WorldWideScience

Sample records for caetite ba aspectos

  1. Anatomia dos órgãos vegetativos de Hymenaea martiana Hayne (Caesalpinioideae-Fabaceae): espécie de uso medicinal em Caetité-BA

    OpenAIRE

    Leite, K. R. B.; Silva, M. S.; Saba, M. D.

    2012-01-01

    p. 673-679 Hymenaea martiana Hayne (Fabaceae-Caesalpinioideae) apresenta grande valor na medicina popular em Caetité. A casca, entrecasca do caule e a resina, são utilizadas no tratamento de diversos males. Neste estudo são apresentadas a caracterização anatômica e histoquímica dos órgãos vegetativos. Amostras foram coletadas e processadas segundo técnicas usuais em anatomia vegetal e histoquímica. Todos os órgãos apresentam, em visão transversal, epiderme unisseriada e cavidades secretora...

  2. Anatomia dos órgãos vegetativos de Hymenaea martiana Hayne (Caesalpinioideae-Fabaceae): espécie de uso medicinal em Caetité-BA

    OpenAIRE

    Silva,M.S.; Leite,K.R.B.; Saba,M.D.

    2012-01-01

    Hymenaea martiana Hayne (Fabaceae-Caesalpinioideae) apresenta grande valor na medicina popular em Caetité. A casca, entrecasca do caule e a resina, são utilizadas no tratamento de diversos males. Neste estudo são apresentadas a caracterização anatômica e histoquímica dos órgãos vegetativos. Amostras foram coletadas e processadas segundo técnicas usuais em anatomia vegetal e histoquímica. Todos os órgãos apresentam, em visão transversal, epiderme unisseriada e cavidades secretoras. Cutícula es...

  3. Anatomia dos órgãos vegetativos de Hymenaea martiana Hayne (Caesalpinioideae-Fabaceae: espécie de uso medicinal em Caetité-BA Anatomy of vegetative organs of Hymenaea martiana Hayne (Fabaceae-Caesalpinioideae: a species of medicinal use in Caetité-Bahia State, Brazil

    Directory of Open Access Journals (Sweden)

    M.S. Silva

    2012-01-01

    Full Text Available Hymenaea martiana Hayne (Fabaceae-Caesalpinioideae apresenta grande valor na medicina popular em Caetité. A casca, entrecasca do caule e a resina, são utilizadas no tratamento de diversos males. Neste estudo são apresentadas a caracterização anatômica e histoquímica dos órgãos vegetativos. Amostras foram coletadas e processadas segundo técnicas usuais em anatomia vegetal e histoquímica. Todos os órgãos apresentam, em visão transversal, epiderme unisseriada e cavidades secretoras. Cutícula espessa ocorre em todos os órgãos aéreos. A raiz é tetrarca. Colênquima lacunar foi encontrado no caule. Bainha de fibras esclerenquimáticas envolve os feixes vasculares dos órgãos aéreos. Células pétreas ocorrem no pecíolo. Tricomas tectores ocorrem em ambas as faces da folha. A folha é hipoestomática com estômatos paracíticos e o mesofilo é dorsiventral. Cristais de oxalato de cálcio ocorrem no caule, pecíolo e lâmina foliar. Compostos fenólicos ocorrem na raiz, pecíolo e nervura central da folha. Grãos de amido ocorrem na raiz, caule e pecíolo. Lipídios ocorrem em todos os órgãos. Acredita-se que compostos fenólicos e cavidades secretoras de resina podem justificar a utilidade medicinal da espécie pela população de Caetité.Hymenaea martiana Hayne (Fabaceae-Caesalpinioideae shows a great value in folk medicine in Caetité. Its bark, stem-bark and resin are used to treat various ailments. In this study, the anatomical and histochemical characterization of vegetative organs is reported. Samples were collected and processed according to usual techniques of plant anatomy and histochemistry. All organs have, by cross-sectional view, uniseriate epidermis and secretory cavities. Thick cuticle occurs in all aerial organs. The root is tetrarch. Lacunar collenchyma was found in the stem. Sclerenchymatic sheath of fibers surrounds the vascular bundles of the aerial organs. Stone cells occur in the petiole. Trichomes occur

  4. Aerial gamma spectrometry of the uranium province of Lagoa Real (Caetite, BA, Brazil): go environmental aspects and distribution of the absorbed dose in the air; Espectrometria gama aerea da provincia uranifera de Lagoa Real (Caetite, BA): aspectos geoambientais e distribuicao da dose absorvida no ar

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Esau Francisco Sena

    2006-07-01

    In the present study, it was analyzed the surface concentrations of the natural radioelements K, U and Th, as well as the absorbed dose rate in air caused by gamma radiation from the Lagoa Real uranium province, which is located at the center southern portion of Bahia State and comprises an area of approximately 4.600 Km{sup 2}. Data from the airborne gamma ray spectrometric survey of the region (Sao Timoeo Project) carried out in 1979, was used in this study. Besides, recent data of U, Th and absorbed dose rates from the Environmental Monitoring Program of the uranium concentration plant (URA), operated in the region by the Brazilian Nuclear Industries (INB), were used with the aim of inter compare the sampling points in the same geo referenced area. Imaging geo processing software's give support to frame maps of surface concentrations and ternary maps, as well as allow the integration of these with other themes (e.g. hydrology, geology, pedology) favouring the interpretation of geo environmental process from the radioactive cartography. Considering the whole study area, it was obtained the following mean values: absorbed dose rate in air (61,08 nGy.h{sup -1}), Potassium (1,65 % K) , Uranium (3,02 ppm eU) and thorium (18,26 ppm eTh). The geological unities bounding the uranium anomalies were placed in the areas characterized by the highest values of radioelements and, as expected, the major dose levels. The use of ternary maps coupled with the geology and hydrology allowed distinguishing the relationship between the surface distribution of natural radioelements and the geo environmental aspects, including the influence of the catchment in their transport and migration. (author)

  5. Determination of the concentration of radionuclides in soil and water next the uranium mine of Caetite, Bahia, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, Geangela M.; Souza, Susana O. [Federal University of Sergipe (UFS), Sao Cristovao, SE (Brazil). Dept. of Physics; Campos, Simara S.S. [State University of Southwest Bahia (UESB), Itapetinga, BA (Brazil). Dept. of Basic and Instrumental Studies; Gennari, Roseli F., E-mail: rgennari@dfn.if.usp.b [University of Sao Paulo (USP), Sao Paulo, SP (Brazil). Inst. of Physics. Dept. of Nuclear Physics

    2011-07-01

    The economic growing in Brazil is responsible for an urgent demand for energy. Uranium is the fuel used to generate nuclear power. Brazil has the sixth largest reserve of the uranium ore in the world and, nowadays there is only one mine under exploration (Uraniferous District of Lagoa Real - Caetite-BA). Some Non-Governmental Organizations (NGOs), such as Greenpeace, state that the explored uranium mine is dangerous and polluting, causing water contamination by uranium. So, the population would be receiving radiation doses above permissible limits. However, Industrias Nucleares do Brasil (INB) the company in charge of the complex extraction and production of yellow cake rejected these accusations. The main purpose of this work is the determination of the composition of natural radionuclides in the Uraniferous District of Lagoa Real in order to determine if the nearest population is exposed to environmental radiation. It was checked if there is water contamination due to the natural transport in the uranium mining surroundings. Soil and water samples from Caetite mine and also from nearby town were collected. Only one water sample collected had concentrations higher than the limits recommended by World Health Organization. The presence of radionuclides in soil samples is considered independent of mineral exploration. The effective dose rates in almost all samples are above the world average which is 2.4 mSv/y. To sum up, the presence of uranium in water and soil of the tested areas is probably due to the nature of the soil and not to the exploration of mine. (author)

  6. Assessment of the total uranium concentration in surface and underground water samples from the Caetite region, Bahia, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Julia Grasiela Batista; Geraldo, Luiz Paulo [Centro Universitario da Fundacao Educacional de Barretos (UNIFEB), (SP) (Brazil); Yamazaki, Ione Makiko [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    At the region of Caetite, BA, it is located the largest uranium mine in exploration at present days in Brazil. During the uranium extraction process, it may be having an environmental contamination by this heavy metal due to rain water and other natural transport mechanism, with potential exposition risk to the local population. The aim of this work was to investigate the total uranium concentration in surface and underground water samples collected at the Caetite region, using the nuclear track registration technique (SSNTD) in a polycarbonate plastic. A 100 mL volume of water samples were initially treated in 10 mL of HNO{sub 3} (PA) and concentrated by evaporation at a temperature around 80 deg C. The resulting residue was diluted to a total volume of 25 mL without pass it to a filter. About 10 {mu}L of this solution was deposited on the plastic detector surface (around 1.0 cm{sup 2} area) together with 5 {mu}L of a Cyastat detergent solution (5%) and evaporated under an infrared lamp. All the resulting deposits of non volatile constituents were irradiated, together with a uranium standard sample, at the IPEN-IEA-R1 (3.5 MW) nuclear reactor for approximately 3 min. After irradiations, chemical etching of the plastic detectors was carried out at 60 deg C, for 65 min. in a NaOH (6N) solution. The fission tracks were counted scanning all the deposit area of the polycarbonate plastic detector with a system consisting of an optical microscope together with a video camera and TV monitor. The average values of uranium concentrations obtained in this work ranged from (0.95{+-}0.19) {mu}g.L{sup -1} to (25.60{+-}3.3) {mu}g.L{sup -1}. These results were compared to values reported in the literature for water samples from other regions and discussed in terms of safe limits recommended by WHO -World Health Organization and CONAMA - Conselho Nacional do Meio Ambiente. (author)

  7. Biodiversidade e aspectos ecológicos de Macroalgas Marinhas Epífitas da Angiosperma Marinha Halodule wrightii na Baía de Suape, Pernambuco

    OpenAIRE

    Cristina Lima Guimarães, Nathalia

    2008-01-01

    Estudos foram realizados na Baía de Suape - PE, situada 40 km ao sul da cidade do Recife (8º15 00 , 8º30 00 S e 34º55 00 e 35º05 00 W), com o objetivo de conhecer a biodiversidade e os aspectos ecológicos das macroalgas marinhas epífitas de Halodule wrightii. As amostras foram provenientes de seis coletas realizadas entre julho/setembro de 2006 e janeiro/março de 2007, durante as baixas-mares de sizígia. Foram delimitadas três estações, e em cada uma foi demarcado um transe...

  8. Aspectos da anatomia e do óleo essencial em folhas de Pindaíba (Xylopia brasiliensis Spreng. Aspects of the anatomy and essential oil in leaves of pindaíba (Xylopia brasiliensis Spreng.

    Directory of Open Access Journals (Sweden)

    Breno Régis Santos

    2004-04-01

    Full Text Available Neste trabalho, estudaram-se aspectos de anatomia foliar, extraiu-se e caracterizou-se o óleo essencial presente nos tecidos foliares de pindaíba (Xylopia brasiliensis. Os cortes transversais foram realizados à mão livre com o auxílio de uma lâmina de barbear e submetidos ao processo de coloração com safranina e azul de astra. A extração e a caracterização do óleo essencial foram realizadas pela técnica de arraste de vapor de água. Na seção transversal da folha da pindaíba foi observada a presença de cavidade oleífera, sendo o óleo constituído principalmente de óxido de cariofileno.Aspects of leaf anatomy, extraction and characterization of essential oils present in leaf tissues of Pindaíba (Xylopia brasiliensis, were studied. The anatomical cuts were manually performed and their visualization were made through a coloration process using safranine and astra blue. The extraction and characterization of the essential oil used the steam drag’s method. With these studies it was observed the presence of oily idioblasts filled mainly with cariophylene oxide.

  9. Critical analysis of the waste management performance of two uranium production units in Brazil--part II: Caetite production center.

    Science.gov (United States)

    Fernandes, Horst Monken; Gomiero, Luiz Alberto; Peres, Valeska; Franklin, Mariza Ramalho; Simões Filho, F Fernando Lamego

    2008-09-01

    This paper discusses the environmental waste management of the Heap-Leach Uranium Production Facility of Caetité located in a semi-arid region in Brazil. A comparison is made with the first uranium production site of the country located in Poços de Caldas. It is demonstrated that differences in the operational process along with different environmental conditions can lead to different impacts. In the present case groundwater is the potential most sensitive environmental medium despite the well-established consensus in the literature that radon and aerosol emissions may turn-out to be the most relevant environmental aspects of an installation located at this type of region. Most of the (226)Ra content in the ore remains in the leached ore that is deposited with the waste rock. A lack in appropriate prediction of the hydrological balance has been causing unanticipated emissions of liquid effluents into the environment. Chemical treatment of this effluent may be needed. Contamination of groundwater in the short term by the waste ponds is not to be expected but it can be a relevant issue in the long term. As a consequence, careful closure schemes will need to be put in place. Finally, the overall costs with remediation in the Caetité production center are lower than those observed at the Poços de Caldas mining site.

  10. Aspectos físico-químicos e microbiológicos de polpas de frutas comercializadas em Petrolina (PE e Juazeiro (BA

    Directory of Open Access Journals (Sweden)

    Erica Heloise Freitas Santos

    Full Text Available Resumo Objetivou-se com este trabalho avaliar as características físico-químicas e microbiológicas de polpas de frutas congeladas comercializadas em Petrolina (PE e Juazeiro (BA. Para tanto, foram analisados sete sabores de quatro marcas de polpas de frutas (A, B, C e D quanto ao número total de bolores e leveduras, coliformes totais e termotolerantes a 45 °C (fecais, pH, sólidos solúveis e cor. Os resultados obtidos para um mesmo sabor, das diferentes marcas, de quatro repetições, foram submetidos à análise de variância e comparação de médias pelo teste de Tukey, a 5% de significância. Os resultados de cada amostra foram comparados, individualmente, aos valores determinados pela legislação brasileira para cada sabor de polpa de fruta. Todas as marcas apresentaram características de sólidos solúveis e cor condizentes com a legislação, com pequenas variações entre marcas, a depender do sabor. A marca C apresentou amostras com valores elevados de bolores e leveduras em todos os sabores. Observou-se, ainda, valores de pH diferentes do estabelecido pela legislação nas polpas de manga e caju. Também foram detectados coliformes termotolerantes em polpas da marca C. Concluiu-se que 61,75% das polpas da marca C, 14,29% das polpas da marca A e 14,29% das polpas da marca D apresentaram-se impróprias para o consumo. Constatou-se também a necessidade de se estabelecerem, na legislação, padrões físico-químicos para polpas de abacaxi e tamarindo.

  11. Experimental study of the uranium mobility due to the weathering action at the uraniferous district of Caetite/Lagoa Real, Bahia, Brazil; Estudo experimental da mobilidade do uranio por acao intemperica, distrito uranifero de Caetite/Lagoa Real, Bahia, Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Scislewski, Alexandro Rocha

    2004-01-15

    In the present research, the proposal was to develop a preliminary study about the geochemical behavior of determined chemical elements, mainly the uranium, during the action of weathering processes in the rocks that bear the uranium mineralizations of the Caetite-Lagoa Real region, State of Bahia, more specifically of the Jazida Cachoeira uranium mine. To reach this purpose were used samples that represent several stages of the milling process of the uranium ore, so selecting representatives of the host rock, the ore and the treated ore (waste from the milling plant) to be used in the laboratory-controlled experiments. The samples were dried, sieved and finally introduced in the reactors, these adapted from the Flow-Through Reactor of Brantley and Chen. In the geochemical point of view, the results of the experiments showed a distinct behavior between the samples. It was observed that the treated ore, in relation to the host rocks of the ore and the own ore, shown a faster and homogeneous interaction with the leaching solution; it was also noted that in the output solution of the treated ore samples existed a significant complexation of the uranium by the sulfate (S0{sub 4}{sup -2}), ), instead of the non treated samples (host rock and ore) that were complexed mainly by the carbonate (C0{sub 3}{sup -2}). These different results are attributed to the alterations imposed to the rock during the milling process, and occur mainly, during the acid attack in the leaching process of the milling plant. The results and conclusions of this research, in spite of been preliminary, are essential to understand the behavior of the geochemical speciation of the effluent solutions; to understand the alterations of a rock matrix, and finally, to understand the migration chemical behavior of the related chemical elements. It is expected that these results contribute, in the future, to a deeper knowledge of the processes that control the chemical composition of the natural waters from

  12. Hydrological Processes Modifications Induced by Land-Use Changes in the Caetité Region, Northeastern Brazil

    Science.gov (United States)

    Fernandes, N. F.; Franklin, M. R.; Ferraz, A. C.; Reis, R. G.; Melo, V. P.

    2009-04-01

    Land-use changes can generate important modifications in hydrological processes, especially those that take place close to the soil surface. These changes usually lead to a decrease in infiltration rates and to an increase in surface runoff and soil erosion. Besides, in the long-term, they tend to reduce groundwater recharge. Such effect can be amplified when intensive groundwater pumping is carried out in order to support mining and milling activities. This is the case in the region close to Caetité, in the southwestern portion of Bahia state located in northeastern Brazil, where an already problematic situation in terms of water supply due to the semi-arid conditions is becoming worse due to the exhaustive pumping, mainly for supporting the uranium mining and concentration activities, leading to a variety of potential conflicts concerning the water management in the basin. Since 2008 an experimental basin was installed in the area in order to characterize, through field monitoring and modeling, the evolution of the hydrogeochemical processes in the basin. This study aims, besides the assessment of the water quality, to characterize the effects produced by land-use changes in the hydrological processes that take place at the soil surface, especially on the soil infiltration capacity and saturated hydraulic conductivity (ksat). The Caetité experimental basin has a total area of about 65 km2 that includes portions with natural vegetation (dense and sparse), agriculture (usually small farms), grazing, as well as those resulting from the mining and milling activities (open pit, waste rock piles , industrial plant, ponds and access dirty roads). Although the mining activities have been only recently installed in the area (year of 2000), farmers have been established in the basin for up to 40 years. Average total annual rainfall in the basin is about 710 mm, with a long dry period (from April to October). The geological frame of the area comprises an Archaean gneiss

  13. The quality of life of older people from the influence of religiosity and spirituality: care for the institutionalized elderly in Caetité (BA

    Directory of Open Access Journals (Sweden)

    Rosemeire Moreira de Oliveira

    2015-02-01

    Full Text Available This article illustrates how elderly caretakers from a Long-Term Care Institution (LTCI perform the care of the body, mind and spirit, and how it affects the life quality of the elderly. Emphasizes the importance of a better preparation for the caretakers to deal and supply the needs of these elderly, in order to provide cares involving the body, mind and the spirit. Uses observational research, with a cross-sectional, descriptive and quantitative qualitative approach.  

  14. Aspectos Morfológicos e Morfométricos do Colo Uterino de Ratas Ooforectomizadas após Aplicação de Óleo de Copaíba Morphological and Morphometric Aspects of the Uterine Cervix in Oophorectomized Rats after Copaíba Oil Application

    Directory of Open Access Journals (Sweden)

    Nara Macedo Botelho Brito

    2000-09-01

    Full Text Available Objetivos: verificar o efeito do óleo de copaíba no colo uterino de ratas ooforectomizadas. Métodos: foram utilizadas 120 ratas adultas distribuídas em 4 grupos: as que receberam aplicação de óleo de copaíba, óleo de milho, água e um grupo sem tratamento. Todos os animais foram submetidos a ooforectomia bilateral e posteriormente mantidos em gaiolas por um período de 20 dias antes de iniciar a aplicação das substâncias. Estas foram administradas via vaginal na dose de 0,3 ml, diariamente, uma vez ao dia até os dias determinados para o sacrifício (7º, 14º e 21º, sendo sacrificados de cada grupo 5 animais por dia. Resultados: todos os animais do grupo copaíba apresentaram epitélio exuberante, estratificado pavimentoso queratinizado, em torno de 10 fileiras de células epiteliais, e lâmina própria com tecido conjuntivo denso, rico em fibroblastos, fibras colágenas, inúmeros vasos sanguíneos e alguns leucócitos. Conclusões: o óleo de copaíba utilizado neste modelo experimental promoveu espessamento do epitélio do colo uterino, que se apresentava pavimentoso estratificado com queratinização, além do espessamento progressivo deste epitélio no decorrer dos dias de estudo.Purpose: to study the effect of copaíba oil on the uterine cervix of oophorectomized rats. Method: 120 female adults were used, divided into four groups: control, water, corn oil and copaíba oil. All animals were submitted to bilateral oophorectomy, and kept in cages for twenty days before applying the substances. These substances were applied by vaginal route at a dose of 0.3 ml, once a day until the predetermined day of sacrifice (7, 14 e 21 days. Results: the animals from the copaíba oil group showed on all days of the study exuberant, keratinous stratified squamous epithelium with about 10 epithelial cell layers and the chorion with conjunctive tissue, fibroblasts, collagen fibers, blood vessels and some leukocytes. Conclusions: The copaíba

  15. Hydrological Monitoring and Environmental Modeling to Assess the Quality and Sustainability of the Water Resources in an Uranium Mine Area, Caetité - Brazil

    Science.gov (United States)

    Franklin, M. R.; van Slobbe, E.; Fernandes, N. F.; Palma, J.; van Dalen, D.; Santos, A. C.; Melo, V.; Reis, R. G.; Carmo, R.; Fernandes, H. M.

    2009-12-01

    Uranium mining and processing constitute the front-end of the nuclear fuel-cycle and respond for most of its radiological impacts. For many years it has been accepted that the key driving force associated with these radiological impacts was related with radon exhalation from mill tailings. However, evidences coming from other mining sites showed that impacts in superficial and ground waters could also play a significant role. In Brazil, the newest uranium production unit presents a unique opportunity to integrate all the above concepts in a logical framework that will lead to sound and environmental balanced operations. The production center (Caetité plant) consists of open pit mine and sulfuric acid Heap Leach operations and is located at a semi-arid region in northeastern Brazil. Because groundwater is the sole perennial source of water for human consumption and industrial use, this resource has to be managed wisely and efficiently. Therefore, this paper intends to summarize the components of an ongoing project of groundwater management in uranium mining areas. The results will guide the adequate management of groundwater use and provide the basis for the appropriate impact assessment of the potential releases of pollutants. The methodology starts with the mathematical simulation of the long-term behavior of the hydrogeological system based on an experimental basin approach. The occurrence and pattern of groundwater flow in the Caetité experimental basin (CEB) are mainly conditioned by the degree of faulting/fracturing of rocks (predominantly gneisses and granites). Two faulting systems are observed in the area, the principal one, parallel to the foliation (with NW direction) and the secondary one with NE direction. The main water reservoirs in the CEB are related to the intrusion of a diabase dike, which increased the density of fractures in the rocks. This dike serves as natural barrier to the water flow and constrains the potential contamination of

  16. Aspectos produtivos do capim-elefante (Pennisetum purpureum, Schum. cv. Roxo no brejo paraibano Productive aspects of elephant grass (Pennisetum purpureum, Schum. var. Roxo in Paraíba swamp region

    Directory of Open Access Journals (Sweden)

    Estácio Alves dos Santos

    2001-02-01

    Full Text Available O trabalho foi realizado com o objetivo de verificar o efeito de diferentes alturas de corte sobre a produtividade do capim-elefante cv. Roxo em épocas de seca e chuva no Brejo paraibano. O esquema experimental foi um fatorial 4 x 2, sendo quatro alturas de corte (0, 15, 30 e 45 cm, duas épocas (períodos seco e chuvoso e quatro blocos. Foram avaliadas as produções por hectare de massa verde (MV, matéria seca total (MS, de folhas (MSF e colmos (MSC e proteína bruta (PB. Após o corte de uniformização, efetuaram-se dois cortes no período seco em intervalos de 90 dias e três no período chuvoso em intervalos de 60 dias. Não houve interação entre altura de corte e a época. Entretanto, à medida que se elevou a altura do corte, reduziram-se as produções de MV, MS e MSC. As produções de PB e MSF não diferiram. Quando elevadas as alturas dos cortes de 0 para 45 cm, houve redução de aproximadamente 33% na produção para MV, 24,83% para MSF e 60% para MSC. Os cortes no período seco foram mais produtivos em relação aos da época chuvosa. As médias das produções de MS, MV, MSF, MSC e PB foram, respectivamente, 4,12; 21,19; 2,65; 1,47 e 0,32 t/ha no período seco e 12,44; 2,45; 1,81; 0,54 e 0,17 t/ha no período chuvoso.This work was carried to evaluate the effect of different cutting heights on the productivity of elephant grass var. Roxo in dry and rainy season in the Paraíba swamp region. A randomized complete block design in a 4 X 2 factorial, arrangement, with four cutting heights (0, 15, 30 and 45 cm, two periods (dry and rainy seasons and 4 blocks were used. It was evaluated the production/ha of fresh matter (FM, dry matter (DM, leaves (DML, stems (DMS and crude protein (CP. After the uniformity cut, two cuts in dry season with 90 days interval and three cuts in the rainy season with 60 days interval were made. There was no interaction between seasons and cutting heights. However, as cutting height increased, the values

  17. Aspectos clínicos, epidemiológicos e patológicos da infecção natural em bovinos por Trypanosoma vivax na Paraíba Clinical, epidemiological and pathological signs of natural infection in cattle by Trypanosoma vivax in Paraíba, Brazil

    Directory of Open Access Journals (Sweden)

    Jael S. Batista

    2008-01-01

    Full Text Available Descrevem-se dois surtos de tripanossomíase por Trypanosoma vivax em bovinos, ocorridos em dois estabelecimentos do alto sertão da Paraíba. Os sinais clínicos, a patologia e a epidemiologia da doença foram estudados no período de maio de 2005 a novembro de 2006.T. vivax foi identificado em esfregaços da capa leucocitária e mediante a reação em cadeia da polimerase (PCR. Os animais afetados apresentaram anorexia, depressão, febre, anemia, perda de peso, redução da produção leiteira, cegueira transitória, aborto e sinais nervosos caracterizados por incoordenação motora, salivação, opistótono, nistagno, tetania e bruxismo. Todos os animais que apresentaram sintomatologia nervosa morreram. As alterações macroscópicas observadas em um bovino submetido à necropsia foram aumento de volume dos linfonodos, atrofia serosa dos depósitos de gordura, aumento de volume do baço com evidência da polpa branca, hidropericárdio, além de petéquias e equimoses no epicárdio. Histologicamente havia meningoencefalite. O controle da doença na propriedade com tratamento específico dos casos clínicos com aceturato de diminazene foi eficiente, pois após o tratamento não se verificou mais a presença do parasita em esfregaços sanguíneos nem evidência clínica da enfermidade em até 2 meses após o início do surto. Os fatores epidemiológicos favoráveis à ocorrência dos surtos foram a abundância de vetores mecânicos, como tabanídeos e Stomozys spp., e a entrada, no rebanho, de animais oriundos de propriedades onde ocorreu a doença em questão. Sugere-se que o semi-árido do Nordeste, devido a períodos prolongados de secas e altas temperaturas, é região de instabilidade enzoótica para a tripanossomíase, em conseqüência, provavelmente, ao ambiente desfavorável para o desenvolvimento de vetores durante a maior parte do ano.Two outbreaks of trypanosomiasis by Trypanosoma vivax, reported in cattle, occurred on two farms

  18. Aspectos quirales del grafeno

    OpenAIRE

    H Torres-Silva; López-Bonilla,J.L

    2011-01-01

    El grafeno, una alotropía del carbono, es un logro de los avances de la nanotecnología. Siendo una nanoestructura, este componente estructural del grafito posee propiedades que lo han convertido en un potencial sustituto del silicio en el diseño y fabricación de circuitos integrados. Este artículo resume sus orígenes, posibilidades teóricas, así como sus propiedades prácticas. Se presentan aspectos teóricos de quiralidad en el grafeno, específicamente una teoría quiral para el grafeno, vincul...

  19. Aspectos morfológicos, morfométricos e ultraestruturais do baço de ratos após o clampeamento total do pedículo hepático Morphologic, morphometric, and ultrastructural aspects of the spleen of rats after hepatic pedicle total clamping

    Directory of Open Access Journals (Sweden)

    S.H. Freitas

    2009-12-01

    Full Text Available Avaliaram-se as alterações morfológicas, morfométricas e ultraestruturais que ocorreram no baço devido à isquemia produzida pelo clampeamento total do pedículo hepático. Para tanto, foram utilizados 40 ratos machos, distribuídos em quatro grupos de 10 animais. O grupo-controle (C não foi submetido à isquemia, e os grupos tratados (E1, E2e E3 foram submetidos ao clampeamento por 10, 20 e 30 minutos, respectivamente. Fragmentos do baço foram retirados e analisados histologicamente pela microscopia de luz (hematoxilina-eosina, ferrocianeto-férrico e pela microscopia eletrônica de transmissão. Os resultados demonstraram que 10 minutos de clampeamento do pedículo hepático são suficientes para apresentar sinais de congestão esplênica e 20 e 30 minutos promovem intensa digestão de hemácias pelos macrófagos, com presença de grânulos de ferro (hemossiderina no parênquima esplênico.The macro and microscopic alterations that occurred in the spleen during an ischemia produced by the hepatic pedicle total clamping were studied. Forty male rats were distributed in four groups of 10 animals each. The control group (C was not submitted to ischemia and the treated groups (E1, E2, and E3 were submitted to the clamping during 10, 20, and 30 minutes, respectively. Spleen fragments were collected and histologically analyzed by the light microscopy (eosin-hematoxilin and ferric ferrocyanide and by the transmission electron microscopy. The results showed that 10 minutes of hepatic pedicle total clamping was enough produce signs of splenic congestion and 20 and 30 minutes promoted intense red bood cels digestion by the macrophages with the presence of iron granules (hemosiderin in the splenic parenchyma.

  20. Aspectos morfológicos e hemodinâmicos do baço em indivíduos normais: estudo por ultra-som Doppler Morphological and hemodynamic features of the spleen in normal subjects: a Doppler ultrasound study

    Directory of Open Access Journals (Sweden)

    Denise Said Jannini

    2003-08-01

    Full Text Available ANTECEDENTES: A diversidade de técnicas de mensuração esplênica pelo ultra-som Doppler (US Doppler, a falta de valores biométricos e dopplervelocimétricos dificultam a avaliação deste órgão e de suas características hemodinâmicas. OBJETIVO: Estabelecer padrões biométricos e hemodinâmicos por US-Doppler em indivíduos adultos sadios. MATERIAIS E MÉTODOS: Estudo prospectivo de 44 indivíduos sadios, sendo 19 do sexo masculino e 25 do sexo feminino, na faixa etária de 23 a 60 anos (37,4 ± 9,6. Morfometria (US modo-B: baço: eixos longitudinal (L, transversal (T e ântero-posterior (AP; diâmetro da artéria esplênica (DAE e diâmetro da veia esplênica (DVE. Índices morfométricos do baço: uniplanar (IBU, biplanar (IBB e volume esplênico (VE. Dopplervelocimetria (US Doppler: a artéria esplênica: velocidade de pico sistólico (VPS, média das velocidades máximas de fluxo (TAMax; índices de impedância vascular: índice de resistividade (IR; índice de pulsatilidade (IP; b veia esplênica: média das velocidades máximas de fluxo (TAMax. RESULTADOS: Morfometria: L = 9,3 ± 1,3 cm; T= 3,9 ± 0,7 cm; AP = 8,4 ± 1,2 cm; DAE = 0,3 ± 0,07 cm; DVE: 0,5 ± 0,12 cm. Índices morfométricos do baço: IBU = 33,5 ± 9,9; IBB = 36,7 ± 10,3; VE = 164,3 ± 62,9 cm³. Dopplervelocimetria: a artéria esplênica: VPS = 59,8 ± 23,6 cm/s; TAMax = 40,2 ± 15,9 cm/s; IP = 0,86 ± 0,30; IR = 0,55 ± 0,09; b veia esplênica: TAMax = 16,8 ± 8,3 cm/s. CONCLUSÃO: Relato de valores biométricos e dopplervelocimétricos do baço em indivíduos sadios.BACKGROUND: The diversity of existing techniques for the measurement of the spleen using Doppler ultrasound (Doppler-US as well as the lack of biometrical and Doppler velocimetry reference values make the evaluation of this organ and its hemodynamics quite difficult. OBJECTIVES: To establish biometrical and hemodynamics Doppler-US standard values for healthy adult individuals. MATERIALS AND METHODS

  1. Máquina de Aspectos: un enfoque alternativo para la implementación de aspectos.

    OpenAIRE

    Gesto, Esteban; Hallar, Karim; Casas, Sandra

    2006-01-01

    La Programación Orientada a Aspectos (POA) es un nuevo paradigma de programación que propone mecanismos para soportar la separación de los aspectos no funcionales de los sistemas software. Una herramienta POA consiste en tres componentes principales: un lenguaje de programación base, un lenguaje de programación orientado a aspectos y un tejedor de aspectos (weaver). El presente trabajo propone un enfoque alternativo para la implementación de aspectos basado en la especificación de los mism...

  2. aspectos epistemológicos

    Directory of Open Access Journals (Sweden)

    José Antonio Acevedo-Díaz

    2007-01-01

    Full Text Available La inclusión de la naturaleza de la ciencia en el currículo de ciencias requiere, como requisito previo, el establecimiento de acuerdos sobre sus principales rasgos y los correspondientes contenidos que podrían trasladarse al aula para su tratamiento explícito en la educación científica. En este artículo se muestran los consensos conseguidos en una investigación empírica sobre cuestiones de NdC correspondientes a la epistemología de la ciencia y a las definiciones de ciencia y tecnología y las relaciones entre ambas. Se ha seguido para ello una metodología basada en la valoración de las cuestiones incluidas en el Cuestionario de Opiniones sobre Ciencia, Tecnología y Sociedad (COCTS por parte de un panel de 16 jueces expertos. Los acuerdos alcanzados se extienden tanto a los aspectos de NdC que se consideran adecuados como a los inadecuados, los cuales son mucho más numerosos.

  3. Aspectos evolutivos de las personas con discapacidad, 2007-08

    OpenAIRE

    Santiago Vicente Martín, Santiago

    2007-01-01

    I. Materiales de clase: Tema 1: INTRODUCCIÓN AL CONCEPTO DE NECESIDADES EDUCATIVAS ESPECIALES; Tema 2: ASPECTOS EVOLUTIVOS DE LAS PERSONAS CON DISCAPACIDAD VISUAL; Tema 3: ASPECTOS EVOLUTIVOS DE LAS PERSONAS CON RETRASO MENTAL; Tema 4: ASPECTOS EVOLUTIVOS DE LAS PERSONAS CON DISCAPACIDAD MOTORA; Tema 5: ASPECTOS EVOLUTIVOS DE LAS PERSONAS CON AUTISMO; Tema 6: ALUMNOS CON ALTAS CAPACIDADES. II. Bibliografía Aspectos evolutivos de las personas con discapacidad: Los objetivos de la asignatura...

  4. Alleen BA vaak niet voldoende

    NARCIS (Netherlands)

    Maas, F.M.; Poldervaart, G.

    2007-01-01

    Voor de vruchtdunning bij appel is in 2007 MaxCel toegelaten. Dit middel, met de werkzame stof benzyladenine (BA), is in de plaats van carbaryl gekomen. Proeven met BA op Elstar, in 2001 en 2003 uitgevoerd door PPO-fruit, bieden nu waardevolle informatie over de (on)mogelijkheden van benzyladenine

  5. Aspectos que interfieren en la movilidad estudiantil

    Directory of Open Access Journals (Sweden)

    María Mercedes Ramírez-Ordoñez

    2014-12-01

    Full Text Available Objetivo: Identificar los aspectos que interfieren en la realización de movilidad estudiantil. Materiales y Métodos: Esta investigación es cuantitativa de tipo descriptivo transversal por conveniencia, constituida por 243 estudiantes que hacen parte de un programa de enfermería en una institución de educación superior X, de los cuales se entrevistaron a 237. Para la recolección de la información se diseñó un cuestionario donde se evalúa el aspecto económico, académico y familiar y su interferencia con el programa de movilidad de la institución. Para su estructuración se realizó revisión bibliográfica, evaluación de expertos, alfa de cronbach y prueba piloto. Resultados: El aspecto económico ocupa el primer lugar en interferir en la movilidad estudiantil con un 73%, es importante resaltar que la población encuestada pertenece al estrato 2 por lo tanto cuentan con pocos recursos. El segundo lugar fue para el aspecto académico con un 63.45% y en menor dimensión el aspecto familiar con 26%; el 77% manifiesta tener un interés por participar del programa de movilidad, de los cuales el 43.78% prefiere el nivel internacional, el 29,79 % nacional y ambas opciones el 25,95%. Conclusiones: Al relacionar los aspectos económicos, académicos y familiares con el total de la población se encontró que solo el 12% de los estudiantes cumplen la totalidad de estos requisitos y pueden participar de la movilidad estudiantil.

  6. The BaBar Mini

    Energy Technology Data Exchange (ETDEWEB)

    Brown, David N.

    2003-07-11

    BaBar has recently deployed a new event data format referred to as the Mini. The mini uses efficient packing and aggressive noise suppression to represent the average reconstructed BaBar event in under 7 KBytes. The Mini packs detector information into simple transient data objects, which are then aggregated into roughly 10 composite persistent objects per event. The Mini currently uses Objectivity persistence, and it is being ported to use Root persistence. The Mini contains enough information to support detailed detector studies, while remaining small and fast enough to be used directly in physics analysis. Mini output is customizable, allowing users to both truncate unnecessary content or add content, depending on their needs. The Mini has now replaced three older formats as the primary output of BaBar event reconstruction. A reduced form of the Mini will soon replace the physics analysis format as well, giving BaBar a single, flexible event data format covering all its needs.

  7. A = Ba, Sr or Pb

    Indian Academy of Sciences (India)

    Unknown

    tion in the transmission mode. The samples were rotated ... The profiles were fitted using a pseudo-Voigt function. The Chebyshev ... Crystal data for ABi4Ti4O15 (A = Ba, Sr or Pb) at. 298 K. Formula. BaBi4Ti4O15. SrBi4Ti4O15. PbBi4Ti4O15. Formula weight. 1404⋅85. 1355⋅13. 1474⋅70. Colour. Yellow. Yellow. Yellow.

  8. Aspectos biopsicosociales asociados al embarazo adolescente

    Directory of Open Access Journals (Sweden)

    Regina Cogollo Jiménez

    2012-12-01

    Full Text Available Introducción: El embarazo en la adolescencia, es un evento inesperado, sorpresivo. Este artículo establece la importancia de identificar los aspectos biopsicosociales asociados al embarazo adolescente en las embarazadas asistentes al programa de Control Prenatal de una Empresa Social del Estado de nivel 1 en Montería en 2009, para comprender las actitudes y los comportamientos asociados a esta etapa tan temprana. Materiales y Métodos: Es un estudio descriptivo, cuantitativo, de corte transversal. Población y muestra: 30 adolescentes embarazadas asistentes al Programa, el muestreo por conveniencia. Se utilizó la encuesta y la observación directa, previa autorización del Director de la empresa. Resultados: Caracterización de la población: predominó la edad de 15 a 19 años (adolescencia tardía, uniones libres, baja escolaridad debido a la deserción escolar, ingreso económico menor al salario mínimo legal vigente. Aspectos Biológicos: la menarquía a temprana edad (9 a 14 años, y en ella la mitad de los embarazos. La mayoría de los segundos embarazos terminaron en parto, la minoría en cesárea y aborto. La captación para los controles prenatales fue tardía, algunas no cumplieron con las citas programadas. Aspectos Psicológicos: inestabilidad con la pareja al enterarse del embarazo, tuvieron soporte familiar moral y económico, abandonaron sus estudios y presentaron malestares como estrés, depresión y tristeza. Aspectos Sociales: predominó la convivencia con la familia extensa. Hubo aceptación en el colegio y en los amigos. Discusión y Conclusiones: Se plantean estrategias para disminuir estos aspectos: elaboración de una cartilla sobre “Cuidado de la adolescente embarazada”, creación de espacios de reflexión, jornadas lúdicas educativas, entre otros. (Rev Cuid 2012; 3(3:385-93.Palabras clave: Embarazo en Adolescencia, Bienestar Materno, Atención Prenatal. (Fuente: De

  9. AHP 45: REVIEW: PHYUR BA

    Directory of Open Access Journals (Sweden)

    'Brug mo skyid འབྲུག་མོ་སྐྱིད། (Zhoumaoji 周毛吉

    2017-03-01

    Full Text Available Mkha' mo rgyal was born in Dgon gong ma Village, 'Ba' (Tongde County, Mtsho lho (Hainan Tibetan Autonomous Prefecture, Mtsho sngon (Qinghai Province. While attending the Tibetan Studies College of Mtsho sngon Nationalities University she began writing. In addition to editing and translating teaching materials for primary and secondary schools, she has also published short stories and poetry (Mkha' mo rgyal, 2015. Phyur ba is the first Tibetan women's novel (Robin 2016:86 and was recognized as an Outstanding Work by the Qinghai Writers Guild in 2014 (Duojiecairang and Limaoyou 2014. 1 The name, which translates as 'dried cheese' is a food eaten daily by many Tibetans. Made from fermented milk without cream, it is dried in the sun by women in pastoral areas. Both sweet and sour, phyur ba brings to mind the happiness and sadness, ups and downs, laughter and tears that life brings. ...

  10. Aspectos biopsicosociales asociados al embarazo adolescente

    OpenAIRE

    Regina Cogollo Jiménez

    2012-01-01

    Introducción: El embarazo en la adolescencia, es un evento inesperado, sorpresivo. Este artículo establece la importancia de identificar los aspectos biopsicosociales asociados al embarazo adolescente en las embarazadas asistentes al programa de Control Prenatal de una Empresa Social del Estado de nivel 1 en Montería en 2009, para comprender las actitudes y los comportamientos asociados a esta etapa tan temprana. Materiales y Métodos: Es un estudio descriptivo, cuantitativo, de corte transver...

  11. Aspectos laborales del contrato a tiempo parcial

    OpenAIRE

    Garcia Perrote Escartin, Ignacio; Nieto Rojas, Patricia

    2010-01-01

    Las sucesivas reformas en materia de empleo a tiempo parcial han tratado de incrementar el espacio convencional para la regulación de aspectos nucleares de esta modalidad contractual con el objetivo de adecuar la regulación legal a las necesidades empresariales. Sin embargo, los resultados son bastante tenues: el escaso uso de este contrato (la tasa de empleo a tiempo parcial se sitúa en torno al 12%) y la nula atención prestada por los agentes sociales a este tipo de contrato han dific...

  12. Aspectos éticos de la obesidad

    OpenAIRE

    de Santiago Martín, Sandra

    2016-01-01

    El sobrepeso y la obesidad se están convirtiendo en uno de los problemas de salud de mayor preocupación, convirtiéndose en los últimos años en una verdadera pandemia mundial. Los objetivos de esta revisión bibliográfica son analizar los aspectos éticos de la obesidad, desde el punto de vista de la familia y la sociedad, las buenas prácticas sanitarias, los principios bioéticos y de los derechos del paciente obeso. Para realizar este trabajo de investigación se accedieron a las bases de ...

  13. Contenedores: Aspectos tecnicos, biologicos y economicos

    Science.gov (United States)

    Tara Luna; Thomas D. Landis; R. Kasten. Dumroese

    2012-01-01

    La elección del contenedor es una de las consideraciones más importantes al establecer un nuevo vivero o empezar a producir una especie nueva. El tipo y tamaño de contenedor no sólo determina la cantidad de agua y nutrientes minerales que están disponibles para el crecimiento de una planta, sino que también afecta otros aspectos operativos del vivero, como el tamaño de...

  14. Aspectos psicossociais de adolescentes com epilepsia

    OpenAIRE

    Nathália Ferreira Siqueira

    2014-01-01

    Resumo: A epilepsia na adolescência pode acarretar perdas em diferentes áreas: física, saúde, emprego, relações sociais e familiares. Essa pesquisa buscou avaliar aspectos psicossociais de adolescentes com de epilepsia: autoestima, qualidade de vida, depressão, ansiedade e estigma. Foram avaliados 101 adolescentes, de ambos os sexos, na faixa etária de 10 a 19 anos, de ensino fundamental e médio. Cinquenta pacientesdo ambulatório de Neurologia/HC da Unicamp com diagnóstico de epilepsia compus...

  15. High spin properties of Ba

    Indian Academy of Sciences (India)

    Abstract. The 124Ba nucleus is investigated on the basis of the method of statistical mechanics by assuming the nucleons to move in triaxially deformed Nilsson potential. The variation in the Fermi energies of protons and neutrons is studied as a function of spin and temperature. The Fermi energies determined as a function ...

  16. TRANSITIVITY AND THE BA CONSTRUCTION

    Directory of Open Access Journals (Sweden)

    Pei-Jung Kuo

    2010-06-01

    Full Text Available In this paper, I discuss the legitimacy of positing a Transitivity Projection (= TrP cf. Bowers 1993, 1997, 2001 and 2002 in the BA construction in Mandarin Chinese. BA has been proposed to be a semantically-bleached verb, inserted in the v position (Huang 1997 and Lin 2001. Several pieces of evidence such as manner adverbial placement (cf. Huang, Li and Li 2009 and GEI-insertion (cf. Tang 2001 indicate that there must be a functional projection between the vP and VP to host the BA NP. I propose that a TrP is probably the most apt candidate for the XP. I also argue, in contrast to the proposal by Huang, Li and Li (2009, that the present proposal which employs a TrP captures most of the properties of the BA construction. A comparison with the structure of the BEI construction also shows that the TrP proposal fits into the general picture of current linguistic theory on transitive constructions without extra stipulations.

  17. Ba isotopic signature for early differentiation between Cs and Ba in natural fission reactors

    Science.gov (United States)

    Hidaka, Hiroshi; Gauthier-Lafaye, François

    2008-08-01

    Ba isotopic studies of the Oklo and Bangombé natural fission reactors in east Gabon provide information on the geochemical behavior of radioactive Cs ( 135Cs and 137Cs) in a geological medium. Large isotopic deviations derived from fissiogenic Ba were found in chemical leachates of the reactor uraninites. The fissiogenic Ba isotopic patterns calculated by subtracting the non-fissiogenic component are classified into three types that show different magnifications of chemical fractionation between Cs and Ba. In addition, the isotopic signatures of fissiogenic 135Ba, 137Ba and 138Ba suggest an early differentiation between Cs and Ba of less than 20 years after the production of fissiogenic Cs and Ba. On the other hand, only small excesses of 135Ba ( ɛ reactors by differentiation.

  18. Aspectos indicativos de envelhecimento facial precoce em respiradores orais adultos

    National Research Council Canada - National Science Library

    Oliveira, Aline Cabral de; Anjos, César Antônio Lira dos; Silva, Érika Henriques de Araújo Alves da; Menezes, Pedro de Lemos

    2007-01-01

    TEMA: envelhecimento facial precoce em respiradores orais adultos. OBJETIVO: verificar a presença de aspectos indicativos de envelhecimento facial precoce e caracterizar morfometricamente as medidas...

  19. Aspectos y normas de accesibilidad web

    Directory of Open Access Journals (Sweden)

    Jairo Armando Riaño Herrera

    2014-12-01

    Full Text Available Este artículo revisa la diferencia y relación que existe entre los términos de accesibilidad y usabilidad en contextos de software y páginas web. Además con base en la definición de accesibilidad web hace una revisión de las normas y estándares que existen y que son mantenidas por el consorcio internacional W3C con su iniciativa “Web Accessibility Inititive”, con el objetivo de garantizar la accesibilidad a los sitios web por cualquier persona usuario independiente de su estado de discapacidad. Finalmente se enumeran aspectos a tener en cuenta al momento de publicar contenidos en la web y algunas herramientas de validación en línea que permiten validar el cumplimiento de normas de accesibilidad de los sitios web.

  20. LABORATORIO DE HORMONAS: ASPECTOS PRÁCTICOS

    Directory of Open Access Journals (Sweden)

    René E. Díaz T., DR.

    2015-11-01

    Full Text Available Las técnicas de laboratorio de análisis hormonales han experimentado grandes progresos en las últimas décadas, actualmente se pueden realizar determinaciones hormonales con gran precisión y automatización, sin embargo, existen muchos elementos que es necesario tener en consideración al momento de interpretar un examen hormonal. El elegir el examen adecuado para la condición que estamos estudiando, el conocer sus limitaciones y potenciales falsos positivos y negativos es parte del conocimiento que es fundamental tener como clínicos. En este artículo se pretende entregar una breve revisión de las principales determinaciones hormonales, orientado a aspectos que puedan ser de utilidad al médico no especialista en su práctica clínica.

  1. Aspectos da pesquisa sobre tipologia textual

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Travaglia

    2014-03-01

    Full Text Available Este artigo chama a atenção dos pesquisadores sobre tipologiatextual, na área da Linguística Textual, sobre aspectos que sãoimportantes para que estas pesquisas gerem conclusões egeneralizações mais confiáveis. Os pontos comentados são: a anecessidade de uma teoria tipológica geral de textos que inclusivedetermine se as categorias de texto são todas da mesma natureza. Oautor propõe uma teoria geral; b a necessidade de estudos maishorizontalizados ou amplos que estabeleçam campos de pesquisa ede estudos mais verticalizados, que aprofundam o conhecimentode pontos específicos; c os aspectos metodológicos para superarproblemas no levantamento das categorias de texto existentes emuma sociedade e cultura, em suas diversas comunidades discursivase esferas de ação social; d a questão dos parâmetros e critérios paraconsiderar uma categoria de texto como sendo uma categoria e seela é de determinada natureza; e a questão dos critérios e parâmetrospara a caracterização das categorias de texto; f a necessidade deestudar as diversas relações de diferentes tipos que podem ocorrerentre as categorias de texto (de diferentes naturezas, tanto em suacomposição quanto em seu funcionamento sociodiscursivo; e g aatenção que merece a questão teminológica.

