 24.18±0.67 and 28.23±2.01) than that observed in BPH samples (respectively18.46±2.04 and 18.66±1.59) with special localisation in the nucleus. Different profiles of NF-κBp65 immunoexpressions were observed and BPH patients with sera PSA levels between 0-4ng/mL presented a significant weak percentage compared to BPH patients with sera PSA levels between 4-20ng/mL and >20ng/mL. No immunoreactions to NF-κBp65 were observed in PC patients with sera PSA levels between 4-20ng/mL. The sensibility of both NF-κB and PSA to inflammation allowed confirming the relationship between these two molecules and its involvement in prostatic diseases progression (inflammatory and neoplasic). Copyright © 2011 Elsevier Masson SAS. All rights reserved.
The upgrade of the laser calibration system for the ATLAS hadron calorimeter TileCal
Spalla, Margherita; The ATLAS collaboration
2014-01-01
The Tile Calorimeter (TileCal), the central section of the hadronic calorimeter of the ATLAS experiment, is a key detector component to detect hadrons, jets and taus and to measure the missing transverse energy. TileCal is built of steel and scintillating tiles coupled to optical fibers and read‐out by photomultipliers (PMT). The performance of TileCal relies on a continuous, high resolution calibration of the individual response of the 10,000 channels forming the detector. The calibration is based on a three level architecture: a charge injection system used to monitor the full electronics chain including front-end amplifiers, digitizers and event builder blocks for each individual channel; a distributed optical system using laser pulses to excite all PMTs; and a mobile Cesium radiative source which is driven through the detector cell floating inside a pipe system. This architecture allows for a cascade calibration of the electronics, of the PMT and electronics, and of full chain including the active detec...
Firmware Development for the ATLAS TileCal sROD
Moreno Marti, Pablo; The ATLAS collaboration; Valero, Alberto
2015-01-01
TileCal is the central hadronic calorimeter of the ATLAS experiment at the Large Hadron Collider (LHC) at CERN. A main upgrade of the LHC (also called Phase-II) is planned in order to increase the instantaneous luminosity in 2022. At the TileCal level, the upgrade involves the redesign of the complete read-out architecture, affecting both the front-end and the back-end electronics. In the new read-out architecture, the front-end electronics will transmit digitized information of the full detector to the back-end system every single bunch-crossing. Thus, the back-end system must provide digital calibrated information to the first level of trigger. Having all detector data per bunch crossing in the back-end will increase the precision and granularity of the trigger information, improving this way the trigger efficiencies. A reduced part of the detector, 1/256 of the total, will be equipped with the new electronics during 2015 to evaluate the proposed architecture in real conditions in the so-called “demonstra...
Firmware Development for the ATLAS TileCal sROD
Moreno Marti, Pablo; The ATLAS collaboration; Valero, Alberto
2015-01-01
TileCal is the central hadronic calorimeter of the ATLAS experiment at the Large Hadron Collider (LHC) at CERN. A main upgrade of the LHC (also called Phase-II) is planned in order to increase the instantaneous luminosity in 2022. For TileCal, the upgrade involves the redesign of the complete read-out architecture, affecting both the front-end and the back-end electronics. In the new read-out architecture, the front-end electronics will transmit digitized information of the full detector to the back-end system every single bunch-crossing. Thus, the back-end system must provide digital calibrated information to the first level of trigger. Having all detector data per bunch crossing in the back-end will increase the precision and granularity of the trigger information, improving this way the trigger efficiencies. A reduced part of the detector, 1/256 of the total, will be equipped with the new electronics during 2016 to evaluate the proposed architecture in real conditions in the so-called “demonstrator proje...