  2. Aspectos neurológicos da Pelagra

    Directory of Open Access Journals (Sweden)

    Aluízio Marques

    1944-12-01

    Full Text Available São estudadas as várias questões gerais da Pelagra, nomeadamente os aspectos clínicos e etiopatogênicos. As formas clássicas se traduzem por manifestações intensificadas na época de maior insolação e evidenciadas por desordens da pele, do aparelho digestivo e sistema nervoso. Lembra o autor que, não obstante se deva ter em primeira conta esses aspectos do mal, na prática não se podem descuidar os oligossintomáticos, frustos e larvados. Com referência a tais formas, acredita ser de grande importância salientar os exemplares em que se não encontram sintomas cutâneos e configuram a "Pelagra sine Pelagra". A seguir, procura mostrar a freqüência dos aspectos neurológicos e psiquiátricos da condição e afirma que, se não se descrevem mais amiúde, é porque os médicos que se ocupam da Pelagra, descuidam de esmiuçar a existência de sinais e sintomas nervosos e mentais muito sutis que com freqüência passam despercebidos. Também recorda que os aspectos neurológicos da Pelagra não se encontram mais vezes, porque, via de regra, só se diagnostica a doença quando as lesões cutâneas são evidentes; de hábito deixam-se de lado os exemplares de "Pelagra Sine Pelagra", os de tradução clínica destituída de eritema ou outros fenômenos dermatológicos. Baseado na sua experiência, diz que as manifestações nervosas e mentais da Pelagra são em muito maior número do que é de supor-se. Para documentar essa afirmação, recorda a observação que tem feito em mais de uma oportunidade e os casos publicados pelos autores brasileiros; nem só os registados especialmente do ponto de vista neurológico mas, também, aqueles em que se não deu particular apreço a esse aspecto e em que a simples leitura das observações evidencia fenômenos neuro-psiquiátricos muito caraterísticos. Os quatro exemplares relatados no trabalho, foram colhidos do Serviço de Clínica Neurológica do Hospital Getúlio Vargas. Dois deles

  3. Aspectos da secagem convectiva de papel artesanal

    Directory of Open Access Journals (Sweden)

    Oswaldo Curty da Motta Lima

    2001-05-01

    Full Text Available Neste trabalho, são estudados alguns aspectos da secagem de papel reciclado obtido de forma artesanal, tendo como objetivo principal a análise da cinética de secagem para diferentes condições operacionais em regime de convecção natural ou forçada. Deste modo, pretendeu-se verificar a possibilidade de redução do tempo de secagem das folhas produzidas artesanalmente, pela utilização de ar aquecido em convecção forçada, como alternativa para a secagem convencional com ar ambiente, sem que com isso houvesse perda na qualidade final do papel produzido. Dentro deste contexto, foram levantadas as curvas de secagem para diferentes condições operacionais, de modo a se verificar a influência de variáveis importantes, tais como: temperatura e velocidade do ar de secagem e espessura das amostras de papel artesanal, no comportamento do processo. Também foi analisada a possibilidade de utilização de correlações disponíveis na literatura, na simulação do comportamento das curvas de secagem obtidas

  4. ASPECTOS INTRODUCTORIOS AL DERECHO DEL CONSUMO

    Directory of Open Access Journals (Sweden)

    Juan Carlos Villalba Cuellar

    2009-01-01

    Full Text Available La protección al consumidor ha penetrado el derecho de tal forma que hoy en día se puede hablar en la mayoría de los ordenamientos jurídicos del derecho del consumo como una disciplina jurídica autónoma. En Colombia sin embargo esta tendencia no ha logrado permear las instituciones jurídicas de una manera clara y aún se conserva una legislación poco idónea para resolver las vicisitudes que la complejidad de los mercados impone a este grupo de personas denominadas los consumidores. Este artículo tiene por finalidad demostrar que el derecho del consumo es una perspectiva del derecho que tiene una fisonomía propia e involucra los aspectos más debatidos del derecho privado y del derecho de la empresa en la actualidad. Para tal fin se abordará primero la evolución de la protección a los consumidores en el derecho comparado, para en un segundo lugar caracterizarlo y finalmente delimitar el derecho del consumo de tal forma que se sepa cuál es su contexto y real alcance.

  5. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Letícia M.K. Forster

    1994-04-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  6. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Forster Letícia M.K.

    1994-01-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  7. Aspectos Bioéticos de los Cuidados Paliativos

    OpenAIRE

    Rodríguez Artavia, Allan

    2012-01-01

    El presente ensayo busca dar a conocer los principales aspectos bioéticos relacionados con los cuidados paliativos. Con este fin,primeramente se hace un recorrido por la significancia de los conceptos, para luego analizar algunos aspectos relacionados con con la ética delos cuidados paliativos tales como el tratamiento apropiado, la nutrición e hidratación, y la posición frente a la eutanasia. Posteriormente discute algunos aspectos relacionados con la muerte digna y con el morir como acto hu...

  8. Thermodynamic study of BaCuO2 and BaCu2O2

    Science.gov (United States)

    Shimpo, Ryokichi; Nakamura, Yasushi

    1994-06-01

    The Gibbs energy changes for the syntheses of the interceramic compounds of BaCuO2 and BaCu2O2 were investigated as a basic study in the Y-Ba-Cu-O system that includes a superconductor, YBa2Cu3O6.5+ x . For the compound BaCuO2, thermogravimetry with CO2-O2-N2 gas mixtures was employed, and equilibrium temperatures were determined at which CO2 partial pressures in the gas mixtures were equilibrated with mixed powder of BaCuO2, CuO, and BaCO3. The Gibbs energy change for the reaction of BaCO3 + CuO = BaCuO2 + CO2 was determined from the relation between CO2 partial pressure and equilibrium temperature, taking into consideration the effect of CO2 dissolution in BaCuO2. For the study on BaCu2O2, electromotive force (emf) measurement using yttria-stabilized zirconia solid electrolyte was conducted. A technique using two cells was applied to the emf measurement for minimizing the effect of dispersion of oxygen from samples, and the Gibbs energy change for the reaction of BaCuO2 + CuO = BaCu2O2 + 1/2O2 was decided from the measured O2 partial pressure.

  9. BaBar Data Aquisition

    CERN Document Server

    Scott, I; Grosso, P; Hamilton, R T; Huffer, M E; O'Grady, C; Russell, J J

    1998-01-01

    The BaBar experiment at the Stanford Linear Accelerator Center is designed to perform a search for CP violation by analysing the decays of a very large sample of B and Bbar mesons produced at the high luminosity PEP-11 accelerator. The data acquisition system must cope with a sustained high event rate, while supporting real time feature extraction and data compression with minimal dead time. The BaBar data acquisition system is based around a common VME interface to the electronics read-out of the separate detector subsystems. Data from the front end electronics is read into commercial VME processors via a custom "personality card" and PCI interface. The commercial CPUs run the Tornado operating system to provide a platform for detector subsystem code to perform the necessary data processing. The data are read out via a non-blocking network switch to a farm of commercial UNIX processors. Careful design of the core data acquisition code has enabled us to sustain events rates in excess of 20 kHz while maintaini...

  10. ASPECTOS FINANCIEROS DE LA REFORMA LOCAL

    Directory of Open Access Journals (Sweden)

    Amable Corcuera Torres

    2015-01-01

    Full Text Available En este trabajo se analizan los aspectos jurídico-financieros más relevantes que incluye la Ley 27/2013, de 27 de diciembre, de racionalización y sostenibilidad de la Administración Local. Las nuevas medidas incluidas en la citada Ley afectan tanto a los ingresos de los entes locales como a sus gastos. Al respecto, se abordan cuestiones relativas a los efectos económicos de la fusión de municipios, la supresión general de licencias, el contenido de los planes económico-financieros, el cálculo del coste efectivo de los servicios, el redimensionamiento del sector público local, la novedosa atribución a la Junta de Gobierno Local de la competencia para aprobar ciertos actos financieros, la disolución de entidades de ámbito territorial inferior al Municipio que no presenten sus cuentas antes de 31 de diciembre de 2014 o la posibilidad de reducir la deuda comercial o financiera a través de la venta de patrimonio público del suelo. In this work the most important legal and financial aspects including the Law 27/2013, of 27 December, rationalization and sustainability of local government are analyzed. The new measures included in that Act affect both the income of local authorities and their expenses. In this regard, issues concerning the economic effects of the merger of municipalities, the general abolition of licenses, the content of financial plans, the calculation of the actual cost of services, the local public sector downsizing, the novel addresses allocation to the Local Government of the power to grant certain financial actions, the dissolution of entities below the Municipality territory who do not submit their accounts before December 31, 2014 or the possibility of reducing the commercial or financial debt through the sale of public land heritage.

  11. Aspectos nutricionales del búfalo

    Directory of Open Access Journals (Sweden)

    André Mendes Jorge

    2011-11-01

    necesario para mantener al animal en un estado saludable donde puedan expresar su potencial reproductivo de acuerdo con el nivel de producción deseado en condiciones específicas de ambientales y de alimentación (Paul & Lal, 2010. El presente texto fue escrito con la intención de abordar algunos aspectos nutricionales del búfalo, exponiendo lo más actual sobre el tema y de esa forma aclarar las posibles dudas sobre las normas de alimentación para esta especie.

  12. Aspectos indicativos de envelhecimento facial precoce em respiradores orais adultos

    OpenAIRE

    de Oliveira, Aline Cabral; Anjos,César Antônio Lira dos; Silva, Érika Henriques de Araújo Alves da; Menezes,Pedro de Lemos

    2007-01-01

    TEMA: envelhecimento facial precoce em respiradores orais adultos. OBJETIVO: verificar a presença de aspectos indicativos de envelhecimento facial precoce e caracterizar morfometricamente as medidas da projeção do sulco nasogeniano ao tragus e da largura facial (distância entre os bucinadores) em respiradores orais e nasais adultos. MÉTODO: foi realizada, em 60 indivíduos, observação de aspectos indicativos de envelhecimento facial precoce (presença de olheiras, rugas embaixo dos olhos, rugas...

  13. Aspectos del dengue investigados en Santander

    Directory of Open Access Journals (Sweden)

    Ruth Martínez

    2004-03-01

    Full Text Available

    Entre 1998 y 2003 se registraron en Colombia 256,831 casos de dengue (22,834 de dengue hemorrágico DH de los cuales 41,325 (36% fueron en Santander (3,265 DH (1,2. En este período ocurrieron brotes en 1998 y 2001 observándose incremento de casos severos en el segundo (2. Por otro lado, existen inconvenientes con el diagnóstico que dificultan el manejo clínico oportuno y la vigilancia epidemiológica. Como consecuencia, los siguientes aspectos han sido investigados:

    1 Contribución de la circulación de los serotipos/genotipos al incremento del dengue hemorrágico, considerando que la entrada o emergencia de éstos se han asociado con epidemias (3. Entre 1998 y 2004 se hicieron 1,180 intentos de aislamiento viral en células C6/36 (4, detectándose los 4 serotipos. El DEN-2 se aisló todos los años con mayor frecuencia durante los brotes (43% y 40% de los cepas; el DEN-1 se detectó entre 1998 y 2001, siendo el prevalente en el primer brote (57%, pero el menos en el segundo (4%; el DEN-3 se detectó en el brote del 2001 con similar frecuencia al DEN-2 (36%, por primera vez en Colombia luego de 23 años ausente, y fue el prevalerte entre 2002-2004 (92% de los aislados, aunque en estos años no se reportó incremento del DH (2; el DEN-4 se aisló solo en el 2000 (27% y en el brote del 2001 (20%. El genotipo de cada serotipo se identificó por análisis de RSS-PCR (5,6. Se encontraron el subtipo A (ó III, C (ó I y B (ó II de los serotipos 2, 1 y 4, similares a los que están circulando en países de América y oriundos del Asia. Los DEN-3 fueron del subtipo C (ó III iguales al virus que entró en América en 1994 oriundo de Sri-Lanka, India. Los genotipos del 2 y 3 encontrados en Santander producen con mayor frecuencia DH (3,7.

    Aspectos clave de las negociaciones en la China empresarial actual

    OpenAIRE

    Rodríguez Seva, Carmen María

    2013-01-01

    En este trabajo hemos realizado un recorrido por todos aquellos aspectos relevantes para entender cómo se llevan a cabo las negociaciones en la China empresarial actual. En aquest treball hem realitzat un recorregut per tots aquells aspectes rellevants per entendre com es duen a terme les negociacions a la Xina empresarial actual. Master thesis for the East Asia program.

  14. ASPECTOS ERGONÔMICOS E POSTURAIS EM CENTRO DE MATERIAL

    Directory of Open Access Journals (Sweden)

    Neusa Maria Cosía Alexandre

    Full Text Available Determinados fatores ambientais inadequados podem provocar lesões na coluna vertebral. Este trabalho discute certos aspectos ergonômicos e posturais específicos em Centro de Material com o objetivo de desenvolver uma consciência crítica a respeito dos efeitos do local de trabalho sobre a saúde.

  15. Aspectos funcionales de la psicoterapia analítico funcional.

    OpenAIRE

    Javier Virués Ortega; Alberto Descalzo Quero; José Fernando Venceslá Martínez

    2003-01-01

    Se considera una nueva psicoterapia de orientación conductual: la Psicoterapia Analítico Funcional. Se describen brevemente sus fundamentos teóricos, metodológicos y aplicados. Se discuten sus aspectos funcionales desde un punto de vista contextual.

  16. Presentación del Libro, “Epilepsia. Aspectos Clínicos y Psicosociales”.

    Directory of Open Access Journals (Sweden)

    Carlos Medina Malo

    2006-12-01

    aspectos biológicos. Es excelente porque muestra el equipo que reunió el Dr. Medina, a los integrantes de la Liga contra la Epilepsia, que se ve reflejada en ese aspecto biopsicosocial de la persona con epilepsia.

  17. 134Ba diffusion in polycrystalline BaMO3 (M = Ti, Zr, Ce)

    Science.gov (United States)

    Sažinas, Rokas; Sakaguchi, Isao; Einarsrud, Mari-Ann; Grande, Tor

    2017-11-01

    Cation diffusion in functional oxide materials is of fundamental interest, particularly in relation to interdiffusion of cations in thin film heterostructures and chemical stability of materials in high temperature electrochemical devices. Here we report on 134Ba tracer diffusion in polycrystalline BaMO3 (M = Ti, Zr, Ce) materials. The dense BaMO3 ceramics were prepared by solid state sintering, and thin films of 134BaO were deposited on the polished pellets by drop casting of an aqueous solution containing the Ba-tracer. The samples were subjected to thermal annealing and the resulting isotope distribution profiles were recorded by secondary ion mass spectrometry. The depth profiles exhibited two distinct regions reflecting lattice and grain boundary diffusion. The grain boundary diffusion was found to be 4-5 orders of magnitude faster than the lattice diffusion for all three materials. The temperature dependence of the lattice and grain boundary diffusion coefficients followed an Arrhenius type behaviour, and the activation energy and pre-exponential factor demonstrated a clear correlation with the size of the primitive unit cell of the three perovskites. Diffusion of Ba via Ba-vacancies was proposed as the most likely diffusion mechanism.

  18. Aspectos sociotécnicos das TI & Relacionamento Humano & Sinergia

    Directory of Open Access Journals (Sweden)

    Sergio Vieira Holtz Filho

    2008-06-01

    Full Text Available As Tecnologias de Informação (TI estão entre os principais agentes de mudança sociais. Para gerir tais mudanças, uma miríade de áreas do conhecimento humano têm muito a contribuir para a abordagem dos aspectos sociotécnicos das TI e promover sinergia. Como uma organização empresarial atua no sentido de provocar mudanças no comportamento das pessoas, visando a melhoria contínua, esse processo de mudança provocada chama-se aprendizagem. Isto posto, neste artigo apresentaremos resultados observados em empresas em processo de reengenharia e submetidas a utilização de metodologias integradas (PDCA, Método Paulo Freire e Roteiro Integração de Equipes, abordando os aspectos sociotécnicos das TI & relacionamentos humanos pela praxe da pedagogia como elemento de sinergia.

  19. Aspectos de regulación sanitaria en Brasil

    Directory of Open Access Journals (Sweden)

    Jose Carlos Buzanello

    2016-06-01

    Full Text Available Mira a algunos aspectos de la regulación de los servicios de saneamiento en Brasil, específicamente la política de regulación resultante del proceso de reforma del Estado de 1995. Cuestiona los resultados de la productividad de los servicios de agua y alcantarillado de los concesionarios y el alcance de estas medidas al consumismo usuario.

  1. Aspectos jurídicos de la lectura digital

    Directory of Open Access Journals (Sweden)

    Ramón Fernández, Francisca

    2017-01-01

    Full Text Available En el presente trabajo se analizan algunos aspectos jurídicos referentes a la lectura digital, desde la perspectiva de los sujetos que intervienen. Se prestará atención a la legislación aplicable en materia de propiedad intelectual y legislación asimilada para determinar cuáles son los principales problemas no resueltos y poder aportar una solución al caso concreto.

  2. Aspectos claves para elaborar un estudio de clima laboral

    OpenAIRE

    Mena Gómez, Luis Alberto

    2014-01-01

    El siguiente trabajo contiene los resultados de un estudio de medición de clima laboral, aplicando cinco dimensiones: Formación, Comunicación Interna, Situación Profesional y Perspectivas de Desarrollo e Imagen corporativa, realizado en una empresa de distribución alimentaria. Los distintos aspectos valorados en la elaboración de una encuesta se han aplicado en la investigación realizada.

  3. Aspectos fundamentales del método de Edith Stein

    Directory of Open Access Journals (Sweden)

    Mariano Crespo

    2010-01-01

    Full Text Available este trabajo aborda tres aspectos fundamentales del método filosófico de Edith Stein. En primer lugar, se alude a las cosas mismas como el punto de partida del filosofar de esta autora. En segundo lugar, se considera el aspecto que constituye uno de los aportes fundamentales del método fenomenológico y que es claramente reconocible en nuestra autora, a saber, el haber puesto de manifiesto la imposibilidad de hacer filosofía primera sin tomar en cuenta la vida consciente ante la que todas las cosas se abren. En tercer lugar, se remite a la individualidad de la persona como un aspecto de la antropología de Stein especialmente relevante. Al final del análisis de cada uno de estos tres aspectos metodológicos se intenta mostrar en qué sentido éstos pueden ser de relevancia para emprender el camino hacia la pregunta por la mujer.This paper addresses three fundamental aspects of Edith Stein's philosophical method. Firstly, it looks at issues such as the author's starting point of philosophizing. Secondly, it considers the aspect, which constitutes one of the fundamental contributions of the phenomenological method and is clearly recognizable in our author, such as having highlighted that it is impossible to carry out first philosophy without taking into account conscious life, before which all things are opened. Thirdly it looks at the individuality of the person as an especially relevant aspect of Stein's anthropology After analyzing each of these methodological aspects, this paper attempts to show how they may be relevant in laying out the path towards the question of the woman.

  4. High spin properties of 124 Ba

    Indian Academy of Sciences (India)

    The 124Ba nucleus is investigated on the basis of the method of statistical mechanics by assuming the nucleons to move in triaxially deformed Nilsson potential. The variation in the Fermi energies of protons and neutrons is studied as a function of spin and temperature. The Fermi energies determined as a function of ...

  5. Magnetic comparison of BaCa and BaSr substituted hexaferrite powders

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez-Angeles, A [Alvaro Gonzalez-Angeles, Facultad de IngenierIa, Universidad Autonoma de Baja California, (UABC), Blvd. Benito Juarez s/n, Cp 21280 Mexicali, B. C. (Mexico); Lipka, J; Gruskova, A; Slama, J; Jancarik, V; Slugen, V, E-mail: gangelesa@yahoo.com.m [Faculty of Electrical Engineering and Information Technology, (FEEIT), Slovak University of Technology, (SUT), Ilkovicova 3, 812 19 Bratislava (Slovakia)

    2010-03-01

    Results on magnetic studies of Ba{sub 0.5}Sr{sub 0.5}Fe{sub 12-2x}(ZnTi){sub x}O{sub 19} and Ba{sub 0.75}Ca{sub 0.25}Fe{sub 12-2x}(ZnTi){sub x}O{sub 19}, where x = 0.2 to 0.6, ferromagnetic powders prepared by mechanical alloying are discussed. The structural and magnetic properties of the resulting powders were analyzed by thermo-magnetic analysis, X-ray diffraction, scanning electron microscopy, Moessbauer spectroscopy and magnetic measurements. Curie temperature, T{sub c} decreased dramatically (drop {approx} 39%) for BaCa samples, whilst for BaSr samples remained almost without change (diminution {approx} 2%) at x {<=} 0.2. SEM studies showed that all the particles present nearly hexagonal platelet shape.

  6. Spectroscopy of Ba and Ba$^+$ deposits in solid xenon for barium tagging in nEXO

    CERN Document Server

    Mong, B; Walton, T; Chambers, C; Craycraft, A; Benitez-Medina, C; Hall, K; Fairbank, W; Albert, J B; Auty, D J; Barbeau, P S; Basque, V; Beck, D; Breidenbach, M; Brunner, T; Cao, G F; Cleveland, B; Coon, M; Daniels, T; Daugherty, S J; DeVoe, R; Didberidze, T; Dilling, J; Dolinski, M J; Dunford, M; Fabris, L; Farine, J; Feldmeier, W; Fierlinger, P; Fudenberg, D; Giroux, G; Gornea, R; Graham, K; Gratta, G; Heffner, M; Hughes, M; Jiang, X S; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; Koffas, T; Kravitz, S; Krucken, R; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Moore, D; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Retiere, F; Rowson, P C; Rozo, M P; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Twelker, K; Vuilleumier, J -L; Walton, J; Weber, M; Wen, L J; Wichoski, U; Yang, L; Yen, Y -R; Zhao, Y B

    2014-01-01

    Progress on a method of barium tagging for the nEXO double beta decay experiment is reported. Absorption and emission spectra for deposits of barium atoms and ions in solid xenon matrices are presented. Excitation spectra for prominent emission lines, temperature dependence and bleaching of the fluorescence reveal the existence of different matrix sites. A regular series of sharp lines observed in Ba$^+$ deposits is identified with some type of barium hydride molecule. Lower limits for the fluorescence quantum efficiency of the principal Ba emission transition are reported. Under current conditions, an image of $\\le10^4$ Ba atoms can be obtained. Prospects for imaging single Ba atoms in solid xenon are discussed.

  7. Thermodynamic study of BaCuO[sub 2] and BaCu[sub 2]O[sub 2

    Energy Technology Data Exchange (ETDEWEB)

    Shimpo, Ryokichi; Nakamura, Yasushi (Univ. of Tokyo (Japan). Faculty of Engineering)

    1994-06-01

    The Gibbs energy changes for the syntheses of the interceramic compounds of BaCuO[sub 2] and BaCu[sub 2]O[sub 2] were investigated as a basic study in the Y-Ba-Cu-O system that includes a superconductor, YBa[sub 2]Cu[sub 3]O[sub 6.5+x]. For the compound BaCuO[sub 2], thermogravimetry with CO[sub 2[minus

  8. Viabilidade do baço de ratos após a ligadura simultânea da artéria e veia esplênicas

    Directory of Open Access Journals (Sweden)

    Danilo Nagib Salomão Paulo

    Full Text Available OBJETIVO: A ligadura simultânea da artéria e veia esplênicas, com preservação do baço, é realizada em seres humanos, na pancreatectomia caudal, mas o efeito exato dessa ligadura sobre o baço não é bem conhecido. O objetivo deste trabalho foi verificar o efeito da ligadura dos vasos esplênicos principais no baço de ratos. MÉTODO: Foram operados 58 ratos Wistar, machos, variando entre 230 e 408 g de peso. Os animais foram divididos aleatoriamente em dois grupos: grupo 1, simulação (N=23, submetido à laparotomia e manipulação do baço; grupo 2 (N=35 submetido à ligadura simultânea da artéria e veia esplênica. Todos os animais foram mortos 12 dias após a operação. O baço era retirado, pesado, fixado em formol a 4%, incluído em parafina, e os cortes foram corados pela hematoxilina e eosina para exame microscópico. RESULTADOS: O baço era normal em todos os animais do grupo 1 e em três dos 34 animais ( 8,82% do grupo 2. Ocorreu infarto branco parcial do baço em 91,18% dos animais do grupo 2. O percentual médio de massa esplênica viável nos baços com infartos foi de 56,9 + 21,8 %. O aspecto histopatológico mostrou arquitetura preservada na porção não infartada, e neoformação conjuntivo-vascular cicatricial substituindo as áreas necrosadas. CONCLUSÕES: A ligadura simultânea da artéria e veias esplênicas resultou em infarto branco parcial do baço em 91,2% dos animais, com preservação mínima de 35% e média de 56,9% de massa esplênica viável. Na maioria dos animais que sofreram ligadura, o infarto se localizou na porção inferior do baço.

  9. Mapeamento de aspectos afetivos em um ambiente virtual de aprendizagem

    OpenAIRE

    Magalí Teresinha Longhi

    2011-01-01

    Esta tese apresenta mecanismos computacionais concebidos para reconhecer e inferir estados de ânimo de alunos em interação num ambiente virtual de aprendizagem (AVA). A pesquisa, tendo por base investigações interdisciplinar – Educação, Psicologia Cognitiva e Computação Afetiva (CA) –, apresenta, a título de problema central, o de como alcançar tais objetivos. A Psicogenética Construtivista, base teórica que fundamenta o exame dos aspectos afetivos envolvidos nos processos de aprendizagem, re...

  10. Aspectos ideológicos de los discursos sobre drogas.

    OpenAIRE

    Campos Aparicio, Carmen

    2014-01-01

    Existen otras maneras de explicar los consumos de drogas, diferentes a la ideología hegemónica representada por -y en- los discursos oficiales sobre drogas. Revisaremos algunos aspectos ideológicos en torno a las drogas así como otros postulados teóricos menos convencionales acerca del uso de drogas: Por una parte, encontramos autores que narran la historia de los consumos de drogas (ilícitas) como una cuestión de clase social. Por otro lado, encontramos el enfoque marxista, pa...

  11. Responsabilidad de directores de sociedades en Estados Unidos. Aspectos procesales

    Directory of Open Access Journals (Sweden)

    Héctor José Miguens

    2015-01-01

    El objeto de este artículo es describir este régimen en su totalidad y realizar un juicio crítico de las normas que rigen las acciones procesales de la responsabilidad de los directores de sociedades comerciales en el derecho societario en Estados Unidos. La metodología utilizada en este trabajo responde a la sistemática de los autores norteamericanos citados, que se caracteriza por centrarse en los aspectos prácticos, la solución de problemas particulares y el comentario crítico de la jurisprudencia aplicable a la cuestión.

  12. La Entomofagia en México. Algunos aspectos culturales

    OpenAIRE

    Felipe Carlos Viesca González

    2009-01-01

    En este trabajo se abordan aspectos culturales del consumo de insectos con fines alimenticios en México y el mundo; particularmente se analiza la entomofagia en la época prehispánica y nuestros días, así como las causas por las cuales ha disminuido el consumo de estos artrópodos. Se explica porqué se ha creado una aversión hacia los insectos en diversos países y algunas regiones de México. Se reflexiona acerca del valor nutritivo de los insectos y las distintas culturas que han hecho posible ...

  13. ¿Qué aspecto debe tener una iglesia?

    Directory of Open Access Journals (Sweden)

    Neutra, Richard J.

    1960-02-01

    Full Text Available Si nos referimos a edificios destinados a la celebración del culto religioso, ¿podemos hablar de la existencia de un denominador común?... Creo que sí; más aún, espero que la cuestión planteada desde este punto de vista presente una respuesta fácil y susceptible de utilización práctica. Pero hoy quiero hablar únicamente del aspecto y de las impresiones visuales que una iglesia debe ofrecer.

  14. ASPECTOS DE LA VIDA Y SOCIEDAD NOVOHISPANA DEL SIGLO XVIII

    OpenAIRE

    Francisco Javier Quirós Vicente

    2013-01-01

    En este artículo se habla acerca de diversos aspectos de la vida y sociedad en la Nueva España. Se tratan concretamente dos temas que sirven de reflejo de esta la sociedad colonial de principios del siglo XVIII; en primer lugar el de la relación las colonias españolas de ultramar con la corona española, en la época de la Guerra de la Sucesión, y en segundo el de la esclavitud que se desarrolla en este mismo periodo, con el negocio conocido como Paso Medio, con africanos mayormente provenient...

  15. Las empresas castellano-leonesas: aspectos financieros de las manufactureras

    OpenAIRE

    Fernández Martín, Virginia

    2016-01-01

    Este trabajo se va a centrar en el estudio del sector manufacturero (industrial) de Castilla y León, en concreto, en sus aspectos económico-financieros. Dicho sector manufacturero abarca los códigos del 10 al 33, ambos incluidos, de la Clasificación Nacional de Actividades Económicas (CNAE 2009). Con este estudio, se pretende determinar si existen diferencias significativas o no entre la financiación de las empresas manufactureras y las no manufactureras de Castilla y León para el periodo ...

  16. Cultura, lenguaje y cognición: algunos aspectos

    OpenAIRE

    Martínez de Oliveira, Daniel

    2012-01-01

    El artículo trata de algunos aspectos generales sobre cultura y cognición, con especial interés en la cuestión del lenguaje, partiendo de estudios de antropología social y cultural, psicología, lingüística, neurociencia y paleoantropología. Se discute rápidamente el tema de la evolución, relacionándola al desarrollo cognitivo humano, y algunas implicaciones políticas sobre lenguaje, cultura y cognición en el mundo moderno. The article deals with some general aspects of culture ...

  17. Aspectos creativos de la obra de Gustave Doré

    Directory of Open Access Journals (Sweden)

    Juan Rodrigo Lobato Castaño

    2012-04-01

    Full Text Available Este artículo se va a centrar en los aspectos creativos y heurísticos (arte de crear de la obra ilustrada de Paul Gustave Doré. Para ello, vamos a buscar los elementos que definen la esencia de la creatividad y aplicarlos a la obra de este artista francés del siglo XIX, quien a pesar de poseer una de las obras que mayor difusión tiene en la historia de la humanidad, se presenta como un desconocido para la sociedad.

  18. ASPECTOS PSICOLÓGICOS NA CURA RELIGIOSA PENTECOSTAL

    OpenAIRE

    Moreira, Manoel Messias da Silva

    2006-01-01

    Esta pesquisa aborda, em caráter principal os aspectos psicológicos na cura religiosa pentecostal. Não discute se existe ou não cura religiosa, porém centra-se em investigar os elementos psicológicos presentes, ou que contribuam para a efetivação da cura religiosa pentecostal. Pretende entender de alguma forma o aparato psíquico e seus elementos que a partir da simbologia religiosa e psicológica se constituem participantes desta demanda, através da visão junguiana. Questiona at...

  19. ALGUNOS ASPECTOS A CONSIDERAR SOBRE LA SEXUALIDAD DEL ADULTO MAYOR

    OpenAIRE

    Zoila Edith Hernández Zamora*

    2008-01-01

    La presente investigación expone, a partir de una serie de entrevistas realizadas a una muestra de adultos mayores, aspectos relativos a la satisfacción general en la vida, así como las actitudes, conocimientos y prácticas de la sexualidad de un grupo de adultos mayores que asisten regularmente a una estancia diurna de la ciudad de Xalapa, Veracruz, México, misma que fue diseñada especialmente para este grupo etario. Se encontraron diferencias estadísticamente significativas entre la actitud...

  20. Varizes ganglionares: fisiopatologia e aspectos ecográficos

    OpenAIRE

    Rosado, E; Cabral, P; Pinto, E.; Penha, D; Paixão, P.; Germano, A

    2012-01-01

    INTRODUÇÃO: As veias gânglionares presentes no triângulo femoral constituem uma rede venosa subcutânea que liga vários pontos do sistema venoso superficial e profundo. A dilatação desta rede venosa pode ser causa de insuficiência do sistema venoso superficial ou, mais frequentemente, estar envolvida no processo de recorrência varicosa pós-safenectomia. OBJECTIVOS: Descrever os aspectos anatómicos e fisiológicos da rede venosa ganglionar do triângulo femoral, alertando para uma causa pouco...

  1. Principales aspectos del consumo colaborativo en España

    OpenAIRE

    Cadierno Ferrero, Rubén

    2016-01-01

    Mi trabajo se centra en el estudio de la economía colaborativa, analizando aspectos de la misma como son sus principales características, plataformas, sistemas, regulación, etc. Una vez efectuado dicho análisis, en la segunda parte del trabajo se analiza una de las mayores empresas de economía colaborativa existentes actualmente: Uber. Se trata de una empresa tecnológica perteneciente al ámbito del transporte, la cual está generando mucha controversia debido a su modo de operar. Departa...

  2. Aspectos neuropsicológicos de la música

    OpenAIRE

    Pérez López, Guillermo Rubén

    2014-01-01

    Traballo Fin de Grao en Psicoloxía. Curso 2013-2014 [ES] Desde hace aproximadamente dos décadas el estudio de los aspectos neuropsicológicos relacionados con la música ha venido cobrando gran importancia en el ámbito de la Neurociencia. La música constituye un estímulo multimodal que transmite información visual, auditiva y motora a nuestro cerebro, que a su vez, como el lenguaje, cuenta con una red neural específica para su procesamiento. De este modo, la percepción y producci...

  3. Aspectos financieros de las cesiones de carteras de siniestros

    Directory of Open Access Journals (Sweden)

    Rivas López, María Victoria

    2003-01-01

    Full Text Available Se analizan los aspectos financieros y económicos de las compañías de seguros a través de las cesiones de carteras de siniestros. Esta técnica da cobertura a ciertos riesgos financieros, permitiendo la optimización de riesgo soportado por la cedente, con el fin de diluir los efectos adversos del comportamiento de la variable aleatoria de la siniestralidad, para la mejora de la solvencia, el incremento de la capacidad de suscripción y salvaguardar el balance.

  4. Hadron Physics in BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Lafferty, G.D.; /Manchester U.

    2005-08-29

    Some recent results in hadron physics from the BaBar experiment are discussed. In particular, the observation of two new charmed states, the D*{sub sJ}{sup +}(2317) and the D*{sub sJ}{sup +}(2457), is described, and results are presented on the first measurement of the rare decay mode of the B meson, B{sup 0} {pi}{sup 0}{pi}{sup 0}.

  5. The BaBar Data Acquisition System

    CERN Document Server

    Scott, I; Grosso, P; Huffer, M E; O'Grady, C; Russell, J J

    1999-01-01

    The BaBar experiment at the Stanford Linear Accelerator Center is designed to perform a search for CP violation by ana-lyzing the decays of a very large sample of B and B(Bar) mesons produced at the high luminosity PEP-II accelerator. The data acquisition system must cope with a sustained high event rate, while supporting real time feature extraction and data compression with minimal dead time. The BaBar data acquisition system is based around a common VME interface to the electronics read-out of the separate detec-tor subsystems. Data from the front end electronics is read into commercial VME processors via a custom "Personality Card" and PCI interface. The commercial CPUs run the Tornado operating system to provide a platform for detector subsystem code to perform the necessary data processing. The data is read out via a non-blocking network switch to a farm of commercial UNIX processors. The current implementation of the BaBar data acquisition sys-tem has been shown to sustain a Level 1 trigger rate of 1.3...

  6. New Spectroscopy at BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Mazzoni, M.A.; /INFN, Rome

    2007-04-18

    The Babar experiment at the SLAC B factory has accumulated a high luminosity that offers the possibility of systematic studies of quarkonium spectroscopy and of investigating rare new phenomena. Recent results in this field are presented. In recent times spectroscopy has become exciting again, after the discovery of new states that are not easily explained by conventional models. States such as the X(3872) and the Y(4260) could be new excited charmonium states, but require precise measurements for positive identification. The BaBar experiment [1] is installed at the asymmetric storage ring PEP-II. 90% of the data accumulated by BaBar are taken at the Y(4S) (10.58 GeV) and 10% just below (10.54 GeV). The BaBar detector includes a 5-layer, double-sided silicon vertex tracker and a 40-layer drift chamber in a 1.5 T solenoidal magnetic field, which detect charged particles and measures their momenta and ionization energy losses. Photons, electrons, and neutral hadrons are detected with a CsI(Tl)-crystal electromagnetic calorimeter. An internally reflecting ring-imaging Cherenkov is also used for particle id. Penetrating muon and neutral hadrons are identified by an array of resistive-plate chambers embedded in the steel of the flux return. The detector allows good track and vertex resolution, good particle id and good photon detection so it is especially suited for spectroscopy studies.

  7. Aspectos prosódicos da fala de sujeitos parkinsonianos

    Directory of Open Access Journals (Sweden)

    Lourenço Chacon

    2001-02-01

    Full Text Available

    Problemas de prosódia na fala de parkinsonianos têm sido apontados nos estudos sobre parkinsonismo. Contudo, nesses estudos a prosódia é freqüentemente desvinculada dos fatores comunicativos da fala. O propósito deste artigo foi investigar fatores comunicativos relacionados a aspectos prosódicos da fala de sujeitos com doença de Parkinson. As amostras 'de fala foram extraídas de conversas espontâneas de dois sujeitos parkinsonianos, do sexo masculino. A análise mostrou que os elementos prosódicos ocorreram em diversas combinações, possibilitando a identificação de: a atos de fala; b alguns aspectos da organização conversacional; e c diferentes vozes no discurso. Foram destacadas algumas implicações desses resultados para uma melhor compreensão da atividade verbal em condições patológicas, bem como para avaliação, diagnóstico e terapia de parkinsonianos.

  8. Hemangiomas cavernosos do cranio: aspectos clinicos, radiologicos e terapeuticos

    Directory of Open Access Journals (Sweden)

    D. Kirchhoff

    1977-12-01

    Full Text Available São discutidos os aspectos relativos ao diagnóstico e tratamento dos hemangiomas cavernosos do crânio. Os dados obtidos em 26 casos, são apresentados, sendo salientado que a localização dos hemangiomas foi maior na região frontal, sendo mais atingido o sexo masculino. Os outros aspectos são coincidentes com os demais autores. A problemática desses tumores, principalmente a sua demonstração radiológica e o seu tratamento, são ressaltados, chegando-se à conclusão final de que o melhor meio de demonstração radiológica é a punção para contrastação direta do tumor. O tratamento de escolha é o cirúrgico, sendo a extirpação em bloco preferida nos casos de comprometimento ósseo importante, sendo a intervenção direta com dissecção e excisão reservada para as localizações nos tecidos moles ou com mínima participação óssea.

  9. ALGUNOS ASPECTOS A CONSIDERAR SOBRE LA SEXUALIDAD DEL ADULTO MAYOR

    Directory of Open Access Journals (Sweden)

    Zoila Edith Hernández Zamora

    2008-12-01

    Full Text Available La presente investigación expone, a partir de una serie de entrevistas realizadas a una muestra de adultos mayores, aspectos relativos a la satisfacción general en la vida, así como las actitudes, conocimientos y prácticas de la sexualidad de un grupo de adultos mayores que asisten regularmente a una estancia diurna de la ciudad de Xalapa, Veracruz, México, misma que fue diseñada especialmente para este grupo etario. Se encontraron diferencias estadísticamente significativas entre la actitud hacia el ejercicio de la sexualidad de las personas mayores entre los hombres y las mujeres de la muestra, y entre .las personas que tienen pareja con relación a las que no tienen; así como que hay una diferencia estadísticamente significativa entre aquellas personas que tiene una o ninguna enfermedad y las que tienen dos o más enfermedades con respecto a su frecuencia de actividad sexual. Es de resaltar la escasez de conocimientos sobre aspectos básicos de la sexualidad que poseen estas personas mayores, lo que hace necesario el establecimiento de programas educativos que incluyan al personal de salud y a los mismos senectos.

  10. Los aspectos ambientales en el sistema de gestion de calidad de una empresa de elaborados carnicos

    National Research Council Canada - National Science Library

    Ulloa-Enriquez, Medardo Angel

    2011-01-01

    El objetivo del presente articulo es compartir una metodologia adecuada para la identificacion, priorizacion e incorporacion de los aspectos ambientales en el sistema de gestion de calidad certificado...

  11. Aspectos orofaciais dos maus-tratos infantis e da negligencia odontologica

    National Research Council Canada - National Science Library

    Massoni, Andreza Cristina de Lima Targino; Ferreira, Angela Maria Brito; Aragao, Ana Karla Ramalho; de Menezes, Valdenice Aparecida; Colares, Viviane

    2010-01-01

    O objetivo deste artigo foi identificar os principais aspectos orofaciais dos maus-tratos infantis e da negligencia odontologica, contribuindo com a identificacao destas vitimas no ambiente odontologico...

  12. Entre notícias e formulários policiais: uma análise da construção midiática de jovens vítimas de crimes violentos nos periódicos Correio da Paraíba e Jornal da Paraíba

    OpenAIRE

    Aguiar, Tássio José Ponce de Leon

    2015-01-01

    Esta pesquisa analisou como são construídas as notícias sobre jovens vítimas de crimes violentos, nos cadernos de Cidades e Últimas dos jornais impressos Correio da Paraíba e Jornal da Paraíba, durante uma amostra referente ao ano de 2014. O objetivo foi identificar o sentido provocado pelas escolhas feitas por ambos os periódicos, observando aspectos como a valoração atribuída a esse tipo de matéria, a diversidade de conteúdo publicado, as fontes ouvidas, o caráter do noticiário, bem como as...

  13. Geoenvironmental weathering/deterioration of landfilled MSWI-BA glass.

    Science.gov (United States)

    Wei, Yunmei; Saffarzadeh, Amirhomayoun; Shimaoka, Takayuki; Zhao, Chun; Peng, Xuya; Gao, Junmin

    2014-08-15

    Municipal solid waste incineration bottom ash (MSWI-BA) glass serves as a matrix of assorted bottom ash (BA) compounds. Deterioration of the BA glass phases is quite important as they regulate the distribution of a series of toxic elements. This paper studied landfilled MSWI-BA samples from the mineralogical and geochemical viewpoint to understand the deterioration behavior of the BA glass phases as well as mechanisms involved. Bulk analysis by PXRD as well as micro-scale analysis by optical microscopy and SEM/EDX was conducted for such purposes. The results revealed that dissolution of the BA glass phases has resulted in a deterioration layer of 10(0)-10(2)μm thickness after years of disposal. This rapid weathering process is highly relevant to the specific glass characteristics and solution pH. The BA glass phases with more embedded compounds and cracks/fissures tend to be more vulnerable. Moreover, the generally alkaline pH in ash deposit favors a rapid disruption of the glass phase. The weathering products are mainly gel phases (including Al-Si gel, Ca-Al-Si gel, Fe-Al-Si gel etc.) with iron oxide/hydroxide as accessory products. Breakdown of the BA glass phases triggers chemical evolution of the embedded compounds. Based on all the findings above, a model is proposed to illustrate a general evolution trend for the landfilled MSWI-BA glass phases. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Syntheses and crystal structures of BaAgTbS{sub 3}, BaCuGdTe{sub 3}, BaCuTbTe{sub 3}, BaAgTbTe{sub 3}, and CsAgUTe{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Prakash, Jai; Beard, Jessica C.; Ibers, James A. [Department of Chemistry, Northwestern University, 2145 Sheridan Road, Evanston, IL 60208-3113 (United States); Mesbah, Adel [Department of Chemistry, Northwestern University, 2145 Sheridan Road, Evanston, IL 60208-3113 (United States); ICSM-UMR 5257 CNRS/CEA/UM2/ENSCM, Bat 426, BP 17171, 30207 Bagnols/Ceze (France)

    2015-06-15

    Five new quaternary chalcogenides of the 1113 family, namely BaAgTbS{sub 3}, BaCuGdTe{sub 3}, BaCuTbTe{sub 3}, BaAgTbTe{sub 3}, and CsAgUTe{sub 3}, were synthesized by the reactions of the elements at 1173-1273 K. For CsAgUTe{sub 3} CsCl flux was used. Their crystal structures were determined by single-crystal X-ray diffraction studies. The sulfide BaAgTbS{sub 3} crystallizes in the BaAgErS{sub 3} structure type in the monoclinic space group C{sup 3},{sub 2h}-C2/m, whereas the tellurides BaCuGdTe{sub 3}, BaCuTbTe{sub 3}, BaAgTbTe{sub 3}, and CsAgUTe{sub 3} crystallize in the KCuZrS{sub 3} structure type in the orthorhombic space group D{sup 1},{sub 2}{sup 7},{sub h}-Cmcm. The BaAgTbS{sub 3} structure consists of edge-sharing [TbS{sub 6}{sup 9-}] octahedra and [AgS{sub 5}{sup 9-}] trigonal pyramids. The connectivity of these polyhedra creates channels that are occupied by Ba atoms. The telluride structure features {sup 2}{sub ∞}[MLnTe{sub 3}{sup 2-}] layers for BaCuGdTe{sub 3}, BaCuTbTe{sub 3}, BaAgTbTe{sub 3}, and {sup 2}{sub ∞}[AgUTe{sub 3}{sup 1-}] layers for CsAgUTe{sub 3}. These layers comprise [MTe{sub 4}] tetrahedra and [LnTe{sub 6}] or [UTe{sub 6}] octahedra. Ba or Cs atoms separate these layers. As there are no short Q..Q (Q = S or Te) interactions these compounds achieve charge balance as Ba{sup 2+}M{sup +}Ln{sup 3+}(Q{sup 2-}){sub 3} (Q = S and Te) and Cs{sup +}Ag{sup +}U{sup 4+}(Te{sup 2-}){sub 3}. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  15. Fibrose cística : aspectos nutricionais e manejo

    OpenAIRE

    Simon, Míriam Isabel Souza dos Santos

    2011-01-01

    Nutrição é um dos aspectos críticos do manejo de pacientes com fibrose cística, e o estado nutricional está diretamente associado com função pulmonar e sobrevida. Desnutrição é uma complicação frequente devido ao balanço energéticoproteico negativo. Diversos fatores, incluindo insuficiência pancreática, doença pulmonar supurativa crônica e anorexia podem afetar o balanço energético, contribuindo com a desnutrição. A desnutrição pode interferir no crescimento pulmonar e reduzir massa magra com...

  16. Aspectos legales al utilizar las principales redes sociales en Colombia

    Directory of Open Access Journals (Sweden)

    Manuel Adolfo Alvarado Carmona

    2017-01-01

    Full Text Available Se analizaron los aspectos legales al utilizar las dos principales redes sociales en Colombia como los son facebook y twitter. Cuando un usuario se conecta a cualquiera de las redes sociales debe hacerlo de forma responsable porque de lo contrario puede incurrir en la violación de la normatividad Colombiana en la cual se encuentran los delitos informáticos, la protección de la información y los datos, injuria y calumnia, ciberacoso y derechos de autor. Se determinaron los problemas que conllevan cuando no se utiliza bien la información en las redes sociales en el ámbito jurídico.

  17. La Entomofagia en México. Algunos aspectos culturales

    Directory of Open Access Journals (Sweden)

    Felipe Carlos Viesca González

    2009-01-01

    Full Text Available En este trabajo se abordan aspectos culturales del consumo de insectos con fines alimenticios en México y el mundo; particularmente se analiza la entomofagia en la época prehispánica y nuestros días, así como las causas por las cuales ha disminuido el consumo de estos artrópodos. Se explica porqué se ha creado una aversión hacia los insectos en diversos países y algunas regiones de México. Se reflexiona acerca del valor nutritivo de los insectos y las distintas culturas que han hecho posible que sobreviva esta práctica culinaria en el centro y sur del territorio nacional, algunas formas de preparar platillos basados en insectos, así como los problemas que enfrenta actualmente esta costumbre alimenticia entre los mexicanos y sus perspectivas.

  18. MANEJO DEL USO DE LA TIERRA. EL ASPECTO INSTITUCIONAL

    Directory of Open Access Journals (Sweden)

    Eric Richters

    2012-11-01

    Full Text Available El título de este evento es "El desarrollo y los límites de las tierras agrícolas utilizables en Costa Rica". En mi charla quiero dedicarme al aspecto general de cómo manejaremos las tierras, y esto en su contexto histórico. El objetivo de mi ponencia es aclarar nuestro acercamiento actual hacia la tierra en general y hacia la tierra rural en particular; los problemas de degradación de la misma, y también es mi deseo el dejar a ustedes algunas preguntas sobre un posible "involucramiento" del Estado en la solución de la problemática.

  19. ASPECTOS SEMÂNTICOS DO LÉXICO DA MODA

    Directory of Open Access Journals (Sweden)

    Emilia Maria Peixoto Farias

    2016-01-01

    Full Text Available Este trabalho tem com objetivo o estudo de aspectos semânticos do léxico da Moda que incluem a organização conceptual do universo discursivo investigado, hiponímia, hiperonímia, homonímia, polissemia e sinonímia. Ao contrário do que acontece na língua comum, esses fenômenos adquirem características muito próprias nas línguas de especialidade, merecendo ser discutidas para que possamos ter uma idéia mais precisa do dinamismo lexical dessas línguas. Palavras-chave: Lexicologia; Línguas de Especialidade.

  20. Cefaleia em salvas: aspectos clinicos e terapeuticos em 26 casos

    Directory of Open Access Journals (Sweden)

    Wilson Luiz Sanvito

    1980-12-01

    Full Text Available Vinte e seis casos de cefaléia-em-salvas são estudados do ponto de vista clínico e terapêutico. Nos aspectos clínicos são ressaltados a dramaticidade deste tipo de cefaléia, o nítido predomínio no sexo masculino, a média de idade dos pacientes, a presença de manifestações associadas e os fatores desencadeantes das crises nos períodos suscetíveis. Do ponto de vista terapêutico três esquemas medicamentosos foram utilizados: maleato de metisergida, prednisona e associação de ambas as drogas. Em 88,3% dos casos um resultado significativo foi alcançado, traduzido por melhora ou abolição das crises.

  1. Amamentação-aspectos antropológicos

    Directory of Open Access Journals (Sweden)

    Selma Campestrini

    1992-12-01

    Full Text Available O estudo é resultado de pesquisa bibliográfica, de pesquisa "in loco" com lactantes e de experiência profissional. A autora analisa aspectos antropológicos da amamentação e revela que grande número de nutrizes demonstra conhecimento empírico emergente de sua herança sócio-cultural, no período da lactação; proibições escrupulosas sem justificativas ou fundamentos deixam as nutrizes indecisas quanto ao que "tem que fazer" e o que "não pode fazer", as inúmeras superstições e crenças, que envolvem a amamentação, carecem ser conhecidas e aceitas pelos enfermeiros com risco de gerar choque cultural na sociedade e, conseqüentemente, desestímulo ao aleitamento materno.

  2. Jeroky Mbaekua - aspectos da etnoarte indígena.

    Directory of Open Access Journals (Sweden)

    Oseias de Oliveira

    2015-06-01

    Full Text Available A idéia de arte compartilhada na cultura ocidental tradicionalmente tem sido entendida a partir de elementos conceituais e categorizações que não podem ser aplicados na cultura indígena. Assim, considerar a arte indígena significa observar sua complexidade, de forma a perpassar todas as instâncias da vida desses sujeitos. Desta forma, o texto busca discutir aspectos da etnoarte indígena que não é focada em uma noção de arte centralizada e homogeneizadora mas, sim atenta à uma perspectiva que busca contemplar melhor o seu modo de construção de símbolos, significados e representações culturais.

  3. Aspectos Comportamentais no Julgamento Profissional dos Auditores Independentes

    Directory of Open Access Journals (Sweden)

    José Emerson Firmino

    2013-12-01

    Full Text Available Alguns estudos evidenciam que a adoção das International Financial Reporting Standards (IFRS proporcionou melhorias na qualidade das informações contábeis. Mas, o conjunto de Procedimentos descritos nas IFRSs é fortemente afetado pelo julgamento profissional dos contadores. O mesmo fato ocorre com o auditor, que deve avaliar se a aplicação das normas resulta em fair presentation. Esse julgamento dependerá da interpretação do auditor sobre o nível de probabilidade associada a determinadas expressões presentes no texto das normas contábeis. Alguns autores evidenciam que existem diferenças significativas na interpretação das expressões verbais de probabilidade entre os auditores e que aspectos comportamentais estão influenciando a emissão do parecer de auditoria. Diante desse cenário, o objetivo deste estudo foi investigar como se comportam os auditores no julgamento de situações subjetivas, inseridos em um cenário pessimista ou otimista, no momento da avaliação dos critérios de reconhecimento e/ou mensuração, quando da execução dos trabalhos da auditoria. A amostra desta pesquisa é composta por 258 auditores independentes com registro de responsáveis técnicos junto à Comissão de Valores Mobiliários (CVM. Os resultados obtidos, por intermédio da análise das respostas dos auditores para situações subjetivas, sugerem que o julgamento do auditor em situações de subjetividade é influenciado por aspectos comportamentais, sendo que eles podem apresentar opiniões distintas em seus relatórios.

  4. Co2FeAl based magnetic tunnel junctions with BaO and MgO/BaO barriers

    Directory of Open Access Journals (Sweden)

    J. Rogge

    2015-07-01

    Full Text Available We succeed to integrate BaO as a tunneling barrier into Co2FeAl based magnetic tunnel junctions (MTJs. By means of Auger electron spectroscopy it could be proven that the applied annealing temperatures during BaO deposition and afterwards do not cause any diffusion of Ba neither into the lower Heusler compound lead nor into the upper Fe counter electrode. Nevertheless, a negative tunnel magnetoresistance (TMR ratio of -10% is found for Co2FeAl (24 nm / BaO (5 nm / Fe (7 nm MTJs, which can be attributed to the preparation procedure and can be explained by the formation of Co- and Fe-oxides at the interfaces between the Heusler and the crystalline BaO barrier by comparing with theory. Although an amorphous structure of the BaO barrier seems to be confirmed by high-resolution transmission electron microscopy (TEM, it cannot entirely be ruled out that this is an artifact of TEM sample preparation due to the sensitivity of BaO to moisture. By replacing the BaO tunneling barrier with an MgO/BaO double layer barrier, the electric stability could effectively be increased by a factor of five. The resulting TMR effect is found to be about +20% at room temperature, although a fully antiparallel state has not been realized.

  5. A Dubious Distinction? The BA versus the BS in Psychology

    Science.gov (United States)

    Pfund, Rory A.; Norcross, John C.; Hailstorks, Robin; Aiken, Leona S.; Stamm, Karen E.; Christidis, Peggy

    2016-01-01

    Previous studies have documented small differences between the bachelor of arts (BA) and the bachelor of science (BS) psychology degrees in their general education core requirements, particularly mathematics and science courses. But are there differences between the BA and BS degrees within the psychology curriculum? Using data from the…

  6. Exotic decay in Ba isotopes via 12 C emission

    Indian Academy of Sciences (India)

    Considering Coulomb and proximity potentials as barriers, we have calculated the half lives for 12C emission from various Ba isotopes using different mass tables. The half life for 112Ba isotope calculated by us is 6.020 × 103 s which is comparable with the experimental value 5.620 × 103 s. From our study it is found that ...

  7. Ba II 4554 Å speckle imaging as solar Doppler diagnostic

    NARCIS (Netherlands)

    Sütterlin, P.; Rutten, R.J.; Skomorovsky, V.I.

    2001-01-01

    We present observations testing the Dopplergram capability of a narrow-band (80 mÅ) Lyot filter imaging the solar surface in the wings of the Ba II 4554 Å resonance line in combination with speckle reconstruction to obtain high angular resolution. The Ba II line is found to be an excellent tool

  8. Radioactive contamination of BaF2 crystal scintillator

    CERN Document Server

    Polischuk, O G; Bernabei, R; Cappella, F; Caracciolo, V; Cerulli, R; Di Marco, A; Danevich, F A; Incicchitti, A; Poda, D V; Tretyak, V I

    2013-01-01

    Barium fluoride (BaF$_2$) crystal scintillators are promising detectors to search for double beta decay processes in $^{130}$Ba ($Q_{2{\\beta}}$ = 2619(3) keV) and $^{132}$Ba ($Q_{2{\\beta}}$ = 844(1) keV). The $^{130}$Ba isotope is of particular interest because of the indications on 2${\\beta}$ decay found in two geochemical experiments. The radioactive contamination of BaF$_2$ scintillation crystal with mass of 1.714 kg was measured over 113.4 hours in a low-background DAMA/R&D set-up deep underground (3600 m w.e.) at the Gran Sasso National Laboratories of INFN (LNGS, Italy). The half-life of $^{212}$Po (present in the crystal scintillator due to contamination by radium) was estimated as $T_{1/2}$ = 298.8 $\\pm$ 0.8(stat.) $\\pm$ 1.4(syst.) ns by analysis of the events pulse profiles.

  9. Tillandsia recurvata L. (Bromeliaceae: aspectos farmacognósticos

    Directory of Open Access Journals (Sweden)

    Alex Lucena de Vasconcelos

    2013-01-01

    Full Text Available A cobertura superior das florestas tropicais, formada pelas copas das árvores, constitui um ambiente de extrema diversidade vegetal. Contribuindo com a grande riqueza dessas florestas encontram-se as espécies botânicas epífitas, cuja importância pode ser observada do ponto de vista ecológico, faunístico, etnobotânico e até mesmo farmacológico. Dentre as espécies adaptadas à vida epifítica podemos citar as bromeliáceas, que compõem uma das famílias mais representativas dessa flora com elevada variabilidade genética. Tillandsia recurvata é uma espécie epífita cosmopolita, nativa, adaptada a habitats áridos, utilizada para o tratamento de diversas doenças, mas pouco se tem publicado a respeito das comprovações científicas de suas propriedades. O presente trabalho revisa os aspectos etnofarmacológicos, atividades biológicas e compostos químicos relacionados à espécie em questão, pertencente à Bromeliaceae. A partir do levantamento de dados realizado, observa-se que esta se trata de uma espécie de conhecido uso popular no tratamento de diferentes distúrbios, com alguns estudos farmacológicos que comprovam suas propriedades terapêuticas. Do ponto de vista químico observa-se a presença de terpenos, flavonoides e derivados cinâmicos em sua constituição, em que alguns compostos isolados ilustram a potencialidade desta espécie como fonte de biomoléculas de interesse. Todos estes aspectos considerados nesta revisão contribuem para o conhecimento a respeito da importância biológica e o potencial terapêutico acerca dos metabólitos desta promissora espécie.

  10. Afinal, existe algum aspecto positivo no modelo da Escola Tradicional?

    Directory of Open Access Journals (Sweden)

    Fernando Henrique Protetti

    2010-03-01

    Full Text Available

    O artigo apresenta elementos de reflexão sobre o campo da educação escolar, relativo às distintas teorias pedagógicas e suas concepções sobre o processo do trabalho educativo. Objetiva-se compreender a relação entre o modelo pedagógico da Escola Tradicional e o debate existente com outras perspectivas pedagógicas, na procura de responder a questão que corresponde ao título do artigo: afinal, existe algum aspecto positivo no modelo pedagógico da Escola Tradicional? Inicialmente, realiza-se a exposição do modelo pedagógico da Escola Tradicional, na definição dos elementos singulares do seu método de ensino. No segundo momento, investigam-se as diferentes críticas recebidas pela Escola Tradicional por meio da exemplificação de duas teorias pedagógicas, Escola Nova e Pedagogia das Competências, com a intenção de identificar as características comuns que envolvem ambas as críticas, a partir da tese que versa sobre a existência de “pedagogias negativas”, a negação de tudo aquilo a que se refere à Educação Tradicional. Finalmente procura-se responder através desta investigação a seguinte questão: a partir da consideração de que todas as críticas recebidas figuram a Escola Tradicional como um modelo pedagógico atrasado e anacrônico, será possível a existências de algum aspecto positivo nesta concepção de trabalho educativo?

  11. Snakebites in Paraíba, Brazil

    Directory of Open Access Journals (Sweden)

    H. N. Albuquerque

    2005-09-01

    Full Text Available The epidemiological data on snakebites in the state of Paraíba, Brazil, is scarce. This accounts for the difficulties in helping the victims. Hence, to obtain the clinical and epidemic profile of the snakebite accidents in Paraíba, we studied the number of cases recorded in this state between January 1995 and December 2000. The data was collected from these sources: Center for Toxicological Assistance (Centro de Assistência Toxicológica - CEATOX and State Secretariat of Health (Secretaria Estadual de Saude, João Pessoa; 3rd Regional Health Center (3º Núcleo Regional de Saúde - NRS and the Division of Epidemiological Vigilance of the Municipal Secretariat of Health (Divisão de Vigilância Epidemiológica da Secretaria Municipal de Saúde - DVE/SMS, Campina Grande. The annual distribution of the snakebite incidence showed an irregularity and an increase in March, May and August; followed by a large reduction in November and December. It was also observed that snakebites occurred more frequently in the rural area, mainly among the male laborers between 10-49 years. In most cases, the bite occurred on the leg or foot. The interval between the snakebite and the medical assistance was less than six hours. The most common symptoms were pain, edema, erythema, and bleeding. The low lethality index and the high frequency of healing, without sequels, suggest that the treatment with serum neutralized the poison, indicating the efficacy of this treatment against snakebites by the specific species found in this region.

  12. Comida de rua: um estudo crítico e multirreferencial em Salvador, BA − Brasil / Street food: A critical and multifaceted study in Salvador, BA, Brazil

    Directory of Open Access Journals (Sweden)

    Cristian Oliveira Benevides Sanches Leal

    2014-11-01

    Full Text Available O objetivo deste artigo é descrever e analisar a situação da comida de rua em Salvador, BA – Brasil, compreendendo suas especificidades em diferentes contextos da cidade. Trata-se de estudo de caso único, cujas técnicas de coleta de dados foram a observação de cunho etnográfico, entrevistas semiestruturadas, uso de imagens e leitura de jornal local ao logo de um ano em três aspectos relacionados ao segmento: riscos relacionados aos alimentos e ao ambiente onde são comercializados e riscos relacionados aos trabalhadores. Os resultados indicaram grandes fragilidades relacionadas às categorias analisadas: diversidade de alimentos comercializados, mal manipulados e conservados; ambiente urbano insalubre, sem pontos de água, coleta de lixo inadequada, drenagem precária de águas e poluição atmosférica pelo elevado número de veículos; trabalhadores sem qualificação, sem uniformização adequada e submetidos a riscos sociais e ambientais constantes. Evidencia-se a necessidade da adoção de novas formas de gerenciamento de riscos para o segmento pela Vigilância sanitária, numa perspectiva intersetorial e solidária, dada a complexidade do objeto e a importância socioeconômica, cultural e nutricional da comida de rua. Constata-se a dificuldade para a VISA controlar os riscos relacionados à comida de rua atuando de forma apenas fiscalizatória, especialmente em grandes centros urbanos, como no caso de Salvador, BA. ==================================== This study aims to describe and analyze the present situation of street food in Salvador, BA, Brazil, understanding its specificities in different urban contexts. In this single case study, the data collection techniques included ethnographic observation, semi-structured interviews, use of images, and reading a local newspaper for one year focusing on three aspects related to the segment that include risks related to food, to the environment in which it is sold, and to workers

  13. When one becomes two: Ba12In4Se20, not quite isostructural to Ba12In4S19

    Science.gov (United States)

    Yin, Wenlong; Iyer, Abishek K.; Li, Chao; Yao, Jiyong; Mar, Arthur

    2017-09-01

    The ternary selenide Ba12In4Se20 was synthesized by reaction of BaSe, In2Se3, and Se at 1023 K. Single-crystal X-ray diffraction revealed a trigonal structure (space group R 3 bar, Z = 6, a = 10.0360(6) Å, c = 78.286(4) Å at room temperature) consisting of one-dimensional stacks of InSe4 tetrahedra, In2Se7 double tetrahedra, selenide Se2- anions, and diselenide Se22- anions, with Ba2+ cations in the intervening spaces. The selenide Ba12In4Se20 can be derived from the corresponding sulfide Ba12In4S19 by replacing one monoatomic Ch2- anion with a diatomic Ch22- anion. An optical band gap of 1.70(2) eV, consistent with the dark red colour of the crystals, was deduced from the UV-vis-NIR diffuse reflectance spectrum.

  14. Proyecto Vidas Paralelas Indígena: revelando el pueblo Potiguara de Paraíba, Brasil

    Directory of Open Access Journals (Sweden)

    Nadyele TARGINO

    2012-03-01

    Full Text Available Los indígenas Potiguara habitan el litoral norte del Estado de Paraíba (Nordeste del Brasil, en los municipios litoráneos da Baía da Traição, Marcação y Rio Tinto. Son cerca de 12.000 indígenas distribuídos en 36 aldeas. Se destacan aspectos de la historia y de la resistencia a la colonización, formando una barrera a lo largo del litoral y la lucha con los latifundistas desde el siglo XIX. Las tierras fueron demarcadas y oficialmente reconocidas Saúde Indígena Tempus - Actas de Saúde Coletiva Revista Tempus Actas de Saúde Coletiva 92 en la década de 1990. Se describen los esfuerzos para revivir la lengua Tupí, y la incipiente inserción de estudiantes indígenas en la enseñanza superior. Con respecto a la salud, de las 36 aldeas potiguara, nueve tienen Unidad Básica de Salud que funciona solamente cuando hay presencia del médico, cada semana o cada 15 días. Los caso más graves son reportados al DSEI, atendiendo em tres polos-base (Baía da Traição, Marcação e Rio Tinto; dependiendo da patología, el indígena es remitido para diferentes hospitales de João Pessoa, capital del Estado.

  15. Aspectos emocionales del paciente crítico

    Directory of Open Access Journals (Sweden)

    Lucio A. Martha

    1998-12-01

    Full Text Available

    This paper analyzes the emotional answer of the people we call "critical patient", the relationship between nurse-patient is the most significant point of view and the influence of this relationship in the mental state of both; a special reference is made to the connotation of the "patient" and "critical" term and the emotional expression of comfort or discomfort.

    El presente ensayo es un análisis sobre las respuestas emocionales y en general las actitudes de aquellas personas a quienes llamamos "pacientes críticos", el aspecto novedoso consiste en que su mirada se hace desde la relación paciente-cuidador y en como ésta influye en los comportamientos de los involucrados; igualmente busca reflexionar acerca de las connotaciones que los vocablos "paciente" y "crítico" imprimen al manejo de la relación y como consecuencia al bien-estar o mal-estar de la persona enferma.

  16. Psicopatología descriptiva : aspectos cualitativos y cuantitativos

    Directory of Open Access Journals (Sweden)

    Germán E. Berrios

    2013-09-01

    Full Text Available En el presente artículo se discuten algunos aspectos que afectan a la comprensión y al funcionamiento de la psicopatología descriptiva (PD, la cual proporciona un lenguaje descriptivo a la psiquiatría y las bases para sus constructos nosológicos. La PD formula postulados sobre la naturaleza de su objeto de estudio y sus causas subyacentes (haciendo uso del modelo médico. Se propone que la PD necesita una recalibración histórica, clínica y numérica. En relación a esto, se sugiere que en algunos casos, en contra de los principios psicométricos tradicionales, ciertos instrumentos deberán ser construidos de un modo flexible que permita que varíen de acuerdo a las necesidades descriptivas que presenten casos individuales. This paper deals with some of the issues that affect the understanding and functioning of descriptive psychopathology (DP. The latter remains the language of description in psychiatry and the basis for her nosological constructs. DP makes assumptions concerning the nature of its object and its underlying causes (i.e. makes use of the medical model. DP needs historical, clinical and numerical recalibration. It is suggested that in some cases, and against traditional psychometric principles, some instruments will have to be constructed that show flexibility and can be varied according to the descriptive needs presented by individual cases.

  17. ASPECTOS DE LA VIDA Y SOCIEDAD NOVOHISPANA DEL SIGLO XVIII

    Directory of Open Access Journals (Sweden)

    Francisco Javier Quirós Vicente

    2013-08-01

    Full Text Available En este artículo se habla acerca de diversos aspectos de la vida y sociedad en la Nueva España. Se tratan concretamente dos temas que sirven de reflejo de esta la sociedad colonial de principios del siglo XVIII; en primer lugar el de la relación las colonias españolas de ultramar con la corona española, en la época de la Guerra de la Sucesión, y en segundo el de la esclavitud que se desarrolla en este mismo periodo, con el negocio conocido como Paso Medio, con africanos mayormente provenientes de Angola y La Guinea. El ámbito geográfico se acota a la localidad de San Luís Potosí, en México. Y su desarrollo se basa en dos documentos encontrados en el Archivo Histórico Municipal del San Luís Potosí, en su sección de Alcaldía Mayor.

  18. La influencia del Aspecto en la eficiencia del mensaje gráfico publicitario

    OpenAIRE

    Martínez Bouza, José Manuel

    2010-01-01

    La investigación se centra en cómo mejorar la eficiencia del mensaje gráfico publicitario desde la perspectiva formal del diseño y concreta la variación de la preferencia del receptor ante los cambios en los estímulos visuales provocados por los cambios de Aspecto del mensaje gráfico publicitario, así como la importancia del aspecto en el rendimiento comunicativo. El trabajo se orienta hacia el estudio de la influencia del Aspecto en la eficiencia del diseño gráfico aplicado a un sector en al...

  19. Aspectos subjetivos relacionados con la violencia intrafamiliar. Caso municipio de Sabaneta Antioquia

    OpenAIRE

    Naidalis Yadira Martínez; María Isabel Ochoa Toro; Edison Francisco Viveros Chavarria

    2016-01-01

    El artículo identifica las interacciones en aspectos familiares y subjetivos. En el artículo se desarrollan los aspectos subjetivos de las dinámicas familiares que justifican el uso y la implementación de la violencia intrafamiliar, se da cuenta de la naturalización de la violencia intrafamiliar en la interacción de los grupos familiares, convirtiéndola en un elemento de la relación que se establece entre los miembros de la familia. En el análisis realizado se identifican aspectos coyunturale...

  20. Ba-hexaferrite Films for Next Generation Microwave Devices (invited)

    Energy Technology Data Exchange (ETDEWEB)

    Harris,V.; Chen, Z.; Chen, Y.; Yoon, S.; Sakai, T.; Geiler, A.; Yang, A.; He, Y.; Ziemer, K.; et al.

    2006-01-01

    Next generation magnetic microwave devices require ferrite films to be thick (>300 {mu}m), self-biased (high remanent magnetization), and low loss in the microwave and millimeter wave bands. Here we examine recent advances in the processing of thick Ba-hexaferrite (M-type) films using pulsed laser deposition (PLD), liquid-phase epitaxy, and screen printing. These techniques are compared and contrasted as to their suitability for microwave materials processing and industrial production. Recent advances include the PLD growth of BaM on wide-band-gap semiconductor substrates and the development of thick, self-biased, low-loss BaM films by screen printing.

  1. Refractarios: un aspecto clave en la industria del cemento

    Directory of Open Access Journals (Sweden)

    Castillo Neira, Percy

    1985-09-01

    Full Text Available To sit in judgement values of the technic level reached in a cement plant, it is surprisingly objetive to analyse work, planning and control development about Refractories subject. Considering and recognizing the validity of this pragmatic axiom it will offer unexpected improvement perspectives of the productivity rates and production records. This work pretends to be a contribution for this purpose, bringing some theoretic and practical accounts about de conditions offered by the Kiln-Exchanger-Cooler most diffused system, analyzing the characteristics that refractory material must have, in accordance with each zone, and finally, including some appraisals and recommendations regarding some of the manifold aspects which belongs to one of the most interesting ad complex fields of cement industry.

    Para establecer un juicio de valor respecto al nivel técnico alcanzado en una planta cementera resulta sorprendentemente objetivo analizar el trabajo, planificación y control que se desarrolla alrededor del tema de Refractarios. Considerarlo y reconocer la validez de este axioma pragmático ofrecerá inusitadas perspectivas de superación de índices de productividad y récords de producción. En este trabajo se pretende un aporte a tal objetivo proporcionando algunas consideraciones teórico-prácticas sobre las condiciones que se presentan en el sistema Horno Intercambiador-Enfriador, más difundido, analizando las características que debe reunir el material refractario para cada zona y, finalmente, incluyendo algunas apreciaciones y recomendaciones principalmente de criterio, respecto a algunos de los múltiples aspectos que forman parte de uno de los campos más interesantes y complejos de la industria del cemento.

  2. A TEOLOGIA DA HISTÓRIA: ASPECTOS FUNDAMENTAIS

    Directory of Open Access Journals (Sweden)

    Pedro Miguel Sousa Santos

    2011-01-01

    Full Text Available Desde as relações primordiais dos homens com os deuses houve uma necessidade de se conceituar a temporalidade e firmá-la como consequência dessa relação. Salvas as devidas proporções, não foi diferente com a Teologia, é o que o presente artigo pretende tocar: os aspectos fundamentais da Teologia da História que nasce de um Deus, o Singular absoluto, o Cristo, e a sua participação na História empírica que encontra uma sintonia profunda na soteriologia vétero e neotestamentária. O problema é de se entender de que forma um único sujeito pode ser a divisa para a História em sua totalidade. O autor que se toma como referência nessa discussão é o teólogo Hans Urs von Balthasar em seu livro Teologia da História, destacando-se a originalidade como é tratada a História no viés teológico. ABSTRACT: Since the primordial relations of men with the gods there was a need to conceptualize temporality and secure it as a result of this relationship. With the proper proportions preserved, it was no different with theology, which is what this article intends to demonstrate: the fundamental theology of history born of a God, absolute Single, the Christ, and its participation in empirical History which encounters a profound harmony in the old and new testament soteriology. The problem is to understand how one subject can be the division for History in its entirety. The author who serves as a reference in this discussion is the theologian Hans Urs von Balthasar in his book Theology of History, highlighting the originality as it is applied to History in the theological perspective.

  3. Aspectos técnicos da psicoterapia de grupo

    Directory of Open Access Journals (Sweden)

    Bernardo Blay Neto

    1959-09-01

    Full Text Available São estudados os mecanismos psíquicos que se desenvolvem em agrupamentos humanos e a sua utilização para fins terapêuticos, sendo focalizado o fenômeno da interação como o dinamismo básico dessas reações. O autor compara a forma pela qual encara o grupo com as idéias de Bion, Moreno e Sullivan, encarando a hipótese de que os sentimentos de amor e hostilidade se manifestem em função do bom ou do mau funcionamento dos contactos primários que caracterizam a dependência. O autor comenta resultados que obteve usando o psicodrama, mediante o qual estudou reações emocionais de inveja, ódio, agressividade e amor. O autor analisa as técnicas de Slavson e Pratt baseando-se nos dinamismos inerentes ao grupo e refere os estudos de Beukemkamp para a compreensão do fenômeno transferenciai que, no grupo, tem características próprias. As diferenças entre a terapia de grupo e a individual são apontadas, sendo a contra-transferência considerada como elemento construtivo. Pensa o autor que o aspecto dramático vivenciado pelo grupo ou por um dos seus componentes tem alto valor, pois engloba a verbalização, os componentes emocionais e os componentes posturais. O tono emocional vivenciado pelo grupo é mais intenso e opressivo que o que é despertado na terapêutica individual, o que é explicável pela somação de efeitos provocada pela reação circular. Segundo o autor, a Psicoterapia de Grupo e a Psicoterapia Individual não se opõem, mas se completam.

  4. Conocimientos de los adolescentes sobre aspectos de la sexualidad

    Directory of Open Access Journals (Sweden)

    Ileana García Imia

    2002-12-01

    Full Text Available Se realizó un estudio descriptivo retrospectivo, de corte transversal, en el área del Policlínico Docente "Wilfredo Pérez Pérez" del municipio San Miguel del Padrón, de Ciudad de La Habana, con el fin de explorar los conocimientos sobre algunos aspectos de la sexualidad, en un grupo de 100 adolescentes en edades entre 10 y 19 años y de uno y otro sexos, en el año 2001. Se apreció un elevado tanto por ciento de jóvenes que tenían conocimientos sobre la anatomía del aparato genital, la mejor edad para tener hijos y la anticoncepción. En general, no tenían conocimientos de todas las enfermedades de transmisión sexual, no así el método más eficaz para evitarlas. El grupo de edad de mayor relevancia lo constituyó el de 10 a 13 años por sus escasos conocimientos sobre sexualidad.A retrospective, descriptive and crosswise study was made in the health areas of "Wilfredo Pérez Pérez" Teaching Polyclinics in San Miguel del Padrón municipality, Havana City province, with the objective of exploring what a group of 100 adolescents aged 10-19 years of both sexes knows about sexuality in the year 2001. A high percentage of them had knowledge about anatomy of the genital system, the most suitable age for having children and contraception. In general, they did not know all the sexually-transmitted diseases but they did know the most efficient method to prevent them. The most relevant age group was 10-13 years old because of their poor knowledge about sexuality.

  5. Revisión de algunos aspectos importantes

    Directory of Open Access Journals (Sweden)

    J. A. Ávila

    2012-01-01

    Full Text Available El soporte nutricional adecuado y oportuno contribuye en la reducción del riesgo de infecciones, mejora la función inmune y el pronóstico del paciente; es por esto que se destaca la importancia de mantener un adecuado estado nutricional en los pacientes críticamente enfermos. Con este propósito, el presente documento resalta el valor de la nutrición parenteral y su papel en aquellos animales con desnutrición presente o prevista, siempre y cuando la vía enteral no esté disponible o sea insuficiente; esto, en razón de su metabolismo alterado, el cual predispone a un mayor catabolismo mus-cular. La correcta elaboración de un plan nutricional debe tener en cuenta aspectos de gran importancia como la evaluación integral de los hallazgos históricos, clínicos y paraclínicos, con el fin de detectar el grado o riesgo de desnutrición; por su parte, la selección del tipo de nutrición más adecuada y el tipo de solución por emplear, son variables igualmente relevantes pues varían según cada caso particular, dependiendo de la condición del paciente y el tipo de patologías asociadas. Así pues, el cálculo de los requerimientos calóricos y la manera en que estos serán suplementados, son variables que deben manejarse con cautela, con el fin de no exceder la capacidad metabólica y desencadenar complicaciones que representen mayor morbilidad y mortalidad. Por úl-timo, es importante resaltar que la nutrición parenteral debe descontinuarse tan pronto como sea posible para disminuir los problemas relacionados con la misma, como la atrofia gastrointestinal.

  6. Algunos aspectos técnicos sobre la liofilización de pulpa de cocona (Solanum sessiliflorum Dunal

    Directory of Open Access Journals (Sweden)

    Leynard Natividad Marín

    2013-12-01

    Full Text Available La cocona (Solanum sessiliflorum Dunal es una fruta ampliamente distribuida en la Amazonia Sudamericana, con buenas características nutricionales y antioxidantes. El objetivo de este trabajo fue deshidratar la pulpa de cocona mediante liofilización para evaluar algunos aspectos técnicos de un nuevo tipo de producto que permita su mejor comercialización y mayores usos en la industria alimentaria. Los frutos fueron adquiridos en el Mercado Central de Frutas de Lima (Perú y procesados en el Centro Experimental Tecnológico de la Universidad Nacional del Callao (Callao, Perú. Fue realizado un acondicionamiento y liofilización de la materia prima; en el primero la muestra fue cortada, escaldada, pelada, despulpada, refinada y concentrada al vacío a temperatura de baño de 60 ºC durante 15 minutos y presión de -800 mbar; mientras que en la segunda, se congelaron previamente las muestras durante 12 horas a -20 ºC para su sublimación durante 24 horas a una presión inferior a 200 μHg. Asimismo, se determinaron los rendimientos y contenidos de humedad en el proceso. Se realizaron caracterizaciones en la pulpa refinada, muestra liofilizada y en la pulpa liofilizada reconstituida: contenido de humedad, proteína, extracto etéreo, cenizas, carbohidratos incluido el contenido de fibra, densidad, viscosidad, sólidos solubles, azúcares reductores, acidez titulable, pH y solubilidad, según fue el caso. Se obtuvo un polvo higroscópico, con solubilidad en agua de 84,33 % y con ligeras variaciones en sus características con respecto al producto inicial.

  7. Estudo das variaçoes anatômicas na divisao terminal da artéria esplenica e da segmentaçao em baços humanos

    OpenAIRE

    Lima, Carlos Augusto de; Ribas Filho,Jurandir Marcondes

    2013-01-01

    Resumo: Este trabalho tem por objetivo estudar os aspectos anatômicos da vascularização arterial do baço humano, bem como de sua segmentação. O mesmo foi realizado no Laboratório de Anatomia Humana da Universidade Regional de Blumenau. Estudou-se 20 baços de cadáveres frescos de crianças e adultos. Estes foram retirados, junto com parte do corpo e cauda do pâncreas. Após a remoção dissecou-se o tronco da artéria esplénica injetando no seu leito uma resina acrílica de uso odontológico, e. cpjo...

  8. Leptonic B Decays at BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Monorchio, Diego; /INFN, Naples /Naples U.

    2011-09-13

    The authors will present the most recent results on leptonic B decays B{sup {+-}(0)} {yields} K*{sup {+-}(0)} {nu}{bar {nu}} and B{sup {+-}} {yields} {mu}{sup {+-}}{nu}, based on the data collected by the BaBar detector at PEP-II, an asymmetric e{sup +}e{sup -} collider at the center of mass energy of the {Upsilon}(4S) resonance. Rare B decays have always been a standard probe for New Physics (NP) searches. The very low Standard Model (SM) rate of these decays often make them unaccessible with the present experimental datasets, unless NP effects enhance the rate up to the current experimental sensitivity. Moreover, as NP effects can modify the decay kinematic, particular attention must be payed in order to perform a model independent analysis. A B-Factory provides an unique environment where to investigate these processes. The high number of B{bar B} pairs produced by a B-Factory often allows to approach the needed experimental sensitivity. Moreover, the clean environment and the closed kinematic of the initial state enable to obtaining a very pure sample where to look for these decays.

  9. Leptonic B Decays at BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Baracchini, Elisabetta; /Rome U. /INFN, Rome

    2011-11-10

    We will present the most recent results on leptonic B decays B{sup {+-}(0)} {yields} K*{sup {+-}(0)}{nu}{bar {nu}} and B{sup {+-}} {yields} {mu}{sup {+-}}{nu}, based on the data collected by the BaBar detector at PEP-II, an asymmetric e{sup +}e{sup -} collider at the center of mass energy of the {Upsilon}(4S) resonance. Rare B decays have always been a standard probe for New Physics (NP) searches. The very low Standard Model (SM) rate of these decays often make them unaccessible with the present experimental datasets, unless NP effects enhance the rate up to the current experimental sensitivity. Moreover, as NP effects can modify the decay kinematic, particular attention must be paid in order to perform a model independent analysis. A B-Factory provides an unique environment to investigate these processes. The high number of B{bar B} pairs produced by a B-Factory often allows to approach the needed experimental sensitivity. Moreover, the clean environment and the closed kinematic of the initial state enable to obtaining a very pure sample where to look for these decays.

  10. Hipertermia maligna: aspectos moleculares e clínicos

    Directory of Open Access Journals (Sweden)

    Ana Carolina de Carvalho Correia

    2012-12-01

    Full Text Available CONTEÚDO: A hipertermia maligna (HM é uma doença farmacogenética potencialmente letal que acomete indivíduos geneticamente predispostos. Manifesta-se em indivíduos susceptíveis em resposta à exposição a anestésicos inalatórios, relaxantes musculares despolarizantes ou atividade física extrema em ambientes quentes. Durante a exposição a esses agentes desencadeadores, há um aumento rápido e sustentado da concentração de cálcio mioplasmático (Ca2+ induzido pela hiperativação dos receptores de rianodina (RYR1 do músculo esquelético, causando uma alteração profunda na homeostase de Ca2+, caracterizando um estado hipermetabólico. RYR1, canais de libertação de Ca2+ do retículo sarcoplasmático, é o principal local de susceptibilidade à HM. Várias mutações no gene que codifica a proteína RYR1 foram identificadas, mas outros genes podem estar envolvidos. Atualmente, o método padrão para o diagnóstico de sensibilidade à HM é o teste de contratura muscular para exposição ao halotano-cafeína (CHCT e o único tratamento é o uso de dantroleno. No entanto, com os avanços no campo da genética molecular, um pleno entendimento da etiologia da doença pode ser fornecido, favorecendo o desenvolvimento de um diagnóstico preciso, menos invasivo, com o teste de ADN, e também proporcionar o desenvolvimento de novas estratégias terapêuticas para o tratamento da HM. Logo, esta breve revisão tem como objetivo integrar os aspectos clínicos e moleculares da HM, reunindo informações para uma melhor compreensão desta canalopatia.

  11. Sialometria: aspectos de interesse clínico

    Directory of Open Access Journals (Sweden)

    Denise Pinheiro Falcão

    2013-12-01

    Full Text Available A saliva total é um complexo de secreções multiglandulares composto de fluido gengival, células epiteliais descamadas, microrganismos, produtos do metabolismo bacteriano, resíduos alimentares, leucócitos, muco da cavidade nasal e da faringe. A saliva possui diversas funções, incluindo reparação tecidual, tamponamento, proteção, digestão, gustação, ação antimicrobiana, manutenção da integridade do dente e sistema de defesa antioxidante. A redução do fluxo salivar (hipossalivação é um distúrbio comum, e estima-se que cerca de 20% da população geral tenham esta alteração. A hipossalivação pode ser decorrente de diabetes mellitus, hipotireoidismo, desidratação, comprometimento do parênquima glandular por processos infecciosos, doenças granulomatosas ou condições autoimunes e inflamatórias (como a síndrome de Sjögren e a artrite reumatoide, radioterapia da região cefálica e/ou cervical, bem como pode estar associada a distúrbios do humor, efeitos adversos ocasionados pelo uso de algumas medicações ou, ainda, ser de causa idiopática. As terapias convencionais para o tratamento da redução do fluxo salivar, com o uso de sialogogos gustatórios e químicos, ainda apresentam restrições. Contudo, novas alternativas têm mostrado grande perspectiva no tratamento deste problema. Diagnosticar um paciente como hipossalivador crônico é um desafio na prática clínica, e os métodos de avaliação do fluxo salivar são pouco conhecidos pelos reumatologistas. A avaliação seriada do fluxo salivar é importante para o correto diagnóstico e prognóstico de determinadas condições bucais e sistêmicas. Esta revisão aborda alguns aspectos relacionados à função da saliva, às consequências da hipossalivação e aos métodos de medição da taxa de fluxo salivar, conceitos úteis na prática diária do reumatologista.

  12. Aspectos fisiológicos do mountain biking competitivo

    Directory of Open Access Journals (Sweden)

    Ricardo Dantas de Lucas

    2010-12-01

    Full Text Available A prática do ciclismo off-road (mountain biking - MTB, cresceu muito nas últimas duas décadas, sendo incluído como esporte olímpico, nos Jogos de Atlanta em 1996, na modalidade Cross Country. Na última década, houve um aumento no número de publicações científicas que verificaram a demanda fisiológica durante competições, assim como o estudo de possíveis preditores da performance nesta modalidade. O objetivo deste estudo de revisão foi descrever alguns aspectos fisiológicos específicos do MTB Cross Country (MTB CC competitivo (intensidade de provas, perfil fisiológico de atletas de elite, uso de suspensões e determinantes da performance em subidas. Observa-se na literatura analisada que as provas de MTB CC parecem impor uma sobrecarga fisiológica maior, quando analisada através da frequência cardíaca, do que provas de ciclismo de estrada com duração semelhante. Entretanto, quando analisada pela potência de pedalada, observa-se claramente a característica intermitente da modalidade, com variações de potência durante a prova entre zero e 500W, e potência média relativamente baixa em comparação aos valores de FC encontrados. Outro fator importante levantado neste estudo são as alterações fisiológicas decorrentes do uso de suspensões nas bicicletas de MTB CC. O uso deste equipamento reduz o estresse muscular provocado pelo terreno acidentado, embora pareça não afetar o gasto energético total, tanto em percurso plano como em subidas. Entretanto, é fato que o desempenho em circuitos acidentados é melhorado com o uso das suspensões. Com base nos estudos abordados nessa revisão, conclui-se que o MTB CC enquanto modalidade competitiva apresenta uma grande variação de intensidade (avaliada através da potência, sendo esta atribuída principalmente ao tipo de terreno (irregular e com muitas aclives e declives acentuados em que as provas de MTB CC acontecem.

  13. Aspectos relevantes sobre tuberculose para profissionais de saúde

    Directory of Open Access Journals (Sweden)

    Alexandre Daronco

    2012-01-01

    Full Text Available A Tuberculose (TB é uma patologia infectocontagiosa com clínica ampla cujo agentecausador é o Mycobacterium tuberculosis (Bacilo de Koch, uma micobactéria aeróbia estrita. Apesar de tratar-se dedoença antiga, que acomete seres humanos há séculos, sendo uma importante causa de morte no mundo inteiro,diferentes pesquisas do Ministério da Saúde apontam números preocupantes no tocante a novos casos. Materiais eMétodos: O presente artigo de revisão procura, de forma objetiva e clara, explicitar os principais aspectos de interessepara profissionais de saúde no tocante a Tuberculose doença. O artigo divide-se em tópicos: Defi nição, Sintomatologia,Diagnóstico, Tratamento, Multirresistência, Profi laxia, Formas de Contágio e Formas de Prevenção. Foram utilizadasreferências atuais sobre o tema, incluindo Manuais, Guidelines e Artigos científicos diversos de bases de dados comoUp to Date e Science Direct. Discussão: Sinais e sintomas da doença aumentam o grau de suspeição da mesma, oque torna o pedido de exames para confirmação da infecção dentro de tempo hábil para instituição da terapêuticaadequada. Assim como diagnóstico e tratamento, medidas para evitar o contágio, em serviços de saúde, locaiscom aglomerações humanas e em residências, são de fundamental importância no combate a tuberculose. Osprofissionais de saúde devem atentar para possíveis casos de resistência aos fármacos e as indicações de profilaxia,pois tais variáveis são de extrema relevância no controle da disseminação da doença. Conclusão: Por tratar-se dedoença infecciosa que pode acometer todas as classes sociais, além de possuir formas diferentes de acometimento,o conhecimento básico acerca da Tuberculose é deveras imprescindível em serviços de saúde, desde a atençãoprimária até os centros de saúde com alta tecnologia.

  14. Clinical-pathological aspects of Blue-fronted Parrots parrots (Amazona aestiva, Linne 1758 coming traffickin arrests from the State of Paraíba, Brazil

    Directory of Open Access Journals (Sweden)

    Raul Antunes Silva Siqueira

    2016-12-01

    Full Text Available ABSTRACT. Siqueira R.A.S., de Lucena R.B., Cavalcanti T.A., Luna A.C. de L., Firmino M. de O. & Guerra R.R. [Clinical-pathological aspects of Blue-fronted Parrots parrots (Amazona aestiva, Linne 1758 coming traffickin arrests from the State of Paraíba, Brazil.] Aspectos clinico-patológicos em papagaios-verdadeiros (Amazona aestiva, L., 1758 oriundos de apreensões do tráfico no estado da Paraíba, Brasil. Revista Brasileira de Medicina Veterinária, 38(4:439-444, 2016. Programa de Pós-Graduação em Ciências Veterinárias, Faculdade de Veterinária, Universidade Estadual do Ceará, Av. Silas Munguba, 1700, Fortaleza, CE 60740-000, Brasil. E-mail: siqueiraras@gmail.com The objective of this study was to describe the clinical and pathological characteristics of true parrots (Amazona aestiva arising from trafficking seized by the Wild Animals Triage Center (CETAS in the State of Paraíba, Brazil. In order to establish the real condition which they were. The study was developed at CETAS in the Municipality of Cabedelo in the State of Paraíba. Fifteen birds from seizures were used, and nine of them were anesthetized. Blood samples were collected, body weight was checked and liver biopsy was performed. In the other six birds, that died, a necroscopic examination was performed. The results indicated that the birds had a poor body condition. Histopathological and serological findings showed very poor health conditions, and indicated the need to develop a health recovery work to reintroduce and release these birds in the wild.

  15. Decay Data Evaluation Project (DDEP): Updated evaluation of the 133Ba, 140Ba, 140La and 141Ce decay characteristics

    Science.gov (United States)

    Chechev, Valerii P.; Kuzmenko, Nikolai K.

    2017-09-01

    Within the Decay Data Evaluation Project (DDEP) an updated comprehensive assessment has been made of the decay characteristics of 133Ba, 140Ba, 140La, and 141Ce. Experimental data published up to 2016 along with other information (new compilations, analyses and corrections) were taken into account. Newly evaluated values of the half-lives and a number of other key decay characteristics are presented in this paper for all four radionuclides.

  16. Syntheses, crystal structures, and optical properties of CsBa5Ti2Se9Cl and CsBa2Cl5

    Science.gov (United States)

    Mesbah, Adel; Prakash, Jai; Malliakas, Christos D.; Lebègue, Sébastien; Badawi, Michael; Ibers, James A.

    2017-09-01

    The mixed-cation compounds CsBa5Ti2Se9Cl and CsBa2Cl5 were synthesized in the same solid-state reaction at 1173 K. CsBa5Ti2Se9Cl adopts the Cs3CoCl5 structure type in the tetragonal crystal system whereas CsBa2Cl5 crystallizes in the PbU2Se5 structure type in the monoclinic crystal system. The CsBa5Ti2Se9Cl structure displays both Cs/Ba and Se/Cl disorder. From optical absorption measurements CsBa5Ti2Se9Cl is an indirect wide-gap semiconductor. From theoretical calculations CsBa2Cl5 has a large band gap of 6.4 eV.

  17. Vulnerabilidade Sócio Ambiental de Pescadores e Marisqueiras em S. Francisco do Conde/Ba

    Directory of Open Access Journals (Sweden)

    Ana Almeida

    2016-12-01

    Full Text Available A partir da identificação dos determinantes socioambientais em saúde, este estudo tem como objetivo mapear aspectos relativos aos riscos e vulnerabilidade social e ambiental de um grupo de pescadores e marisqueiras no município de São Francisco do Conde, região metropolitana de Salvador, Ba. Com o propósito de colaborar na formulação de políticas públicas voltadas a promoção da qualidade de vida das marisqueiras e pescadores artesanais, tomou-se como base 2 diagnósticos complementares: o ambiental e sócio demográfico. Foi verificado a qualidade microbiológica das águas, presença de metais pesados nos sedimentos, mariscos e peixes; contaminantes microbiológicos do esgoto doméstico e 6 metais pesados mais comuns nos efluentes industriais. O diagnóstico sócio demográfico levantou as condições de trabalho e habitação além de aspectos relativos à saúde. Aliados à observação de campo e estudos similares, constatou-se que o oficio da pesca e coleta de mariscos, vem sofrendo declínio enquanto atividade ligada a tradição, despertando pouco interesse das gerações mais jovens, além das características artesanais que restringem sua inserção no modo de produção capitalista. Resultados indicam comprometimento do ecossistema costeiro, o manguezal, pela contaminação por metais pesados e coliformes fecais que potencializam os agravos de ordem ocupacional, decorrentes da ergonomia e exposição à contaminação. Refere-se ainda as condições de habitabilidade destes sujeitos e sua condição de invisibilidade que recorrentemente fortalece e amplia o grau de vulnerabilidade social e ambiental. Assim, as raízes negras do município, manifestadas na composição da população, encontra-se ameaçada face a vulnerabilidade social das comunidades, grupos remanescentes e seus descendentes.

  18. Metaplasia mieloide do baço na Ancilostomose

    Directory of Open Access Journals (Sweden)

    W. O. Cruz

    1934-06-01

    Full Text Available Pesquizamos, no figado e baço de dez casos puros de ancilostomose, elementos hemocitopoieticos; verificamos o peso do baço em 23 casos de individuos com idades compreendidas entre 3 e 60 anos; não encontramos, em nenhum caso, celulas hemoformadoras no figado. Em sete casos, encontramos, no baço, elementos da série vermelha em adiantado estado de evolução (eritroblastos ortocromaticos de nucleo picnotico. Em alguns destes casos observamos megacariocitos e numerosos mielocitos eosinofilos. Os tres casos que não apresentavam metaplasia mieloide no baço, eram os de individuos acima de 50 anos de idade. Entretanto, em outro caso de um individuo com 59 anos esta metaplasia foi verificada. Em individuos acima de 20 anos, o peso médio do baço, em nove casos, mostrou-se igual ao peso normal. Em 14 casos, compreendidos entre 3 e 14 anos, o peso deste orgão foi sempre sensivelmente mais elevado que nos normais de idade correspondente. Estes resultados sugerem a possibilidade de ser a metaplasia mieloide responsavel pelos aumentos de pezo nos baços de individuos jovens, vitimados pela anemia ancilostomica. A notavel proliferação dos eritroblastos ortocromaticos mostra que o grão e a rapidez da regeneração sanguinea, após a administração de ferro, são devidos, essencialmente, á grande quantidade de hemoglobina já preformada no baço e na medula ossea dos organismos ancilostomados.

  19. ASPECTOS CIENTÍFICOS Y BENEFICIOSOS DEL CULTO TANTRICO

    Directory of Open Access Journals (Sweden)

    Ratan Lal Basu

    2016-07-01

    Full Text Available Este artículo se propone identificar y aislar lo científico y beneficioso de la falsedad, superstición y misticismo que envuelve al tantrismo. De todas las prácticas religiosas y semireligiosas antiguas de la India, el culto tántrico es el que ha conseguido el mayor reconocimiento y la mayor popularidad en todo el mundo. La razón de esta popularidad no ha sido el interés académico, espiritual o filosófico. Por el contrario, se lo ha asociado con promesas de obtener poderes mágicos y sobrenaturales, como también promesas de mejorar la potencia sexual y la intensidad del disfrute sexual y restablecer la potencia sexual perdida en las personas mayores. En la India, la gente común le confirió una mala reputación al culto tántrico. El misterio, la psicosis de culpa y temor también se asocian a este culto esotérico. El tantra en sí no es una religión pero ha penetrado en la mayoría de las comunidades religiosas y subreligiosas no solo de la India sino también de Tíbet, China, Japón y muchos otros países (especialmente asiáticos. En la India, son innumerables las asociaciones de tantra y los tántricos individuales en calidad de gurús (maestros con sus círculos de discípulos. Sin embargo, son muchos los aspectos del tantra que son científicamente demostrables y sus efectos son beneficiosos tanto para los individuos como la sociedad en su conjunto. En esta línea, al final del artículo se destacan algunos estudios que demuestran la reducción de los niveles de estrés como resultado de las prácticas tántricas. Este trabajo también apunta a inspirar a más investigadores competentes y eruditos a continuar con la tarea aquí iniciada. Abstract This article endeavors to identify and isolate the scientific and beneficial from falsehood, superstition and mysticism surrounding tantrism. Among the various ancient Indian religious and semi-religious practices, tantra cult has got the most widespread recognition and popularity

  20. Astaxanthin: structural and functional aspects Astaxantina: aspectos estruturais e funcionais

    Directory of Open Access Journals (Sweden)

    Larissa Mont'Alverne Jucá Seabra

    2010-12-01

    ças cardiovasculares, degeneração macular e câncer. Pesquisas têm demonstrado efeitos satisfatórios da astaxantina obtida de fontes naturais assim como da obtida sinteticamente, porém os estudos em humanos se limitam à utilização de fontes naturais. Não há recomendação nutricional estabelecida para a ingestão diária de 4mg de astaxantina, mas muitos estudos relatam resultados benéficos com a ingestão diária média de 4mg. Assim, a presente revisão discute alguns aspectos do carotenóide astaxantina, com destaque para sua estrutura química e atividade antioxidante, mostrando também alguns estudos que relatam seu uso em humanos.

  1. Thermoelectric properties of doped BaHfO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Dixit, Chandra Kr., E-mail: ckparadise@gmail.com, E-mail: sharmarameshfgiet@gmail.com [Dept. of Physics, Dr. Shakuntala Misra National Rehabilitation University, Lucknow-229001, U.P India (India); Bhamu, K. C. [Department of Physics, Goa University, Goa-403 206 (India); Sharma, Ramesh, E-mail: ckparadise@gmail.com, E-mail: sharmarameshfgiet@gmail.com [Dept. of Physics, Feroze Gandhi Institute of Engineering & Technology, Raebareli-229001, U.P India (India)

    2016-05-06

    We have studied the structural stability, electronic structure, optical properties and thermoelectric properties of doped BaHfO{sub 3} by full potential linearized augmented plane wave (FP-LAPW) method. The electronic structure of BaHfO{sub 3} doped with Sr shows enhances the indirect band gaps of 3.53 eV, 3.58 eV. The charge density plots show strong ionic bonding in Ba-Hf, and ionic and covalent bonding between Hf and O. Calculations of the optical spectra, viz., the dielectric function, refractive index and extinction coefficient are performed for the energy range are calculated and analyzed. Thermoelectric properties of semi conducting are also reported first time. The doped BaHfO{sub 3} is approximately wide band gap semiconductor with the large p-type Seebeck coefficient. The power factor of BaHfO{sub 3} is increased with Sr doping, decreases because of low electrical resistivity and thermal conductivity.

  2. Observation of the Nuclear Magnetic Octupole Moment of 137Ba+

    Science.gov (United States)

    Hoffman, Matthew

    Single trapped ions are ideal systems in which to test atomic physics at high precision, which can in turn be used for searches for violations of fundamental symmetries and physics beyond the standard model, in addition to quantum computation and a number of other applications. The ion is confined in ultra-high vacuum, is laser cooled to mK temperatures, and kept well isolated from the environment which allows these experimental efforts. In this thesis, a few diagnostic techniques will be discussed, covering a method to measure the linewidth of a narrowband laser in the presence of magnetic field noise, as well as a procedure to measure the ion's temperature using such a narrowband laser. This work has led to two precision experiments to measure atomic structure in 138Ba+, and 137Ba+ discussed here. First, employing laser and radio frequency spectroscopy techniques in 138Ba+, we measured the Lande- gJ factor of the 5D5/2 level at the part-per-million level, the highest precision to date. Later, the development of apparatus to efficiently trap and laser cool 137Ba+ has enabled a measurement of the hyperfine splittings of the 5D3/2 manifold, culminating in the observation of the nuclear magnetic octupole moment of 137Ba+.

  3. LaBaNiO{sub 4}: a Fermi glass

    Energy Technology Data Exchange (ETDEWEB)

    Schilling, A; Dell' Amore, R; Mueller, K A [Physics Institute of the Universitaet of Zuerich, Winterthurerstrasse 190, CH-8057 Zuerich (Switzerland); Karpinski, J; Bukowski, Z [Laboratory for Solid-State Physics, ETH Zuerich HPF F-7, CH-8093 Zuerich (Switzerland); Medarde, M; Pomjakushina, E [Laboratory for Neutron Scattering, ETHZ and PSI, CH-5232 Villigen PSI (Switzerland)], E-mail: schilling@physik.uzh.ch

    2009-01-07

    Polycrystalline samples of LaSr{sub 1-x}Ba{sub x}NiO{sub 4} show a crossover from a state with metallic transport properties for x = 0 to an insulating state as x{yields}1. The end member LaBaNiO{sub 4} with a nominal nickel Ni 3d{sup 7} configuration might therefore be regarded as a candidate for an antiferromagnetic insulator. However, we do not observe any magnetic ordering in LaBaNiO{sub 4} down to 1.5 K, and despite its insulating transport properties several other physical properties of LaBaNiO{sub 4} resemble those of metallic LaSrNiO{sub 4}. Based on an analysis of electrical and thermal-conductivity data as well as magnetic-susceptibility and low-temperature specific-heat measurements, we suggest that LaBaNiO{sub 4} is a Fermi glass with a finite electron density of states at the Fermi level but these states are localized.

  4. Tikumu vienība Platona sokratiskajos dialogos

    OpenAIRE

    Skvireckis, Eduards

    2010-01-01

    Bakalaura darbā „Tikumu vienība Platona sokratiskajos dialogos” tiek skatīts viens no Sokrata paradoksiem – kā ir iespējams, ka individuālie tikumi (vīrišķība, taisnīgums, mērenība, dievbijība un saprātība) ir vienlaicīgi nošķirti viens no otra un katru tikumu veido viena un tā pati lieta – morālā zināšana. Šī problēma vistiešāk atklājas divos Platona dialogos, Protagorā un Lahētā, līdz ar to tie tika izmantoti kā pamats šajā darbā veiktajai analīzei. Darbā tika pierādīts, ka starp tiem ir ie...

  5. Aspectos morfológicos e funcionais dos autoimplantes esplênicos em ratos tratados com oxigenio hiperbárico

    Directory of Open Access Journals (Sweden)

    Isabel Cristina Andreatta Lemos Paulo

    Full Text Available OBJETIVO: Estudar aspectos morfológicos e funcionais dos autoimplantes esplênicos de ratos submetidos ou não à oxigenioterapia hiperbárica (OHB. MÉTODOS: Foram estudados em dois períodos distintos 105 ratos Wistar. No período mediato (n= 56 os animais foram avaliados até o 11º dia de pós-operatório, e no período tardio (n= 49, até o 70º dia. Em cada período os ratos foram distribuídos nos grupos: A- Simulação, B- Autoimplante esplênico, tratados com oxigênio hiperbárico ou não. Nos animais do Grupo A realizou-se apenas manipulação do baço. Nos animais do Grupo B realizou-se esplenectomia total e a seguir quatro fragmentos do baço foram implantados no grande omento. Em todos os animais foram dosados os lípides e imunoglobulinas e contadas as plaquetas e os corpúsculos de Howell-Jolly no pré-operatório e no 11º ou 70º dia de pós-operatório. O baço dos animais do Grupo A e os autoimplantes dos animais do Grupo B foram retirados e enviados para avaliação morfológica. RESULTADOS: No grupo B11nt houve aumento do colesterol total, LDL-colesterol, VLDL-colesterol e triglicérides. No grupo B70nt houve aumento do colesterol total e LDL-colesterol. Nos grupos tratados não houve alterações lipídicas. A IgM caiu nos grupos B e não alterou nos grupos A. Os corpúsculos de Howell - Jolly foram menos freqüentes nos grupos Bt que nos grupos Bnt. As plaquetas aumentaram nos grupos B11t e B11nt e não se alteraram nos demais grupos. A viabilidade microscópica dos grupos Bt foi melhor que a dos grupos Bnt. CONCLUSÃO: Os autoimplantes esplênicos dos animais tratados com OHB apresentaram melhor função e viabilidade do que os autoimplantes dos animais não tratados.

  6. Comparacion de metodos para el diseno arquitectonico del software que consideran las orientaciones de metas y aspectos

    National Research Council Canada - National Science Library

    Guzman, Jean Carlos; Losavio, Francisca; Matteo, Alfredo

    2013-01-01

    Se presenta como objetivo realizar un marco de comparacion aplicado a metodos de diseno arquitectonico del software que incorporen metas, aspectos o estandares de calidad para especificar Requisitos...

  7. Synthesis of BaTiO3 nanoparticles from TiO2-coated BaCO3 particles derived using a wet-chemical method

    Directory of Open Access Journals (Sweden)

    Yuuki Mochizuki

    2014-03-01

    Full Text Available BaCO3 particles coated with amorphous TiO2 precursor are prepared by a wet chemical method to produce BaTiO3 nanoparticles at low temperatures. Subsequently, we investigate the formation behavior of BaTiO3 particles and the particle growth behavior when the precursor is subjected to heat treatment. The state of the amorphous TiO2 coating on the surface of BaCO3 particles depends on the concentration of NH4HCO3, and the optimum concentration is found to be in the range 0.5–1.0 M. Thermogravimetric curves of the BaCO3 particles coated with the TiO2 precursor, prepared from BaCO3 particles of various sizes, show BaTiO3 formation occurring mainly at 550–650 °C in the case of fine BaCO3 particles. However, as evidenced from the curves, the temperature of formation of BaTiO3 shifts to higher values with an increase in the size of the BaCO3 particles. The average particle size of single phase BaTiO3 at heat-treatment temperature of 650–900 °C is observed to be in the range 60–250 nm.

  8. Aspectos subjetivos relacionados con la violencia intrafamiliar. Caso municipio de Sabaneta Antioquia

    Directory of Open Access Journals (Sweden)

    Naidalis Yadira Martínez

    2016-01-01

    Full Text Available El artículo identifica las interacciones en aspectos familiares y subjetivos. En el artículo se desarrollan los aspectos subjetivos de las dinámicas familiares que justifican el uso y la implementación de la violencia intrafamiliar, se da cuenta de la naturalización de la violencia intrafamiliar en la interacción de los grupos familiares, convirtiéndola en un elemento de la relación que se establece entre los miembros de la familia. En el análisis realizado se identifican aspectos coyunturales asociados a situaciones que se vivieron en la dinámica de la familia de origen, pero que al momento han sido pocas las condiciones que permiten la modi- ficación de estas conductas ya que las familias han asumido estas expresiones de violencia intrafamiliar como parte de sus vidas.

  9. O exercício físico e os aspectos psicobiológicos

    OpenAIRE

    Mello,Marco Túlio de; Boscolo,Rita Aurélia; Esteves,Andrea Maculano; Tufik,Sergio

    2005-01-01

    O objetivo desta revisão é trazer parte dos estudos sobre um assunto pouco explorado: a relação entre o exercício físico e os aspectos psicobiológicos. A importância da compreensão desses aspectos e como eles afetam a qualidade de vida do ser humano é o que estimula as pesquisas sobre esse assunto. A literatura destaca que a prática regular de exercício físico traz resultados positivos não somente ao sono e aos seus possíveis distúrbios, mas também aos aspectos psicológicos e aos transtornos ...

  10. Epitaxial growth of Fe/BaTiO3 heterostructures

    Energy Technology Data Exchange (ETDEWEB)

    Brivio, S., E-mail: m.gooley@elsevier.com [LNESS, Dipartimento di Fisica, Politecnico di Milano, via Anzani 42, 22100, Como (Italy); Rinaldi, C.; Petti, D.; Bertacco, R. [LNESS, Dipartimento di Fisica, Politecnico di Milano, via Anzani 42, 22100, Como (Italy); Sanchez, F. [Institut de Ciencia de Materials de Barcelona, Consejo Superior de Investigaciones Cientificas, Campus Universitat Autonoma de Barcelona, Bellaterra 08193, Catalunya (Spain)

    2011-06-30

    The realization of epitaxial heterostructures involving ferroelectric (FE) and ferromagnetic (FM) materials is one of the possible routes towards the realization of devices exploiting sizable magnetoelectric effects. In this paper we demonstrate the epitaxial growth of Fe on BaTiO{sub 3}(001) as this system represents a prototypical example of interface between well known FE and FM materials with bcc and perovskite structure respectively, both with Curie temperature well above 300 K. Fe grows on BaTiO{sub 3} with 45 deg. rotation of its cubic lattice with respect to that of the substrate in order to reduce the lattice mismatch. Negligible interdiffusion of Ba and Ti cations or Fe atoms is found by X-ray photoemission spectroscopy, while a sizable Fe oxidation occurs within an interfacial layer with thicknesses thinner than 3 nm.

  11. The BaBar instrumented flux return performance: lessons learned

    CERN Document Server

    Anulli, F; Baldini, R; Band, H R; Bionta, R; Brau, J E; Brigljevic, V; Buzzo, A; Calcaterra, A; Carpinelli, M; Cartaro, C; Cavallo, N; Crosetti, G; De Nardo, Gallieno; De Sangro, R; Eichenbaum, A; Fabozzi, F; Falciai, D; Ferrarotto, F; Ferroni, F; Finocchiaro, G; Forti, F; Frey, R; Gatto, C; Graug; Iakovlev, N I; Iwasaki, M; Johnson, J R; Lange, D J; Lista, L; Lo Vetere, M; Lü, C; Macri, M; Messner, R; Moore, T B; Morganti, S; Neal, H; Neri, N; Palano, A; Paoloni, E; Paolucci, P; Passaggio, S; Pastore, F C; Patteri, P; Peruzzi, I; Piccolo, D; Piccolo, M; Piredda, G; Robutti, E; Roodman, A; Santroni, A; Sciacca, C; Sinev, N B; Soha, A; Strom, D; Tosi, S; Vavra, J; Wisniewski, W J; Wright, D M; Xie, Y; Zallo, A

    2002-01-01

    The BaBar Collaboration has operated an instrumented flux return (IFR) system covering over 2000 m sup 2 with resistive plate chambers (RPCs) for nearly 3 years. The chambers are constructed of bakelite sheets separated by 2 mm. The inner surfaces are coated with linseed oil. This system provides muon and neutral hadron detection for BaBar. Installation and commissioning were completed in 1998, and operation began mid-year 1999. While initial performance of the system reached design, over time, a significant fraction of the RPCs demonstrated significant degradation, marked by increased currents and reduced efficiency. A coordinated effort of investigations have identified many of the elements responsible for the degradation. This article presents our current understanding of the aging process of the BaBar RPCs along with the action plan to combat performance degradation of the IFR system.

  12. Bi3+ Luminescence in ABiO2Cl (A = Sr, Ba) and BaBiO2Br

    Energy Technology Data Exchange (ETDEWEB)

    Porter-Chapman, Yetta D.; Bourret-Courchesne, Edith E.; Derenzo,Stephen E.

    2007-01-18

    Trivalent bismuth luminescence is reported in three Sillenbismuth oxyhalide phases, SrBiO2Cl, BaBiO2Cl, and BaBiO2Br. Thesecompounds exhibit Bi 6s6->6 s2 emission under UV and X-ray radiation.At room temperature, BaBiO2Cl shows the most intense light emission, withspectral and decay properties similar to those found in Bi4Ge3O12 (BGO).At low temperatures, each phase show an increase in the photoluminescenceintensities and a narrowing of the emission peaks. In contrast to thetemperature dependence of BGO, X-ray excited luminescence intensities ofall three phases remain relatively constant throughout the temperaturerange 10 - 295 K. This result indicates that the Sillen phases undergoless thermal quenching than BGO. The low temperature and room temperatureradio-luminescence decay times were determined from pulsed x-raymeasurements. At room temperature, SrBiO2Cl exhibits faster decays thanBGO, while, BaBiO2Cl and BaBiO2Br have decay times similar toBGO.

  13. Aspectos psicosociales del embarazo en la adolescencia, año 2000

    OpenAIRE

    Elena Ávila Gálvez; Maylén Cid Santana; Ileana García Imia; Antonio Lorenzo González; Pablo Rodríguez

    2002-01-01

    Se realizó un estudio explicativo-observacional, de tipo estudio de casos y controles, en adolescentes entre 10 y 19 años, del sexo femenino, provenientes del Policlínico Docente "Wilfredo Pérez Pérez", en el año 2000, compartidos en 2 grupos: el estudio, con 53 casos que se embarazaron, y el control con 106 adolescentes que no lo hicieron. Se compararon diferentes aspectos de la sexualidad, esfera familiar y sociodemográficos, con el fin de determinar la influencia de algunos aspectos psicos...

  14. ASPECTOS E IMPACTOS AMBIENTAIS DE UM LABORATÓRIO DE BIOLOGIA

    OpenAIRE

    Jaísa Marília dos Santos Mendonça Oliveira; Robson Garcia Silva

    2016-01-01

    O presente trabalho tem como objetivo avaliar os aspectos e impactos ambientais de um laboratório de Biologia do IFRN Campus Natal Central (CNAT). A pesquisa é do tipo exploratória e descritiva, na qual foram adotados como procedimentos as pesquisas bibliográfica e documental e o estudo caso. Para avaliação de aspectos e impactos do laboratório foi adotado o método de Análise dos Modos e Efeitos das Falhas (FMEA). Como resultados constatou-se que nos doze processos do laboratório há oito tipo...

  15. The Danish Microbiology Database (MiBa) 2010 to 2013

    DEFF Research Database (Denmark)

    Voldstedlund, M; Haarh, M; Mølbak, Kaare

    2014-01-01

    The Danish Microbiology Database (MiBa) is a national database that receives copies of reports from all Danish departments of clinical microbiology. The database was launched in order to provide healthcare personnel with nationwide access to microbiology reports and to enable real-time surveillance...... of communicable diseases and microorganisms. The establishment and management of MiBa has been a collaborative process among stakeholders, and the present paper summarises lessons learned from this nationwide endeavour which may be relevant to similar projects in the rapidly changing landscape of health...

  16. Isovector states in /sup 128-134/Ba

    Energy Technology Data Exchange (ETDEWEB)

    Harter, H.; Lipas, P.O.; Nojarov, R.; Taigel, T.; Faessler, A.

    1988-04-28

    Phenomenological IBA-2 and microscopic QRPA are applied to predict isovector, or mixed-symmetry, states in /sup 128-134/Ba. The lowest 1/sup +/ state is found at 2.6-3.2 MeV with B(M1)arrow up approx. = 0.1-0.4 ..mu../sub N//sup 2/. IBA predictions are also given for the lowest mixed 2/sup +/ state at 2.2-2.7 MeV. A very strong (up to 5 ..mu../sub N//sup 2/) 1/sup +/ doublet is predicted (QRPA) at 4.7 MeV in /sup 130-134/Ba.

  17. The Danish Microbiology Database (MiBa) 2010 to 2013.

    Science.gov (United States)

    Voldstedlund, M; Haarh, M; Mølbak, K

    2014-01-09

    The Danish Microbiology Database (MiBa) is a national database that receives copies of reports from all Danish departments of clinical microbiology. The database was launched in order to provide healthcare personnel with nationwide access to microbiology reports and to enable real-time surveillance of communicable diseases and microorganisms. The establishment and management of MiBa has been a collaborative process among stakeholders, and the present paper summarises lessons learned from this nationwide endeavour which may be relevant to similar projects in the rapidly changing landscape of health informatics.

  18. Development of BaSO sub 4 :Eu thermoluminescence phosphor

    CERN Document Server

    Madhusoodanan, U; Lakshmanan, A R

    1999-01-01

    A highly sensitive thermoluminescence (TL) phosphor based on BaSO sub 4 :Eu was developed following the coprecipitation technique and firing in argon atmosphere at 1123 K. Photoluminescence studies confirm that firing in argon atmosphere instead of air increased the incorporation of Eu ions in 2+ valence state. At low gamma-ray doses, its TL sensitivity is nearly 2 to 3 times higher than that of CaSO sub 4 :Dy phosphor. The other salient features of this BaSO sub 4 :Eu TL phosphor are a constant glow curve shape and a nearly linear gamma-ray dose response.

  19. Results on conventional and exotic charmonium at BaBar

    CERN Document Server

    Bernard, Denis

    2013-01-01

    The B factories provide a unique playground for studying the properties of conventional and exotic charmonium states. We present recent results in initial state radiation and two-photon fusion, obtained using the full data set collected by the BaBar experiment. Amongst BaBar 's harvest presented in this talk, the determination of the quantum numbers of the X(3915) resonance, a body of concording evidence pointing to JPC = 1++ for the X(3872), and updates on the family of the Y resonance to the full integrated luminosity.

  20. ANÁLISE SOCIOAMBIENTAL DAS TRANSFORMAÇÕES DA PAISAGEM A PARTIR DA EXPLORAÇÃO DE RECURSOS MINERAIS

    Directory of Open Access Journals (Sweden)

    Polliana Bezerra Oliveira

    2014-10-01

    Full Text Available A compreensão do espaço geográfico segundo os aspectos social e natural desafia as pesquisas e de igual modo valoriza a Geografia na medida em que o avanço do sistema econômico capitalista traz consigo mudanças nas relações sociais, ambientais, políticas e científicas influenciando a reorganização do espaço. Nesse sentido, o presente estudo busca estabelecer uma discussão acerca das transformações na paisagem a partir de empreendimentos mineradores e como esta exploração reflete na materialidade das questões socioambientais da contemporaneidade. Uma discussão que tem como elemento central a explotação de Urânio no Município de Caetité (BA implementada pelas Indústrias Nucleares do Brasil (INB, empresa mista, vinculada à Comissão Nacional de Energia Nuclear (CNEN e subordinada ao Ministério da Ciência e Tecnologia encarregada, de promover, no país, a exploração do Urânio, da mineração à fabricação do combustível que gera energia elétrica nas usinas nucleares.

  1. Temas em Direitos Humanos de uma organização da Paraíba e o master frames de Direitos Humanos

    Directory of Open Access Journals (Sweden)

    Arlene Martinez Ricoldi

    2012-01-01

    Full Text Available Utilizando-se do conceito de frames, o artigo procura delimitar um master frames de direitos humanos entre organizações não governamentais brasileiras que orienta ações e ativismo destas. Analisa-se particularmente a atuação da Fundação Margarida Maria Alves, sediada em João Pessoa, na Paraíba, utilizando principalmente os boletins informativos editados pela organização. O exame de sua trajetória e frames master ilumina aspectos da construção de um master frames de direitos humanos no Brasil.Using the frames approach, the paper attempts to outline a human rights master frames in force among nongovernmental organizations in Brazil that guides its actions and activism. This article examines in particular the work of the Margarida Maria Alves Foundation, based in João Pessoa, Paraíba, using mainly the newsletters published by the organization. The examination of its trajectory and organizationalframes master illuminates aspects concerning building a human rights master frames in Brazil.

  2. INDIOS PURIS E GOITACAZES ANÁLISE SOBRE A PRESENÇA INDÍGENA NA SERRA DA MANTIQUEIRA E VALE DO PARAÍBA

    Directory of Open Access Journals (Sweden)

    Maurício de Souza Lino

    2017-05-01

    Full Text Available Esse texto tem como objetivo analisar a presença dos índios Puris e Goitacazes na região do Vale do Paraíba e da Serra da Mantiqueira do século XVII ao XVIII, partindo da corrida do ouro. Analisa um recorte bibliográfico específico proveniente da historiografia, antropologia e relatos de viajantes que registram a passagem de grupos indígenas percorrendo a região. Busca-se identificar e investigar sobre a presença destes grupos no Vale do Paraíba e Serra da Mantiqueira. Procura evidenciar aspectos de sua cultura, bem como a análise dos nomes atuais de algumas localidades. Para responder ao questionamento de como surgiu essa presença indígena na região, a presente pesquisa parte da hipótese de que a evidência está associada ao desbravamento e exploração da região pelos exploradores e bandeirantes do Brasil e exterior.

  3. Punta Pitt, Galapagos Ba/Ca Data for 1963-1982

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — File contains Ba/Ca data (in mmol/mol) presented by Lea et al. (1989). Samples were measured at the Massachusetts Institute of Technology by D. Lea. Ba...

  4. Growth and characterization of acentric BaHf(BO{sub 3}){sub 2} and BaZr(BO{sub 3}){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Mączka, Mirosław, E-mail: m.maczka@int.pan.wroc.pl [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wrocław 2 (Poland); Szymborska-Małek, Katarzyna; Gągor, Anna [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wrocław 2 (Poland); Majchrowski, Andrzej [Institute of Applied Physics, Military University of Technology, 2 Kaliskiego Str., 00-908 Warszawa (Poland)

    2015-05-15

    Growth, single crystal X-ray diffraction, polarized Raman and infrared (IR) studies of BaHf(BO{sub 3}){sub 2} are presented. Raman and IR spectra of polycrystalline BaZr(BO{sub 3}){sub 2} are also reported to facilitate assignment of modes. BaHf(BO{sub 3}){sub 2} borate crystallizes in trigonal system, space group R3c, with lattice parameters: a=5.1540(4) Å, c=33.901(3) Å. It accommodates dolomite-like structure doubled in the c direction, which is built of alternating layers of HfO{sub 6} octahedra and BaO{sub 6} distorted trigonal prisms that are connected through borate groups. The obtained structural as well as spectroscopic data show that BaHf(BO{sub 3}){sub 2} is isostructural with BaZr(BO{sub 3}){sub 2} and the deviations from centrosymmetry is small. - Graphical abstract: Arrangement of BO{sub 3} groups in BaHf(BO{sub 3}){sub 2} along the c direction in one unit cell. Dark and light blue denote different borate groups. - Highlights: • BaHf(BO{sub 3}){sub 2} single crystals were grown. • X-ray diffraction showed that this borate crystallizes in the acentric R3c structure. • Raman and IR spectra were measured for BaHf(BO{sub 3}){sub 2} and BaZr(BO{sub 3}){sub 2}, respectively. • Assignment of modes is proposed.

  5. Barium stable isotopes in the global ocean: Tracer of Ba inputs and utilization

    Science.gov (United States)

    Hsieh, Yu-Te; Henderson, Gideon M.

    2017-09-01

    Barium has been used as a biogeochemical tracer for alkalinity, productivity, and riverine inputs in the ocean, but its oceanic cycle remains poorly constrained. Barium stable isotope measurements may improve the use of Ba as a tracer and better constrain the cycling of Ba, but data are only available in limited regions of the oceans. In this study, we present dissolved seawater Ba isotopic compositions in a sample collection spanning the North Atlantic, South Atlantic, North Pacific and Southern Oceans. Compiled global upper-ocean [Ba] data show a relatively constant [Ba] (35-45 nM) in the near-surface waters throughout the global ocean, with the exception of areas near river inputs or strong upwelling. The relatively uniform distribution of [Ba] in the upper ocean seawater indicates that Ba removal is slow relative to supply and mixing, and implies that near-surface Ba isotope values are controlled by basin-scale balances rather than by regional or short-term processes. Seawater Ba isotopic compositions show a large variation of δ 138 / 134 Ba values ranging from 0.24 to 0.65‰, and a tight relationship with [Ba]. This global relationship can be simply modelled assuming a primary deep Southern Ocean source for Ba to yield a maximum isotope fractionation of α = 1.00058 ± 0.00010 (α =seawater 138/134Ba/particle 138/134Ba). This suggested isotope fractionation during Ba removal from seawater is larger than implied by laboratory measurement during barite formation, suggesting additional fractionating phases or a two-stage fractionation process. Riverine input from the Rio de la Plata to the South Atlantic has a signature of δ 138 / 134 Ba = - 0.06- 0.11 ‰, which is too light to explain the heavy values (>0.58‰) observed in the surface open ocean. Globally, the Ba isotope composition of the upper ocean waters is correlated with the fraction of Ba utilization at the basin scale (which varies from <15 to 70% at sites studied here). In the deep Atlantic Ocean

  6. De BaSO-fiche: een artefact in actie

    NARCIS (Netherlands)

    März, V.; Vermeir, K.; Kelchtermans, G.

    2014-01-01

    Via onderwijsvernieuwingen wil men de praktijk van onderwijzen en leren verbeteren. Die vernieuwingen worden ook ondersteund door artefacten zoals een nieuw schoolboek, een stappenplan of een fiche. Aan de hand van de implementatie van de BaSO-fiche in twee basis- en twee secundaire scholen wordt

  7. The BaBar detector: Upgrades, operation and performance

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.; Barate, R.; Boutigny, D.; Couderc, F.; del Amo Sanchez, P.; Gaillard, J. -M.; Hicheur, A.; Karyotakis, Y.; Lees, J. P.; Poireau, V.; Prudent, X.; Robbe, P.; Tisserand, V.; Zghiche, A.; Grauges, E.; Garra Tico, J.; Lopez, L.; Martinelli, M.; Palano, A.; Pappagallo, M.; Pompili, A.; Chen, G. P.; Chen, J. C.; Qi, N. D.; Rong, G.; Wang, P.; Zhu, Y. S.; Eigen, G.; Stugu, B.; Sun, L.; Abrams, G. S.; Battaglia, M.; Borgland, A. W.; Breon, A. B.; Brown, D. N.; Button-Shafer, J.; Cahn, R. N.; Charles, E.; Clark, A. R.; Day, C. T.; Furman, M.; Gill, M. S.; Groysman, Y.; Jacobsen, R. G.; Kadel, R. W.; Kadyk, J. A.; Kerth, L. T.; Kolomensky, Yu. G.; Kral, J. F.; Kukartsev, G.; LeClerc, C.; Levi, M. E.; Lynch, G.; Merchant, A. M.; Mir, L. M.; Oddone, P. J.; Orimoto, T. J.; Osipenkov, I. L.; Pripstein, M.; Roe, N. A.; Romosan, A.; Ronan, M. T.; Shelkov, V. G.; Suzuki, A.; Tackmann, K.; Tanabe, T.; Wenzel, W. A.; Zisman, M.; Barrett, M.; Bright-Thomas, P. G.; Ford, K. E.; Harrison, T. J.; Hart, A. J.; Hawkes, C. M.; Knowles, D. J.; Morgan, S. E.; O' Neale, S. W.; Penny, R. C.; Smith, D.; Soni, N.; Watson, A. T.; Watson, N. K.; Goetzen, K.; Held, T.; Koch, H.; Kunze, M.; Lewandowski, B.; Pelizaeus, M.; Peters, K.; Schmuecker, H.; Schroeder, T.; Steinke, M.; Fella, A.; Antonioli, E.; Boyd, J. T.; Chevalier, N.; Cottingham, W. N.; Foster, B.; Mackay, C.; Walker, D.; Abe, K.; Asgeirsson, D. J.; Cuhadar-Donszelmann, T.; Fulsom, B. G.; Hearty, C.; Knecht, N. S.; Mattison, T. S.; McKenna, J. A.; Thiessen, D.; Khan, A.; Kyberd, P.; McKemey, A. K.; Randle-Conde, A.; Saleem, M.; Sherwood, D. J.; Teodorescu, L.; Blinov, V. E.; Bukin, A. D.; Buzykaev, A. R.; Druzhinin, V. P.; Golubev, V. B.; Korol, A. A.; Kravchenko, E. A.; Onuchin, A. P.; Serednyakov, S. I.; Skovpen, Yu. I.; Solodov, E. P.; Telnov, V. I.; Todyshev, K. Yu.; Yushkov, A. N.; Best, D. S.; Bondioli, M.; Bruinsma, M.; Chao, M.; Curry, S.; Eschrich, I.; Kirkby, D.; Lankford, A. J.; Mandelkern, M.; Martin, E. C.; McMahon, S.; Mommsen, R. K.; Stoker, D. P.; Abachi, S.; Buchanan, C.; Hartfiel, B. L.; Weinstein, A. J. R.; Atmacan, H.; Foulkes, S. D.; Gary, J. W.; Layter, J.; Liu, F.; Long, O.; Shen, B. C.; Vitug, G. M.; Wang, K.; Yasin, Z.; Zhang, L.; Hadavand, H. K.; Hill, E. J.; Paar, H. P.; Rahatlou, S.; Schwanke, U.; Sharma, V.; Berryhill, J. W.; Campagnari, C.; Cunha, A.; Dahmes, B.; Hong, T. M.; Kovalskyi, D.; Kuznetsova, N.; Levy, S. L.; Lu, A.; Mazur, M. A.; Richman, J. D.; Verkerke, W.; Beck, T. W.; Beringer, J.; Eisner, A. M.; Flacco, C. J.; Grillo, A. A.; Grothe, M.; Heusch, C. A.; Kroseberg, J.; Lockman, W. S.; Martinez, A. J.; Nesom, G.; Schalk, T.; Schmitz, R. E.; Schumm, B. A.; Seiden, A.; Spencer, E.; Spradlin, P.; Turri, M.; Walkowiak, W.; Wang, L.; Wilder, M.; Williams, D. C.; Wilson, M. G.; Winstrom, L. O.; Chen, E.; Cheng, C. H.; Doll, D. A.; Dorsten, M. P.; Dvoretskii, A.; Echenard, B.; Erwin, R. J.; Fang, F.; Flood, K.; Hitlin, D. G.; Metzler, S.; Narsky, I.; Oyang, J.; Piatenko, T.; Porter, F. C.; Ryd, A.; Samuel, A.; Yang, S.; Zhu, R. Y.; Andreassen, R.; Devmal, S.; Geld, T. L.; Jayatilleke, S.; Mancinelli, G.; Meadows, B. T.; Mishra, K.; Sokoloff, M. D.; Abe, T.; Antillon, E. A.; Barillari, T.; Becker, J.; Blanc, F.; Bloom, P. C.; Chen, S.; Clifton, Z. C.; Derrington, I. M.; Destree, J.; Dima, M. O.; Ford, W. T.; Gaz, A.; Gilman, J. D.; Hachtel, J.; Hirschauer, J. F.; Johnson, D. R.; Kreisel, A.; Nagel, M.; Nauenberg, U.; Olivas, A.; Rankin, P.; Roy, J.; Ruddick, W. O.; Smith, J. G.; Ulmer, K. A.; van Hoek, W. C.; Wagner, S. R.; West, C. G.; Zhang, J.; Ayad, R.; Blouw, J.; Chen, A.; Eckhart, E. A.; Harton, J. L.; Hu, T.; Toki, W. H.; Wilson, R. J.; Winklmeier, F.; Zeng, Q. L.; Altenburg, D.; Feltresi, E.; Hauke, A.; Jasper, H.; Karbach, M.; Merkel, J.; Petzold, A.; Spaan, B.; Wacker, K.; Brandt, T.; Brose, J.; Colberg, T.; Dahlinger, G.; Dickopp, M.; Eckstein, P.; Futterschneider, H.; Kaiser, S.; Kobel, M. J.; Krause, R.; Müller-Pfefferkorn, R.; Mader, W. F.; Maly, E.; Nogowski, R.; Otto, S.; Schubert, J.; Schubert, K. R.; Schwierz, R.; Sundermann, J. E.; Volk, A.; Wilden, L.; Bernard, D.; Brochard, F.; Cohen-Tanugi, J.; Dohou, F.; Ferrag, S.; Latour, E.; Mathieu, A.; Renard, C.; Schrenk, S.; T' Jampens, S.; Thiebaux, Ch.; Vasileiadis, G.; Verderi, M.; Anjomshoaa, A.; Bernet, R.; Clark, P. J.; Lavin, D. R.; Muheim, F.; Playfer, S.; Robertson, A. I.; Swain, J. E.; Watson, J. E.; Xie, Y.; Andreotti, D.; Andreotti, M.; Bettoni, D.; Bozzi, C.; Calabrese, R.; Carassiti, V.; Cecchi, A.; Cibinetto, G.; Cotta Ramusino, A.; Evangelisti, F.; Fioravanti, E.; Franchini, P.; Garzia, I.; Landi, L.; Luppi, E.; Malaguti, R.; Negrini, M.; Padoan, C.; Petrella, A.; Piemontese, L.; Santoro, V.; Sarti, A.; Anulli, F.; Baldini-Ferroli, R.; Calcaterra, A.; Finocchiaro, G.; Pacetti, S.; Patteri, P.; Peruzzi, I. M.; Piccolo, M.; Rama, M.; de Sangro, R.; Santoni, M.; Zallo, A.; Bagnasco, S.; Buzzo, A.; Capra, R.; Contri, R.; Crosetti, G.; Lo Vetere, M.; Macri, M. M.; Minutoli, S.; Monge, M. R.; Musico, P.; Passaggio, S.; Pastore, F. C.; Patrignani, C.; Pia, M. G.; Robutti, E.; Santroni, A.; Tosi, S.; Bhuyan, B.; Prasad, V.; Bailey, S.; Brandenburg, G.; Chaisanguanthum, K. S.; Lee, C. L.; Morii, M.; Won, E.; Wu, J.; Adametz, A.; Dubitzky, R. S.; Marks, J.; Schenk, S.; Uwer, U.; Klose, V.; Lacker, H. M.; Aspinwall, M. L.; Bhimji, W.; Bowerman, D. A.; Dauncey, P. D.; Egede, U.; Flack, R. L.; Gaillard, J. R.; Gunawardane, N. J. W.; Morton, G. W.; Nash, J. A.; Nikolich, M. B.; Panduro Vazquez, W.; Sanders, P.; Smith, D.; Taylor, G. P.; Tibbetts, M.; Behera, P. K.; Chai, X.; Charles, M. J.; Grenier, G. J.; Hamilton, R.; Lee, S. -J.; Mallik, U.; Meyer, N. T.; Chen, C.; Cochran, J.; Crawley, H. B.; Dong, L.; Eyges, V.; Fischer, P. -A.; Lamsa, J.; Meyer, W. T.; Prell, S.; Rosenberg, E. I.; Rubin, A. E.; Gao, Y. Y.; Gritsan, A. V.; Guo, Z. J.; Lae, C. K.; Schott, G.; Albert, J. N.; Arnaud, N.; Beigbeder, C.; Breton, D.; Davier, M.; Derkach, D.; Dû, S.; Firmino da Costa, J.; Grosdidier, G.; Höcker, A.; Laplace, S.; Le Diberder, F.; Lepeltier, V.; Lutz, A. M.; Malaescu, B.; Nief, J. Y.; Petersen, T. C.; Plaszczynski, S.; Pruvot, S.; Roudeau, P.; Schune, M. H.; Serrano, J.; Sordini, V.; Stocchi, A.; Tocut, V.; Trincaz-Duvoid, S.; Wang, L. L.; Wormser, G.; Bionta, R. M.; Brigljević, V.; Lange, D. J.; Simani, M. C.; Wright, D. M.; Bingham, I.; Burke, J. P.; Chavez, C. A.; Coleman, J. P.; Forster, I. J.; Fry, J. R.; Gabathuler, E.; Gamet, R.; George, M.; Hutchcroft, D. E.; Kay, M.; Parry, R. J.; Payne, D. J.; Schofield, K. C.; Sloane, R. J.; Touramanis, C.; Azzopardi, D. E.; Bellodi, G.; Bevan, A. J.; Clarke, C. K.; Cormack, C. M.; Di Lodovico, F.; Dixon, P.; George, K. A.; Menges, W.; Potter, R. J. L.; Sacco, R.; Shorthouse, H. W.; Sigamani, M.; Strother, P.; Vidal, P. B.; Brown, C. L.; Cowan, G.; Flaecher, H. U.; George, S.; Green, M. G.; Hopkins, D. A.; Jackson, P. S.; Kurup, A.; Marker, C. E.; McGrath, P.; McMahon, T. R.; Paramesvaran, S.; Salvatore, F.; Vaitsas, G.; Winter, M. A.; Wren, A. C.; Brown, D. N.; Davis, C. L.; Denig, A. G.; Fritsch, M.; Gradl, W.; Griessinger, K.; Hafner, A.; Prencipe, E.; Allison, J.; Alwyn, K. E.; Bailey, D. S.; Barlow, N. R.; Barlow, R. J.; Chia, Y. M.; Edgar, C. L.; Forti, A. C.; Fullwood, J.; Hart, P. A.; Hodgkinson, M. C.; Jackson, F.; Jackson, G.; Kelly, M. P.; Kolya, S. D.; Lafferty, G. D.; Lyon, A. J.; Naisbit, M. T.; Savvas, N.; Weatherall, J. H.; West, T. J.; Williams, J. C.; Yi, J. I.; Anderson, J.; Farbin, A.; Hulsbergen, W. D.; Jawahery, A.; Lillard, V.; Roberts, D. A.; Schieck, J. R.; Simi, G.; Tuggle, J. M.; Blaylock, G.; Dallapiccola, C.; Hertzbach, S. S.; Kofler, R.; Koptchev, V. B.; Li, X.; Moore, T. B.; Salvati, E.; Saremi, S.; Staengle, H.; Willocq, S. Y.; Cowan, R.; Dujmic, D.; Fisher, P. H.; Henderson, S. W.; Koeneke, K.; Lang, M. I.; Sciolla, G.; Spitznagel, M.; Taylor, F.; Yamamoto, R. K.; Yi, M.; Zhao, M.; Zheng, Y.; Klemetti, M.; Lindemann, D.; Mangeol, D. J. J.; Mclachlin, S. E.; Milek, M.; Patel, P. M.; Robertson, S. H.; Biassoni, P.; Cerizza, G.; Lazzaro, A.; Lombardo, V.; Neri, N.; Palombo, F.; Pellegrini, R.; Stracka, S.; Bauer, J. M.; Cremaldi, L.; Eschenburg, V.; Kroeger, R.; Reidy, J.; Sanders, D. A.; Summers, D. J.; Zhao, H. W.; Godang, R.; Brunet, S.; Cote, D.; Nguyen, X.; Simard, M.; Taras, P.; Viaud, B.; Nicholson, H.; Cavallo, N.; De Nardo, G.; Fabozzi, F.; Gatto, C.; Lista, L.; Monorchio, D.; Onorato, G.; Paolucci, P.; Piccolo, D.; Sciacca, C.; Baak, M. A.; Raven, G.; Snoek, H. L.; Jessop, C. P.; Knoepfel, K. J.; LoSecco, J. M.; Wang, W. F.; Allmendinger, T.; Benelli, G.; Brau, B.; Corwin, L. A.; Gan, K. K.; Honscheid, K.; Hufnagel, D.; Kagan, H.; Kass, R.; Morris, J. P.; Rahimi, A. M.; Regensburger, J. J.; Smith, D. S.; Ter-Antonyan, R.; Wong, Q. K.; Blount, N. L.; Brau, J.; Frey, R.; Igonkina, O.; Iwasaki, M.; Kolb, J. A.; Lu, M.; Potter, C. T.; Rahmat, R.; Sinev, N. B.; Strom, D.; Strube, J.; Torrence, E.; Borsato, E.; Castelli, G.; Colecchia, F.; Crescente, A.; Dal Corso, F.; Dorigo, A.; Fanin, C.; Furano, F.; Gagliardi, N.; Galeazzi, F.; Margoni, M.; Marzolla, M.; Michelon, G.; Morandin, M.; Posocco, M.; Rotondo, M.; Simonetto, F.; Solagna, P.; Stevanato, E.; Stroili, R.; Tiozzo, G.; Voci, C.; Akar, S.; Bailly, P.; Ben-Haim, E.; Bonneaud, G.; Briand, H.; Chauveau, J.; Hamon, O.; John, M. J. J.; Lebbolo, H.; Leruste, Ph.; Malclès, J.; Marchiori, G.; Martin, L.; Ocariz, J.; Perez, A.; Pivk, M.; Prendki, J.; Roos, L.; Sitt, S.; Stark, J.; Thérin, G.; Vallereau, A.; Biasini, M.; Covarelli, R.; Manoni, E.; Pennazzi, S.; Pioppi, M.; Angelini, C.; Batignani, G.; Bettarini, S.; Bosi, F.; Bucci, F.; Calderini, G.; Carpinelli, M.; Cenci, R.; Cervelli, A.; Forti, F.; Giorgi, M. A.; Lusiani, A.; Marchiori, G.; Morganti, M.; Morsani, F.; Paoloni, E.; Raffaelli, F.; Rizzo, G.; Sandrelli, F.; Triggiani, G.; Walsh, J. J.; Haire, M.; Judd, D.; Biesiada, J.; Danielson, N.; Elmer, P.; Fernholz, R. E.; Lau, Y. P.; Lu, C.; Miftakov, V.; Olsen, J.; Lopes Pegna, D.; Sands, W. R.; Smith, A. J. S.; Telnov, A. V.; Tumanov, A.; Varnes, E. W.; Baracchini, E.; Bellini, F.; Bulfon, C.; Buccheri, E.; Cavoto, G.; D' Orazio, A.; Di Marco, E.; Faccini, R.; Ferrarotto, F.; Ferroni, F.; Gaspero, M.; Jackson, P. D.; Lamanna, E.; Leonardi, E.; Li Gioi, L.; Lunadei, R.; Mazzoni, M. A.; Morganti, S.; Piredda, G.; Polci, F.; del Re, D.; Renga, F.; Safai Tehrani, F.; Serra, M.; Voena, C.; Bünger, C.; Christ, S.; Hartmann, T.; Leddig, T.; Schröder, H.; Wagner, G.; Waldi, R.; Adye, T.; Bly, M.; Brew, C.; Condurache, C.; De Groot, N.; Franek, B.; Geddes, N. I.; Gopal, G. P.; Olaiya, E. O.; Ricciardi, S.; Roethel, W.; Wilson, F. F.; Xella, S. M.; Aleksan, R.; Bourgeois, P.; Emery, S.; Escalier, M.; Esteve, L.; Gaidot, A.; Ganzhur, S. F.; Giraud, P. -F.; Georgette, Z.; Graziani, G.; Hamel de Monchenault, G.; Kozanecki, W.; Langer, M.; Legendre, M.; London, G. W.; Mayer, B.; Micout, P.; Serfass, B.; Vasseur, G.; Yèche, Ch.; Zito, M.; Allen, M. T.; Akre, R.; Aston, D.; Azemoon, T.; Bard, D. J.; Bartelt, J.; Bartoldus, R.; Bechtle, P.; Becla, J.; Benitez, J. F.; Berger, N.; Bertsche, K.; Boeheim, C. T.; Bouldin, K.; Boyarski, A. M.; Boyce, R. F.; Browne, M.; Buchmueller, O. L.; Burgess, W.; Cai, Y.; Cartaro, C.; Ceseracciu, A.; Claus, R.; Convery, M. R.; Coupal, D. P.; Craddock, W. W.; Crane, G.; Cristinziani, M.; DeBarger, S.; Decker, F. J.; Dingfelder, J. C.; Donald, M.; Dorfan, J.; Dubois-Felsmann, G. P.; Dunwoodie, W.; Ebert, M.; Ecklund, S.; Erickson, R.; Fan, S.; Field, R. C.; Fisher, A.; Fox, J.; Franco Sevilla, M.; Fulsom, B. G.; Gabareen, A. M.; Gaponenko, I.; Glanzman, T.; Gowdy, S. J.; Graham, M. T.; Grenier, P.; Hadig, T.; Halyo, V.; Haller, G.; Hamilton, J.; Hanushevsky, A.; Hasan, A.; Hast, C.; Hee, C.; Himel, T.; Hryn' ova, T.; Huffer, M. E.; Hung, T.; Innes, W. R.; Iverson, R.; Kaminski, J.; Kelsey, M. H.; Kim, H.; Kim, P.; Kharakh, D.; Kocian, M. L.; Krasnykh, A.; Krebs, J.; Kroeger, W.; Kulikov, A.; Kurita, N.; Langenegger, U.; Leith, D. W. G. S.; Lewis, P.; Li, S.; Libby, J.; Lindquist, B.; Luitz, S.; Lüth, V.; Lynch, H. L.; MacFarlane, D. B.; Marsiske, H.; McCulloch, M.; McDonald, J.; Melen, R.; Menke, S.; Metcalfe, S.; Messner, R.; Moss, L. J.; Mount, R.; Muller, D. R.; Neal, H.; Nelson, D.; Nelson, S.; Nordby, M.; Nosochkov, Y.; Novokhatski, A.; O' Grady, C. P.; O' Neill, F. G.; Ofte, I.; Ozcan, V. E.; Perazzo, A.; Perl, M.; Petrak, S.; Piemontese, M.; Pierson, S.; Pulliam, T.; Ratcliff, B. N.; Ratkovsky, S.; Reif, R.; Rivetta, C.; Rodriguez, R.; Roodman, A.; Salnikov, A. A.; Schietinger, T.; Schindler, R. H.; Schwarz, H.; Schwiening, J.; Seeman, J.; Smith, D.; Snyder, A.; Soha, A.; Stanek, M.; Stelzer, J.; Su, D.; Sullivan, M. K.; Suzuki, K.; Swain, S. K.; Tanaka, H. A.; Teytelman, D.; Thompson, J. M.; Tinslay, J. S.; Trunov, A.; Turner, J.; van Bakel, N.; van Winkle, D.; Va' vra, J.; Wagner, A. P.; Weaver, M.; Weinstein, A. J. R.; Weber, T.; West, C. A.; Wienands, U.; Wisniewski, W. J.; Wittgen, M.; Wittmer, W.; Wright, D. H.; Wulsin, H. W.; Yan, Y.; Yarritu, A. K.; Yi, K.; Yocky, G.; Young, C. C.; Ziegler, V.; Chen, X. R.; Liu, H.; Park, W.; Purohit, M. V.; Singh, H.; Weidemann, A. W.; White, R. M.; Wilson, J. R.; Yumiceva, F. X.; Sekula, S. J.; Bellis, M.; Burchat, P. R.; Edwards, A. J.; Majewski, S. A.; Meyer, T. I.; Miyashita, T. S.; Petersen, B. A.; Roat, C.; Ahmed, M.; Ahmed, S.; Alam, M. S.; Bula, R.; Ernst, J. A.; Jain, V.; Liu, J.; Pan, B.; Saeed, M. A.; Wappler, F. R.; Zain, S. B.; Gorodeisky, R.; Guttman, N.; Peimer, D.; Soffer, A.; De Silva, A.; Lund, P.; Krishnamurthy, M.; Ragghianti, G.; Spanier, S. M.; Wogsland, B. J.; Eckmann, R.; Ritchie, J. L.; Ruland, A. M.; Satpathy, A.; Schilling, C. J.; Schwitters, R. F.; Wray, B. C.; Drummond, B. W.; Izen, J. M.; Kitayama, I.; Lou, X. C.; Ye, S.; Bianchi, F.; Bona, M.; Gallo, F.; Gamba, D.; Pelliccioni, M.; Bomben, M.; Borean, C.; Bosisio, L.; Cossutti, F.; Della Ricca, G.; Dittongo, S.; Grancagnolo, S.; Lanceri, L.; Poropat, P.; Rashevskaya, I.; Vitale, L.; Vuagnin, G.; Manfredi, P. F.; Re, V.; Speziali, V.; Frank, E. D.; Gladney, L.; Guo, Q. H.; Panetta, J.; Azzolini, V.; Lopez-March, N.; Martinez-Vidal, F.; Milanes, D. A.; Oyanguren, A.; Agarwal, A.; Albert, J.; Banerjee, Sw.; Bernlochner, F. U.; Brown, C. M.; Choi, H. H. F.; Fortin, D.; Fransham, K. B.; Hamano, K.; Kowalewski, R.; Lewczuk, M. J.; Nugent, I. M.; Roney, J. M.; Sobie, R. J.; Back, J. J.; Gershon, T. J.; Harrison, P. F.; Ilic, J.; Latham, T. E.; Mohanty, G. B.; Puccio, E.; Band, H. R.; Chen, X.; Cheng, B.; Dasu, S.; Datta, M.; Eichenbaum, A. M.; Hollar, J. J.; Hu, H.; Johnson, J. R.; Kutter, P. E.; Li, H.; Liu, R.; Mellado, B.; Mihalyi, A.; Mohapatra, A. K.; Pan, Y.; Pierini, M.; Prepost, R.; Scott, I. J.; Tan, P.; Vuosalo, C. O.; von Wimmersperg-Toeller, J. H.; Wu, S. L.; Yu, Z.; Greene, M. G.; Kordich, T. M. B.

    2013-11-01

    The BaBar detector operated successfully at the PEP-II asymmetric e+e- collider at the SLAC National Accelerator Laboratory from 1999 to 2008. This report covers upgrades, operation, and performance of the collider and the detector systems, as well as the trigger, online and offline computing, and aspects of event reconstruction since the beginning of data taking.

  8. Enhanced Optical Performance of BaMgAl

    NARCIS (Netherlands)

    Yin, L.J.; Dong, Juntao; Wang, Yinping; Zhang, Bi; Zhou, Zheng Yang; Jian, Xian; Wu, Mengqiang; Xu, Xin; van Ommen, J.R.; Hintzen, H.T.J.M.

    2016-01-01

    Many strategies have been adopted to improve thermal degradation of phosphors. Because of the stability and high transmittance of graphene, here we report a novel method of carbon coating on BaMgAl10O17:Eu2+ (BAM) phosphor particles through chemical vapor

  9. studies of radiative penguin decays at BaBar

    Indian Academy of Sciences (India)

    We summarize results on a number of observations of penguin dominated radiative decays of the meson. Such decays are forbidden at tree level and proceed via electroweak loops. As such they may be sensitive to physics beyond the standard model. The observations have been made at the BaBar experiment at PEP-II, ...

  10. Measurements of Form Factors with the BaBar Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Li, Selina Z.; /SLAC

    2011-08-25

    Selected recent results on measurements of form factors by the BaBar Collaboration are reviewed, including e{sup +}e{sup -} {yields} {eta}{prime}{gamma}, leptonic and semileptonic charm decays from data collected at or near the {Upsilon}(4S) resonance.

  11. Refugees' perceptions regarding HIV and AIDS in Ba-Phalaborwa ...

    African Journals Online (AJOL)

    2014-10-20

    Oct 20, 2014 ... doi:10.4102/hsag.v19i1.711. Refugees' perceptions regarding HIV and AIDS in. Ba-Phalaborwa Municipality in Limpopo Province. Authors: Elizabeth Nkwinika1. Lunic B. Khoza2. Rachel T. Lebese2. Hildah N. Shilubane2. Affiliations: 1Lulekani Health Centre,. South Africa. 2Department of Advanced.

  12. Proton microbeam irradiation effects on PtBA polymer

    Indian Academy of Sciences (India)

    Unknown

    irradiation effects on poly-tert-butyl-acrylate (PtBA) polymer using 2⋅0 MeV proton microbeam are reported. Preliminary results on pattern ... sist materials: electromagnetic radiation (e.g. optical, UV or X-ray photons) or charged ... a substrate and depending on the positive or negative type of resist material, the exposed or ...

  13. Thermodynamic study on the Sm-Ba-Cu-O system

    Science.gov (United States)

    Xian-ran, Xing; Zhi-yu, Qiao; Shou-kun, Wei; Xiao-long, Chen; Jing-kui, Liang; Guang-hui, Rao

    1996-11-01

    The assembly for EMF measurement with CaF2 single crystal or MgO partially stabilized zirconia as solid state electrolyte has been constructed. From the EMF data, the standard Gibbs energies, standard enthalpies of formation and standard entropies of six complex oxides in the Sm-Ba-Cu-O system were calculated. The decomposition pressures of these complex oxides were derived.

  14. Upconversion emission of BaTiO3: Er nanocrystals

    Indian Academy of Sciences (India)

    Here, we report the dopant concentration and pump-power dependence upconversion emission properties of erbium doped BaTiO3 nanocrystals derived from sol–emulsion–gel method. Green (550 nm) and red (670 nm) upconversion emissions were observed at room temperature from the 4 S 3 / 2 and 4 F 9 / 2 levels of ...

  15. Two-Photon Interactions at Belle and BaBar

    CERN Document Server

    Eidelman, Simon

    2010-01-01

    Results on two-photon physics obtained in experiments at the B factories are discussed. BaBar used single-tag collisions to measure the transition form factor of the 0 meson. Belle studied no-tag collisions to measure cross sections of exclusive production of two baryons and two mesons. Experimental results are confronted with QCD predictions.

  16. The Danish Microbiology Database (MiBa) 2010 to 2013

    DEFF Research Database (Denmark)

    Voldstedlund, M; Haarh, M; Mølbak, K

    2014-01-01

    The Danish Microbiology Database (MiBa) is a national database that receives copies of reports from all Danish departments of clinical microbiology. The database was launched in order to provide healthcare personnel with nationwide access to microbiology reports and to enable real-time surveillance...

  17. Observation of high spin levels in Cs from Ba decay

    Indian Academy of Sciences (India)

    Abstract. The γ- and conversion electron spectra following 131Ba ε-decay are investigated, using. HPGe detector and mini-orange electron spectrometer. Attention is particularly focussed on iden- tifying weak transitions associated with low energy high spin levels in 131Cs level scheme earlier inferred in reaction studies but ...

  18. Potential energy surfaces for Ж = , Ne- Ba nuclei

    Indian Academy of Sciences (India)

    112Ba nu- clei in an axially deformed relativistic mean field approach. A quadratic constraint scheme is applied to determine the complete energy surface for a wide range of the quadrupole deformation. The NL3, NL-RA1 and TM1 parameter sets ...

  19. Nonlinearity parameter B/A of biological tissue ultrasound imaging in echo mode

    Energy Technology Data Exchange (ETDEWEB)

    Toulemonde, M., E-mail: matthieu.toulemonde@creatis.univ-lyon1.fr; Varray, F.; Bernard, A.; Basset, O.; Cachard, C. [Université de Lyon, CREATIS, CNRS UMR 5220, INSERM U1044, INSA-Lyon, Université Claude Bernard Lyon 1 (France)

    2015-10-28

    The nonlinearity B/A parameter influences the distortion of ultrasound waves during their propagation in tissue. Normal and pathological media have different B/A values and this parameter may be used to characterize them. In this paper the multitaper coherent plane wave compounding (MCPWC) is combined with the extended comparative method (ECM) to estimate the B/A parameter in simulation and acquisition. Using plane wave transmission and orthogonal apodization during beam forming improves the B/A estimation and delineation.

  20. LOS LAGARTOS DE MALPELO (COLOMBIA: ASPECTOS SOBRE SU ECOLOGÍA Y AMENAZAS

    Directory of Open Access Journals (Sweden)

    LÓPEZ-VICTORIA MATEO

    2006-06-01

    Full Text Available Se aportan nuevos aspectos sobre la historia natural de los saurios de la Isla deMalpelo y, como complemento al Libro Rojo de reptiles de Colombia, se plantea sunivel de amenaza y clasificación según los criterios de la UICN.

  1. Aspectos relativos a la salud laboral y los riesgos psicosociales de los equipos de proyectos

    OpenAIRE

    Donate Fernández, Alejandro

    2013-01-01

    Es el objetivo del presente trabajo presentar una serie de directrices relacionadas con la salud laboral y los riesgos psicosociales de los equipos de proyectos y, en algunos aspectos centrándose en el principal responsable: el director de proyecto.

  2. Aspectos cuantitativos de los programas universitarios de administración de empresas en Colombia

    Directory of Open Access Journals (Sweden)

    Carlos Henao Restrepo

    1991-05-01

    Full Text Available RESUMEN La estabilización o el crecimiento en la oferta universitaria de este programa, en términos  cuantitativos como cualitativos, es uno de los aspectos críticos para las instituciones que postulan mejoras de calidad dentro de las nuevas reglas del mercado educativo.

  3. Core-corona PSt/P(BA-AA) composite particles by two-stage emulsion polymerization

    Science.gov (United States)

    Xie, Delong; Ren, Xiaolin; Zhang, Xinya; Liao, Shijun

    2016-03-01

    Raspberry-shaped composite particles with polystyrene (PSt) as core and poly(n-butyl acrylate-co-acrylic acid) (P(BA-AA)) as corona were synthesized via emulsion polymerization. The random copolymer, P(BA-AA), was pre-prepared and used as a polymeric surfactant, its emulsifying properties adjusted by changing the mass ratio of BA and AA. The morphology of the resulting core-corona composite particles, P(St/P(BA-AA)), could be regulated and controlled by varying the concentrations of P(BA-AA) or the mass ratio of BA:AA in P(BA-AA). The experimental results indicate that 3.0-6.0 wt% of P(BA-AA) is required to obtain stable composite emulsions, and P(BA-AA) with a mass ratio of BA:AA = 1:2 is able to generate distinct core-corona structures. A mechanism of composite particle formation is proposed based on the high affinity between the PSt core and the hydrophobic segments of P(BA-A). The regular morphology of the colloidal film is expected to facilitate potential application of core-corona particles in the field of light scattering. Furthermore, the diversity of core-corona particles can be expanded by replacing P(BA-AA) corona particles with other amphiphilic particles.

  4. X-ray excited optical luminescence studies on the system BaXY (X ...

    Indian Academy of Sciences (India)

    The present paper reports the experimental observations on the x-ray excited optical luminescence (XEOL) along with the afterglow and colour center features found for the barium salts, represented by the formula, Ba, where and are the halides. The system thus consists of four dihalides (BaF2, . . . ,BaI2) and six ...

  5. Crystallization of the HigBA2 toxin-antitoxin complex from Vibrio cholerae

    DEFF Research Database (Denmark)

    Hadǽi, San; Garcia-Pino, Abel; Martinez-Rodriguez, Sergio

    2013-01-01

    The genome of Vibrio cholerae encodes two higBA toxin-antitoxin (TA) modules that are activated by amino-acid starvation. Here, the TA complex of the second module, higBA2, as well as the C-terminal domain of the corresponding HigA2 antitoxin, have been purified and crystallized. The HigBA2 complex...

  6. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN P-00...

  7. A study on the damping capacity of BaTiO3-reinforced Al-matrix ...

    Indian Academy of Sciences (India)

    To study the damping capacity of BaTiO 3 /Al composites, Al composites reinforced with BaTiO 3 powder (average grain sizes: 100 and 1000 nm) were fabricated by the hot-pressing sintering method. The damping properties of pure Al and BaTiO 3 /Al composites were investigated and compared based on the dynamic ...

  8. Complete Genome Sequence of the Methanogen Methanoculleus bourgensis BA1 Isolated from a Biogas Reactor.

    Science.gov (United States)

    Maus, Irena; Wibberg, Daniel; Winkler, Anika; Pühler, Alfred; Schnürer, Anna; Schlüter, Andreas

    2016-06-23

    Methanoculleus bourgensis BA1, a hydrogenotrophic methanogen, was isolated from a laboratory-scale biogas reactor operating under an elevated ammonium concentration. Here, the complete genome sequence of M. bourgensis BA1 is reported. The availability of the BA1 genome sequence enables detailed comparative analyses involving other Methanoculleus spp. representing important members of microbial biogas communities. Copyright © 2016 Maus et al.

  9. Stellar Laboratories: 3. New Ba 5, Ba 6, and Ba 7 Oscillator Strengths and the Barium Abundance in the Hot White Dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Werner, K.; Quinet, P.; Kruk, Jeffrey Walter

    2014-01-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims. Reliable Ba 5-7 oscillator strengths are used to identify Ba lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and to determine their photospheric Ba abundances. Methods. We newly calculated Ba v-vii oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Ba lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results. For the first time, we identified highly ionized Ba in the spectra of hot white dwarfs. We detected Ba vi and Ba vii lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE 0503-289. The Ba vi/Ba vii ionization equilibrium is well reproduced with the previously determined effective temperature of 70 000 K and surface gravity of log g=7.5. The Ba abundance is 3.5 +/- 0.5 × 10(exp-4) (mass fraction, about 23 000 times the solar value). In the FUSE spectrum of G191-B2B, we identified the strongest Ba vii line (at 993.41 Å) only, and determined a Ba abundance of 4.0 +/- 0.5 × 10(exp-6) (about 265 times solar). Conclusions. Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Ba vi-vii line profiles in two white dwarfs' (G191-B2B and RE 0503-289) far-ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed to determine the photospheric Ba abundance of these two stars precisely.

  10. Antiferromagnetic structure and electronic properties of BaCr2As2 and BaCrFeAs2

    Science.gov (United States)

    Filsinger, Kai A.; Schnelle, Walter; Adler, Peter; Fecher, Gerhard H.; Reehuis, Manfred; Hoser, Andreas; Hoffmann, Jens-Uwe; Werner, Peter; Greenblatt, Martha; Felser, Claudia

    2017-05-01

    Recent theoretical studies suggest that superconductivity may be found in doped chromium pnictides with crystal structures similar to their iron counterparts. Here, we report a comprehensive study on the magnetic arsenides BaCr2As2 and BaCrFeAs2 (space group I 4 /m m m ), which are possible mother compounds with d4 and d5 electron configurations, respectively. DFT-based calculations of the electronic structure evidence metallic antiferromagnetic ground states for both compounds. By powder neutron diffraction, we confirm for BaCr2As2 a robust ordering in the antiferromagnetic G -type structure at TN=580 K with μCr=1.9 μB . Anomalies in the lattice parameters point to magnetostructural coupling effects. In BaCrFeAs2, the Cr and Fe atoms randomly occupy the transition-metal site and G -type order is found below 265 K with μCr /Fe=1.1 μB . 57Fe Mössbauer spectroscopy demonstrates that only a small ordered moment is associated with the Fe atoms, in agreement with electronic structure calculations leading to μFe˜0 . The temperature dependence of the hyperfine field does not follow that of the total moments. Both compounds are metallic but show large enhancements of the linear specific heat. Electrical transport in BaCrFeAs2 is dominated by the atomic disorder and the partial magnetic disorder of Fe. Our results indicate that Néel-type order is unfavorable for Fe moments and thus it is destabilized with increasing Fe content.

  11. The effects of BaSO₄ loading on OPC cementing system for encapsulation of BaSO₄ scale from oil and gas industry.

    Science.gov (United States)

    Hussein, O; Utton, C; Ojovan, M; Kinoshita, H

    2013-10-15

    The BaSO4 scales obtained from piping decontamination from oil and gas industries are most often classified as low level radioactive waste. These wastes could be immobilised by stable cement matrix to provide higher safety of handling, transportation, storage and disposal. However, the information available for the effects of the basic formulation such as waste loading on the fundamental properties is still limited. The present study investigated the effect of BaSO4 loading and water content on the properties of OPC-BaSO4 systems containing fine BaSO4 powder and coarse granules. The BaSO4 with different particle size had a marked effect on the compressive strength due to their different effects on hydration products formed. Introduction of fine BaSO4 powder resulted in an increased formation of CaCO3 in the system, which significantly contributed to the compressive strength of the products. Amount of water was important to control the CaCO3 formation, and water to cement ratio of 0.53 was found to be a good level to maintain a low porosity of the products both for fine BaSO4 powder and coarse BaSO4 granule. BaSO4 loading of up to 60 wt% has been achieved satisfying the minimum compressive strength of 5 MPa required for the radioactive wasteforms. Copyright © 2013 Elsevier B.V. All rights reserved.

  12. Experimental investigation of decay properties of neutron deficient $^{116-118}$Ba isotopes and test of $^{112-115}$Ba beam counts

    CERN Multimedia

    We propose to study decay of neutron deficient isotopes $^{116-118}$Ba using Double Sided Silicon Strip Detector (DSSSD). To study delayed-proton and $\\alpha$-decay branching ratios of $^{116-118}$Ba are of special interest because of their vicinity to the proton drip line. The nuclear life-times and properties of the proton unstable states of Cs isotopes, populated through decay of $^{116-118}$Ba isotopes will be measured. In addition to that we propose beam development of $^{112-115}$Ba to study exotic decay properties of these neutron deficient nuclei and to search for super-allowed $\\alpha$-decay in future.

  13. Synthesis of the intermetallic clathrate Na2Ba6Si46 by oxidation of Na2BaSi4 with HCl

    Directory of Open Access Journals (Sweden)

    Bodo Böhme, Umut Aydemir, Alim Ormeci, Walter Schnelle, Michael Baitinger and Yuri Grin

    2007-01-01

    Full Text Available A new preparation route to the intermetallic clathrate-I compound Na2Ba6Si46 is introduced, which allows one to make large amounts of product with standard laboratory equipment. The precursor Na2BaSi4 is oxidized with gaseous HCl at 673 K to Na2Ba6Si46, NaCl and BaCl2. Full-profile refinement of the crystal structure from the X-ray powder diffraction data revealed a composition close to Na2Ba6Si46 (Na1.94(1Ba6.06(1Si46, space group Pmbar 3n, a=10.281(1 Å. Differential scanning calorimetry showed an exothermic effect at 874 K, indicating that Na2Ba6Si46 is metastable. The product was additionally characterized by scanning electron microscopy. The electronic structure of Na2Ba6Si46 was investigated by a first-principles, all-electron full-potential method, predicting metallic conductivity. Na2Ba6Si46 obtained by oxidation with HCl shows Pauli paramagnetism; no bulk superconductivity was found down to 1.8 K in a magnetic field of 20 Oe.

  14. Synthesis, crystal growth and structure, magnetic and electrical properties of Ba4Ru2FeO10 and Ba4Ru2CoO10

    Science.gov (United States)

    Shlyk, L.; Niewa, R.

    2013-05-01

    Crystals of Ba4Ru2FeO10 and Ba4Ru2CoO10 (Cmca, Z = 4, Ba4Ru2FeO10: a = 5.7899(1) Å, b = 13.2898(3) Å, c = 13.0098(4) Å, V = 1001.06 Å3; Ba4Ru2CoO10: a = 5.7691(2) Å, b = 13.2061(3) Å, c = 12.9755(4) Å, V = 988.57 Å3) were obtained from binary oxides and BaCoO3 at 1300 °C. Both compounds crystallize isostructural to Ba4Ru3O10 with different preference of the 3d metal at the two crystallographic sites of Ru in the parent compound. Ba4Ru2FeO10 exhibits a spin-glass like transition at 25 K, while Ba4Ru2CoO10 does not show any magnetic order down to 2 K. According to electrical resistivity measurements performed on single crystals both compounds are semiconductors. In contrast to the variable-range hopping of the transport mechanism of Co bearing material, the electrical resistivity of Ba4Ru2FeO10 follows an activation law resulting in a band gap of approximately 0.98 eV.

  15. Influence of Impurities on the Luminescence of Er3+ Doped BaTiO3 Nanophosphors

    Directory of Open Access Journals (Sweden)

    G. D. Webler

    2014-01-01

    Full Text Available The influence of the presence of barium carbonate (BaCO3 phase on the luminescence properties of barium titanate nanocrystals (BaTiO3 powders was investigated. Structural and optical characterizations of erbium (Er3+ doped BaTiO3 synthesized by the sol-emulsion-gel were performed. Using Fourier transform infrared spectroscopy and X-ray powder diffraction, we identified the presence of impurities related to BaCO3 and quantified its fraction. It was observed that the presence of BaCO3 phase, even at low levels, depletes significantly the infrared-to-visible upconverted luminescence efficiency of the produced nanopowders.

  16. BaH molecular spectroscopy with relevance to laser cooling

    CERN Document Server

    Tarallo, M G; Zelevinsky, T

    2015-01-01

    We describe a simple experimental apparatus for laser ablation of barium monohydride (BaH) molecules and the study of their rovibrational spectra that are relevant to direct laser cooling. We present a detailed analysis of the properties of ablation plumes that can improve the understanding of surface ablation and deposition technologies. A range of absorption spectroscopy and collisional thermalization regimes has been studied. We directly measured the Franck-Condon factor of the $\\mathrm{B}^2\\Sigma^+(v'=0)\\leftarrow\\mathrm{X}^2\\Sigma^+(v"=1)$ transition. Prospects for production of a high luminosity cryogenic BaH beam are outlined. This molecule is a promising candidate for laser cooling and ultracold fragmentation, both of which are precursors to novel experiments in many-body physics and precision measurement.

  17. Magnetization analysis of Ba ferrite magnets by electron holography

    Energy Technology Data Exchange (ETDEWEB)

    Aiso, T. [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University, 1-1 Katahira, 2-Chome, Aobaku, Sendai 980-8577 (Japan); Shindo, D. [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University, 1-1 Katahira, 2-Chome, Aobaku, Sendai 980-8577 (Japan)]. E-mail: shindo@tagen.tohoku.ac.jp; Sato, T. [NEC TOKIN Techno Service Ltd., 6-7-1 Koriyama, Taihaku-ku, Miyagi 982-8510 (Japan)

    2007-11-15

    The magnetization distributions of anisotropic and isotropic Ba ferrite magnets in demagnetized and remanent states are investigated by electron holography. A polar diagram is used to obtain the quantitative mapping of the magnetization distribution. Through the polar diagrams, it is clarified that the magnetization distribution of Ba ferrite magnets closely depends on their magnetic properties. The dispersions of the magnetization direction of the two specimens in the remanent states correlate well with their remanent flux density. In the anisotropic specimen, the magnetization reversal occurs drastically under an applied field of 360 kA/m, while in the isotropic one, the direction of magnetization changes gradually. The results exhibit a good correspondence between the change in the magnetization distribution and the shape of the demagnetization curves.

  18. Performances of RPCs in the BaBar Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Messner, Robert

    2003-09-26

    The BaBar experiment uses a big system based on RPC detectors to discriminate muons from pions and to identify neutral hadrons. About 2000 m{sup 2} of RPC chambers have been working at SLAC since the end of 1998. We report on the performances of the RPC chambers focusing on new problems discovered in the RPC behavior. These problems started very soon after the installation of the chambers on the detector when the high ambient temperature triggered an increase of dark currents inside the chambers and a reduction of the efficiency. Careful analysis of the BaBar data and dedicated R&D efforts in the laboratory have helped to identify the main source of the trouble in the linseed oil varnish on the bakelite electrodes.

  19. Preservative spleen surgery and hyperbaric oxygen therapy Cirurgia conservadora do baço e oxigenoterapia hiperbárica

    Directory of Open Access Journals (Sweden)

    Isabel Cristina Andreatta Lemos Paulo

    2007-01-01

    Full Text Available PURPOSE: To assess functional and morphological aspects of spleen auto-implants and of the splenic inferior pole of rats, post-operatively treated or not with hyperbaric oxygen, as well as the survival of these animals, were studied. METHODS: Seventy-eight male Wistar rats, weighing between 192 and 283 g ( 238,3 ± 9,6g, were randomly distributed into three groups: Group1-(n=20, spleen manipulation; group 2-(n=36, spleen auto-implantation; group3-(n= 22, subtotal splenectomy preserving the inferior pole. Each group was subdivided as follows: subgroup a, not submitted to hyperbaric oxygen therapy: 1a(n=10, 2a(n=21, 3a(n= 13; subgroup b, submitted to the therapy: 1b(n=10, 2b(n=15, 3b(n=9. Blood was collected pre-operatively and 11 days after surgery, for the estimation of lipids and immunoglobulins and the counting of platelets and Howell-Jolly corpuscles. The spleen and remains were taken for histological study. RESULTS: The number of surviving animals was significantly higher in groups 1(p 2. The macro and microscopic appearance in subgroup 2b were more viable than in subgroup 2a, and that of group 3 more viable than in group 2. The survival of the animals carrying their whole spleen or its inferior pole was more frequent than that of the auto-implanted animals. CONCLUSION: Functionality and viability of the whole spleen or of its inferior pole, were better than in the auto-implanted animals. Hyperbaric oxygentherapy contributed to increased survival frequency of auto -implanted animals, and to improve the functionality and viability of the auto-implants and the function of the inferior splenic pole, and did not interfere in animals carrying their whole spleen.OBJETIVO: Estudar aspectos funcionais e morfológicos dos auto-implantes esplênicos e do pólo inferior do baço de ratos, tratados ou não com oxigênio hiperbárico no pós-operatório, e a sobrevida desses animais. MÉTODOS: Foram operados 78 ratos, machos, Wistar, pesando entre 192 g

  20. Thermoelectric properties of topological insulator BaSn2

    Science.gov (United States)

    Guo, San-Dong; Qiu, Liang

    2017-01-01

    Recently, \\text{BaS}{{\\text{n}}2} has been predicted to be a strong topological insulator by the first-principle calculations. It is well known that topological insulators have a close connection to thermoelectric materials, such as the \\text{B}{{\\text{i}}2}\\text{T}{{\\text{e}}3} family. In this work, we investigate thermoelectric properties of \\text{BaS}{{\\text{n}}2} by the first-principles calculations combined with the Boltzmann transport theory. The electronic part is carried out by a modified Becke and Johnson (mBJ) exchange potential, including spin-orbit coupling (SOC), while the phonon part is performed using a generalized gradient approximation (GGA). It was found that the electronic transport coefficients between the in-plane and cross-plane directions showed strong anisotropy, while lattice-lattice thermal conductivities demonstrated almost complete isotropy. Calculated results revealed a very low lattice thermal conductivity for \\text{BaS}{{\\text{n}}2} , and the corresponding average lattice thermal conductivity at room temperature is 1.69 \\text{W}~{{\\text{m}}-1}~{{\\text{K}}-1} , which is comparable or lower than those of lead chalcogenides and bismuth-tellurium systems as classic thermoelectric materials. Due to the complicated scattering mechanism, calculating the scattering time τ is challenging. By using an empirical τ ={{10}-14} s, the n-type figure of merit ZT is greater than 0.40 in wide temperature ranges. Experimentally, it is possible to attain better thermoelectric performance by strain or tuning size parameters. This work indicates that \\text{BaS}{{\\text{n}}2} may be a potential thermoelectric material, which can stimulate further theoretical and experimental work.

  1. Earth Observation for Biodiversity Assessment (EO-BA)

    CSIR Research Space (South Africa)

    Cho, Moses A

    2012-10-01

    Full Text Available of air and water ? Protection of watershed, soil erosion and floods ? Nutrient cycling ? Biomass storage ? Provision of food, water, fuel and energy, raw materials and genetic resources for the pharmaceutical industry ? Cultural services. The role... Observation for Biodiversity Assessment (EO-BA) programme is designed to enhance biodiversity assessment and conservation through the application of earth observation data, with particular focus on the African continent. MISSION To initiate and develop...

  2. Ultrasonic Investigations on Polonides of Ba, Ca, and Pb

    Science.gov (United States)

    Singh, Devraj; Bhalla, Vyoma; Bala, Jyoti; Wadhwa, Shikha

    2017-10-01

    The temperature-dependent mechanical and ultrasonic properties of barium, calcium, and lead polonides (BaPo, CaPo, and PbPo) were investigated in the temperature range 100-300 K. The second- and third-order elastic constants (SOECs and TOECs) were computed using Coulomb and Born-Mayer potential and these in turn have been used to estimate other secondary elastic properties such as strength, anisotropy, microhardness, etc. The theoretical approach followed the prediction that BaPo, CaPo, and PbPo are brittle in nature. PbPo is found to be the hardest amongst the chosen compounds. Further the SOECs and TOECs are applied to determine ultrasonic velocities, Debye temperature, and acoustic coupling constants along , , and orientations at room temperature. Additionally thermal conductivity has been computed using Morelli and Slack's approach along different crystallographic directions at room temperature. Finally ultrasonic attenuation due to phonon-phonon interaction and thermoelastic relaxation mechanisms has been computed for BaPo, CaPo, and PbPo. The behaviour of these compounds is similar to that of semi-metals with thermal relaxation time of the order 10-11 s. The present computation study is reasonably in agreement with the available theoretical data for the similar type of materials.

  3. Analysis of Jupiter's Oval BA: A Streamlined Approach

    Science.gov (United States)

    Sussman, Michael G.; Chanover, Nancy J.; Simon-Miller, Amy A.; Vasavada, Ashwin R.; Beebe, Reta F.

    2010-01-01

    We present a novel method of constructing streamlines to derive wind speeds within jovian vortices and demonstrate its application to Oval BA for 2001 pre-reddened Cassini flyby data, 2007 post-reddened New Horizons flyby data, and 1998 Galileo data of precursor Oval DE. Our method, while automated, attempts to combine the advantages of both automated and manual cloud tracking methods. The southern maximum wind speed of Oval BA does not show significant changes between these data sets to within our measurement uncertainty. The northern maximum dries appear to have increased in strength during this time interval, tvhich likely correlates with the oval's return to a symmetric shape. We demonstrate how the use of closed streamlines can provide measurements of vorticity averaged over the encircled area with no a priori assumptions concerning oval shape. We find increased averaged interior vorticity between pre- and post-reddened Oval BA, with the precursor Oval DE occupying a middle value of vorticity between these two.

  4. Synthesis and characterization of (Ba,Yb doped ceria nanopowders

    Directory of Open Access Journals (Sweden)

    Branko Matović

    2011-06-01

    Full Text Available Nanometric size (Ba, Yb doped ceria powders with fluorite-type structure were obtained by applying selfpropagating room temperature methods. Tailored composition was: Ce0.95−xBa0.05YbxO2−δ with fixed amount of Ba − 0.05 and varying Yb content “x” from 0.05 to 0.2. Powder properties such as crystallite and particle size and lattice parameters have been studied. Röntgen diffraction analyses (XRD were used to characterize the samples at room temperature. Also, high temperature treatment (up to 1550°C was used to follow stability of solid solutions. The mean diameters of the nanocrystals are determined from the full width at half maxima (FWHM of the XRD peaks. It was found that average diameter of crystallites is less than 3 nm. WilliamsonHall plots were used to separate the effect of the size and strain in the nanocrystals.

  5. ASPECTOS NORTEADORES NA ORIENTAÇÃO DE MONOGRAFIA A DISTÂNCIA

    Directory of Open Access Journals (Sweden)

    monica seixas mello

    2012-12-01

    Full Text Available O objetivo do presente estudo é analisar os aspectos norteadores na orientação de monografia na modalidade a distância a partir de relato de experiência em curso de pó-graduação Lato Sensu em Gestão Pública., constatando-se que na orientação a distância em ambientes virtuais de aprendizagem as interações entre professor e aluno observam os seguintes aspectos: pedagógico, gerencial, social e técnico Palavras-chaves: educação, distância, orientação, monografia, pos-graduação.

  6. Aspectos ultra-estruturais da forma epimastigota do Trypanosoma cruzi em meio LIT

    Directory of Open Access Journals (Sweden)

    Wanderley de Souza

    1975-06-01

    Full Text Available E feito um estudo da ultra-estrutura da forma epismastigota do Trypanosoma cruzi mantida em meio de cultivo acelular. O núcleo das formas em divisão apresenta um aspecto homogêneo. Microtúbulos intranucleares são observados durante a divisão. No entanto, a membrana nuclear permanece íntegra. O citoplasma apresenta-se com vacúolos de dimensões e aspectos variados. Com o método do ácido periódico-tiosemicarbazida-proteinato de prata, polissacaríáeos e/ou glicoproteínas foram localizados na membrana celular e na membrana que delimita certos vacúolos citoplasmáticos.

  7. Eugenia vinculada a aspectos bioéticos: uma revisão integrativa

    Directory of Open Access Journals (Sweden)

    Vanessa Cruz Santos

    Full Text Available O objetivo do estudo é analisar o que versam as produções científicas sobre eugenia, vinculando-as com aspectos bioéticos. Trata-se de uma revisão integrativa de literatura. Os dados foram coletados nas bases de dados Lilacs e SciELO, por meio dos descritores: eugenia, etnia e saúde, ética e bioética. Para a análise e posterior síntese dos artigos foi utilizada figura sinóptica. Verificou-se que a eugenia viola os direitos humanos, contradiz com o princípio da solidariedade e coloca em risco a diversidade humana. Conclui-se que houve déficit de artigos que abordem aspectos bioéticos vinculados à eugenia, assim, este estudo poderá contribuir para a reflexão sobre essa articulação.

  8. Los aspectos socioculturales de la migración en la frontera norte

    Directory of Open Access Journals (Sweden)

    Oscar Priego Hernández

    2011-12-01

    Full Text Available México se considera el país de emigrantes más importante del mundo y Estados Unidos el principal país de inmigrantes. Su posición geográfica en la frontera Norte lo convierten atractivo para los flujos migratorios de los países centroamericanos. Hoy enfrenta los retos de la crisis financiera internacional de los últimos años que afecta las economías y las relaciones bilaterales. Este trabajo consiste en realizar un estudio de la problemática de los aspectos socioculturales provocada por la migración de personas, analizar fortalezas y debilidades, identificar los nuevos aspectos de la migración y proponer alternativas para mejorar las condiciones de vida de los migrantes mexicanos.

  9. Aspectos da tomografia computadorizada craniana na neurocisticercose na infância

    Directory of Open Access Journals (Sweden)

    Marilisa M. Guerreiro

    1989-06-01

    Full Text Available Os autores relatam aspectos tomográficos da neurocisticercose na infância a propósito da análise de 27 exames em 18 pacientes, que foram distribuídos em três grupos segundo o quadru clínico e os achados tomográficos. O grupo 1 foi caracterizado basicamente por epilepsias e calcificações. O grupo 2 caracterizou-se por hipertensão intracraniana e diversos aspectos tomográficos: edema, cistos e nódulos em três pacientes; hidrocefalia e calcificações em dois pacientes e normal em um paciente. O grupo 3 consistiu clinicamente de epilepsia e cefaléia, com vários padrões tomográficos. Os resultados são discutidos à luz da literatura disponível.

  10. Calidad de servicio (QoS en procesos: Escenarios de procesamiento con aspectos

    Directory of Open Access Journals (Sweden)

    Hector Manuel Soto Pérez

    2016-12-01

    En resumen el presente trabajo estudia conceptos básicos de calidad de servicio y algunos de sus marcos de aplicación siguiendo un enfoque aspectual. Planteando posibles casos de uso genéricos para aplicar mejoras en la prestación de la QoS mediante aspectos en la planificación y gestión de recursos de aplicaciones tradicionales.

  11. Planificación estratégica: aspectos introductorios (I)

    OpenAIRE

    Galindo Reyes, Fuensanta Carmen; De la Varga Salto, José María

    2016-01-01

    Transparencias como material docente para la asignatura de Administración de Organizaciones. Se corresponden con la etapa primera del proceso administrativo de las organizaciones, la planificación estratétiga. En concreto, incluyen aspectos introductorios relacionados con los conceptos y elementos principales de la planificación estratégica. Planificación estratégica

  12. Distrofia miotônica: aspectos clínico-laboratoriais em 19 casos

    Directory of Open Access Journals (Sweden)

    Milberto Scaff

    1974-09-01

    Full Text Available São relatados os casos de 19 pacientes com distrofia miotônica. São discutidos alguns aspectos clínicos e para-clínicos da doença: eletroforese e imunoeletroforese de proteínas do sôro, eletrocardiograma, eletrencefalograma, radiografia de crânio e pneumencefalograma. Os resultados apresentados foram comparados àqueles da literatura.

  13. EMPREENDEDORISMO CORPORATIVO - ASPECTOS DE INOVAÇÃO E MUDANÇA ORGANIZACIONAL

    OpenAIRE

    Luciana Gehlen

    2016-01-01

    Este artigo analisa o conceito de empreendedorismo corporativo – conhecido também como empreendedorismo interno ou intra-empreendedorismo, seus aspectos relacionados aos fatores de criatividade, inovação e mudança organizacional como fatores de competitividade das organizações, bem como o perfil do empreendedor corporativo e o ambiente organizacional necessário para que o empreendedorismo interno aconteça. Palavras-chave: empreendedorismo corporativo, empreendedorismo interno, intra-empre...

  14. Pobreza multidimensional e seus aspectos subjetivos em contextos rurais e urbanos nordestinos

    Directory of Open Access Journals (Sweden)

    Verônica Morais Ximenes

    Full Text Available Resumo Objetiva-se analisar a pobreza multidimensional e seus aspectos subjetivos em contextos rural e urbano em um Estado do Brasil. Os aspectos subjetivos da pobreza estão relacionados a uma autopercepção vinculada à privação financeira e à responsabilização individual. A amostra total constou de 417 participantes. Foi desenvolvido um Índice de Mensuração de Pobreza Multidimensional a partir das privações nas dimensões habitação, escolaridade, trabalho/renda, saúde e aspectos subjetivos da pobreza. Foram realizados testes de Análise de Regressão Múltipla e Análise Multivariada de Variância. Identificou-se que as privações nas dimensões escolaridade e habitação são mais intensas na zona rural. Já a dimensão subjetiva da pobreza é mais forte no contexto urbano. Em ambos os contextos, dimensão privação de trabalho/renda tem predição positiva com os aspectos subjetivos da pobreza. No contexto urbano, as dimensões saúde e habitação também são preditoras positivas da dimensão subjetiva da pobreza, enquanto a dimensão educação tem uma correlação negativa.

  15. El maltrato infantil: aspectos psicológicos y programas de tratamientos

    OpenAIRE

    González Díaz, Adriana

    2013-01-01

    La presente revisión recoge los aspectos psicológicos derivados del maltrato infantil. Expone la tipología, así la evaluación psicológica de los menores en estos casos y las patologías asociadas al maltrato. Finalmente se exponen los principales programas de intervención y tratamiento en estos casos

  16. El fracaso académico en la universidad: Aspectos motlvacionales e interesesprofesionales

    Directory of Open Access Journals (Sweden)

    Manuel Mar\\u00EDn S\\u00E1nchez

    2000-01-01

    Full Text Available Un total de 103 alumnos con una edad promedio de 21 años fracasado en sus estudios universitarios, se evaluaron a través de una serie de cuestionarios, pruebas objetivas de inteligencia y personalidad, y entrevistas individuales. La investigación pretende describir la relación entre aspectos actitudinales (motivaciones e intereses profesionales y fracaso académico, independientemente del nivel de inteligencia. Asimismo, se elaboró el perfil vocacional de los alumnos fracasados y se determinó su congruencia con respecto a la elección de estudios universitarios. Los resultados indican que los aspectos motivacionales y actitudinales poseen un potencial predictor del fracaso académico igualo mayor que los aspectos cognoscitivos o intelectuales. Los alumnos mostraron claros síntomas de indefensión aprendida, baja motivación intrínseca y pobres tendencias a la realización personal (aprendizajes y/o laboral. Por otra parte, los resultados animan a considerar la importancia de la compatibilidad entre vocación y elección universitaria.

  17. Peixes recifais da costa da Paraíba, Brasil Reef fishes from Paraíba, Brazil

    Directory of Open Access Journals (Sweden)

    Luiz A. Rocha

    1998-01-01

    Full Text Available The coral reef is an ecossystem which evokes great interest, for its beaury, species diversity and fisheries potential. The coast of Paraíba State, northeast Brazil, possesses several natural reefs and shipwrecks which are inhabited by a rich fish fauna. In order to survey the reef fish fauna of Paraíba State, a total of 118 dives, utilizing SCUBA diving techniques, were carriedoutin 27samplingpoints (depths: 0,5-66m, from February/1995 to May/1996. Specimens were collected whenever underwater identification was precluded. A total of 157 known species belonging to 59 families were found. Four unidentified species, one dasyatid, one haemulid, one scarid, and one labrid were recorded. Haemulidae was the most representative family in number of individuais, whereas Carangidae was the most speciose family. This paper is part of a broader study of the northeast Brazilian reef fishes.

  18. High-pressure synthesis of the cubic perovskite BaRuO3 and evolution of ferromagnetism in ARuO3 (A = Ca, Sr, Ba) ruthenates

    Science.gov (United States)

    Jin, C.-Q.; Zhou, J.-S.; Goodenough, J. B.; Liu, Q. Q.; Zhao, J. G.; Yang, L. X.; Yu, Y.; Yu, R. C.; Katsura, T.; Shatskiy, A.; Ito, E.

    2008-01-01

    The cubic perovskite BaRuO3 has been synthesized under 18 GPa at 1,000°C. Rietveld refinement indicates that the new compound has a stretched Ru–O bond. The cubic perovskite BaRuO3 remains metallic to 4 K and exhibits a ferromagnetic transition at Tc = 60 K, which is significantly lower than the Tc ≈ 160 K for SrRuO3. The availability of cubic perovskite BaRuO3 not only makes it possible to map out the evolution of magnetism in the whole series of ARuO3 (A = Ca, Sr, Ba) as a function of the ionic size of the A-site rA, but also completes the polytypes of BaRuO3. Extension of the plot of Tc versus rA in perovskites ARuO3 (A = Ca, Sr, Ba) shows that Tc does not increase as the cubic structure is approached, but has a maximum for orthorhombic SrRuO3. Suppressing Tc by Ca and Ba doping in SrRuO3 is distinguished by sharply different magnetic susceptibilities χ(T) of the paramagnetic phase. This distinction has been interpreted in the context of a Griffiths' phase on the (Ca Sr)RuO3 side and bandwidth broadening on the (Sr,Ba)RuO3 side. PMID:18480262

  19. Optical and structural properties of Eu 2 + doped BaBrI and BaClI crystals

    Science.gov (United States)

    Shendrik, R.; Shalaev, A. A.; Myasnikova, A. S.; Bogdanov, A.; Kaneva, E.; Rusakov, A.; Vasilkovskyi, A.

    2017-12-01

    The work is necessitated by search for new materials to detect ionizing radiation. The rare-earth ions doped with ternary alkali earth-halide systems are promising scintillators showing high efficiency and energy resolution. Some aspects of crystal growth and data on the structural and luminescence properties of BaBrI and BaClI doped with low concentrations of $\\mathrm{Eu^{2+}}$ ions are reported. The crystals are grown by the vertical Bridgman method in sealed quartz ampoule. New crystallography data for BaClI single crystal obtained by single crystal X-ray diffraction method are presented in this paper. Emission, excitation and optical absorption spectra as well as luminescence decay kinetics are studied under excitation by X-ray, vacuum ultraviolet and ultraviolet radiation. The energies of the first 4f-5d transition in $\\mathrm{Eu^{2+}}$ and band gap of the crystals have been obtained. We have calculated the electronic band structure of the crystals using density functional theory as implemented in the \\latin{Ab Initio}. Calculated band gap energies are in accord with the experimental estimates. The energy of gaps between the occupied Eu$^{2+}$ 4f level and the valence band top are predicted. In addition, positions of lanthanide energy levels in relation to valence band have been constructed using the chemical shift model.

  20. Reproducibility of Ba/Ca variations recorded by northeast Pacific bamboo corals

    Science.gov (United States)

    Serrato Marks, G.; LaVigne, M.; Hill, T. M.; Sauthoff, W.; Guilderson, T. P.; Roark, E. B.; Dunbar, R. B.; Horner, T. J.

    2017-09-01

    Trace elemental ratios preserved in the calcitic skeleton of bamboo corals have been shown to serve as archives of past ocean conditions. The concentration of dissolved barium (BaSW), a bioactive nutrientlike element, is linked to biogeochemical processes such as the cycling and export of nutrients. Recent work has calibrated bamboo coral Ba/Ca, a new BaSW proxy, using corals spanning the oxygen minimum zone beneath the California Current System. However, it was previously unclear whether Ba/Cacoral records were internally reproducible. Here we investigate the accuracy of using laser ablation inductively coupled plasma mass spectrometry for Ba/Cacoral analyses and test the internal reproducibility of Ba/Ca among replicate radial transects in the calcite of nine bamboo corals collected from the Gulf of Alaska (643-720 m) and the California margin (870-2054 m). Data from replicate Ba/Ca transects were aligned using visible growth bands to account for nonconcentric growth; smoothed data were reproducible within 4% for eight corals (n = 3 radii/coral). This intracoral reproducibility further validates using bamboo coral Ba/Ca for BaSW reconstructions. Sections of the Ba/Ca records that were potentially influenced by noncarbonate bound Ba phases occurred in regions where elevated Mg/Ca or Pb/Ca and coincided with anomalous regions on photomicrographs. After removing these regions of the records, increased Ba/Cacoral variability was evident in corals between 800 and 1500 m. These findings support additional proxy validation to understand BaSW variability on interannual timescales, which could lead to new insights into deep sea biogeochemistry over the past several centuries.

  1. Toxicological aspects and occurrence of patulin in apple juice/ Aspectos toxicológicos e ocorrência de patulina em suco de maçã

    Directory of Open Access Journals (Sweden)

    Miguel Machinski Junior

    2005-06-01

    Full Text Available Patulin is a secondary metabolite produced by different species of fungi, being Penicillium expansum the most important species. Patulin is a mycotoxin that has been found mainly in mature apples used in the production of concentrated apple juice, but it can also be in other fruits, vegetables and nutritious products. Experiments carried out with laboratory animals have demonstrated that this mycotoxin produces several harmful effects, including mutagenicity, teratogenicity, carcinogenicity, immunosuppression and acute intoxications characterized by pulmonary oedema, hemorrhages, damages in the capillaries of liver, spleen and kidneys, as well as cerebral oedema. This revision article approaches physicochemical properties and toxicological aspects of the patulin, as well as its occurrence and strategies to prevent its presence in apple juices.A patulina é um metabólito secundário produzido por diferentes gêneros e espécies de fungos. Penicillium expansum é certamente a espécie mais importante. É uma micotoxina encontrada principalmente em maçãs maduras utilizadas na produção de suco de maçã concentrado, mas também pode estar presente em outras frutas, vegetais e produtos alimentícios. Experimentos em animais de laboratório demonstraram que esta micotoxina produz diversos efeitos nocivos, incluindo mutagenicidade, teratogenicidade, carcinogenicidade, imunossupressão e intoxicações agudas caracterizadas por edema pulmonar, hemorragias, danos nos capilares hepáticos, do baço e rins, bem como edema cerebral. O presente artigo de revisão aborda aspectos físico-químicos e toxicológicos da patulina, bem como a sua ocorrência e estratégias para prevenir a sua presença em sucos de maçã.

  2. Algunos aspectos del proceso de construcción del museo Guggenheim Bilbao. Bilbao/España

    National Research Council Canada - National Science Library

    Caicoya Gómez-Morán, C

    1997-01-01

    .... Se describen -de manera breve- algunos aspectos del proyecto y construcción del Museo Guggenheim Bilbao, planteando y resolviendo los distintos problemas que se presentaron durante el proceso constructivo...

  3. Flora da Paraíba, Brasil: Solanum L. (Solanaceae Flora of Paraíba, Brazil: Solanum L. (Solanaceae

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Agra

    2009-09-01

    Full Text Available Neste trabalho apresenta-se o tratamento taxonômico do gênero Solanum, como parte do projeto "Flora da Paraíba", que vem sendo realizado com o objetivo de identificar e catalogar as espécies da flora local. Realizaram-se coletas, observações de campo e estudos morfológicos para as identificações, descrições e ilustrações botânicas, com o auxílio da bibliografia especializada, complementadas pela análise de tipos e fotos de tipos de herbários nacionais e internacionais e de espécimes depositados nos herbários EAN e JPB. Foram registradas 22 espécies: Solanum agrarium Sendtn., S. americanum Mill., S. asperum Rich., S. asterophorum Mart., S. caavurana Vell., S. capsicoides All., S. crinitum Lam., S. jabrense Agra & M.Nee, S. melissarum Bohs, S. ovum-fringillae (Dunal Bohs, S. palinacanthum Dunal, S. paludosum Moric., S. paniculatum L., S. paraibanum Agra, S. polytrichum Moric., S. rhytidoandrum Sendtn., Solanum sp., S. stagnale Moric., S. stipulaceum Roem. & Schult., S. stramoniifolium Jacq., S. swartzianum Roem. & Schult. e S. torvum Sw. Três espécies, S. ovum-fringillae, Solanum sp. e S. swartzianum, são novas referências para a Paraíba.A taxonomic treatment of the genus Solanum was done as part of the project "Flora da Paraíba", which aims to identify and catalogue the species of the local flora. Botanical collections, field observations and morphological studies were done for identification, description and botanical illustration of the plant species, supported by the literature and analysis of national and foreign herbaria, and specimens from EAN and JPB. Twenty two species of Solanum were recorded in State of Paraíba, as follows: Solanum agrarium Sendtn., S. americanum Mill., S. asperum Rich., S. asterophorum Mart., S. caavurana Vell., S. capsicoides All., S. crinitum Lam., S. jabrense Agra & M.Nee, S. melissarum Bohs, S. ovum-fringillae (Dunal Bohs, S. palinacanthum Dunal, S. paludosum Moric., S. paniculatum L., S

  4. Early signals of environmental and health impacts caused by uranium mining in Caetite, Bahia, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Brito, Adelson S. de; Rego, Rita de Cassia Franco [Universidade Federal da Bahia (UFBA), Salvador, BA (Brazil). Dept. de Medicina Preventiva. Programa de Pos-Graduacao em Saude, Ambiente e Trabalho; Zucchi, Maria do Rosario [Universidade Federal da Bahia (UFBA), Salvador, BA (Brazil). Dept. de Fisica da Terra. Lab. de Fisica Nuclear Aplicada; Navarro, Marcus V. Teixeira, E-mail: mvtn@ifba.edu.b [Instituto Federal da Bahia (LAFIR/NTS/IFBA) Salvador, BA (Brazil). Nucleo de Tecnologia em Saude. Lab. de Fisica Radiologica

    2011-07-01

    Uranium mining and processing at Lagoa Real (Bahia, Brazil) in the southwest of Bahia state started in the year 2000.The processing of uranium ore for obtaining U3O8 (yellowcake) is done today in the processing unit of the Brazilian Nuclear Industries INB located in the area of the same municipality above mentioned. The production capacity is 400 tons / year of U3O8, and the reserves in this region are estimated at 100.000 tons of uranium without any other associated minerals, enough to supply the demand for nuclear power plants Angra I and II for over 100 years. Since the granting of AOP (Permanent Operation Authorization) by CNEN (National Commission on Nuclear Energy) in the year 2009, there were some incidents at the facility, such as: solvents and liquid containing uranium overflow; pipes rupture, causing indiscriminate dispersion of toxic acids and other chemical agents; collapse of parts of the slope of the open pit. CNEN admitted in an official press release on April 1, 2011 that 'INB has no capacity to produce annual reports on environmental monitoring (unable to perform radiometric measurements, etc.). The last time a report was released happened in the year 2008. These reports are vital to the environmental impact assessment of the facility'. Another potential source of environmental and health negative impacts on the local population could be linked to radon emission. What are the levels of this important pollutant in the affected areas? (author)

  5. Growth of single crystals of BaFe12O19 by solid state crystal growth

    Science.gov (United States)

    Fisher, John G.; Sun, Hengyang; Kook, Young-Geun; Kim, Joon-Seong; Le, Phan Gia

    2016-10-01

    Single crystals of BaFe12O19 are grown for the first time by solid state crystal growth. Seed crystals of BaFe12O19 are buried in BaFe12O19+1 wt% BaCO3 powder, which are then pressed into pellets containing the seed crystals. During sintering, single crystals of BaFe12O19 up to ∼130 μm thick in the c-axis direction grow on the seed crystals by consuming grains from the surrounding polycrystalline matrix. Scanning electron microscopy-energy dispersive spectroscopy analysis shows that the single crystal and the surrounding polycrystalline matrix have the same chemical composition. Micro-Raman scattering shows the single crystal to have the BaFe12O19 structure. The optimum growth temperature is found to be 1200 °C. The single crystal growth behavior is explained using the mixed control theory of grain growth.

  6. Left posterior BA37 is involved in object recognition: a TMS study

    DEFF Research Database (Denmark)

    Stewart, Lauren; Meyer, Bernd-Ulrich; Frith, Uta

    2001-01-01

    Functional imaging studies have proposed a role for left BA37 in phonological retrieval, semantic processing, face processing and object recognition. The present study targeted the posterior aspect of BA37 to see whether a deficit, specific to one of the above types of processing could be induced...... to name pictures when TMS was given over lBA37 compared to vertex or rBA37. rTMS over lBA37 had no significant effect on word reading, nonword reading or colour naming. The picture naming deficit is suggested to result from a disruption to object recognition processes. This study corroborates the finding...... from a recent imaging study, that the most posterior part of left hemispheric BA37 has a necessary role in object recognition....

  7. Quo Vadis the B.A. degree: Perceptions and visions1

    Directory of Open Access Journals (Sweden)

    Annette L. Combrink

    1993-03-01

    Full Text Available Today is a very special day for all the graduates assembled to have a B.A. degree conferred on them. It is a day on which to celebrate the reward for hard work and for realized dreams. This is a very homogeneous group of people - in the sense that they will be receiving B.A. degrees, and for that reason it would be highly apposite to share some cherished thought and ideas about the B.A. degree.

  8. Impacts of Mining and Urbanization on the Qin-Ba Mountainous Environment, China

    OpenAIRE

    Xinliang Xu; Hongyan Cai; Daowei Sun; Lan Hu; Kwamina E. Banson

    2016-01-01

    The Qin-Ba Ecological Functional Zone is a component of China’s ecological security pattern designed to protect the regional ecosystem and maintain biodiversity. However, due to the impact of mining and urban encroachment, the plight of a sustainable ecosystem in the Qin-Ba mountainous area is deteriorating. This paper has used a remote sensing and geographic information system (GIS) to examine the impacts of mining and urban encroachment on the environment in the Qin-Ba mountainous area. The...

  9. THINNING OF ‘GALA’ AND 'GOLDEN DELICIOUS' APPLES WITH BA, NAA AND THEIR COMBINATIONS

    Directory of Open Access Journals (Sweden)

    M STOPAR

    2002-07-01

    Full Text Available Apple trees, eight-year-old ‘Gala’/M.9 and four-year-old ‘Golden Delicious’/M.9 have been thinned with 6- benzyladenine (BA 50 ppm, 100 ppm and 200 ppm, with 1-naphthaleneacetic acid (NAA 5 ppm, 10 ppm and 20 ppm, and with the tank mix combinations of BA 50 ppm + NAA 5 ppm or BA 20 ppm + NAA 5 ppm, all at 9-10 mm fruitlet diameter. All applied concentrations of BA and NAA thinned both cultivars significantly and no significant difference was found between BA or NAA thinning action. No concentration response on thinning was observed with neither BA nor NAA application. All BA or NAA separate treatments caused yield of fruit to shift to bigger size class. The only concentration response effect was found on evaluation of mean fruit weight data on ‘Golden Delicious’. The higher concentration of BA was used, the higher was the weight of ‘Golden Delicious’ fruit. On the opposite, the higher concentration of NAA was used, the lower was the weight of ‘Golden Delicious’ fruit (not significantly. When BA and NAA were sprayed on ‘Gala’ or ‘Golden Delicious’ as a tank mix combination, similar effect on thinning or fruit growth occurred comparing to BA or NAA when sprayed alone. Return bloom was enhanced on all thinned ‘Gala’ trees while flower formation of ‘Golden Delicious’ was better in the case of BA 200 ppm, NAA 5 ppm, NAA 20 ppm or tank mix spraying of BA 20 ppm + NAA 5 ppm.

  10. Ba{sub 2}TeO: A new layered oxytelluride

    Energy Technology Data Exchange (ETDEWEB)

    Besara, T. [National High Magnetic Field Laboratory, Condensed Matter Sciences Department, 1800 E. Paul Dirac Dr., Tallahassee, FL 32310 (United States); Ramirez, D. [National High Magnetic Field Laboratory, Condensed Matter Sciences Department, 1800 E. Paul Dirac Dr., Tallahassee, FL 32310 (United States); Florida Agricultural and Mechanical University—Florida State University College of Engineering, Department of Chemical and Biomedical Engineering, 2525 Pottsdamer St., Tallahassee, FL 32310 (United States); Sun, J. [National High Magnetic Field Laboratory, Condensed Matter Sciences Department, 1800 E. Paul Dirac Dr., Tallahassee, FL 32310 (United States); Florida Agricultural and Mechanical University—Florida State University College of Engineering, Department of Chemical and Biomedical Engineering, 2525 Pottsdamer St., Tallahassee, FL 32310 (United States); Oak Ridge National Laboratory, 1 Bethel Valley Road, Oak Ridge, TN 37831 (United States); Whalen, J.B. [National High Magnetic Field Laboratory, Condensed Matter Sciences Department, 1800 E. Paul Dirac Dr., Tallahassee, FL 32310 (United States); Specialized Crystal Processing, Inc., 400 Capital Circle SE, Suite 18227, Tallahassee, FL 32301 (United States); Tokumoto, T.D.; McGill, S.A. [National High Magnetic Field Laboratory, Condensed Matter Sciences Department, 1800 E. Paul Dirac Dr., Tallahassee, FL 32310 (United States); Singh, D.J. [Oak Ridge National Laboratory, 1 Bethel Valley Road, Oak Ridge, TN 37831 (United States); Siegrist, T. [National High Magnetic Field Laboratory, Condensed Matter Sciences Department, 1800 E. Paul Dirac Dr., Tallahassee, FL 32310 (United States); Florida Agricultural and Mechanical University—Florida State University College of Engineering, Department of Chemical and Biomedical Engineering, 2525 Pottsdamer St., Tallahassee, FL 32310 (United States)

    2015-02-15

    Single crystals of the new semiconducting oxytelluride phase, Ba{sub 2}TeO, were synthesized from barium oxide powder and elemental tellurium in a molten barium metal flux. Ba{sub 2}TeO crystallizes in tetragonal symmetry with space group P4/nmm (#129), a=5.0337(1) Å, c=9.9437(4) Å, Z=2. The crystals were characterized by single crystal x-ray diffraction, heat capacity and optical measurements. The optical measurements along with electronic band structure calculations indicate semiconductor behavior with a band gap of 2.93 eV. Resistivity measurements show that Ba{sub 2}TeO is highly insulating. - Graphical abstract: Starting from a simple stacking of rocksalt layers, the final structure of Ba{sub 2}TeO can be obtained by accommodation of structural strain via atom displacements. Density of states calculations and optical absorbance measurements show that Ba{sub 2}TeO has a band gap of 2.93 eV, indicative of semiconductor behavior. - Highlights: • Single crystal synthesis of a new layered oxytelluride, Ba{sub 2}TeO. • The structure features inverse PbO-type BaO layers and NaCl-type BaTe layers. • Optical absorbance show Ba{sub 2}TeO to be a semiconductor with a 2.93 eV gap. • Density of states indicate a small hybridization between Te 5p and Ba 5d states. • The BaTe (BaO) layers dominate the heat capacity at low (high) temperatures.

  11. Epitaxial growth and spectroscopic investigation of BaSO4:Mn6+ layers

    NARCIS (Netherlands)

    Ehrentraut, D.; Pollnau, Markus; Kück, S.

    2002-01-01

    We report on the first layer growth of a Mn6+-doped material. Large-size BaSO4 substrates of 10×6×4 mm3 were grown from a LiCl solvent by the flux method. Flat surfaces of undoped BaSO4 were then achieved by use of liquid-phase epitaxy (LPE) from a CsCl–KCl–NaCl solvent. Finally, BaSO4:Mn6+ layers

  12. Medication safety in pregnancy : results from the MoBa study

    OpenAIRE

    Hedvig Nordeng; Eivind Ystrom; Malin Eberhard-Gran

    2014-01-01

    This article summarizes the results of several of our studies on medication safety in pregnancy based on the Norwegian Mother and Child Cohort Study (MoBa). Medications investigated include antidepressants, NSAIDs, codeine, triptans, paracetamol and certain herbals. A major advantage of these studies is that MoBa has information on prescribed medications, over-the-counter medications and herbal medications. Moreover, MoBa enables the possibility of including a disease comparison group, and lo...

  13. NUCLEI OF DESERTIFICATION IN STATE OF PARAÍBA

    Directory of Open Access Journals (Sweden)

    Jose Jakson Amancio Alves

    2009-06-01

    Full Text Available The present work boards desertification problem in Paraíba who directly is related to degradation produced by the man in the stunted sparse forest and in the environmental terms and fitogeography of this geoecosystem. The domain geoecology of the stunted sparse forests extends for about 1037.517,80 km², under the latitudes between tropics, comprehended between 2º 45’ and 17º 21’ LS.  Its area corresponds to 54% of the region Northeast and to 11% of the brazilian territory; it constitutes the droughts called polygon. In the stunted sparse forest the woody species call the attention for their biological forms and by the dominant position in the formation structure. In magnitude function of these characteristic, that corresponds to the largest problem in desertification cores generation in state of Paraíba. These woody species of rickety postage are the appreciated most for the burning in coal-pits, bakeries oven, etc. they are fácies more drought and degraded of the stunted sparse forests. Another aspect to observe is that to the natural fragility of this ecosystem brings serious consequences for geótopos and for biocenoses, as well as, the devastation practice of great spaces by the burnt for the pasture areas, provoking great unbalance in the ecosystem and contributing with the earth’s degradation process. That work points a series of surveys that emphasize that process in state of Paraíba, as well as, a contribution for contention of their effects.

  14. Structure and stability of BaTiSi₂O₇.

    Science.gov (United States)

    Viani, Alberto; Palermo, Andrea; Zanardi, Stefano; Demitri, Nicola; Petrícek, Václav; Varini, Federico; Belluso, Elena; Ståhl, Kenny; Gualtieri, Alessandro Francesco

    2015-04-01

    Due to their optical, photo-luminescence (PL), and afterglow properties, barium titanosilicates are compounds of great interest for functional materials and light-emitting devices. Among them, BaTiSi2O7 (BTS2) is certainly one of the most intriguing; it displays peculiar properties (e.g. PL orange emission) whose exhaustive explanation has been hampered to date by the lack of a structure model. In this work, BTS2 and the related compound BaTiSi4O11 (BTS4) were synthesized through conventional solid-state reaction methods. BTS2 invariably shows complex twinning patterns. Thus, its structure solution and Rietveld structure refinement were attempted using synchrotron powder diffraction. BTS2 was found to be an intergrowth of monoclinic and triclinic crystals. The monoclinic phase has the space group P21/n and unit cell a = 7.9836 (3), b = 10.0084 (4), c = 7.4795 (3) Å, and β = 100.321 (3)°, whereas the triclinic phase has the space group P\\bar 1 and unit cell a = 7.99385 (4), b = 10.01017 (5), c = 7.47514 (3) Å, α = 90.084 (8), β = 100.368 (8) and γ = 89.937 (9)°. These lattices can be seen as a distortion of that of tetragonal synthetic β-BaVSi2O7 with Ti in place of V. The structure models obtained from this study confirm the presence of fivefold coordinated Ti atoms in a distorted pyramidal configuration. The proposed solution supports existing theories for the explanation of the PL orange colour in BTS2.

  15. Neutron diffraction study of the crystal structure of BaMoO{sub 4}: A suitable precursor for metallic BaMoO{sub 3} perovskite

    Energy Technology Data Exchange (ETDEWEB)

    Nassif, V.; Carbonio, R.E. [Univ. Nacional de Cordoba (Argentina). Inst. de Investigaciones en Fisicoquimica; Alonso, J.A. [C.S.I.C., Madrid (Spain). Inst. de Ciencia de Materiales

    1999-08-01

    BaMoO{sub 3}, metallic and Pauli paramagnetic, has been prepared by controlled reduction of BaMoO{sub 4}. This precursor, containing Mo(VI), is unusually stable against reduction, due to structural factors. The crystal structure of BaMoO{sub 4} has been refined from neutron powder diffraction data: space group I4{sub 1}/a (no. 88), Z = 4, a = 5.5479(9), and c = 12.743(2) {angstrom}. A bond-valence study allowed the authors to detect the presence of slight tensile and compressive stresses in the crystal structure of BaMoO{sub 4}, in which Ba is overbonded and Mo is underbonded. However, this effect is less pronounced than in other AMO{sub 4} oxides with a scheelite structure (A = Ca, Sr, Ba; M = Mo, W): BaMoO{sub 4} contains the M cation exhibiting the closest valence to the nominal value of 6+, suggesting a large covalent contribution to the Mo-O bonds. This observation is coherent with the large thermal stability of this compound against reduction, taking place at temperatures above 920 C in H{sub 2} flow.

  16. Thermal analysis of formation of nano-crystalline BaTiO3 using Ba(NO32 and TiO2

    Directory of Open Access Journals (Sweden)

    Md. Jawed Ansaree

    2015-12-01

    Full Text Available The reaction of Ba(NO32 with TiO2 was studied by thermogravimetric (TG and differential scanning calorimetric (DSC techniques up to 1000 °C and in nitrogen atmosphere. It was found that the formation of BaTiO3 takes place above 600 °C and that precursor mixing time and heating rate have no effect on the reaction temperature. BaTiO3 powder was prepared by calcination of Ba(NO32 and TiO2 precursor mixture at 800 °C for 8 h. X-ray diffraction analysis of the synthesized BaTiO3 confirmed the formation of tetragonal phase with lattice parameters a = 3.9950±0.0003 Å and c = 4.0318±0.0004 Å. Thermal analysis of the synthesized BaTiO3 powder showed weight loss within temperature range 40–1000 °C of only 0.40%. This small amount of weight loss was connected with some impurity phase, and identified as BaCO3 using Fourier transform infrared (FTIR technique.

  17. Mosaico da sustentabilidade em destinos turísticos : cooperação e conflito de micro e pequenas empresas no roteiro integrado Jericoacoara – Delta do Parnaíba – Lençóis Maranhenses

    OpenAIRE

    Costa, Helena Araújo

    2010-01-01

    Esta tese trata de relações sociais que envolvem micro e pequenas empresas (MPE) no roteiro turístico integrado que perpassa Jericoacoara (Ceará), o Delta do Parnaíba (Piauí) e os Lençóis Maranhenses (Maranhão), também chamado Costa Norte. O objetivo é identificar nas relações sociais os aspectos de cooperação e conflito que produzem condições favoráveis à sustentabilidade nos destinos turísticos da região analisada e os fatores que atuam sobre tais relações. A pesquisa compõe-se de três etap...

  18. Towards trapping and laser cooling Ba and La ions

    Science.gov (United States)

    Hankes, Jessie; Nelson, Amanda; Banner, Patrick; Olmschenk, Steven

    2017-04-01

    Trapped atomic ions are one of the leading candidates for applications in quantum information. We are currently working with barium ions (Ba II), directly loaded by laser ablation of a barium titanium oxide target, and laser cooled using visible laser light (650 nm and 494 nm). Motivated by applications of quantum networks, we also present progress towards laser cooling and trapping lanthanum ions (La III), which should enable quantum information protocols at telecom wavelengths for long-distance applications. This research is supported by the Army Research Office, Research Corporation for Science Advancement, and Denison University.

  19. On the compressibility of BaFe(2)AS(2)

    DEFF Research Database (Denmark)

    Jørgensen, J. E.; Olsen, J. S.; Gerward, Leif

    2009-01-01

    BaFe(2)AS(2) has been studied by high-pressure energy dispersive X-ray diffraction. The compression mechanism was found to be highly anisotropic, and a tetragonal to orthorhombic phase transition was observed at about 17 GPa. The length of the a- and c-axes of the tetragonal phase is reduced by 2...... and 11%, respectively, at the transition pressure. Furthermore, an increase in compressibility was observed at about 1 GPa. The zero-pressure bulk modulus was determined to be B-0 = 71(4) GPa using experimental data points in the pressure range from 1 to 16.5 GPa. The experimental results are supported...

  20. Crystal structure of Ba5In4Sb6

    Directory of Open Access Journals (Sweden)

    Ming-Yan Pan

    2015-05-01

    Full Text Available The title compound, pentabarium tetraindium hexaantimony, was synthesized by an indium-flux reaction and its structure features layers composed of edge-sharing In2Sb6 units. The voids between the In4Sb6 layers are filled by Ba2+ cations, which are all surrounded by six Sb atoms and form bicapped octahedral or triangular prismatic coordination geometries. There are five barium ions in the asymmetric unit: one has no imposed crystallographic symmetry, two lie on mirror planes and two have mm2 point symmetry. The two In atoms and four Sb atoms in the asymmetric unit all lie on general crystallographic positions.

  1. Interdiffusion at the BaCuSeF/ZnTe interface

    Energy Technology Data Exchange (ETDEWEB)

    Zakutayev, Andriy, E-mail: andriy.zakutayev@lifetime.oregonstate.edu [Department of Physics, Oregon State University, Corvallis, OR 97331-6507 (United States); Tate, Janet [Department of Physics, Oregon State University, Corvallis, OR 97331-6507 (United States); Xie Sujing [CAMCOR High Resolution and Analytical Facility, Eugene, OR 97403-1241 (United States); Gibbons, Brady J. [School of Mechanical, Industrial, and Manufacturing Engineering, Oregon State University, Corvallis, OR 97331-6001 (United States); Platt, Heather A.S.; Keszler, Douglas A. [Department of Chemistry, Oregon State University, Corvallis, OR 97331-6507 (United States); Barati, Alireza; Klein, Andreas; Jaegermann, Wolfram [Department of Materials and Earth Sciences, Darmstadt University of Technology, Darmstadt 64287 (Germany)

    2011-08-31

    BaCuSeF/ZnTe is a model system to investigate physical and chemical properties of the interfaces of non-oxide wide-bandgap p-type semiconductors with materials used in chalcogenide solar cells. The BaCuSeF/ZnTe interface was studied using electron microscopy and photoelectron spectroscopy. Both techniques indicate that Se and Cu from BaCuSeF diffuse into ZnTe creating an interdiffused layer between these two materials. The interdiffusion may be attributed to the differences in materials formation enthalpies and to Fermi level pinning in BaCuSeF.

  2. Synthesis and Characterization of Bowl-Like Single-Crystalline BaTiO3 Nanoparticles

    Science.gov (United States)

    2010-01-01

    Novel bowl-like single-crystalline BaTiO3 nanoparticles were synthesized by a simple hydrothermal method using Ba(OH)2·8H2O and TiO2 as precursors. The as-prepared products were characterized by XRD, Raman spectroscopy, SEM and TEM. The results show that the bowl-like BaTiO3 nanoparticles are single-crystalline and have a size about 100–200 nm in diameter. Local piezoresponse force measurements indicate that the BaTiO3 nanoparticles have switchable polarization at room temperature. The local effective piezoelectric coefficient is approximately 28 pm/V. PMID:20596350

  3. Synthesis and Characterization of Bowl-Like Single-Crystalline BaTiO3 Nanoparticles

    OpenAIRE

    Deng, Zhao; Dai, Ying; Chen, Wen; Pei, Xinmei; Liao, Jihong

    2010-01-01

    Novel bowl-like single-crystalline BaTiO3 nanoparticles were synthesized by a simple hydrothermal method using Ba(OH)2?8H2O and TiO2 as precursors. The as-prepared products were characterized by XRD, Raman spectroscopy, SEM and TEM. The results show that the bowl-like BaTiO3 nanoparticles are single-crystalline and have a size about 100?200 nm in diameter. Local piezoresponse force measurements indicate that the BaTiO3 nanoparticles have switchable polarization at room temperature. The local ...

  4. Enhanced 77 K vortex-pinning in Y Ba2Cu3O7−x films with Ba2Y TaO6 and mixed Ba2Y TaO6 + Ba2Y NbO6 nano-columnar inclusions with irreversibility field to 11 T

    Directory of Open Access Journals (Sweden)

    F. Rizzo

    2016-06-01

    Full Text Available Pulsed laser deposited thin Y Ba2Cu3O7−x (YBCO films with pinning additions of 5 at. % Ba2Y TaO6 (BYTO were compared to films with 2.5 at. % Ba2Y TaO6 + 2.5 at. % Ba2Y NbO6 (BYNTO additions. Excellent magnetic flux-pinning at 77 K was obtained with remarkably high irreversibility fields greater than 10 T (YBCO-BYTO and 11 T (YBCO-BYNTO, representing the highest ever achieved values in YBCO films.

  5. Satisfacción con el aspecto dental general y tratamientos deseados en estudiantes universitarios

    Directory of Open Access Journals (Sweden)

    Clarisse Virginia Díaz Reissner

    2015-08-01

    Full Text Available La apariencia dental es considerada un componente de la belleza facial, que al ser restaurada por el odontólogo, podría influir con un efecto positivo en la valoración personal y la calidad de vida. El objetivo del estudio fue determinar la satisfacción general con la apariencia dental en estudiantes de las carreras de Artes Visuales y Diseño de Indumentaria del Instituto Superior de Arte de la Facultad de Arquitectura Diseño y Arte de la Universidad Nacional de Asunción, matriculados en el 2014. Se aplicó un cuestionario que contenía preguntas sobre datos demográficos, satisfacción con el aspecto dental general y con diversos aspectos dentales, así como también sobre el tratamiento estético deseado. La muestra quedó conformada por 108 estudiantes, que corresponde al 49,1% de la población. Se observó que el 48,2% se encontraba insatisfecho con el aspecto general de sus dientes, siendo los tratamientos de elección: blanqueamiento (63,9% y ortodoncia (47,2%. Los factores predisponentes a la insatisfacción fueron residir en Gran Asunción e interior del país y percibir sus dientes como desalineados. Por otro lado, favoreció la satisfacción el haberse sentirse a gusto con el color de sus dientes.

  6. Impacto de las redes sociales e internet en la adolescencia: aspectos positivos y negativos

    Directory of Open Access Journals (Sweden)

    L. Elías Arab, Dr.

    2015-01-01

    Full Text Available Este artículo presenta una revisión teórica del impacto, tanto positivo como negativo, de las redes sociales en los adoles- centes y de la relación directa entre esto y el uso o abuso de las nuevas tecnologías. A su vez, se establece el vínculo entre las formas de utilizarlas y las características psicológi- cas individuales, los desarrollos previos de personalidad y el control parental. Se toma como punto de partida el desa- rrollo adolescente asociado a la construcción de la identidad juvenil en el contexto de un nuevo paradigma comunica- cional (cibercomunicación, donde el límite entre lo públi- co y lo privado se torna cada vez más difuso. Se expone la terminología propia de las redes sociales y se pone énfasis en las estrategias de supervisión y control adulto. Se deta- llan los aspectos positivos que las nuevas tecnologías ofre- cen (diversas oportunidades de aprendizaje, entretención, socialización, desarrollo de habilidades, creatividad y me- jora de la motivación al aprendizaje especialmente en ado- lescentes, entre otros y los aspectos negativos asociados (distanciamiento afectivo, pérdida de límites en la comuni- cación y pérdida de la capacidad de escucha, entre otros. Este artículo destaca la necesidad de entregar y estimular modelos de comunicación social reales y una educación en el uso de las nuevas tecnologías. El objetivo es actualizar y orientar a profesionales de la salud sobre los aspectos posi- tivos y/o negativos de las redes sociales en los adolescentes.

  7. Aspectos histológicos del aparato digestivo de la alpaca

    OpenAIRE

    De la Vega D., Elmo; Departamento de Patología, Facultad de Medicina Veterinaria, Universidad Nacional Mayor de San Marcos, Lima, Perú

    2014-01-01

    Se ha realizado el estudio de la anatomía macroscópica y microscópica normal, del aparato digestivo de la Alpaca en 11 animales, clínicamente normales. El aspecto microscópico ha revelado variación estructural en los proventrículos de estos animales, con respecto a los demás rumiantes por nosotros conocidos. The present article deals with the anatomical study of the digestive system in 11 Alpacas ("Lama glama pacos"). The author has made the microscopical studies on the digestive system an...

  8. Aspectos cognitivos de pacientes com a síndrome de Noonan

    OpenAIRE

    Carolina Rabello Padovani

    2016-01-01

    A síndrome de Noonan é uma doença autossômica dominante geneticamente heterogênea caracterizada por aspectos faciais distintos, atraso no desenvolvimento, dificuldades de aprendizado, baixa estatura, defeitos cardíacos congênitos, pectus excavatum e pescoço alado. Mutações que alteram genes que codificam proteínas com atuação na via RAS-MAPK causam a síndrome de Noonan e têm sido bastante estudadas. No entanto, há poucas informações sobre o perfil cognitivo da síndrome de Noonan. Neste estudo...

  9. Novos aspectos sobre a intoxicação por Trema micrantha (Cannabaceae) em equideos

    OpenAIRE

    Pavarini, Saulo Petinatti; Bandinelli,Marcele Bettim; Bassuino,Daniele Mariath; Correa,Gabriel Laizola Frainer; Bandarra, Paulo Mota; Driemeier, David; Hohendorff,Raquel Von; Both,Maria do Carmo

    2013-01-01

    Trema micrantha é uma planta arbórea distribuída amplamente no Brasil. Descrevem-se nesse trabalho novos aspectos epidemiológicos e patológicos relacionados com a intoxicação por essa planta em equídeos. Dois equinos adultos da raça Crioula e dois asininos, de localidades distintas, foram intoxicados naturalmente por Trema micrantha, após consumirem grande quantidade da planta que ficou disponível a eles após uma poda. Além disso, um cavalo adulto, de outra propriedade, que estava passando po...

  10. Aspectos metacognitivos durante la resolución de problemas en aulas de primaria

    OpenAIRE

    Ramos, M; Vicente, S.; Rosales, J.; Sastre, S.

    2016-01-01

    La interacción maestro-alumnos cuando resuelven problemas en el aula es un aspecto de gran interés dada la relevancia de esta tarea en el desarrollo de la Competencia Matemática. En este sentido, se han realizado minuciosos estudios para analizar los procesos generados durante dicha interacción (p.e: razonamiento). Este trabajo analiza los procesos metacognitivos explicitados durante la resolución conjunta entre maestro-alumnos de problemas con diferente nivel de dificultad. Para ello, se gra...

  11. La pobreza en Colombia, 2001-2005. Curvas globales, dominancia y aspectos inferenciales

    Directory of Open Access Journals (Sweden)

    María Margarita Bahamón

    2013-12-01

    Full Text Available Este artículo propone un método para analizar la pobreza mediante curvas TIP/IID. Analiza la dominancia estocástica de primero y segundo órdenes entre las curvas, incluyendo sus aspectos inferenciales, y propone un contraste de hipótesis adecuado. Empleando datos de la Encuesta Continua de Hogares de 2001 a 2005 demuestra que la pobreza en Colombia no depende de errores de las muestras sino que corresponde a las variaciones registradas en esos años.

  12. La pobreza en Colombia, 2001-2005. Curvas globales, dominancia y aspectos inferenciales

    OpenAIRE

    María Margarita Bahamón; Juana Domínguez; José Javier Núñez

    2014-01-01

    Este artículo propone un método para analizar la pobreza mediante curvas TIP/IID. Analiza la dominancia estocástica de primero y segundo órdenes entre las curvas, incluyendo sus aspectos inferenciales, y propone un contraste de hipótesis adecuado. Empleando datos de la Encuesta Continua de Hogares de 2001 a 2005 demuestra que la pobreza en Colombia no depende de errores de las muestras sino que corresponde a las variaciones registradas en esos años.

  13. Aspectos biopsicossociais na surdocegueira Bio psycho social aspects in deaf blindness

    Directory of Open Access Journals (Sweden)

    Susana Maria Mana de Aráoz

    2008-04-01

    Full Text Available O presente artigo tem por objetivo discutir aspectos biopssicossociais referentes a pessoas com surdocegueira e suas famílias com o objetivo trazer a tona estas questões que se tem mostrado importantes para o desenvolvimento dos atendimentos aos surdocegos. Está baseado em dados bibliográficos de pesquisas com pais e outras divulgações abordando as causas que são, principalmente, Rubéola Congênita, prematuridade, infecções, acidentes, síndromes genéticas ou não. Coloca as conseqüências das mesmas, o desenvolvimento educacional alcançado e as necessidades das famílias em aspectos ligadas às áreas da saúde, educação, lazer, segurança e inclusão social. Também trata da adaptação das famílias ao impacto produzido pela surdocegueira tendo em conta aspectos orgânicos, afetivo-relacional, sócio-culturais e de produtividade. Reflete sobre a necessidade da divulgação dos conhecimentos e da ação conjunta de todas as partes envolvidas nos mais diversos aspectos da vida dos surdocegos para conseguir o desenvolvimento dos atendimentos para os surdocegos.The objective of the present article is to discuss bio-psycho-social aspects related to people with deaf blindness and their families so as to highlight those issues that have become important for the development of working methods in deaf blindness. It is based on bibliographic data found in research with parents of deaf blind children and other publications that deal with the causes of the condition. The main causes are congenital German measles, prematurity, infection, genetic or non genetic syndromes. The authors discuss the results of the various presentations, the expected educational development and the needs of the families in aspects related to health, education, leisure, safety and social inclusion. They also discusses issues of family adaptation to the impact produced by deaf blindness, taking into account organic, social-cultural, affect and inter

  14. Cambio organizacional: Aspecto trascendental para las instituciones de educación superior en Venezuela

    OpenAIRE

    Nelson Labarca; Juliana Ferrer; Esmeralda Villegas

    2006-01-01

    El artículo presenta el estudio de aspectos teóricos gerenciales para el cambio organizacional en el contexto de las instituciones de educación superior en Venezuela. En primer lugar, se plantea la resistencia al cambio, tanto individual como organizacional. En segundo lugar, el camino para superar la resistencia al mismo, los modelos gerenciales para administrar dicho proceso, así como la Universidad desde la perspectiva de la complejidad. Se concluye que la actual dinámica económica, políti...

  15. Aspectos celulares en el diagnóstico y tratamiento de los defectos faciales

    OpenAIRE

    Sara Elena Panizo Bruzón; Salvador Javier Santos Medina; Lourdes Bouza Piard

    2014-01-01

    El manejo de los defectos congénitos refleja globalmente el estilo de vida y la cultura de los diferentes pueblos. Aunque los defectos faciales no constituyan peligro para la vida, existe el daño psicológico y estético para el niño y la angustia para la familia. Se realizó una revisión bibliográfica de los aspectos celulares novedosos, alternativas para el diagnóstico y tratamiento de los defectos congénitos faciales, empleando los recursos disponibles en la red infomed. Se reporta la fisura ...

  16. Aspectos cognitivos de la función simbólica

    OpenAIRE

    Sánchez Gómez, Paloma

    1993-01-01

    La presente investigación tiene como finalidad estudiar los aspectos cognitivos del simbolismo intercultural, de la función simbólica de la mente humana: las estructuras cognitivas-simbolo y metafora-fundamentalmente- son el proceso en el que el ser humano va organizando los datos sensoriales e intelectivos para producir los esquemas y reglas que configuran su conocimiento y conducta. Se divide en cuatro partes. La primera y segunda se orientan al encuadramiento del tema dentro de la antropol...

  17. Prótesis dental en el paciente anciano: aspectos relevantes

    OpenAIRE

    Almeida, Erika Oliveira de; Alumno de Maestría en Odontología, área de Prótesis Dental. Facultad de Odontología de Araçatuba - FOA. Universidad Estadual Paulista - UNESP. Sao Paulo,; Silva, Eulália Maria Martins da; Docente de Odontogeriatria. Facultad de Odontología de Araçatuba - FOA. Universidad Estadual Paulista - UNESP. Sao Paulo,; Falcón Antenucci, Rosse Mary; Alumno de Maestría en Odontología, área de Prótesis Dental. Facultad de Odontología de Araçatuba - FOA. Universidad Estadual Paulista - UNESP. Sao Paulo,; Freitas Junior, Amílcar Chagas; Alumno de Maestría en Odontología, área de Prótesis Dental. Facultad de Odontología de Araçatuba - FOA. Universidad Estadual Paulista - UNESP. Sao Paulo,

    2014-01-01

    Para el paciente anciano la prótesis dental es una integradora familiar, social, mantenedora de la salud general y elevadora de la expectativa de vida. Algunos cambios fisiológicos, patológicos y funcionales que ocurren con los elementos dentales en la tercera edad pueden repercutir en el tratamiento protésico. La siguiente revisión de literatura destaca los aspectos  fundamentales que deben ser considerados en el tratamiento protésico de pacientes ancianos. Se destacan las particularidades d...

  18. ALGUNOS ASPECTOS DEL DERECHO PENAL HISTÓRICO ESPAÑOL

    Directory of Open Access Journals (Sweden)

    Carlos Merchán Aparicio

    2017-06-01

    Full Text Available Este artículo analiza dos aspectos distintos del Derecho Penal del Antiguo Régimen. En primer lugar un estudio del marco global de la cuestión y las categorías y tipos penales de la época, pero sobre todo y en segundo lugar el análisis de un caso penal paradigmático a principios del siglo XVII, como fue el llamado “proceso Ezpeleta”, asesinato entre cuyos testigos procesales figura Miguel de Cervantes y su familia, lo que da al caso un valor especial.

  19. El aspecto y sus cualidades tradicionales perfecto e imperfecto: análisis e inconsistencia

    OpenAIRE

    JORGE ALBERTO VÁSQUEZ GONZÁLEZ

    2017-01-01

    Se analizan el aspecto y sus cualidades tradicionales –perfecto e imperfecto– en ciertas formas verbales del español con el fin de mostrar un problema de inconsistencia conceptual. La distinción aspectual entre los tiempos simple y compuesto de la conjugación verbal española con arreglo a la terminología latina de infectum y perfectum, según se observa en la normatividad de la Real Academia Española (RAE), presenta un equívoco. Se propone, luego de una adecuada comprensión del concepto de par...

  20. Fertilidad de suelos : Objetivos de su conocimiento y algunos aspectos problemáticos

    OpenAIRE

    Mizuno, Ichiro

    1982-01-01

    En esta exposición se tocarán algunos aspectos problemáticos del amplio campo de la fertilidad de los suelos y se efectuarán consideraciones referentes a temas no debidamente atendidos en el mismo. En la I, II y III Reuniones Nacionales de Fertilidad y Usos de Fertilizantes no se interpretó el amplio objetivo que se persigue y se lo consideró como un mero fomento del uso de los fertilizantes. Es por ello oportuno reiterar la idea acerca de la necesidad del conocimiento de la fertilidad ...

  1. Edad, crecimiento y algunos aspectos reproductivos y alimentarios de la caballa (Scomber japonicus peruanus)

    OpenAIRE

    Mendo A., Jaime

    1984-01-01

    El presente trabajo comprende el estudio de algunos aspectos de la biología de la caballa (Scomber japonicus peruanus)referidos a la reproducción, alimentación y crecimiento con material procedente de los laboratorios regionales del Instituto del Mar del Perú (IMARPE) en Chimbote y Callao para los años 1976-1978. Se determinó que el desove de la caballa desembarcada en ambos puertos ocurre con mayor intensidad a fines de primavera y durante el verano; sin embargo, se encontraron individuo...

  2. Algunos aspectos de la Reforma al Código de Procedimiento Laboral (Ley 712 de 2001

    Directory of Open Access Journals (Sweden)

    Armando Rojas

    2002-01-01

    Full Text Available El pasado 9 de junio entró en vigencia la ley 712 del 2001, ley quereformó algunos aspectos del código procesal del trabajo que ahora sellama código procesal del trabajo y de la seguridad social. La razón desu creación obedeció a la necesidad de actualizar un estatuto procesal demás de cincuenta años a la práctica procesal de la actualidad, necesitadade la urgente descongestión de los procesos en los despachos judiciales

  3. Aspectos nutricionales de la leche de cabra (Capra hircus y sus variaciones en el proceso agroindustrial

    Directory of Open Access Journals (Sweden)

    Alejandro Chac\\u00F3n Villalobos

    2005-01-01

    Full Text Available Este trabajo abordó los principales aspectos nutricionales relacionados con la leche de cabra tales como la composición química (proteínas, aminoácidos, minerales, grasas, factores bioactivos, el valor nutricional, la función de la leche de cabra como alimento funcional y antialergénico, así como losprincipales efectos nutricionales del manejo animal y procesamiento agroindustrial de la leche (refrigeración, congelación,tratamientos térmicos.

  4. EMPREENDEDORISMO CORPORATIVO - ASPECTOS DE INOVAÇÃO E MUDANÇA ORGANIZACIONAL

    Directory of Open Access Journals (Sweden)

    Luciana Gehlen

    2016-11-01

    Full Text Available Este artigo analisa o conceito de empreendedorismo corporativo – conhecido também como empreendedorismo interno ou intra-empreendedorismo, seus aspectos relacionados aos fatores de criatividade, inovação e mudança organizacional como fatores de competitividade das organizações, bem como o perfil do empreendedor corporativo e o ambiente organizacional necessário para que o empreendedorismo interno aconteça. Palavras-chave: empreendedorismo corporativo, empreendedorismo interno, intra-empreendedorismo, inovação, mudança organizacional.

  5. Aspectos psicosociales en el embarazo en mujeres menores de edad en España

    OpenAIRE

    Ibáñez Blanco, Raquel

    2015-01-01

    Me decidí a realizar mi Trabajo de Fin de Grado sobre los aspectos fisiológicos y emocionales en mujeres menores de edad porque considero que la gestación es uno de los momentos claves en la vida de cualquier mujer. Esta situación se ve llevada al extremo cuando tiene lugar en una menor de edad. Aunque en principio pueda parecer algo lejano y puntual, podremos comprobar que es una situación más habitual de lo que esperamos. Además de los importantes cambios anatómicos y fisiológicos que se pr...

  6. Aspectos relevantes no diagnóstico de dort e fibromialgia

    OpenAIRE

    de Alencar, JF; Coury, HJCG; Oishi,J.

    2009-01-01

    CONTEXTUALIZAÇÃO: A dor crônica e difusa encontra-se presente tanto nas Lesões por Esforços Repetitivos (LER)/Distúrbios Osteomusculares Relacionados ao Trabalho (DORT) como na Fibromialgia, trazendo dificuldades diagnósticas, preventivas e terapêuticas para profissionais da saúde envolvidos no tratamento de acometidos. OBJETIVOS: Analisar os aspectos relevantes na emissão dos diagnósticos de DORT e Fibromialgia na percepção de médicos assistenciais e peritos. MÉTODOS: Neste estudo, 75 médico...

  7. Aspectos metabólicos e funcionais do zinco na síndrome de Down

    OpenAIRE

    Raynério Costa,Marques; Marreiro,Dilina do Nascimento

    2006-01-01

    Este estudo relata os aspectos funcionais do zinco, bem como a participação desse mineral nas alterações metabólicas presentes em indivíduos portadores de Síndrome de Down. A maioria dos trabalhos realizados observou que o estado nutricional relativo ao zinco nesses pacientes está inadequado, com alterações no sistema antioxidante, imunológico e no metabolismo dos hormônios da tireóide. Estudos in vitro apontam que o zinco participa como cofator da enzima deiodinase tipo II na conversão perif...

  8. Aspectos generales sobre la elaboración del licor de limón

    OpenAIRE

    Arlyn Reyes-Linares; Jorge Pino-Alea; Verónica Moreira-Ocanto

    2011-01-01

    Se presenta una revisión bibliográfica sobre el licor de limón (limoncello). Se abordan aspectos generales de esta temática, así como las materias primas que se emplean en su elaboración y los procesos de obtención. Se comentan los trabajos reportados relacionados con el licor de limón, los que muestran investigaciones sobre la composición, su caracterización para establecer la calidad del producto en el mercado y las posibles adulteraciones, así como el proceso de producción tradicional y un...

  9. Aspectos culturales en el proceso de padecer cáncer de mama

    OpenAIRE

    Carvalho Fernández, Ana Fátima; Mesquita Melo, Elizabeth; de Almeida Araújo, Iliana María; Figueiredo Carvalho, Zuíla María

    2012-01-01

    El objetivo de este estudio fue identificar el aspecto cultural en el proceso de padecer cáncer de mama según la visión de un grupo de mujeres mastectomizadas. El estudio etnográfico se llevó a cabo con 16 mujeres mastectomizadas integrantes de un grupo de auto-ayuda por medio de observaciones y entrevistas. La etnografía nos permitió comprender mediante la observación detallada y el análisis del estilo de vida y patrones culturales de estas mujeres, el proceso de tener cáncer de mama. Las mu...

  10. La dispepsia funcional: Aspectos biopsicosociales, evaluación y terapia psicológica

    OpenAIRE

    Stefano Vinaccia Alpi; Bonifacio Sandín; Sergio Tobón; Ariel César Núñez Rojas

    2008-01-01

    Se abordan los aspectos conceptuales del trastorno gastrointestinal Dispepsia funcional (DP), en lo que se refiere a su definición, prevalencia, clasificación y diagnóstico.; las causas y consecuencias de la DF desde una perspectiva biopsicosocial (variables socioeconómicas, demandas psicosociales, evaluación cognitiva y estrategias de afrontamiento, personalidad y comportamiento, mecanismos psicobiológicos, calidad de vida, tratamiento y evolución); la evaluación psicológica de la DF desde ...

  11. Tres reformas educativas europeas: Reino Unido, Francia y España: aspectos comparativos.

    Directory of Open Access Journals (Sweden)

    Inmaculada Egido Gálvez

    1997-01-01

    Full Text Available Desde una perspectiva unicamente aproximativa, este trabajo lleva a cabo un breve repaso de las reforrnas realizadas en los ultimos afios en el sistema educativo de tres paises europeos: Reino Unido, Francia y Espana. Tras la consideracion de los principales cambios introducidos por las leyes de reforma en relaci6n con la estructura del sistema, el curriculum, el profesorado y el gobiemo y la administraci6n de la educacion, se presenta lavaloraci6n crftica de algunos de los aspectos mas relevantes de las reformas. Por ultimo, se realizan algunas reflexiones globales derivadas de la comparaci6n entre los tres casos tratados

  12. Medicina del niño: aspectos biológicos

    OpenAIRE

    Brines Solanes, Juan

    2009-01-01

    Nuestra contribución en este ciclo de conferencias, se limitará al estadio de desarrollo que en la especie humana comprende un periodo intrauterino, que incluye el embrión y el feto, y otro extrauterino, dividido entre la infancia y la adolescencia; desarrollo que se puede abordar, como es bien sabido, desde las perspectivas biológica, psicológica o social. Nuestra aportación contemplará principalmente los aspectos biológicos.

  13. Métodos de reproducción asistida: aspectos psicológicos

    OpenAIRE

    Kattia Escalante Barboza

    2003-01-01

    Los aspectos psicológicos relacionados con los tratamientos de Reproducción Asistida refieren necesariamente a dos temas muy importantes: - La forma en que se afecta la relación de pareja cuando se diagnostica la infertilidad o la esterilidad, y las emociones que surgen en el proceso de confrontación del problema. - El esquema de tratamiento o acompañamiento "psicológico que debe darse de manera paralela al tratamiento médico.Psychological aspects related to assisted reproduction treatments r...

  14. Fatigue and retention in ferroelectric Y-Ba-Cu-O/Pb-Zr-Ti-O/Y-Ba-Cu-O heterostructures

    Science.gov (United States)

    Ramesh, R.; Chan, W. K.; Wilkens, B.; Gilchrist, H.; Sands, T.; Tarascon, J. M.; Keramidas, V. G.; Fork, D. K.; Lee, J.; Safari, A.

    1992-09-01

    Fatigue and retention characteristics of ferroelectric lead zirconate titanate thin films grown with Y-Ba-Cu-O(YBCO) thin-film top and bottom electrodes are found to be far superior to those obtained with conventional Pt top electrodes. The heterostructures reported here have been grown in situ by pulsed laser deposition on yttria-stabilized ZrO2 buffer [100] Si and on [001] LaAlO3. Both the a- and c-axis orientations of the YBCO lattice have been used as electrodes. They were prepared using suitable changes in growth conditions.

  15. Flora da Paraíba, Brasil: Combretaceae Flora of Paraíba, Brazil: Solanum L., Solanaceae

    Directory of Open Access Journals (Sweden)

    Maria Iracema Bezerra Loiola

    2009-06-01

    Full Text Available Apresenta-se o tratamento taxonômico da família Combretaceae como parte do projeto "Flora da Paraíba", que vem sendo realizado com o objetivo de identificar e catalogar as espécies da flora local. As identificações, descrições e ilustrações botânicas foram efetuadas pela análise morfológica de amostras frescas e espécimes herborizados, com o auxílio da bibliografia e análise de tipos, complementadas pelas observações de campo. Foram registradas 11 espécies subordinadas a cinco gêneros: Buchenavia (1, Combretum (8, Conocarpus (1 e Laguncularia (1. Algumas espécies possuem distribuição restrita aos manguezais, como Conocarpus erectus L. e Laguncularia racemosa (L. C.F. Gaertn., à Caatinga, como Combretum glaucocarpum Mart., C. leprosum Mart. e C. hilarianum D. Dietr., e a Floresta Atlântica, como Buchenavia tetraphylla (Aubl. R.A. Howard, Combretum fruticosum (Loefl. Stuntz e C. laxum Jacq.This taxonomic treatment of the genus Solanum is part of the "Flora da Paraíba" project which aims to identify and catalogue the species of the local flora. Botanical collections, field observations and morphological studies were done for identification, description and botanical illustration of the plant species, also supported by the literature and analysis of Brazilian and foreign herbaria, plus specimens from EAN and JPB herbaria. Twenty two species of Solanum were recorded in the state of Paraíba: Solanum agrarium Sendtn., S. americanum Mill., S. asperum Rich., S. asterophorum Mart., S. caavurana Vell., S. capsicoides All., S. crinitum Lam., S. jabrense Agra & M.Nee, S. melissarum Bohs, S. ovum-fringillae (Dunal Bohs, S. palinacanthum Dunal, S. paludosum Moric., S. paniculatum L., S. paraibanum Agra, S. polytrichum Moric., S. rhytidoandrum Sendtn., Solanum sp., S. stagnale Moric., S. stipulaceum Roem. & Schult., S. stramoniifolium Jacq., S. swartzianum Roem. & Schult. and S. torvum Sw. Three species are new records for Paraíba: S

  16. Sorghum silage production system in Cariri, Paraíba

    Directory of Open Access Journals (Sweden)

    Ebson Pereira Cândido

    2014-06-01

    Full Text Available The objective of this study was to characterize the sorghum farming and ensiling systems in the Cariri region of Paraíba State (Brazil, and to identify different groups of producers based on productive characteristics using frequency distributions, and principal component and cluster analyses. A total of 100 milk producers in the Caturité and Boqueirão municipalities in the dairy region of Cariri, Paraíba, were selected to fill out a questionnaire comprised of 32 questions to collect data on both qualitative and quantitative variables. Of the 100 properties studied, 88% cultivated sorghum as silage forage for feeding dairy cows, demonstrating the importance of this cultural practice in the region of Cariri. Statistical analyses based on the variables studied identified four groups, composed of 35, 8, 6, and 39 farmers. The sorghum cultivation and ensiling production system in Cariri can be improved through the evaluation and improvement of soil fertility to obtain higher forage production, application of weed control using herbicides, and implementation of mechanized planting and harvesting to improve efficiency and reduce costs associated with manpower.

  17. BaBar computing - From collisions to physics results

    CERN Multimedia

    CERN. Geneva

    2004-01-01

    The BaBar experiment at SLAC studies B-physics at the Upsilon(4S) resonance using the high-luminosity e+e- collider PEP-II at the Stanford Linear Accelerator Center (SLAC). Taking, processing and analyzing the very large data samples is a significant computing challenge. This presentation will describe the entire BaBar computing chain and illustrate the solutions chosen as well as their evolution with the ever higher luminosity being delivered by PEP-II. This will include data acquisition and software triggering in a high availability, low-deadtime online environment, a prompt, automated calibration pass through the data SLAC and then the full reconstruction of the data that takes place at INFN-Padova within 24 hours. Monte Carlo production takes place in a highly automated fashion in 25+ sites. The resulting real and simulated data is distributed and made available at SLAC and other computing centers. For analysis a much more sophisticated skimming pass has been introduced in the past year, ...

  18. Towards a sub 15-dBA optical micromachined microphone.

    Science.gov (United States)

    Kim, Donghwan; Hall, Neal A

    2014-05-01

    Micromachined microphones with grating-based optical-interferometric readout have been demonstrated previously. These microphones are similar in construction to bottom-inlet capacitive microelectromechanical-system (MEMS) microphones, with the exception that optoelectronic emitters and detectors are placed inside the microphone's front or back cavity. A potential advantage of optical microphones in designing for low noise level is the use of highly-perforated microphone backplates to enable low-damping and low thermal-mechanical noise levels. This work presents an experimental study of a microphone diaphragm and backplate designed for optical readout and low thermal-mechanical noise. The backplate is 1 mm × 1 mm and is fabricated in a 2-μm-thick epitaxial silicon layer of a silicon-on-insulator wafer and contains a diffraction grating with 4-μm pitch etched at the center. The presented system has a measured thermal-mechanical noise level equal to 22.6 dBA. Through measurement of the electrostatic frequency response and measured noise spectra, a device model for the microphone system is verified. The model is in-turn used to identify design paths towards MEMS microphones with sub 15-dBA noise floors.

  19. Stellar laboratories. III. New Ba v, Ba vi, and Ba vii oscillator strengths and the barium abundance in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Werner, K.; Quinet, P.; Kruk, J. W.

    2014-06-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: Reliable Ba v-vii oscillator strengths are used to identify Ba lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and to determine their photospheric Ba abundances. Methods: We newly calculated Ba v-vii oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Ba lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results: For the first time, we identified highly ionized Ba in the spectra of hot white dwarfs. We detected Ba vi and Ba vii lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE 0503-289. The Ba vi/Ba vii ionization equilibrium is well reproduced with the previously determined effective temperature of 70 000 K and surface gravity of log g = 7.5. The Ba abundance is 3.5 ± 0.5 × 10-4 (mass fraction, about 23 000 times the solar value). In the FUSE spectrum of G191-B2B, we identified the strongest Ba vii line (at 993.41 Å) only, and determined a Ba abundance of 4.0 ± 0.5 × 10-6 (about 265 times solar). Conclusions: Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Ba vi-vii line profiles in two white dwarfs' (G191-B2B and RE 0503-289) far-ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed to determine the photospheric Ba abundance of these two stars precisely. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for

  20. Thin films sputtered from Ba{sub 2}NdFeNb{sub 4}O{sub 15} multiferroic targets on BaFe{sub 12}O{sub 19} coated substrates

    Energy Technology Data Exchange (ETDEWEB)

    Bodeux, Romain [CNRS, ICMCB, UPR 9048, F-33600 Pessac (France); Univ. Bordeaux, ICMCB, UPR 9048, F-33600 Pessac (France); Michau, Dominique, E-mail: dominique.michau@icmcb.cnrs.fr [CNRS, ICMCB, UPR 9048, F-33600 Pessac (France); Univ. Bordeaux, ICMCB, UPR 9048, F-33600 Pessac (France); Maglione, Mario; Josse, Michaël [CNRS, ICMCB, UPR 9048, F-33600 Pessac (France); Univ. Bordeaux, ICMCB, UPR 9048, F-33600 Pessac (France)

    2016-09-15

    Highlights: • Synthesis of Ba{sub 2}NdFeNb{sub 4}O{sub 15}/BaFe{sub 12}O{sub 19} (BaM) heterostructures by RF magnetron sputtering. • Growth of TTB layer were retained regardless of the underlayer (Pt bottom electrode or BaM). • Dielectric and magnetic properties were obtained from the Pt/TTB/BaM/Pt stacks. - Abstract: Ba{sub 2}NdFeNb{sub 4}O{sub 15} tetragonal tungsten bronze (TTB)/BaFe{sub 12}O{sub 19} (BaM) hexaferrite bilayers have been grown by RF magnetron sputtering on Pt/TiO{sub 2}/SiO{sub 2}/Si (PtS) substrates. The BaM layer is textured along (0 0 1) while the TTB layer is multioriented regardless of the PtS or BaM/PtS substrate. Dielectric properties of TTB films are similar to those of bulk, i.e., ε ∼ 150 and a magnetic hysteresis loop is obtained from TTB/BaM bilayers, thanks to the BaM component. This demonstrates the possibility of transferring to 2 dimensional structures the composite multiferroic system TTB/BaM previously identified in 3 dimensional bulk ceramics.

  1. Identification of the neutron-rich nuclides /sup 147; 148/Ba and half- life determination of the heavy isotopes of Rb, Sr, Y, Cs, Ba and La

    CERN Document Server

    Amiel, S; Nir-El, Y; Shmid, M

    1976-01-01

    The neutron nuclides /sup 147; 148/Ba were produced in the thermal neutron induced fission of /sup 235/U. A new surface ionization integrated target ion source operating at temperatures in the region of 1800 degrees C permits the measurement of half-lives of isotopes down to about 0.1 sec due to the very fast release of atoms from the target. Isotopes of Rb, Sr, Cs, and Ba were separated by positive surface ionization and their half-lives measured using beta activity detected by a silicon surface barrier detector with a depletion depth of 300 mu . The isotopes /sup 147/Ba and /sup 148/Ba were identified for the first time and their half-lives were found to be 0.72+or-0.07 sec and 0.47+or-0.20 sec, respectively. (0 refs).

  2. Hybrid HF-DFT modeling of monolayer water adsorption on (001) surface of cubic BaHfO 3 and BaZrO 3 crystals

    Science.gov (United States)

    Bandura, A. V.; Evarestov, R. A.; Kuruch, D. D.

    2010-09-01

    First-principles calculations have been used to study the atomic structure, preferred sites and adsorption energies for water adsorption at different terminations of the cubic phase of perovskite-structured BaHfO 3 and BaZrO 3. By considering different initial positions of water molecules, the possibility of water dissociation has been investigated. It is demonstrated that the site selectivity and the form of adsorbed molecule can be affected by the choice of surface unit cell. Dissociative adsorption was found to be favorable for all surfaces in consideration. Hydroxylation of ZrO 2- and HfO 2-terminated surfaces is accomplished by a noticeable reconstruction of the surface structure of cubic phase towards the orthorhombic phase. Calculated atomic charges in bare and hydroxylated surfaces show that BaHfO 3 crystal is slightly more ionic than BaZrO 3.

  3. Paratuberculosis in a dairy Gyr herd in the State of Paraíba, Brazil Paratuberculose em um rebanho Gir leiteiro no Estado da Paraíba Brasil

    Directory of Open Access Journals (Sweden)

    Pedro M.P.C. Mota

    2009-09-01

    Full Text Available This paper describes the clinical, pathological, and microbiologic aspects of paratuberculosis (Johne's disease in a dairy Gyr herd in the State of Paraíba, northeastern Brazil. An eight years old cow with chronic unresponsive diarrhea was clinically examined and euthanized for pathological evaluation. Fecal samples from all 160 animals over 12 months of age from the herd were collected for isolation of Mycobacterium avium subsp. paratuberculosis. Clinically, the index case cow was severely dehydrated, cachectic, with profuse mucous diarrhea. The main post-mortem findings were emaciation and thickened intestinal wall. Microscopically, the intestinal lamina propria and submucosa were infiltrated by macrophages, epithelioid cells, and Langhans giant cells with numerous alcohol-acid resistant bacilli in the cytoplasm. Two fecal samples displayed growth in slants of Herrold's egg-yolk agar supplemented with mycobactin J, 150 days after incubation. No growth was noticed in slants without mycobactin J. Microscopic examination of the isolated microorganisms stained by Ziehl-Neelsen revealed considerable amounts of alcohol-acid resistant bacilli, morphologically compatible with Mycobacterium spp. Based on the clinical signs, gross and histological lesions, growth time, bacterial morphology in Ziehl-Neelsen staining, and dependence of mycobactin J, the first diagnosis of paratuberculosis in Zebu cattle was made.Objetivou-se descrever os aspectos clínicos, anátomo-histopatológicos e microbiológicos da paratuberculose em um rebanho Gir leiteiro no Estado da Paraíba. Uma vaca de oito anos que apresentava diarréia persistente, refratária a tratamento foi necropsiada para estudo anátamo-histopatológico. Também foram coletadas amostras de fezes de todos os 160 animais do plantel, com idade superior a 12 meses, para tentativa de isolamento de Mycobacterium avium subsp. paratuberculosis. Ao exame clínico, o animal caso índice apresentou caquexia

  4. Aspectos motivacionais e afetivos na mediação de professores alfabetizadores

    Directory of Open Access Journals (Sweden)

    Azevedo, Cleomar

    2010-01-01

    Full Text Available Este artigo é o resultado de uma pesquisa que parte da seguinte questão: o que diferencia o professor que obtém sucesso no processo de alfabetização? Levanto a hipótese que na mediação os aspectos motivacionais e afetivos são componentes que se fazem presente na atuação desses professores alfabetizadores. O objetivo desta pesquisa foi o de levantar os aspectos motivacionais e afetivos na mediação do processo de alfabetização, através da fala de professores alfabetizadores. Foram entrevistados 18 professores com a premissa de serem bons alfabetizadores. Investigar o que mobiliza e caracteriza a ação dos docentes, que mesmo possuindo inúmeras variáveis que interfiram negativamente nesse processo, conseguem obter êxito no desenvolvimento da alfabetização de seus alunos é uma possibilidade de levantar questões voltadas à problemática da aprendizagem do processo de alfabetização

  5. Aspectos significativos surgidos de la experiencia de haber sido responsable de un evento adverso en salud

    Directory of Open Access Journals (Sweden)

    Augusto Hernán Ferreira-Umpiérrez

    2014-01-01

    Full Text Available Objetivo: conocer los aspectos significativos para las enfermeras sobre su experiencia de haber sido responsables de un evento ad- verso en salud. Materiales y métodos: estudio cualitativo exploratorio, con el enfoque de la hermenéutica dialéctica. Se utilizó la técnica de análisis de contenido. Muestra constituida por doce enfermeras que tuvieron al menos una experiencia de responsabilidad ante un evento adverso con un paciente, y por cuatro supervisores de enfermería con responsabilidad de supervisión al ocurrir el evento adverso. Resultados: bajo el enfoque de la hermenéutica dialéctica, el análisis de los datos permitió construir las siguientes categorías relacio- nadas con la organización de salud y los recursos humanos: el contexto organizacional, el desconocimiento del proceso de notifi cación, la sobrecarga de trabajo, la ausencia de descanso. Conclusiones: reconocer la importancia del contexto organizacional donde se desarrollan los cuidados, el desconocimiento del proceso de notificación como aspecto por mejorar, la sobrecarga de trabajo y la ausencia d e descanso del personal. Es necesario profundizar en el tema mediante investigaciones y desarrollo de intervenciones que promuevan la cult ura de seguridad en la atención sanitaria, con implicaciones en la práctica y para la formación de las enfermeras.

  6. Medicina Genómica Aspectos éticos, legales y sociales del Genoma Humano

    Directory of Open Access Journals (Sweden)

    Rodolfo E. Ávila

    2011-01-01

    Full Text Available La Medicina Genómica es el uso de la inf ormación de los genomas y sus deriv ados (ARN, proteínas y met abolitos que permite guiar la toma de decisiones médicas, es un c omponente clave de la medicina personalizada. La Medicina Genómica permite conocer la cartografía del genoma hum ano y proporciona una valiosa información a tener en cuenta a la hora de detect ar genes implicados en ciert as enfermedades. Esto conlleva a que en la actualidad nos centremos más en la predicción de patologías que en l a prevención, por lo que la tendencia es que en el futuro la Medicina Genómica acabe desbancando a la Medicina P reventiva. El Proyecto Genoma Humano presenta diversas aplicaciones que, al no tener una clara cobert ura legal, traen consigo un nuevo paradigma con problemas éticos, sociales y legales que la comunidad científica trat a de resolver para compaginar los aspectos morales con el progreso en la investigación. El objetivo del presente trabajo es describir brevemente los aspectos éticos, legales y sociales del Genoma Humano.

  7. Aspectos ultra-estruturais da forma epimastigota do Trypanosoma cruzi em meio LIT

    Directory of Open Access Journals (Sweden)

    Wanderley de Souza

    1975-06-01

    Full Text Available E feito um estudo da ultra-estrutura da forma epismastigota do Trypanosoma cruzi mantida em meio de cultivo acelular. O núcleo das formas em divisão apresenta um aspecto homogêneo. Microtúbulos intranucleares são observados durante a divisão. No entanto, a membrana nuclear permanece íntegra. O citoplasma apresenta-se com vacúolos de dimensões e aspectos variados. Com o método do ácido periódico-tiosemicarbazida-proteinato de prata, polissacaríáeos e/ou glicoproteínas foram localizados na membrana celular e na membrana que delimita certos vacúolos citoplasmáticos.In this paper the fine structure of the epimastigotes forms of Trypanosoma cruzi maintained in an acellular culture medium, is described. During division the nucleus shows a homogenous structure owing to the dispersion of its chromatin and nucleolar material. Microtubules similar to those of a mitotic spindle in metazoan cells appear, running frorn one pole to the other. During the whole process of division the nuclear membrane remains intact. The cytoplam shows many vacuoles. With the cytochemical method of acid periodic-thiosemicarbazide-silver proteinate, a polysaccharide surface coat is observed on the whole surface membrane system of T. cruzi. A positive re- action is also observed in the membranes of some vacuoles in the cytoplasm of the parasites.

  8. Aspectos éticos en Pediatría, las inmunodeficiencias primarias

    Directory of Open Access Journals (Sweden)

    Martha Leonor Paradoa Pérez

    2012-12-01

    Full Text Available Las inmunodeficiencias primarias son enfermedades genéticas, caracterizadas por infecciones crónicas devastadoras que conllevan a la muerte, al desarrollo de tumores y a enfermedades autoinmunes, y la mayoría de estas enfermedades cursan en la edad pediátrica. Desde la última década del pasado siglo, el desarrollo de la tecnología, el surgimiento del Proyecto del Genoma Humano y la profundización en los aspectos bioéticos, han dado lugar a especificidades en la atención médica e investigativa del paciente pediátrico y del que desarrolla una enfermedad inmunológica. Este trabajo recoge los aspectos bioéticos más importantes y los dilemas éticos con los que se enfrenta el inmunólogo pediátrico en la atención al paciente con inmunodeficiencia primaria, el cual demanda la atención de, prácticamente, todas las especialidades pediátricas.

  9. Aspectos sociales de la malaria importada en Latinoamérica

    Directory of Open Access Journals (Sweden)

    Alfonso J. Rodríguez-Morales

    2008-04-01

    Full Text Available La malaria continúa siendo un grave problema de salud pública mundial, ya no sólo en países endémicos, sino comenzando a representar un dilema médico en países distantes por la llegada de casos importados. Ahora bien, aun cuando en términos de las disciplinas médicas convencionales se ha publicado muchos estudios clínico-epidemiológicos y reportes de caso, los aspectos sociales, que parecerían obvios en el contexto de la malaria importada por supeditarse a la migración de la población, no han sido exhaustivamente explorados en relación con este fenómeno. Por estas razones, en esta revisión se analiza los aspectos sociales relacionados con el fenómeno de la malaria importada con énfasis al contexto epidemiológico de América Latina.

  10. Aspectos etnoecológicos de la agricultura entre los Pumé

    Directory of Open Access Journals (Sweden)

    Silvana Saturno

    Full Text Available Resumen En este artículo se presenta una descripción de las formas de manejo agrícola entre los Pumé desde una perspectiva etnoecológica. Los Pumé son un pueblo indígena que habita en la ecorregión de los Llanos (Venezuela. Aunque han sido identificados por algunos etnógrafos como un grupo de cazadores-recolectores, desde hace tiempo se ha señalado que poseen economías mixtas. Basados o no en las descripciones etnográficas, los agentes del Estado también han hecho representaciones de los Pumé como un grupo que carece de conocimientos agrícolas. En este sentido, el enfoque etnoecológico constituye la posibilidad de considerar aspectos cognitivos, perceptuales, cosmológicos y prácticos de la agricultura de este pueblo indígena. A partir de un estudio etnográfico, se describen siete formas de manejo agrícola que difieren en características como nivel de manejo, extensión, organización social del trabajo y propiedad de la cosecha. Por último, se profundiza en la descripción de los aspectos etnoecológicos de la agricultura de tala y quema de este grupo.

  11. Molecular recognition at methyl methacrylate/n-butyl acrylate (MMA/nBA) monomer unit boundaries of phospholipids at p-MMA/nBA copolymer surfaces.

    Science.gov (United States)

    Yu, Min; Urban, Marek W; Sheng, Yinghong; Leszczynski, Jerzy

    2008-09-16

    Lipid structural features and their interactions with proteins provide a useful vehicle for further advances in membrane proteins research. To mimic one of potential lipid-protein interactions we synthesized poly(methyl methacrylate/ n-butyl acrylate) (p-MMA/nBA) colloidal particles that were stabilized by phospholipid (PLs). Upon the particle coalescence, PL stratification resulted in the formation of surface localized ionic clusters (SLICs). These entities are capable of recognizing MMA/nBA monomer interfaces along the p-MMA/nBA copolymer backbone and form crystalline SLICs at the monomer interface. By utilizing attenuated total reflectance Fourier transform infrared (ATR FT-IR) spectroscopy and selected area electron diffraction (SAD) combined with ab initio calculations, studies were conducted that identified the origin of SLICs as well as their structural features formed on the surface of p-MMA/nBA copolymer films stabilized by 1,2-dilauroyl-sn-glycero-3-phosphocholine (DLPC) PL. Specific entities responsible for SLIC formation are selective noncovalent bonds of anionic phosphate and cationic quaternary ammonium segments of DLPC that interact with two neighboring carbonyl groups of nBA and MMA monomers of the p-MMA/nBA polymer backbone. To the best of our knowledge this is the first example of molecular recognition facilitated by coalescence of copolymer colloidal particles and the ability of PLs to form SLICs at the boundaries of the neighboring MMA and nBA monomer units of the p-MMA/nBA chain. The dominating noncovalent bonds responsible for the molecular recognition is a combination of H-bonding and electrostatic interactions.

  12. Investigation on microstructure and dielectric behaviour of (Ba0· 999 ...

    Indian Academy of Sciences (India)

    Ceramics of BaTiO3 co-doped with Gd and Cr at Ba-site was synthesized via solid-state reaction route. Surface morphology shows the increase in grain size with the increase of Cr-content below 3 mol%. The high value of in the synthesized samples is associated with space charge polarization and inhomogeneous ...

  13. Progress of (Sr, Ba) TiO3 ferroelectric thin film and tunability

    Indian Academy of Sciences (India)

    Unknown

    The studies on (Ba, Sr) TiO3 microstructure concentrate on the crystal structure system, grain size distribution, domain structure, layers of regions, Curie temperature, growth mechanism of grain, lattice mismatch, strain and the influence of dopants on structure and performance etc. (Sr, Ba) TiO3 crystal exists as a cube and a ...

  14. Grain-size effects on thermal properties of BaTiO3 ceramics

    Indian Academy of Sciences (India)

    Administrator

    fine non-agglomerated powder with a narrow particle size distribution and an appropriate densification method to minimize the grain growth are required. In our experi- ment, the raw BaTiO3 powder with the grain sizes of 10 and 100 nm were synthesized by chemical processing. (Li et al 2002). Dense BaTiO3 ceramics with ...

  15. Strom-Spannungs-Messungen an der BaSO4-cellophan-Membran

    NARCIS (Netherlands)

    Hirsch-Ayalon, P.

    Strom-Spannungs-Messungen sind sehr geeignet für das Studium der Permeabilität der BaSO4-Membran für Ionen. Mit verschiedenen Kombinationen von Lösungen erhält man charakteristische i/E-Linien. In geeigneter Versuchsanordnung setzt die BaSO4-Membran Konzentrations-energie (vorzugsweise von H+-

  16. BACTERICIDAL COATINGS ON TEXTILES FOR REMEDIATION OF INTERMICROBE ACTIVITY (BaCTeRIA) SUMMARY REPORT

    Science.gov (United States)

    2017-07-07

    TEXTILES FOR REMEDIATION OF INTERMICROBE ACTIVITY ( BaCTeRIA ) SUMMARY REPORT by Tobyn A. Branck Courtney M. Cowell Jennifer M. Rego and...October 2011 – September 2015 4. TITLE AND SUBTITLE BACTERICIDAL COATINGS ON TEXTILES FOR REMEDIATION OF INTERMICROBE ACTIVITY ( BaCTeRIA ) SUMMARY REPORT...ANTHRAX PURIFICATION BACILLUS ANTHRACIS ENVIRONMENTAL ISOLATES BACTERIA BACTERIOCINS TARGETED ACTIVITY

  17. Searches for low-mass Higgs and dark bosons at BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Oberhof, Benjamin, E-mail: benjamin.oberhof@pi.infn.it [INFN sezione di Pisa and Universitá di Pisa, Polo Fibonacci - Edificio C, Largo B. Pontecorvo 3, 56125 - Pisa (Italy)

    2013-01-15

    We present BaBar latest results for the direct search of a light CP-odd Higgs boson using radiative decays of the ϒ(nS) (n=1,2,3) resonances in different final states. We also present the results for the search of a hidden sector gauge and Higgs bosons using the full BaBar datasample.

  18. Soft X-ray photoelectron spectroscopy of the ultrathin Ba/InGaN interface

    Science.gov (United States)

    Benemanskaya, G. V.; Pronin, V. P.; Timoshnev, S. N.; Nelyubov, A. V.

    2017-11-01

    Electronic structure of the clean In0.22Ga0.78N surface and the ultrathin Ba/In0.22Ga0.78N interface has been studied in situ by the synchrotron-based photoelectron spectroscopy during excitation in the photon energy range of 100-650 eV. Changes in the valence band and surface states spectra and in the In 3d, In 4d, N 1s, Ga 3d, Ba 4d, Ba 5p core levels spectra have been investigated under the step-by-step Ba submonolayer deposition. Changes in the surface electronic structure of the InGaN caused by Ba adsorption are found to originate predominantly from the local interaction of the Ga and In dangling bonds and Ba adatoms that results in effect of the suppression of the two intrinsic surface states and appearance of a new induced state. The Ba atomic layer deposition is revealed to induce the charge transfer between the Ba adatoms and the N surface atoms with increasing N-ionicity.

  19. Ba/ZrO₂ nanoparticles as efficient heterogeneous base catalyst for ...

    Indian Academy of Sciences (India)

    The surface area, basicity and barium content of the material depend strongly on the method of synthesis. The Ba/ZrO₂ catalyst prepared by urea hydrolysis method exhibited higher surface area and barium content compared to other samples. The catalytic activity of the Ba/ZrO₂ catalyst was evaluated for synthesis of ...

  20. The Acquisition of the BA Construction by English-Speaking Learners of Chinese

    Science.gov (United States)

    Xu, Hongying

    2012-01-01

    This study examined the acquisition of the BA construction by English-speaking learners of Chinese. The BA construction is a unique yet important grammar phenomenon in Chinese. Whether second language (L2) learners of Chinese are able to understand and use this construction correctly and appropriately may affect the overall success of their…

  1. Reversible Decomposition of Secondary Phases in BaO Infiltrated LSM Electrodes-Polarization Effects

    DEFF Research Database (Denmark)

    Traulsen, Marie Lund; McIntyre, Melissa D.; Norrman, Kion

    2016-01-01

    potential. A changing electrode surface is observed during operation as the Ba3Mn2O8 secondary phase decomposes and manganese oxide accumulates on the electrode surface during cathodic polarization. The observed changes are reversible. These results suggest that the formation of Ba3Mn2O8 is responsible...

  2. Microstructure and electrical properties of BaTiO3 thin films by modified CSD

    National Research Council Canada - National Science Library

    NAGASAKA, Masaomi; IWASAKI, Dai; SAKAMOTO, Naonori; FU, Desheng; WAKIYA, Naoki; SUZUKI, Hisao

    2011-01-01

    0.3 M BaTiO3 (BT) precursor solution was prepared by the modified CSD, in which partially hydrolyzed Ti-alkoxide and Ba precursor solution was reacted in iced water bath to prepare the highly polymerized BT precursor solution...

  3. Mixed marriages in Ba's so long a letter and scarlet song | Simon ...

    African Journals Online (AJOL)

    Love is the prerequisite for marriage in all cultures. This fact is negated in the marriage relationships described in Ba's two works. This paper examines mixed marriages in Mariama Ba's So Long a Letter and Scarlet Song and its impact on women. It also highlights the woman's predicament in general and the way forward ...

  4. Electrodeposition of BaCO3 coatings on stainless steel substrates ...

    Indian Academy of Sciences (India)

    Administrator

    Department of Chemistry, Central College, Bangalore University, Bangalore 560 001. 2 ... and dissolved ions that can influence the process. Therefore many ... and paper industries. Also it is used as starting mate- rial for BaTiO3 synthesis. Decomposition of a bi- phasic coating of BaCO3 and TiO2 resulted in the formation of ...

  5. Anomalous properties of chloroborosilicate glasses in the K2O–BaO ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 38; Issue 6. Anomalous properties ... All of the thermal and mechanical properties exhibited a similar trend of anomalous variation as a function of the BaCl2 content, showing maxima at 10 mol% and a sharp increase at 25 mol% BaCl2 content. The anomaly has been ...

  6. First-principles study of the relaxor ferroelectricity of Ba(Zr, Ti)O3

    Science.gov (United States)

    Yang, Li-Juan; Wu, Ling-Zhi; Dong, Shuai

    2015-12-01

    Ba(Zr, Ti)O3 is a lead-free relaxor ferroelectric. Using the first-principles method, the ferroelectric dipole moments for pure BaTiO3 and Ba(Zr, Ti)O3 supercells are studied. All possible ion configurations of BaZr0.5Ti0.5O3 and BaZr0.25Ti0.75O3 are constructed in a 2 × 2 × 2 supercell. For the half-substituted case, divergence of ferroelectric properties is found from these structures, which greatly depends on the arrangements of Ti and Zr ions. Thus our results provide a reasonable explanation to the relaxor behavior of Ba(Zr, Ti)O3. In addition, a model based on the thermal statistics gives the averaged polarization for Ba(Zr, Ti)O3, which depends on the temperature of synthesis. Our result is helpful to understand and tune the relaxor ferroelectricity of lead-free Ba(Zr, Ti)O3. Project supported by the National Natural Science Foundation of China (Grant Nos. 51322206 and 11274060) and the Natural Science Foundation of Jiangsu Province, China (Grant No. 15KJB140009).

  7. Dy -activated M2SiO4 (M = Ba, Mg, Sr)-type phosphors

    Indian Academy of Sciences (India)

    aging, photoluminescence (PL) and microwave communica- tion areas due to their high efficiency, easy synthesis method and plenty of host materials [1–3]. ... decomposition of BaCO3, which changes into BaO, from figure 1, an orthorhombic to rhombohedral transition at. 823. ◦. C and a rhombohedral to cubic phase ...

  8. Characterization of BaTiO3 piezoelectric perovskite material for ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 40; Issue 4. Characterization of BaTiO 3 piezoelectric perovskite material ... In this study, we present the results of the manufacturing of BaTiO 3 powder, which is meant for use in stacked-diskmultilayer actuator production. The solid-state technique was used for powder ...

  9. Tsdc and Neutron-Scattering Measurements on Ba1-Xlaxf2+X and Ba1-Xuxf2+2x Solid-Solutions

    DEFF Research Database (Denmark)

    Ouwerkerk, M; Veldkamp, F. F.; Andersen, Niels Hessel

    1985-01-01

    A study was made of the dynamical behaviour of bound interstitial fluoride ions in disordered Ba1−xLaxF2+x and Ba1−xUxF2+2x solid solutions with Thermally Stimulated Depolarisation Current measurements and neutron scattering measurements, and a combination of both techniques. From 10 K to 400 K...... the TSDC spectra showed four reorientation peaks to be present in Ba1−xLaxF2+x, and six in Ba1−xUxF2+2x, along with the relaxation of the macroscopic space charge. The position of a space charge peak shifted to lower temperatures with increasing solute content. The dipolar realaxations were concentration...... invariant. In Ba1−xLaxF2+x neutral associates, L-shaped- and (222)- clusters occur. The present study reveals (212)-clusters to be present in Ba1−xUxF2+2x. The relations between ion dynamics and defect structures are discussed....

  10. Understanding Ferromagnetic Phase Stability, Electronic and Transport Properties of BaPaO3 and BaNpO3 from Ab-Initio Calculations

    Science.gov (United States)

    Khandy, Shakeel Ahmad; Gupta, Dinesh C.

    2017-10-01

    An extensive study of rare-earth perovskite BaPaO3 and BaNpO3 has been performed by first-principles tactics based on density functional theory (DFT), because the delocalized f-electrons play an important role in the band structure formation, to reveal their impact on the overall physical and chemical properties; it has turned out to be an interesting theme. Along with critical radii and thermoelectric properties, two different theories are employed to calculate the structural properties. The DFT and empirically calculated lattice constants are in rational accord with the experimental results. The critical radius calculations show that the BaPaO3 lattice has a smaller oxygen migration activation energy than the BaNpO3. In addition, we discuss the band profile and magnetic moments for these materials, which demonstrate the half-metallic ferromagnetism with a direct energy gap of 3.91 eV for BaPaO3 and an indirect gap of 3.79 eV for BaNpO3. More interestingly, the integral magnetic moments are in accordance with the Slater-Pauling rule.

  11. BA- proposal made in collaboration between students and clinical practitioner at the OT-program

    DEFF Research Database (Denmark)

    Hove, Anne

    2014-01-01

    Presentation 24 BA- proposal made in collaboration between students and clinical practitioner at the OT-program Anne Hove (Metropolitan University College, Denmark) At the OT education a key aim is to ensure the students develop their BA-projects in a concrete collaboration with the practice field...... developing a project proposal is a difficult task. We have therefore in the spring of 2014 piloted a new ways of addressing this challenge. We have given students and practitioners the opportunity to develop project proposals in collaboration. I will present the first experiences from the pilot. We will host....... This focus is strengthen through a process where clinical practitioners and students develop in collaboration project proposals to BA-projects. We strongly believe that students learn more with this type of BA-project. In the lecture, I will short describe the learning potential we see in this type of BA...

  12. Bifunctional properties of hydrothermal synthesized BaMF4 (M = Co, Ni and Zn

    Directory of Open Access Journals (Sweden)

    Farheen N. Sayed

    2013-07-01

    Full Text Available BaMF4 (M = Co, Ni and Zn samples having orthorhombic structure have been synthesized by a mild hydrothermal method and characterized by x-ray diffraction (XRD, magnetic and electrical measurements. Single phase formation of these compounds has been found to be dependent on various factors like reaction time, pH, temperature etc. All the samples showed ferroelectricity, which decreases with increase in temperature. BaMF4 (M = Co, Ni samples show 10-15 times more leakage current compared to that of BaZnF4 at higher applied field. Absence of multivalent ions in BaZnF4 can be the reason for its minimum leakage current. All the samples except, BaZnF4, exhibit weak room temperature ferromagnetism also.

  13. Aspectos “Subjetivos” do Fetichismo da Mercadoria Cultural no Ensaio Sobre Música Popular de T. W. Adorno

    Directory of Open Access Journals (Sweden)

    Fábio César da Silva

    2017-05-01

    Full Text Available Neste artigo, apresento uma leitura do ensaio Sobre Música Popular (1941 de T. W. Adorno (1903-1969, enfatizando os aspectos “subjetivos” do fetichismo da mercadoria cultural. Considero aspectos “subjetivos” do fetichismo quando se enfatiza o consumo de mercadorias. Esse ensaio fez parte dos resultados de pesquisa de rádio da Universidade de Princeton, feita nos Estados Unidos entre 1938 a 1940, cujo objetivo era analisar as programações radiofônicas. Focarei a leitura na seção Teoria do Ouvinte, pois nela Adorno enfatizou esses aspectos “subjetivos” por meio de análises específicas do consumo da música popular americana supondo seus modos de recepção.

  14. Historical materials from the medieval fortress Bač

    Directory of Open Access Journals (Sweden)

    Snežana Petrović

    2007-12-01

    Full Text Available Conservation and restoration of cultural heritage are the objects of great interest worldwide. For setting the correct methodology for the procedures of the restoration it is very important to have the right information about the state of the object and the characteristics of the original materials. The basis of our examinations were clay products (samples of bricks, terracotta and clay roof tile from the middle ages, the fortress in Bač. The following methods were used: x-ray diffraction, classic chemical analysis, SEM-EDS, Hg-porosimetry and dilatometry. Based on the used methods, mineral composition, temperature and regime of firing and textural properties of the examined materials were determined. The degree of destruction of examined materials was also identified, in order to find compatible materials for future techniques of conservation and restoration.

  15. Complex Impedance Spectroscopic Properties of BaVO Ceramics

    Directory of Open Access Journals (Sweden)

    Praveen Khatri

    2008-01-01

    Full Text Available The polycrystalline sample of Ba3V2O8 was prepared by a high-temperature solid-state reaction technique. The effect of temperature on impedance parameters was studied using an impedance analyzer in a wide frequency range (102-106 Hz. The real and imaginary parts of complex impedance trace semicircles in the complex plane. The temperature-dependent plots reveal the presence of both bulk and grain boundary effects above 125∘C. The bulk resistance of the material decreases with rise in temperature. This exhibits a typical negative temperature coefficient of resistance (NTCR behavior of the material. The modulus analysis suggests a possible hopping mechanism for electrical transport processes of the material. The nature of variation of dc conductivity suggests the Arrhenius type of electrical conductivity.

  16. The New BaBar Data Reconstruction Control System

    Energy Technology Data Exchange (ETDEWEB)

    Ceseracciu, Antonio

    2003-06-02

    The BaBar experiment is characterized by extremely high luminosity, a complex detector, and a huge data volume, with increasing requirements each year. To fulfill these requirements a new control system has been designed and developed for the offline data reconstruction system. The new control system described in this paper provides the performance and flexibility needed to manage a large number of small computing farms, and takes full benefit of OO design. The infrastructure is well isolated from the processing layer, it is generic and flexible, based on a light framework providing message passing and cooperative multitasking. The system is actively distributed, enforces the separation between different processing tiers by using different naming domains, and glues them together by dedicated brokers. It provides a powerful Finite State Machine framework to describe custom processing models in a simple regular language. This paper describes this new control system, currently in use at SLAC and Padova on {approx}450 CPUs organized in 12 farms.

  17. The magnetic properties of multiferroic BaCoF4

    Directory of Open Access Journals (Sweden)

    Shuang Zhou

    2017-05-01

    Full Text Available Multiferroic barium cobalt fluoride, BaCoF4, has been prepared by hydrothermal method. The antiferromagnetic structure has been confirmed, and the possible weak ferromagnetism due to Dzyaloshinskii-Moriya interaction has been excluded, from the straight line shape of applied magnetic field dependent magnetization (M-H curve without hysteresis loop at low temperature down to 5 K. After cooling under a magnetic field, conspicuous exchange bias effect was observed at low temperature of T<50 K, which was attributed to the exchange coupling between the two phases of different spin configuration. Furthermore, significant magnetodielectric effect was observed at room temperature, which has been interpreted to the magnetic field modified weak interaction between different layers.

  18. Aluminosilicates compacts by alkoxide route: influence of Ba addition

    Directory of Open Access Journals (Sweden)

    Quaranta N. E.

    1999-01-01

    Full Text Available The sol-gel route was employed to obtain three different powders with the stoichiometric composition corresponding to mullite (3 Al2O3.2SiO2: (i commercial alumina and silica from sol-gel, (ii alumina and silica by alkoxide partial hydrolysis, (iii alumina and silica by alkoxide simultaneous hydrolysis. Tetraethylorthosilicate (TEOS and aluminium tri-sec-butoxide were used as alkoxide precursor. Moreover, 5 wt% of barium, incorporated to precursor solutions as Ba-acetilacetonate, was used as additive to study its influence on densification and mullite phase formation. The precursor powders were pressed uniaxially to form green compacts, after that all samples were heated to 1350 °C for 2 hours to obtain densified pellets. X-ray diffration patterns of powders, obtained by milling of sintering compacts, showed important differences. In barium doped samples a higher grade of densification and a greater glassy phase formation were observed.

  19. Chain magnetic polarons in Y-Ba-Cu-O

    CERN Document Server

    Eremenko, V V; Ponomarchuk, V L

    2002-01-01

    The electron self-localization process in a superconducting cuprate paramagnetic compound Y-Ba-Cu-O is studied by the Moessbauer effect technique. It is shown that the electron self-localization in chain sites gives rise to a phase with a local magnetic ordering and a relaxation time more than 10 sup - sup 7 s. Analysis of the accompanying charge redistribution suggests that the electron self-localization creates a pair of exchange interacted electrons which are mainly localized in oxygen sites. Such a quasiparticle, which consists of a pair of antiferromagnetically oriented atomic moments and a pair of self-localized electrons, has an integer spin and may form a Bose-condensate.

  20. Scorpions from Mata do Buraquinho, João Pessoa, Paraíba, Brazil, with ecological notes on a population of Ananteris mauryi Lourenço (Scorpiones, Buthidae Escorpiões da Mata do Buraquinho, João Pessoa, Paraíba, Brasil, com notas ecológicas sobre uma população de Ananteris mauryi Lourenço (Scorpiones, Buthidae

    Directory of Open Access Journals (Sweden)

    Sidclay C. Dias

    2006-09-01

    Full Text Available Four species of scorpions (Ananteris mauryi Lourenço, 1982, Tityus neglectus Mello-Leitão, 1932, T. pusillus Pocock, 1893 and T. stigmurus (Thorell, 1876 were collected in the " Mata do Buraquinho" , João Pessoa, state of Paraíba, Brazil. Aspects of biology for A. mauryi and new records on the geographic distribution of other species were annotated. Notes on the abundance and sex ratio on A. mauryi, the most abundant species in the area, are presented and discussed.Foram coletadas quatro espécies de escorpiões na Mata do Buraquinho, João Pessoa, Paraíba, Brasil (Ananteris mauryi Lourenço, 1982, Tityus neglectus Mello-Leitão, 1932, T. pusillus Pocock, 1893 e T. stigmurus (Thorell, 1876. Aspectos da biologia de A. mauryi e novos registros de distribuição geográfica das outras espécies foram anotados. Notas sobre a abundância e razão sexual de A. mauryi, a espécie mais abundante nessa área, são apresentados e discutidos.

  1. Radiation dosimetry using nano-BaSO{sub 4}:Eu

    Energy Technology Data Exchange (ETDEWEB)

    Pandey, A.; Sharma R, K. [University of Delhi, Department of Physics, Sri Venkateswara College, Benito Juarez Road, Dhaula Kuan, 110021 New Delhi (India); Bahl, S.; Kumar, P. [Medical Physics Unit, IRCH, AIIMS, 110029 New Delhi (India); Pal L, S., E-mail: apandey@svc.ac.in [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, 110067 New Delhi (India)

    2015-10-15

    Nanocrystalline barium sulfate doped with europium (BaSO{sub 4}:Eu) was successfully prepared by the chemical co-precipitation technique and its thermoluminescence (Tl) dosimetry characteristics were studied for gamma radiation. Initially the dopant (Eu) concentration was varied, starting from 0.05 mol % to up to 1.00 mol %, and it was found that the nano phosphor BaSO{sub 4}:Eu with the dopant concentration of 0.2 mol % had the highest sensitivity within the given lot. The nano phosphor was also optimized for its annealing temperature in order to obtain the best results and was thereafter tested for its reusability and fading features. Further the nano phosphor was compared with the commercially available standard Tl dosimeter material LiF:Mg,Ti (popularly referred to as TLD-100) and it was found that the nano phosphor not only had a higher Tl sensitivity compared to the standard material over a wide range of doses but also had a Tl response which was linear even beyond the dose of 1 kGy. Linearity in Tl response to up to such high doses (∼1 kGy) is typical of nanocrystalline Tl phosphors. All the samples were irradiated by Co-60 source (having 1.25 MeV average energy) of gamma radiation. In order to test the energy independence of the nano phosphor (an important characteristic of an ideal Tl dosimeter) further studies are being carried out to examine the response of the nano phosphor to ionizing radiations of different energies. (Author)

  2. Aspectos podológicos en la Encuesta Nacional de Salud

    Directory of Open Access Journals (Sweden)

    Antonio Martínez Sabater

    Full Text Available Objetivo: la Encuesta Nacional de Salud (ENS es el instrumento para detectar el nivel de salud de la población, por lo que se plantea como objetivo el análisis de las diferentes ediciones para valorar la presencia de los aspectos podológicos y de la figura del profesional de podología en la atención a las personas mayores. Metodología: se ha realizado un análisis de contenido de las diferentes ENS tras la recopilación de las diferentes ediciones (8. Después de la lectura en profundidad y análisis por parte de dos investigadores, se han cumplimentado las fichas de análisis y se han categorizado los diferentes transcriptores, y se ha realizado el análisis e interpretación de la información encontrada. Resultados: en las diferentes ediciones no aparece ninguna mención a la profesión de podología; sí que aparecen referencias a otras figuras como naturópatas, quiroprácticos, entre otros. En relación con los descriptores sobre las afecciones de los pies, solo aparece una referencia en la edición de 1987. No obstante, la referencia a aspectos podológicos es prácticamente inexistente. Conclusiones: la ENS es el instrumento básico para conocer el estado de salud de la población general, pero presenta limitaciones al omitir los aspectos podológicos que suponen una merma en el diagnóstico de las necesidades y, por consiguiente, en la calidad de vida de las personas, principalmente mayores. Al igual que ocurre con la cartera de servicios del SNS, obvia a los/as profesionales formados para la atención básica de los problemas podológicos en el equipo de salud.

  3. ASPECTOS AMBIENTALES EN LA EXPERIMENTACIÓN QUÍMICA PARA PREVENIR RIESGOS A LA SALUD Y AL AMBIENTE

    OpenAIRE

    María O. Peña O.; Esperanza González Q.; Walter Ramírez M.; Sergio A. Franco Ch.

    2011-01-01

    Un aspecto ambiental se considera como cualquier material o elemento físico o químico que el hombre arroja al agua, al aire y al suelo o que interactúe con el ambiente y propicie un riesgo para la salud y para el medio ambiente. Los residuos originados durante el desarrollo de actividades relacionadas con la experimentación química, aunque en una proporción menor que en un proceso industrial, ellos pueden ser residuos peligrosos al medio ambiente. Los aspectos ambientales se asocian con las a...

  4. La relación costo-calidad. Algunos aspectos económicos del confort térmico

    OpenAIRE

    Amarilla, Beatriz Cecilia

    1994-01-01

    El presente trabajo propone una metodología para analizar conjuntamente aspectos de costo y calidad en los edificios para vivienda. A los efectos de ilustrar mediante un ejemplo de aplicación de dicha metodología, el "costo" se ha referido a la construcción, mantenimiento y energía para calefacción; la "calidad", por su parte, se ha identificado con algunos aspectos del confort térmico. Se intenta demostrar que no siempre existe una relación directamente proporcional entre el costo de los ...

  5. Aspectos metodológicos a considerar en las escuelas de iniciación al Fútbol

    OpenAIRE

    Ortí Ferreres, Joan

    2011-01-01

    En el presente artículo veremos cómo ha de ser la iniciación deportiva en una escuela de fútbol para conseguir llegar con el mayor número de jugadores a fases avanzadas de rendimiento. El proyecto en la iniciación ha de basarse en aspectos pedagógicos de forma que entendemos el entrenamiento como un proceso de enseñanza y aprendizaje siendo el entrenador el educador que lleva a cabo dicho proceso. Este proyecto formativo de las escuelas de fútbol no solo atiende a los aspectos ...

  6. ACOMPANHAMENTO DO CRESCIMENTO INFANTIL EM UNIDADES BÁSICAS DE SAÚDE DA FAMÍLIA DO MUNICÍPIO DE QUEIMADAS, PARAÍBA, BRASIL

    Directory of Open Access Journals (Sweden)

    Ana Carolina Dantas Rocha

    2013-01-01

    Full Text Available Estudio transversal que tuvo por objetivo evaluar las acciones de acompañamiento del crecimiento en el contexto de la atención básica de salud del municipio de Queimadas, Paraíba, Brasil destacando aspectos estructurales y procesuales. Fue aplicado un cuestionario a las 204 madres de los niños estudiados, bien como analizados los instrumentos destinados al acompañamiento de salud de los niños y las 16 unidades de salud del municipio. Relacionado a la estructura, la completitud de la equipe mínima y la capacitación de los enfermeros para atender al niño fueron las principales limitaciones. Relacionado al proceso, el peor desempeño fue para los registros de peso y de estatura en los últimos tres meses en los cartones o cadenetas de salud del niño. El registro de peso en los últimos tres meses tuvo mejor desempeño en la zona urbana. En función de actos realizados en discordancia con lo que preconizan las políticas públicas de atención a la salud del niño, se constata la no consolidación efectiva del acompañamiento del crecimiento.

  7. Aspectos neuropsicológicos da depressão Aspectos neuropsicológicos de la depresión Neuropsychological aspects of depression

    Directory of Open Access Journals (Sweden)

    Marcia Rozenthal

    2004-08-01

    Full Text Available Este artigo objetiva rever os principais achados neuropsicológicos na depressão, procurando diferenciar o tipo unipolar do bipolar, com ou sem psicose, tanto nos períodos de fase aguda quanto nos períodos intercríticos. Procurou-se, ainda, correlacionar os achados neuropsicológicos descritos na literatura consultada com os seus correlatos neuroanatômicos e neurofuncionais, ressaltando-se as áreas frontais e seus principais circuitos. Considerando-se estudos neuropsicológicos dos transtornos afetivos, algumas alterações têm se mostrado mais consistentes, sendo descritas disfunções importantes nas fases críticas, mas também no paciente assintomático. Nestas, interessam principalmente os aspectos atentivos e mnêmicos e o funcionamento executivo. Estudos desta natureza têm profundas implicações terapêuticas, apontando para a necessidade de desenvolver outras técnicas coadjuvantes, tais como reabilitação cognitiva e intervenções psicossociais, tornando o tratamento mais abrangente e incisivo nestes casos.Este artículo tiene por objetivo revisar los principales hallazgos neuropsicológicos en la depresión, procurando diferenciar sus formas de presentación unipolar y bipolar, con o sin sintomatología psicótica, tanto en el cuadro agudo como en los periodos inter-críticos. Busca, además, correlacionar los hallazgos neuropsicológicos descritos en la literatura consultada con los aspectos neuroanatómicos y neurofuncionales, destacando el área cortical frontal y sus circuitos principales. Considerándose estudios neuropsicológicos en trastornos afectivos, algunas alteraciones de atención, memoria y de funciones ejecutivas se han presentado más frecuentemente, siendo descritas en los periodos de crisis y también en el paciente asintomático. Estudios de esa naturaleza tienen profundas implicaciones terapéuticas, señalando además la necesidad de desarrollar otras técnicas terapéuticas coadyuvantes, tales como la

  8. Historical and social aspects of halitosis Los aspectos históricos y sociales de halitosis Aspectos históricos e sociais da halitose

    Directory of Open Access Journals (Sweden)

    Marina Sá Elias

    2006-10-01

    Full Text Available Buccal odors have always been a factor of concern for society. This study aims to investigate the historical and social base of halitosis, through systematized research in the database BVS (biblioteca virtual em saúde - virtual library in health and also in books. Lack of knowledge on how to prevent halitosis allows for its occurrence, limiting quality of life. As social relationships are one of the pillars of the quality of life concept, halitosis needs to be considered a factor of negative interference. Education in health should be accomplished with a view to a dynamic balance, involving human beings' physical and psychological aspects, as well as their social interactions, so that individuals do not become jigsaw puzzles of sick parts.Los olores bucales siempre han sido un factor de preocupación para la sociedad, y ellos todavía son ahora. El objetivo de este estudio es hacer una base histórica y social en la halitosis. Fue efectuada una investigación sistematizada en la base de datos BVS (biblioteca virtual em saúde - la biblioteca virtual en salud y también en los libros. La ignorancia en cómo prevenir la halitosis permite su ocurrencia, que limita la calidad de vida. Siendo las relaciones sociales uno de los pilares del concepto de calidad de vida, es necesario considerar la halitosis un factor de interferencia negativa. La educación en salud se debe llevar a cabo buscando un equilibrio dinámico, involucrando los aspectos físicos y psicológicos del ser humano, así como sus interacciones sociales, para que los individuos no se vuelvan rompecabezas de partes enfermas.O problema referente aos odores bucais sempre foi fator de preocupação para a sociedade e ainda hoje se mostra presente. O objetivo do presente estudo foi realizar um embasamento histórico e social sobre a halitose. Para tanto, foi feita busca sistematizada, selecionando artigos por meio da base de dados BVS (Biblioteca Virtual em Saúde e também pesquisa em

  9. Algunos aspectos fisiológicos acerca del sueño

    Directory of Open Access Journals (Sweden)

    Luis Del Castillo Castilla

    2013-10-01

    Full Text Available La tercera parte de la vida de un ser humano transcurre durante el sueño; porque el organismo de los seres vivientes emplea tanto tiempo en el dormir? La neurofisiología ha tratado de responder a este interrogante con hipótesis que se extienden desde el enfoque del sueño como «función reparadora», la de «no respuesta», hasta la de jugar un importante papel en los mecanismos de la memoria. El objetivo de esta revisión es presentar algunos aspectos sobre la fisiología del sueño y de las investigaciones que han venido dando respuesta a la pregunta de porque dormimos.

  10. Algunos aspectos de la pirólisis del carbón

    Directory of Open Access Journals (Sweden)

    Jose M. Rincon

    2009-10-01

    Full Text Available Hasta hace poco tiempo se trataban los procesos de transformación del carbón más desde el punto de vista tecnológico que desde el punto de vista científico, se conocían sus procesos de carbonización, gasificación y licuefacción más no así su mecanismo de transformación. Es por ésto que hoy se trabaja intensamente en lograr un mayor conocimiento de la estructura y mecanismos de transformación química que sufre el carbón durante los diferentes tratamientos, estos aspectos nos ayudarán a la selección de procesos, búsqueda de catalizadores y optimización de los parámetros de trabajo, es decir, un aprovechamiento racional de este recurso.

  11. A imagem do Brasil no discurso do New York Times. Aspectos sociais

    Directory of Open Access Journals (Sweden)

    Maria Inez Mateus Dota

    2010-01-01

    Full Text Available Este texto presenta un análisis de las noticias publicadas en el periódico The New York Times, versión digital, entre los meses de enero y junio de 2004. Al relacionarlas con los aspectos sociales del Brasil se intenta ver cuál es la imagen que ese periódico muestra del Brasil. El artículo adopta como fundamentos teóricos y metodológicos el análisis del discurso, principalmente las contribuiciones de Bell (1991, Fairclough (1995 y 2001, Fowler (1991 y Sousa (2004, discute las estrategias discursivas usadas para representar al Brasil y examina qué elementos escoge y los recursos de lenguaje que son empleados para la producción de los textos analizados.

  12. El aspecto lúdico en la enseñanza del ELE

    Directory of Open Access Journals (Sweden)

    Varela, Patricia

    2010-10-01

    Full Text Available Jugar y aprender son dos acciones íntimamente relacionadas, de forma que su complementación da lugar a un ambiente ameno en clase haciendo que el alumno se sienta más cómodo y abierto al aprendizaje. El objetivo de este artículo es analizar la importancia de la motivación en el alumno y los medios con los que contamos los docentes para desarrollarla de la forma más amena posible. Tendremos en cuenta la importancia del aspecto lúdico en la enseñanza del español como lengua extranjera y a la vez poner en práctica diversas posibilidades de aplicación del mismo

  13. Game, game, game and again game, de Jason Nelson: aspectos da contemporaneidade

    Directory of Open Access Journals (Sweden)

    Flavio Pereira Senra

    2016-01-01

    Full Text Available Embora pensadores como o escritor Mario Vargas Llosa afirmem que os tempos hodiernos têm como característica principal a frivolidade, por conta da velocidade e quantidade de informações a serem digeridas diariamente, artistas em sua pulsão criativa exploram tais paradoxos de grandeza/pequenez em suas obras de arte. Este artigo visa apreender na obra Game, game, game and again game aspectos da contemporaneidade, como o conceito de lúdico e a enorme gama de entretenimentos voltados a um público imerso na indústria da cultura, através da forma como eles são trabalhados junto a conceitos como interatividade como forma de coautoria da obra de arte, finitude artística e permanência no meio digital, e transmidialidade na criação estética.

  14. Aspectos esenciales de la gramática sistémica funcional

    OpenAIRE

    Martínez Lirola, María

    2007-01-01

    Este libro profundiza en los elementos esenciales de la Gramática Sistémica Funcional, cuyo representante más destacado es Michael Halliday. A partir del modelo integrador de descripción lingüística de Halliday, se abordan aspectos relativos a la función social de la lengua: la ideología, la situación tipo, el contexto cultural y las nociones de campo, tenor y modo. Además, se estudia la cuestión de la forma-función en lingüística, se presentan las principales diferencias entre las teorías fo...

  15. Aspectos genéticos del procesamiento de antígenos intracelulares

    Directory of Open Access Journals (Sweden)

    Beatriz Martínez

    1993-03-01

    Full Text Available La activación de los linfocitos T (LT, un aspecto fundamental en la generación de la respuesta inmune (RI, se produce mediante el contacto de sus receptores antigénicos (TCR con un complejo formado por un péptido derivado del antígeno y una molécula del complejo mayor de Histocompatibilidad (MHC, HLA en el humano sobre la superficie de una célula presentadora de antígenos (APC. El origen del péptido puede ser exógenooextracelular, como sucede con la mayoría de los antígenos presentados por las moléculas MHC clase II, o endógeno (intracelular, como es el caso de las proteínas virales. sintetizadas por la célula y presentadas por las moléculas MHC Clase.

  16. Algunos aspectos fisiológicos acerca del sueño

    OpenAIRE

    Luis Del Castillo Castilla

    2013-01-01

    La tercera parte de la vida de un ser humano transcurre durante el sueño; porque el organismo de los seres vivientes emplea tanto tiempo en el dormir? La neurofisiología ha tratado de responder a este interrogante con hipótesis que se extienden desde el enfoque del sueño como «función reparadora», la de «no respuesta», hasta la de jugar un importante papel en los mecanismos de la memoria. El objetivo de esta revisión es presentar algunos aspectos sobre la fisiología del sueño y de las investi...

  17. ASPECTOS SEMÁNTICOS EN LOS ENTORNOS VIRTUALES DE FORMACIÓN

    Directory of Open Access Journals (Sweden)

    Ana Vanessa Leguízamo León

    2010-07-01

    Full Text Available La semántica es un elemento necesario en cualquier actividad de aprendizaje, independientemente del contexto en el que nos encontremos. Los entornos virtuales de formación, como instituciones sociales mediadas por tecnología, tienen también una semántica asociada, que muchas veces es poco valorada por las personas que los diseñan. El componente semántico en estos entornos facilita la negociación de significados, que debe ocurrir para que los estudiantes puedan apropiarse de conocimiento y asociarlo con alguno de los patrones semánticos que ya posee, o crear uno nuevo. Se muestran aquí los aspectos semánticos que deben estar presentes en los entornos virtuales de formación, para situar al estudiante en el contexto semántico propuesto por el docente y que lo conduzca a un aprendizaje significativo.

  18. Aspectos claves-tiempo dependientes que amenazan la vida en el prehospitalario

    Directory of Open Access Journals (Sweden)

    Patricio A. Cortés P., Dr.

    2011-09-01

    En esta misma perspectiva, la resolución de oportunidad y calidad se logra apuntando hacia los aspectos claves-tiempo dependientes que amenazan la vida del paciente, siendo estos clínicos (parocardiorespiratorio, compromiso de la vía aérea y la ventilación, compromiso de la perfusión tisular y el enfrentamiento al dolor torácico con su expresión máxima que es el síndrome coronario agudo, como también organizacionales (entre algunos la presencia de médicos en el Prehospitalario (Ph o el uso de determinados recursos sensibles como el traslado heliportado.

  19. Aspectos interculturales de la reforma del sistema de salud en Bolivia

    Directory of Open Access Journals (Sweden)

    Susana Ramírez Hita

    Full Text Available Este artículo es una reflexión sobre cómo la interculturalidad entendida como el camino para mejorar la salud de la población boliviana, unida al concepto de vivir bien, no está contribuyendo a la mejora de la calidad de vida y de salud de las poblaciones más vulnerables del país. El discurso va unido a la intención de salvar la vida en su más amplio sentido, sin embargo, para ello es necesario la toma de decisiones sobre la salud ambiental y la política extractivista que no son tomados en cuenta en los problemas de salud que afectan a las pueblos indígenas, población a la que se dirigen los aspectos interculturales de la reforma de salud.

  20. Miastenia grave: aspectos históricos Myasthenia gravis: historical aspects

    Directory of Open Access Journals (Sweden)

    FRANCISCO MARCOS B. CUNHA

    1999-06-01

    Full Text Available Foram pesquisados aspectos históricos da miastenia grave desde as primeiras descrições da doença em 1672, pelo clínico inglês Thomas Willis. São descritas as dificuldades encontradas no manuseio dos primeiros pacientes diagnosticados. Pesquisaram-se fatos históricos ligados à investigação da doença, o tratamento, bem como curiosidades pouco citadas na literatura.We studied historical aspects of myasthenia gravis starting from its first description by the English physician, Sir Thomas Willis, in 1672. We also describe the difficulties in managing triating the first diagnosed patient. Historical facts related to the investigation and the initial treatment of this disorder as well as curiosities seldom mentioned in the literature are part of this paper.

  1. Importancia de los aspectos psicosociales en la enfermedad celíaca

    Directory of Open Access Journals (Sweden)

    Trini Fragoso Arbelo

    2002-06-01

    Full Text Available Se revisan los conceptos clínicos actuales sobre la enfermedad celíaca. Se definen con precisión los términos enfermedad celíaca activa, silente, latente y potencial. Se enfatiza en los aspectos psicosociales que influyen en su tratamiento y se trazan pautas generales acerca del manejo integral de los pacientes afectados, dada la importancia de la dieta sin gluten de por vida como único tratamiento.The current clinical concepts of celiac disease are reviewed. The terms active, silent, latent and potential related to celiac disease are accurately defined. Emphasis is made on the psychosocial aspects influencing its treatment and general guidelines are drawn on the comprehensive management of the patients suffering from this disease, given the importance of diet without gluten as the only lifelong treatment.

  2. Aspectos metabólicos y nutricionales en el paciente quirúrgico

    OpenAIRE

    Méndez, J.L.; Ortega, M.; Nogales, A.; Balogo, R.; Capitan-Morales, Luis-Cristobal; Guerrero, J.M.; Arenas, J; Jiménez, A.; Ortega, J.M.; Cantillana, J.

    1993-01-01

    Cada día se presta una mayor atención a los aspectos nutricionales en el ejercicio clínico de la cirugía. La malnutrición se considera como uno de los factores que influyen sobre la mortalidad y morbilidad en el paciente quirúrgico, representando para éste un riesgo adicional debido a la incompetencia inmunológica y a los trastornos en la curación de las heridas o las anastomosis. El paciente operado se encuentra sujeto a una situación de ayuno, más o menos prolongado, y a un estado de agresi...

  3. Algunos aspectos de la lógica jurídica de Luigi Ferrajoli

    OpenAIRE

    Ratti, Giovanni Battista

    2010-01-01

    El artículo presenta y analiza algunos aspectos relevantes del tratamiento de la lógica jurídica ofrecido por L. Ferrajoli. En particular, el artículo contiene: a) la reconstrucción, desde tres perspectivas diferentes (teoría jurídica, órdenes jurídicos y ciencia jurídica), de los fundamentos del sistema lógico de Ferrajoli; b) el examen de los postulados de completitud y consistencia que desarrollan un papel básico en su teoría axiomática, y finalmente c) algunas observaciones críticas acerc...

  4. Aspectos clínicos del síndrome de Ehlers-Danlos

    OpenAIRE

    Fernández Gabarda, Rafael; Rodríguez Collel, J.R.; Fernández Fernández, C.I.

    1997-01-01

    Se realiza una revisión bibliográfica de conjunto de los aspectos clínicos más significativos del síndrome de Ehlers-Danlos. Se recogen datos estadísticos, características raciales, morfotipo e interpretación patogénica actual. Se ha prestado especial atención a su comportamiento hereditario y su fácil confusión con otras afecciones musculares o neurogénicas. Se analizan sus síntomas más característicos, formas clínicas y complicaciones neurológicas, intestinales, cardíacas, va...

  5. Globalización: aspectos políticos, económicos y sociales

    Directory of Open Access Journals (Sweden)

    Jambell García

    2010-01-01

    Full Text Available En el artículo se exploran las dimensiones políticas, económicas y sociales del proceso de globalización. La revisión documental, bibliográfica y hemerográfica, permite identificar los aspectos que involucra este fenómeno mundial. Como resultado se observa que mientras persista el actual esquema de reproducción capitalista a escala global, la globalización tenderá a favorecer más a un pequeño grupo de países altamente desarrollados, en detrimento de la mayoría de la población del planeta, haciendo difícil superar los retos del desarrollo humano. Se concluye la necesidad de un cambio de paradigma y de comportamiento por parte de la sociedad para alcanzar un desarrollo económico y social equitativo.

  6. Estudo dos aspectos éticos dos transplantes na América Latina

    Directory of Open Access Journals (Sweden)

    Virgínia Maria Coelho de Holanda

    1994-06-01

    Full Text Available Respeitando recomendações da OMS, foi feito estudo retrospectivo comparativo das Legislações de 16 Países da América Latina, a saber Argentina, Bolívia, Brasil, Colômbia, Costa Rica, Chile, Cuba, Equador, Guatemala, Honduras, México, Panamá, Paraguai, Peru, República Dominicana e Venezuela, do período de 1963 a 1992, enfatizando-se os aspectos éticos referentes a doação, determinação da morte, conflito de interesses, seleção do receptor, comercialização e intercâmbio internacional de órgãos.

  7. Aspecto de referencialidade na composição de música eletroacústica

    OpenAIRE

    Ferreira, Alesandro Goularte

    2012-01-01

    Resumo: Este trabalho apresenta uma reflexão teórica e composicional sobre a exploração de aspectos de referencialidade na música eletroacústica, mais especificamente na música eletroacústica mista e na música acusmática. A partir da definição da palavra “referencialidade” é apresentado um breve panorama da utilização de diferentes distinções binárias ou oposições dialéticas correlativas que situam o significado dentro ou fora do discurso musical, baseado principalmente em investigações semio...

  8. La dispepsia funcional: Aspectos biopsicosociales, evaluación y terapia psicológica

    Directory of Open Access Journals (Sweden)

    Stefano Vinaccia Alpi

    2008-09-01

    Full Text Available Se abordan los aspectos conceptuales del trastorno gastrointestinal Dispepsia funcional (DP, en lo que se refiere a su definición, prevalencia, clasificación y diagnóstico.; las causas y consecuencias de la DF desde una perspectiva biopsicosocial (variables socioeconómicas, demandas psicosociales, evaluación cognitiva y estrategias de afrontamiento, personalidad y comportamiento, mecanismos psicobiológicos, calidad de vida, tratamiento y evolución; la evaluación psicológica de la DF desde la perspectiva procesual; y la intervención psicológica, con énfasis en el enfoque cognitivo conductual.

  9. Luzia-Homem: aspectos da crÃtica sobre uma obra

    OpenAIRE

    CarmÃlia Maria AragÃo

    2008-01-01

    RESUMO O projeto Luzia-Homem: aspectos da crÃtica sobre obra procura investigar os enfoques da crÃtica na obra Luzia-Homem, de Domingos OlÃmpio, bem como a relaÃÃo entre a figuraÃÃo desta e a realidade no imaginÃrio popular. Para isto, mediante pesquisa bibliogrÃfica, adotaremos o mÃtodo investigativo, sem abandonar a anÃlise interpretativa, dividindo essa pesquisa em quatro capÃtulos. No primeiro, faremos um breve histÃrico sobre os mÃtodos de anÃlise literÃria e suas variaÃÃes. No segu...

  10. USO DE ANIMALES DE LABORATORIO EN COLOMBIA: REFLEXIONES SOBRE ASPECTOS NORMATIVOS Y ÉTICOS

    Directory of Open Access Journals (Sweden)

    L. Botero

    2013-01-01

    Full Text Available El uso de modelos animales para la experimentación se ha incrementado considerablemente en Colombia. Mientras en países desarrollados estos animales se producen en ambientes controlados bajo normas estrictas que garantizan la validez de los resultados de investigación, en Colombia la normatividad al respecto es precaria e imprecisa lo que ha llevado a que pocas instituciones mantengan los animales con los estándares requeridos para obtener resultados de investigación con el rigor que la comunidad científica internacional exige. En este artículo presentamos una breve revisión de la normatividad en el tema a nivel mundial y, finalmente, se mencionan algunas recomendaciones sobre ajgunos aspectos que debería integrar la normatividad colombiana para que se adecúe a las regulaciones internacionales.

  11. Audición espacial en ambientes reverberantes: aspectos teóricos relevantes

    Directory of Open Access Journals (Sweden)

    Claudia Arias

    2003-01-01

    Full Text Available En ambientes reverberantes el sonido se propaga en múltiples direcciones sufriendo cambios físicos de importancia. El sistema auditivo debe se capaz de resolver la competencia perceptual que se produce entre el sonido original y sus reflexiones. En este artículo se presentan aspectos teóricos relevantes de la audición espacial con especial tratamiento del efecto precedente. Se trata de una estrategia inconciente que el individuo utiliza para enfrentar la información sonora conflictiva de los espacios reverberantes. Es el fenómeno perceptual de fusión espacial que ocurre cuando dos sonidos similares se presentan desde diferentes lugares, separados por un breve retardo de tiempo. El individuo escucha sólo un sonido que localiza según la dirección del sonido que llegó primero

  12. Aspectos de educación desde la perspectiva maya-tojolabal

    Directory of Open Access Journals (Sweden)

    Carlos Lenkersdorf

    2002-01-01

    Full Text Available El artículo enfoca aspectos educativos de los tojolabales, uno de los pueblos mayas de Chiapas, es decir, uno de los pueblos originarios del país que nos acercan al México pluricultural. Al destacar la particularidad de la educación tojolabal nos encontramos con el nosotros, concepto clave de su cosmovisión, que modifica la educación y la contrasta con la educación occidental de la sociedad dominante. Por el lado tojolabal encontramos, pues, lo comunitario y complementario del nosotros y, por el occidental, lo competitivo del yo: dos tipos opuestos de educación y de principios organizativos de la sociedad

  13. Aspectos prácticos de las profesiones en el ámbito de la fiscalidad

    Directory of Open Access Journals (Sweden)

    Ana Maria Delgado

    2014-11-01

    Full Text Available

    El 10 de octubre de 2014, los Estudios de Derecho y Ciencia Política de la UOC, en el marco del máster universitario de Fiscalidad, organizaron la «VI Jornada sobre problemas actuales de fiscalidad. Aspectos prácticos de las profesiones en el ámbito de la fiscalidad». La dirección corrió a cargo de Ana María Delgado García, catedrática de Derecho Financiero y Tributario de la Universitat Oberta de Catalunya, y de Rafael Oliver Cuello, consultor de Derecho Financiero y Tributario de la Universitat Oberta de Catalunya.

  14. Aspectos teóricos para el estudio sociodemográfico del embarazo adolescente

    Directory of Open Access Journals (Sweden)

    Humberto Gónzalez Galbán

    2000-01-01

    Full Text Available El embarazo adolescente se presenta como un tópico de interés en una buena parte de los países del mundo actualmente. Ello se explica tanto por la gran incidencia que tiene en numerosas regiones como por las implicaciones sociales, familiares y personales a que es vinculado. Esta situación ha motivado la realización de investigaciones en las que las gestaciones en edades tempranas son centro de atención, sin embargo, en estos estudios el tema es presentado generalmente de manera inadecuada. En este articulo se retoma, desde el punto de vista sociodemográfico, el análisis de aspectos teóricos sobre el embarazo adolescente, presentando críticamente la forma en que es problematizado, así como los diferentes supuestos que es posible encontrar en la literatura especializada sobre el tema.

  15. A Psicologia no hospital geral: aspectos históricos, conceituais e práticos

    OpenAIRE

    Azevêdo, Adriano Valério dos Santos; Crepaldi, Maria Aparecida

    2016-01-01

    Resumo A atuação da Psicologia aplicada ao ambiente hospitalar é marcada por fatos históricos relevantes que contribuíram para a definição da área e delimitação da prática profissional. Este artigo objetivou apresentar os aspectos históricos, conceituais e práticos da Psicologia no hospital geral nos Estados Unidos da América e no Brasil. Esse tipo de atividade da Psicologia se iniciou na década de 1950 e, posteriormente, ocorreu o reconhecimento da especialidade Psicologia da Saúde. A prátic...

  16. Aspectos do Desenvolvimento Político e Econômico da Guyana

    Directory of Open Access Journals (Sweden)

    Iuri Cavlak

    2014-07-01

    Full Text Available Este artigo visa analisar alguns aspectos do desenvolvimento político e econômico da Guyana, pequeno país sul-americano situado no extremo norte do subcontinente. Tendo seu passado ligado a Holanda e a Inglaterra, a Guyana só conquistou sua independência em 1966, num contexto de avanço dos movimentos sociais, empolgados na construção de uma nova nação, e oposição dos Estados Unidos, tentando frear a difusão das ideias socialistas e o apego da política externa guianense ao bloco soviético. A busca por uma economia nacionalizada e planejada foi constante, embora com resultados deveras aquém do esperado.

  17. Formación en recreación en Colombia: aspectos fundamentales para el estudio

    OpenAIRE

    Juan Manuel Carreño Cardozo; Narda Dioselina Robayo Fique

    2010-01-01

    El escrito presenta la reflexión fundamental de la investigación Estado del arte de los conceptos de recreación en Colombia, en Instituciones de educación técnica-tecnológica y de pregrado en recreación y afines originado en la línea de Investigación formar - Formación de Maestros en Recreación3 del programa Licenciatura en Recreación de la Facultad de Educación Física en la Universidad Pedagógica Nacional. La reflexión contiene los aspectos fundamentales que se postulan en la investigación p...

  18. ALGUNOS ASPECTOS ESENCIALES DEL PENSAMIENTO DE JEAN WATSON Y SU TEORÍA DE CUIDADOS TRANSPERSONALES

    OpenAIRE

    Urra M,Eugenia; Jana A,Alejandra; García V,Marcela

    2011-01-01

    En este trabajo se realiza una síntesis del pensamiento de Jean Watson a partir de dos perspectivas fundamentales a saber: su filosofía de cuidados y su teoría de cuidados transpersonales. El análisis se centra, por una parte, en los fundamentos filosóficos del cuidado que derivan del existencialismo y de la teoría de la alteridad levin-asiana y, por otra, en los 10 factores de cuidado que caracterizan su teoría. El artículo además rescata aspectos de la utilización de su teoría de cuidados e...

  19. Aspectos históricos da vulcanização Historical aspects of vulcanization

    Directory of Open Access Journals (Sweden)

    Helson M. da Costa

    2003-06-01

    Full Text Available As borrachas, para serem convertidas em materiais úteis do ponto de vista de aplicações, precisam ser misturadas a alguns ingredientes, os quais vão lhes dar as características desejadas para, então, serem vulcanizadas. Neste artigo, os aspectos históricos da vulcanização são abordados bem como a evolução dos aditivos essenciais à maioria das formulações.Rubbers, to be turned into useful materials from the commercial applications point of view, need the addition of a few other ingredients which, upon vulcanization, will impart the desired characteristics to the material. In this paper, historical aspects of vulcanization are revised as well as the evolution of the additives used in most of the formulations.

  20. Aspectos de la respuesta inmune innata en las infecciones intramamarias causadas por Staphylococcus aureus en bovinos

    Directory of Open Access Journals (Sweden)

    Elizabet A.L Pereyra

    2014-12-01

    Full Text Available Staphylococcus aureus es el principal agente causante de mastitis bovina en Argentina y en el mundo. Esta bacteria ocasiona infecciones crónicas que generan importantes pérdidas a los productores y la industria lechera. El objetivo de este artículo es caracterizar los mecanismos que intervienen en la infección causada por S. aureus en la glándula mamaria bovina, evaluando dos aspectos diferentes del proceso infeccioso: por un lado, lo vinculado con la respuesta inmune innata por parte del hospedador, y por otro, la capacidad de la bacteria para evadir el sistema inmune e interactuar con diferentes tipos celulares. La exploración de la interacción de S. aureus con el sistema inmune de la glándula mamaria bovina permitirá identificar blancos para delinear nuevas alternativas preventivas o curativas, que contribuyan a evitar o eliminar las infecciones causadas por este organismo.

  1. Modelo integral de productividad, aspectos importantes para su implementación

    Directory of Open Access Journals (Sweden)

    Jorge Eduardo Medina Fernández de Soto

    2010-08-01

    Full Text Available El Modelo Integral busca la optimización de la productividad, a partir de los objetivos estratégicos empresariales y el análisis y mejoramiento de la propuesta de valor para el cliente, identificando el nivel de operación óptimo y los recursos tangibles realmente necesarios. También identifica los procesos empresariales de creación de valor y es una guía hacia el desarrollo de la propuesta de valor. Además, analiza las inversiones necesarias para las nuevas propuestas de valor, buscando un crecimiento estratégico sostenible. El artículo explica en primer lugar los fundamentos y componentes del modelo y luego algunos aspectos importantes para su implementación.

  2. Aspectos psicológicos en el cáncer ginecológico

    Directory of Open Access Journals (Sweden)

    María Eugenia Olivares Crespo

    2004-01-01

    Full Text Available En el presente trabajo se abordan los aspectos psicológicos concomitantes a la patologíaoncológica ginecológica. De forma habitual estas pacientes están sometidas a diferentes modalidadesterapéuticas que provocan efectos acumulativos. En términos generales, el tratamiento deelección es quirúrgico, principalmente mastectomía e histerectomía. Estos tratamientos quirúrgicosprovocan efectos antes, durante y después de los mismos. Entre los que cabe citar: alteraciones sexuales, cambios en la imagen corporal, infertilidad y menopausia inducida. Para concluir, seespecifican los procedimientos terapéuticos psicológicos del proceso, tanto del diagnóstico como deltratamiento quirúrgico y de los efectos derivados del mismo.

  3. Aspectos morfofisiológicos das cultivares de cafeeiro Catuaí-Vermelho e Conilon

    Directory of Open Access Journals (Sweden)

    Carvalho Luciana Marques de

    2001-01-01

    Full Text Available O objetivo deste trabalho foi comparar cafeeiros das espécies Coffea arabica L. cv. Catuaí-Vermelho e C. canephora Pierre cv. Conilon quanto à fotossíntese líquida e a aspectos da anatomia foliar a esta relacionados. Verificaram-se taxas fotossintética líquida, transpiratória e de condutância estomática maiores em plantas de C. canephora. As plantas de C. arabica apresentaram menor eficiência do sistema "antena", e folhas menores, porém mais espessas. As duas espécies diferiram, ainda, quanto ao tipo, dimensões e número dos estômatos presentes na epiderme foliar: paracíticos em C. arabica e actinocíticos em C. canephora, e maiores, mas em menor número, em C. arabica.

  4. Aspectos regulatorios e questionamentos para o futuro sobre dentifricios semi-solidos no Brasil

    OpenAIRE

    Sonia Yuri Yokoto

    2003-01-01

    Resumo: Este estudo teve como objetivo reunir informações sobre aspectos da regulamentação brasileira e estimular questionamentos sobre dentifrícios semi-sólidos para futuras pesquisas. Foram comparadas as regulamentações brasileira vigente ou não e a internacional sobre dentifrícios contendo no máximo 1.500 ppm de flúor total e sob a classificação de produto de higiene pessoal através da legislação sanitária brasileira vigente no período deste estudo. Foram também avaliados os textos de rotu...

  5. Aspectos afetivos da justiça e injustiça e assimetrias entre temas

    Directory of Open Access Journals (Sweden)

    Lila Spadoni

    Full Text Available Neste artigo abordam-se os aspectos afetivos das representações sociais organizadas em tematas para demonstrar que a oposição entre a justiça e a injustiça possui uma organização marcada por simetrias e assimetrias. Para isso foram testadas duas hipóteses baseadas na perspectiva estruturalista das representações sociais. A primeira hipótese conjetura que esta dupla de representações possui uma ancoragem de emoções organizadas simetricamente. A segunda hipótese pressupõe que a injustiça tem sua organização marcada por uma maior intensidade afetiva do que a justiça. Os dados advindos de uma manipulação quasi-experimental com alunos de psicologia de Paris confirmam as duas hipóteses.

  6. Aspectos Contábeis dos Créditos de Carbono: Estudo com Autores Nacionais

    Directory of Open Access Journals (Sweden)

    Vanderlei dos Santos

    2013-12-01

    Full Text Available O estudo objetiva verificar o entendimento de autores nacionais no que concerne à classificação, forma de reconhecimento e mensuração das operações com créditos de carbono. O estudo de natureza descritiva foi realizado em 2011, por meio de pesquisa de levantamento ou survey, com abordagem quantitativa. Utilizou-se o questionário como instrumento de coleta de dados, que foi enviado a 23 pesquisadores nacionais que possuem publicação de artigos relacionados à contabilização dos créditos de carbono em periódicos nacionais. Obtiveram-se nove respostas, que constituíram numa amostra por acessibilidade. Para a análise dos dados obtidos optou-se pelo uso da técnica da entropia informacional. Os resultados do estudo mostraram que, quanto à classificação dos créditos de carbono, há um entendimento maior entre os autores de que se trata de ativos especiais e que não podem ser considerados como commodity. Observou-se que não há consenso entre os autores em classificar os créditos de carbono como ativo intangível ou estoque. Deste modo, concluiu-se que ainda existem divergências no entendimento dos autores analisados no que concerne aos aspectos contábeis das operações com créditos de carbono. O artigo contribui principalmente na medida em que busca consolidar diferentes opiniões de autores, que pesquisam sobre a temática, demonstrando aspectos convergentes e divergentes, além de enfatizar lacunas para desenvolver pesquisas futuras.

  7. Aspectos biológicos e danos de Pachycoris torridus em pinhão-manso

    Directory of Open Access Journals (Sweden)

    Sérgio Roberto Rodrigues

    2011-01-01

    Full Text Available Pachycoris torridus (Hemiptera: Scutelleridae é relacionado como uma praga de frutos e de sementes na cultura do pinhão-manso (Jatropha curcas L.. Este trabalho teve por objetivo estudar os aspectos biológicos e os danos que essa espécie pode ocasionar nessa cultura. Ovos, ninfas e adultos de P. torridus foram coletados e levados a laboratório, onde foram mantidos em câmaras climatizadas para estudo de aspectos biológicos. Para avaliação dos danos, adultos foram confinados em gaiolas no campo, contendo frutos em desenvolvimento. As posturas obtidas tinham em média 57,6 ovos. O período embrionário durou 12,7 dias, enquanto as ninfas de primeiro ao quinto ínstar duraram, respectivamente, 8,1; 10,9; 9,7; 11,6 e 11,7 dias. Da fase de ovo a adulto, o ciclo completou-se em 86,5 dias em média. A cópula durou em média 3h43min. Frutos em desenvolvimento e que receberam uma fêmea, um e dois casais para alimentação, reduziram em 63%; 54% e 85% respectivamente, sua massa, quando comparados com frutos sem percevejos. As sementes formadas em frutos que receberam uma fêmea e um casal apresentaram redução de 99 e 58% no teor de óleo respectivamente. Frutos com dois casais não armazenaram óleo nas sementes. Em frutos desenvolvidos infestados com um casal não se verificou alteração no tamanho e na redução ou alteração da massa, no tamanho e teor de óleo das sementes.

  8. Aspectos socioeconómicos y familiares asociados en niños y adolescentes obesos

    Directory of Open Access Journals (Sweden)

    William José González Cabriles

    2013-01-01

    Full Text Available El estudio es transversal y correlacional donde se analizaron las variables socioeconómicas y familiares de una muestra no probabilística, constituida por 528 familias de niños con obesidad exógena, de 2 a 18 años, provenientes de diversos sectores del país, atendidos en la consulta de primera del Centro de Atención Nutricional Infantil Antímano. El objetivo fue determinar los aspectos socioeconómicos y familiares asociados en niños y adolescentes con obesidad que asistieron al Centro. Los datos se procesaron con el programa SPSS 9.0. Se analizaron las distribuciones de frecuencias y el estadístico Chi-cuadrado para probar asociación entre las variables. El nivel de significancia fue 95%. En las familias de niños obesos se encontró que la mayoría de los jefes de familia eran obesos; las familias con pobreza extrema y la población infantil mayor de 15 años presentaron mayor sedentarismo; por último, las madres en general no participaron en la toma de decisiones en la compra de alimentos y no poseían nociones de alimentación equilibrada que les permitieran planificar la compra de alimentos. Estos aspectos se erigen como claves para ser abordados y resueltos por el trabajador social durante la intervención con el fin de favorecer la recuperación nutricional del niño obeso y su familia.

  9. Fundamentos e aspectos computacionais para posicionamento computacionais para posicionamento por ponto GPS

    Directory of Open Access Journals (Sweden)

    Bruno César Vani

    2013-11-01

    Full Text Available Este artigo descreve alguns aspectos teóricos e computacionais envolvidos na implementação de um aplicativo para Posicionamento por Ponto Simples (PPS com dados GPS. São utilizadas efemérides transmitidas, Modelo de Klobuchar para atenuação dos efeitos da ionosfera, Modelo de Hopfield para atenuação dos efeitos da troposfera e ajustamento pelo método dos mínimos quadrados. O objetivo é proporcionar ao leitor o embasamento teórico e os aspectos práticos acerca dos procedimentos para obtenção de coordenadas terrestres a partir das observações de pseudodistância advindas dos satélites de navegação GPS. Um exemplo similar consta em Monico (2008. No presente artigo, uma abordagem semelhante é apresentada, mas recorrendo-se aos citados modelos para atenuação dos efeitos da ionosfera e da troposfera. São utilizados dados recentes de uma estação da Rede Brasileira de Monitoramento Contínuo (RBMC para demonstração de um exemplo prático. Vários detalhes acerca dos procedimentos envolvidos são apresentados. Desta forma, o leitor interessado poderá repeti-los, inclusive recorrendo-se a efemérides precisas e demais modelos para a realização de Posicionamento por Ponto Preciso (PPP.

  10. ALGUNOS ASPECTOS ECONÓMICOS PARA EL DEBATE SOBRE EL TEMA DE LOS PARQUEADEROS EN BOGOTÁ

    Directory of Open Access Journals (Sweden)

    Edwin Tarapuez Chamorro

    2008-01-01

    Full Text Available Este artículo nace de las reexiones que el autor y sus estudiantes de Fundamentos de Economía de la Universidad del Quindío han planteado acerca de algunos conceptos de la ciencia económica, que en muchas ocasiones se abordan sin un piso real que permita contrastar la teoría con aplicaciones y debates prácticos, para el logro de un mejor proceso de aprendizaje. El presente artículo contiene una reexión sobre el tema de los parqueaderos públicos en Bogotá (Colombia, en el que se examina la problemática que se ha presentado en los últimos años como consecuencia de las elevadas tarifas que al parecer cobran las empresas dedicadas a esta actividad económica. En el escrito se analiza la problemática mencionada con base en aspectos como la renta de la tierra, las leyes de oferta y demanda, la competencia imperfecta y otros factores que inuyen en la situación que se presenta actualmente. El proceso de elaboración del presente trabajo se ha enriquecido con los aportes y comentarios de personas con mucho conocimiento y experiencia en el sector, lo que le ha brindado una visión mucho más real sobre la problemática en cuestión. Al !nal de este artículo se incluyen unas breves reexiones que buscan llamar la atención sobre algunos aspectos que no se han tenido en cuenta por los agentes vinculados con la problemática de los parqueaderos en Bogotá.

  11. Synthesis, Crystal Structure, and Chemical-Bonding Analysis of BaZn(NCN2

    Directory of Open Access Journals (Sweden)

    Alex J. Corkett

    2017-12-01

    Full Text Available The ternary carbodiimide BaZn(NCN2 was prepared by a solid-state metathesis reaction between BaF2, ZnF2, and Li2NCN in a 1:1:2 molar ratio, and its crystal structure was determined from Rietveld refinement of X-ray data. BaZn(NCN2 represents the aristotype of the LiBa2Al(NCN4 structure which is unique to carbodiimide/cyanamide chemistry and is well regarded as being constructed from ZnN4 tetrahedra, sharing edges and vertices through NCN2− units to form corrugated layers with Ba2+ in the interlayer voids. Structural anomalies in the shape of the cyanamide units are addressed via IR spectrometry and DFT calculations, which suggest the presence of slightly bent N=C=N2− carbodiimide units with C2v symmetry. Moreover, chemical-bonding analysis within the framework of crystal orbital Hamilton population (COHP reveals striking similarities between the bonding interactions in BaZn(NCN2 and SrZn(NCN2 despite their contrasting crystal structures. BaZn(NCN2 is only the second example of a ternary post-transition metal carbodiimide, and its realization paves the way for the preparation of analogues featuring divalent transition metals at the tetrahedral Zn2+ site.

  12. Dynamics of photoexcited Ba{sup +} cations in {sup 4}He nanodroplets

    Energy Technology Data Exchange (ETDEWEB)

    Leal, Antonio; Pi, Martí [Departament ECM, Facultat de Física, and IN" 2UB, Universitat de Barcelona, Diagonal 645, 08028 Barcelona (Spain); Zhang, Xiaohang; Drabbels, Marcel [Laboratoire de Chimie Physique Moléculaire, Swiss Federal Institute of Technology Lausanne (EPFL), CH-1015 Lausanne (Switzerland); Barranco, Manuel [Departament ECM, Facultat de Física, and IN" 2UB, Universitat de Barcelona, Diagonal 645, 08028 Barcelona (Spain); Laboratoire des Collisions, Agrégats, Réactivité, IRSAMC, UMR 5589, CNRS et Université Paul Sabatier-Toulouse 3, 118 route de Narbonne, F-31062 Toulouse Cedex 09 (France); Cargnoni, Fausto [Istituto di Scienze e Tecnologie Molecolari (ISTM), Consiglio Nazionale delle Ricerche, via Golgi 19, 20133 Milano (Italy); Hernando, Alberto [Social Thermodynamics Applied Research (SThAR), EPFL Innovation Park, Bâtiment C, CH-1015 Lausanne (Switzerland); Mateo, David [Department of Chemistry and Biochemistry, California State University at Northridge, Northridge, California 91330 (United States); Mella, Massimo [Dipartimento di Scienza ed Alta Tecnologia, Università degli Studi dell’Insubria, via Valleggio 11, 22100 Como (Italy)

    2016-03-07

    We present a joint experimental and theoretical study on the desolvation of Ba{sup +} cations in {sup 4}He nanodroplets excited via the 6p ← 6s transition. The experiments reveal an efficient desolvation process yielding mainly bare Ba{sup +} cations and Ba{sup +}He{sub n} exciplexes with n = 1 and 2. The speed distributions of the ions are well described by Maxwell-Boltzmann distributions with temperatures ranging from 60 to 178 K depending on the excitation frequency and Ba{sup +} He{sub n} exciplex size. These results have been analyzed by calculations based on a time-dependent density functional description for the helium droplet combined with classical dynamics for the Ba{sup +}. In agreement with experiment, the calculations reveal the dynamical formation of exciplexes following excitation of the Ba{sup +} cation. In contrast to experimental observation, the calculations do not reveal desolvation of excited Ba{sup +} cations or exciplexes, even when relaxation pathways to lower lying states are included.

  13. Arborização em canteiros centrais na cidade de Patos, Paraíba

    Directory of Open Access Journals (Sweden)

    J. N. Lucena

    2015-10-01

    Full Text Available A arborização de canteiros nas cidades é uma prática que embeleza e permiti reduzir efeitos antropogênicos. O trabalho objetivou quantificar e avaliar a qualidade das árvores localizadas em canteiros centrais da cidade de Patos-PB e o risco que elas representam para a população. Foi realizado o levantamento florístico em 1.391,95 m de canteiros centrais, registrando informações dendrométricas e qualitativas quanto aos aspectos das condições existentes no meio. Foram registrados 166 indivíduos representados em 14 espécies, sendo 71,4% exóticas com destaque para Azadirachta indica e Prosopis juliflora. A maioria das árvores são adultas e medem mais de 10 cm de DAP com altura variando entre 1,6-7,21 m. Em relação à avaliação do risco, não registrou-se indivíduos em conflito com as redes elétricas e sim a presença de galhos ocos nos níveis médio e leve. Na maioria dos indivíduos o sistema radicular apresenta-se subterrâneo, mas, observou-se que 70,1% não apresentam neilóides em superfície, aumentando a suscetibilidade de risco de queda desses indivíduos. Conclui-se que as espécies de maior ocorrência nos canteiros centrais da cidade de Patos são exóticas e que a maioria dos indivíduos sofreram intervenção silvicultural de forma inadequada.Arborization in the medians of the city of Patos, Paraíba EstateAbstract: The arborization in the central urban area of cities is a practice that beautifies urban areas and reduces anthropogenic effects in these areas. The aim of the present study was to measure and assess the quality of trees located in the medians of the city of Patos, PB, through identifying, quantifying and characterizing the vegetation in three different medians and evaluating the risks these trees posed to the population. The analyzed vegetation included 166 individual trees belonging to 14 different species, 71.4% of which were exotic species. The most represented species were Azadirachta indica

  14. Nem tudo que parece ser, é lesão: aspectos anatômicos, não lesões, artefatos, lesões sem significado clínico e alterações post mortem encontrados na necropsia de suínos domésticos e selvagens (Sus scrofa

    Directory of Open Access Journals (Sweden)

    Raquel R. Rech

    Full Text Available A interpretação das alterações encontradas na necropsia é uma etapa importante para o sucesso do diagnóstico final. Este trabalho tem como objetivo descrever e ilustrar os aspectos anatômicos, não lesões, artefatos, lesões sem significado clínico e alterações post mortem encontradas em suínos domésticos e selvagens. Além disso, também se recomenda técnicas de colheita de tecidos para o diagnóstico de doenças que acometem essa espécie. Os principais aspectos anatômicos e não lesões descritos são fímbrias linguais, quadrilátero esofágico, toro pilórico e demarcação do padrão lobular do fígado (sistema gastrintestinal; tonsilas do palato mole, tecido linfoide associado ao estômago, placas de Peyer do intestino delgado e dobras da margem do baço (sistema hematopoiético; mediastino proeminente do testículo e aréolas da placenta (sistema reprodutor; atelectasia pulmonar e apêndice decidual (feto; e glândulas carpais (sistema tegumentar. Os artefatos de eutanásia abordados são petéquias na superfície do pulmão e rim, falsa anemia por sangria, hemorragia subdural por concussão cerebral, pseudo-infartos do baço e aspecto cerebriforme do intestino delgado. As lesões de pouco significado clínico descritas são cistos renais, linfonodos com pigmento de ferro, papilomas e hemangiomas no escroto, ossos no mesentério e hiperemia da mucosa gástrica. As alterações post mortem comumente encontradas são livor mortis, músculos pálidos, pseudomelanose e líquido serosanguinolento nas cavidades torácica e abdominal em fetos.

  15. Phase controlled synthesis of (Mg, Ca, Ba)-ferrite magnetic nanoparticles with high uniformity

    Energy Technology Data Exchange (ETDEWEB)

    Wang, S.F., E-mail: wangshifa2006@yeah.net [School of Physical Electronics, University of Electronic Science and Technology of China, Chengdu 610054, Sichuan (China); Science and technology on vacuum technology and physics laboratory, Lanzhou Institute of Physics, Lanzhou 730000, Gansu (China); Li, Q. [School of Physical Electronics, University of Electronic Science and Technology of China, Chengdu 610054, Sichuan (China); Zu, X.T., E-mail: xtzu@uestc.edu.cn [Institute of Fundamental and Frontier Sciences, University of Electronic Science and Technology of China, Chengdu 610054, Sichuan (China); Xiang, X.; Liu, W. [School of Physical Electronics, University of Electronic Science and Technology of China, Chengdu 610054, Sichuan (China); Li, S., E-mail: sean.li@unsw.edu.au [School of Material Science and Engineering, University of New South Wales, Sydney 2052 (Australia)

    2016-12-01

    (Mg, Ca, Ba)-ferrite magnetic nanoparticles were successfully synthesized through modifying the atomic ratio of polysaccharide and chelating agent at an optimal sintering temperature. In the process, the polysaccharide plays an important role in drastically shrinking the precursor during the gel drying process. In the metal-complex structure, M{sup 2+} ion active sites were coordinated by −OH of the water molecules except for EDTA anions. The MFe{sub 2}O{sub 4} magnetic nanoparticles exhibited enhanced magnetic properties when compared with nano-MFe{sub 2}O{sub 4} of similar particle size synthesized by other synthesis route reported in the literature. In particular, the sintering temperature improves the crystallinity and increases the hysteresis loop squareness ratio of (Mg, Ca, Ba)-ferrite nanoparticles significantly. - Graphical abstract: Schematic representation of the proposed model for MFe{sub 2}O{sub 4} nanoparticle synthesis, starting from EDTA-chelated M{sup 2+} (M=Mg, Ca, or Ba) cations (left). High dispersion (Mg, Ca, Ba)-ferrite magnetic nanoparticles were prepared by a modified polyacrylamide gel route. Optimized utilization of polysaccharide, chelating agent, and sintering temperature allowed the formation of (Mg, Ca, Ba)-ferrite nanoparticles with a narrow diameter distribution. - Highlights: • We report a modified polyacrylamide gel route to synthesize (Mg, Ca, Ba)-ferrite magnetic nanoparticles. • Chelate mechanism of metal ions (Mg, Ca, Ba) and EDTA has been discussed. • Phase transformation process of (Mg, Ca, Ba)-ferrites has been discussed. • The preparation method increases the hysteresis loop squareness ratio of (Mg, Ca, Ba)-ferrite nanoparticles.

  16. Rapid preparation of ultrafine BaSO{sub 3} by SO{sub 2} storage material

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Fei; Sha, Feng; Qiao, Xian Shu; Zhao, Tian Xiang; Guo, Bo; Zhang, Jian Bin [College of Chemical Engineering, Inner Mongolia University of Technology, Huhhot (Korea, Republic of)

    2017-01-15

    In this work, a green and efficient process was developed for the preparation of ultrafine BaSO{sub 3} with layered nanostructure surface via the reaction of BaCl{sub 2} with a SO{sub 2} storage material (SO{sub 2}SM) at room temperature. The absorption of SO{sub 2} with equimolar ethylenediamine (EDA) and ethylene glycol (EG) afforded SO{sub 2}SM, which not only offered alkyl sulfite but also released EDA and EG that served as efficient surfactants to promote the formation of BaSO{sub 3} with spherical morphology and porous structure in the process of synthesis of ultrafine BaSO{sub 3}. The factors affecting the morphology and size of BaSO{sub 3} particle were assessed by investigating the effects of SO{sub 2}SM concentration, BaCl{sub 2} concentration, stirring time and speed. It was found that a higher SO{sub 2}SM concentration led to a higher degree of supersaturation, and the particle size of BaSO{sub 3} could be reduced by increasing SO{sub 2}SM concentration. Moreover, under the identified optimal reaction conditions, ultrafine BaSO{sub 3} was obtained with an average diameter of 450 nm. In addition, a plausible formation process of BaSO{sub 3} was proposed to explain the observed reaction results. Overall, the developed process in this work provides an efficient method for the capture, utilization, and conversion of SO{sub 2} into a valuable chemical.

  17. Aspectos epidemiológicos e anatomopatológicos do hemagiossarcoma em cães: 40 casos (1965-2012

    Directory of Open Access Journals (Sweden)

    Mariana M. Flores

    2012-12-01

    Full Text Available Os aspectos epidemiológicos e anatomopatológicos de casos de hemangiossarcoma em cães da Região Central do RS foram estudados. Dos casos avaliados (n=40, cães idosos e da raça Pastor Alemão foram nitidamente os mais afetados (72,2% e 20% dos casos, respectivamente, visto que na população total de cães necropsiados nesse mesmo período (n=7.063 essa faixa etária e raça tiveram comparativamente uma prevalência bem mais baixa (14,6% e 10,1% dos casos, respectivamente. Na necropsia (n=40, os tumores ocorreram quase sempre como nódulos (92,5% e, menos frequentemente, como massas (37,5%, e afetaram principalmente: baço (62,5%, pulmão (60%, fígado (52,5%, peritônio (42,5%, rim (37,5%, encéfalo (30%, pleura (25% e coração (22,5%. Hemoperitônio (42,5% e, consequentemente, anemia (22,5% foram vistos com certa frequência. Na histologia (n=25, os hemangiossarcomas eram principalmente bem diferenciados (84%, de baixo grau (64% e com estroma escasso (84%, mas frequentemente (68% havia áreas com células demonstrando algum grau de atipia. Necrose, hemorragia e trombose foram vistos em todos os casos, mas hematopoiese extramedular (28% e proliferação angiomatosa benigna (12% foram achados menos comuns. Na imuno- -histoquímica (n=24, utilizando anticorpo anti-fator de von Willebrand, todos os casos demonstraram marcação de intensidade variável com um padrão citoplasmático finamente granular. Em relação à classificação anatômica, 55% dos hemangiossarcomas foram considerados como multicêntricos, 30% como primários com metástase(s e 15% como solitários. Esse artigo discute esses resultados e propõe, com base em combinações de órgãos afetados, um esquema de separação entre hemangiossarcomas primário com metástase(s e multicêntrico, a fim de tentar homogeneizar a maneira com que patologistas veterinários referem-se a esse neoplasma.

  18. Aspectos morfológicos, morfométricos e topográficos do aparelho digestório de Chinchilla lanigera

    Directory of Open Access Journals (Sweden)

    Tiane Ferreira de Castro

    2010-02-01

    Full Text Available O objetivo deste estudo foi o de descrever os aspectos morfológicos e topográficos do Aparelho Digestório (AD de chinchilas, mediante a dissecação de dez animais. Os segmentos do AD foram coletados e demarcados, seguido de análise volumétrica dos órgãos cavitários, por meio de injeção de solução salina a 60 °C, além da mensuração dos comprimentos dos órgãos tubulares. Nos órgãos parenquimatosos realizou-se a sua pesagem. Durante a análise da disposição dos órgãos, evisceração e medição, observou-se que a cavidade oral é característica de roedores, as glândulas salivares são semelhantes às de lagomorfos e órgãos como esôfago, estômago, duodeno, cólon transverso, fígado, pâncreas e baço apresentam-se dispostos de forma semelhante ao descrito nas outras espécies. Já o jejuno e o cólon descendente foram evidenciados muito extensos e dispostos de forma ondulatória, suspensos no teto da cavidade abdominal. O íleo assemelhou-se ao descrito para as outras espécies, porém sua disposição topográfica é da direita para esquerda, direcionando-se ao ceco, o qual se constitui de duas porções distintas e bem desenvolvidas. Ambas as partes encontram-se localizadas à esquerda do plano mediano. O cólon ascendente dispõe-se de forma bastante particular, ocorrendo a presença de uma alça dupla que realiza um looping junto ao fígado. Uma característica relevante foi evidenciada ao comparar-se o reto de machos e fêmeas, o qual apresenta maior comprimento nos machos. De posse dos resultados concluímos que, apesar da chinchila ser um roedor, há características próprias da espécie e também outras que se assemelham aos lagomorfos, constituindo uma relação entre essas ordens.

  19. Bağırsak Mikrobiyatası, Probiyotikler ve İrritable Bağırsak Sendromu(İBS)

    OpenAIRE

    Karacaer, Cengiz; Varım, Ceyhun; Toka, Bilal; Yaylacı, Selçuk; Ahmet Bilal GENÇ

    2017-01-01

    İrritable bağırsak sendromu (İBS), karın ağrısı, rahatsızlıkhissi ve bağırsakalışkanlıklarının değişmesi gibi belirtilerle karakterizekompleks bir hastalıktır.Son deneysel ve klinik araştırmalara dayanarak, düşükdereceli inflamasyon, değiştirilmiş bağırsak mikrobiyatası ve bağırsakbağışıklık sistemindeki değişikliği içermektedir.Bu etiyolojik faktörlerin İBSpatogenezinde önemli rol oynadığı öne sürülmüştür.Bunedenle, değişmiş bağırsak mikrobiyotiklerinin terapötik restorasyonu İBS içinideal b...

  20. Low-energy oxygen ion beam assisted growth of BaO/EuBa2Cu3O7-δ multilayers in ultrahigh vacuum

    Science.gov (United States)

    Pindoria, Govind; Kawaguchi, K.; Morishita, Tadataka

    1996-07-01

    Molecular beam epitaxial growth of cuprate oxide superconducting thin films using a mass separated, low energy, O+ beam source, is discussed. The mono-valent O+ ion is chemically, highly reactive, and its kinetic energy at 10's of electron volts, is significant. It allows the growth of REBa2Cu3O7-(delta ) (REBCO) thin films at low pressures and temperatures. The effective over-pressure of the O+ ions at the substrate being 2 X 10-7 Torr, and the optimum growth temperature 500 degrees C. These conditions are below the currently accepted stability line for the growth of REBCO thin films. We characterize the physical and chemical properties of the O+ ion beam, and its effect on superconducting thin films. We have grown highly crystalline BaO and EuBa2Cu3O7-(delta ) (EBCO) thin films on SrTiO3 substrates. The full width at half maximum of the rocking curves for BaO(002) equals 0.07 degrees and that for the EBCO (005) peak equals 0.05 degrees. Also, we found that BaO is a good insulating material (1.7 X 1013 (Omega) m at 4K), with an excellent lattice match to EBCO, therefore a suitable candidate as an insulating layer in multilayer structures. The results of the first growth studies of BaO/EBCO multilayers are discussed.

  1. Genomics-based high-resolution mapping of the BaMMV/BaYMV resistance gene rym11 in barley (Hordeum vulgare L.).

    Science.gov (United States)

    Lüpken, Thomas; Stein, Nils; Perovic, Dragan; Habekuss, Antje; Krämer, Ilona; Hähnel, Urs; Steuernagel, Burkhard; Scholz, Uwe; Zhou, Rounan; Ariyadasa, Ruvini; Taudien, Stefan; Platzer, Matthias; Martis, Mihaela; Mayer, Klaus; Friedt, Wolfgang; Ordon, Frank

    2013-05-01

    Soil-borne barley yellow mosaic virus disease, caused by different strains of Barley yellow mosaic virus (BaYMV) and Barley mild mosaic virus (BaMMV), is one of the most important diseases of winter barley (Hordeum vulgare L.) in Europe and East Asia. The recessive resistance gene rym11 located in the centromeric region of chromosome 4HL is effective against all so far known strains of BaMMV and BaYMV in Germany. In order to isolate this gene, a high-resolution mapping population (10,204 meiotic events) has been constructed. F2 plants were screened with co-dominant flanking markers and segmental recombinant inbred lines (RILs) were tested for resistance to BaMMV under growth chamber and field conditions. Tightly linked markers were developed by exploiting (1) publicly available barley EST sequences, (2) employing barley synteny to rice, Brachypodium distachyon and sorghum and (3) using next-generation sequencing data of barley. Using this approach, the genetic interval was efficiently narrowed down from the initial 10.72 % recombination to 0.074 % recombination. A marker co-segregating with rym11 was developed providing the basis for gene isolation and efficient marker-assisted selection.

  2. Relationship between Ba atom emission and electrode temperature in a low-pressure fluorescent lamp

    Energy Technology Data Exchange (ETDEWEB)

    Yamagata, Yukihiko, E-mail: yamagata@ence.kyushu-u.ac.j [Interdisciplinary Graduate School of Engineering Sciences, Kyushu University, 6-1 Kasugakouen, Kasuga, Fukuoka 816-8580 (Japan); Kai, Makoto [Lighting Company, Panasonic Corporation, 1-1 Saiwaicho, Takatsuki, Osaka 569-1193 (Japan); Naito, Sho; Tomita, Kentaro; Uchino, Kiichiro [Interdisciplinary Graduate School of Engineering Sciences, Kyushu University, 6-1 Kasugakouen, Kasuga, Fukuoka 816-8580 (Japan); Manabe, Yoshio [Lighting Company, Panasonic Corporation, 1-1 Saiwaicho, Takatsuki, Osaka 569-1193 (Japan)

    2010-04-30

    A relationship between emission characteristics of Ba atom as an emitter material and temperature distributions of an electrode in a fluorescent lamp is described, which is measured by using laser-induced fluorescence and black-body radiation method, respectively. In a virgin lamp, a hot spot observed at the electrode edge connected to the power supply is the main source of Ba atom emission. In a long-term-used lamp, it is shown that Ba atom emission, thermionic electron emission in cathode half-cycle and electron collection in anode half-cycle are most active on the hot spot appearing on the center of the electrode.

  3. Melatonin ve Bağışıklık Sistemi

    OpenAIRE

    ÇETİN, E.

    2005-01-01

    Melatonin, pineal bezin beta adrenerjik reseptörlerinin aktivasyonu ile triptofandan sentezlenen bir hormondur.Üretim ve salınımı karanlık ile başlar ve aydınlıkla sona erer. Melatonin, birçok biyolojik fonksiyonun düzenlenmesinderol oynar. Bu derlemede melatonin hakkında genel bilgiler verilerek, melatoninin lenfoid dokular, humoral bağışıklık,hücresel bağışıklık ve kanser üzerine etkileri tartışılmıştır

  4. Metrological activity determination of {sup 133}Ba by sum-peak absolute method

    Energy Technology Data Exchange (ETDEWEB)

    Silva, R.L. da; Delgado, J.U.; Poledna, R.; Santos, A.; Veras, E.V. de; Rangel, J.; Trindade, O.L. [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil); Almeida, M.C.M. de, E-mail: marcandida@yahoo.com.br, E-mail: candida@cnen.gov.br [Comissao Nacional de Energia Nuclear (CNEN), Rio de Janeiro, RJ (Brazil)

    2015-07-01

    The National Laboratory for Metrology of Ionizing Radiation provides gamma sources of radionuclide and standardized in activity with reduced uncertainties. Relative methods require standards to determine the sample activity while the absolute methods, as sum-peak, not. The activity is obtained directly with good accuracy and low uncertainties. {sup 133}Ba is used in research laboratories and on calibration of detectors for analysis in different work areas. Classical absolute methods do not calibrate {sup 133}Ba due to its complex decay scheme. The sum-peak method using gamma spectrometry with germanium detector standardizes {sup 133}Ba samples. Uncertainties lower than 1% to activity results were obtained.

  5. Phonon modes in Gd1-xCexBa2Cu3O7-δ

    Directory of Open Access Journals (Sweden)

    SH Mozaffari

    2009-08-01

    Full Text Available  XRD and Raman analyses were performed to probe the phase formation and the variation of the normal phonon frequencies of the high temperature superconductor GdBa2Cu3O7-δ upon Ce doping. It was found that in addition to the orthorhombic 123 phase, some nonsuperconducting peaks, which are mainly due to the BaCeO3 secondary phase, are also formed that suppress the superconducting transition temperature. Besides, analysis of the Raman peaks shows that substitutions of Ce for Gd in GdBa2Cu3O7-δ are restricted to low concentrations in favor of impurity island formation .

  6. Solution based approaches for the morphology control of BaTiO3 particulates

    OpenAIRE

    Florentina Maxim; Paula Ferreira; Paula M. Vilarinho; Ian Reaney; Anne Aimable; Paul Bowen

    2010-01-01

    Within the action COST 539 - ELENA our contribution was aimed at studying solution based approaches for the morphology control of BaTiO3 particulates. Initially, our kinetic analysis and systematic structural and morphological studies, demonstrated that during hydrothermal synthesis from layered titanate nanotubes (TiNTS), BaTiO3 forms via two mechanisms depending on the temperature and time. At low temperatures (90°C), “wild” type BaTiO3 dendritic particles with cubic structure were formed t...

  7. Preparation and Stoichiometry Effects on Microstructure and Properties of High Purity BaTiO3.

    Science.gov (United States)

    1986-03-27

    established calcined powders. Hydrothermal synthesis of polycrystalline BaTIO 3 involves dissolution of barium hydroxide and titanium dioxide in a...thermal decomposition of oxalates and by hydrothermal synthesis . As-received lots of mixed oxide and oxalate-derived powders had Ba:TI ratios of 0.997 and...BaTiO 3," Bull. Am. Ceram. Soc., 60 [5] 566-70 (1981). 10. L. I Shvets, N. A. Ovramenko and F. 0. Qvramenko, " Hydrothermal Synthesis of Highly-Dispersed

  8. Microstructural properties of BaTiO{sub 3} ceramics and thin films

    Energy Technology Data Exchange (ETDEWEB)

    Fundora C, A.; Portelles, J.J.; Siqueiros, J.M. [Posgrado en Fisica de Materiales, Centro de Investigacion Cientifica y de Educacion Superior de Ensenada. Apartado Postal 2861, 22800 Ensenada, Baja California (Mexico)

    2000-07-01

    A microstructural study of BaTiO{sub 3} ceramics obtained by the conventional ceramic method is presented. Targets were produced to grow BaTiO{sub 3} thin films by pulsed laser deposition on Pt/Ti/Si (100) substrates. X-ray diffraction, Auger Electron Spectroscopy, X-ray Photon Spectroscopy and Scanning Electron Microscopy were used to study the properties of the BaTiO{sub 3} ceramic samples and thin films, as deposited and after an annealing process. (Author)

  9. Addendum: Safety Standards for Gua sha (press-stroking) and Ba guan (cupping).

    Science.gov (United States)

    Nielsen, Arya; Kligler, Ben; Koll, Brian S

    2014-06-01

    Our previous article Safety Standards for Gua sha (press-stroking) and Baguan (cupping) discussed the risk of transfer of blood-borne pathogens with Gua sha and Ba guan, identified Gua sha and Ba guan 'instrument criticality' as semi-critical and offered recommendations for safe practice based on hospital disinfection standards. Based on the article's feedback, we feel the need to clarify that Gua sha and Ba guan instruments, if intended for reuse, must undergo high level disinfection (HLD) or, in the case of 'wet-cupping', sterilization. We update our recommendations to be amenable to both private practice and education settings. Copyright © 2014 Elsevier Ltd. All rights reserved.

  10. LOUCURA E ASPECTOS DA CULTURA HELÊNICA EM “ÓPERA DOS MORTOS”, DE AUTRAN DOURADO

    Directory of Open Access Journals (Sweden)

    Daniel Cavalcanti ATROCH

    2012-01-01

    Full Text Available Neste artigo, visamos expor as duas faces da loucura manifestadas pela personagemRosalina (a “loucura dionisíaca” e a “loucura redentora”, além de aspectos da culturahelênica subjacentes ao romance de Autran Dourado, que permeiam desde o conteúdo atécaracterísticas formais da obra.

  11. Aspectos do verbo depoente para o ensino do latim e do português Aspectos do verbo depoente para o ensino do latim e do português

    Directory of Open Access Journals (Sweden)

    Liebert de Abreu MUNIZ

    2012-06-01

    Full Text Available This paper aims to discuss features and possibilities of readings of the middle voice and its extent as Latin deponent verb. From contributions of Suzanne Kemmer (1993 and Rutger Allan (2002, both seated on Givón’s postulates, we will see that the complexity of the matter – somehow looked down up by the traditional grammars of the classical languages – be will better comprehended when we perceive that syntax, semantic and pragmatic concur to the efficiency of the employment and understanding of the language, and when we classify middle voice or deponent verb not from generalized definitions, rather from affluence of the mentioned matters, regarding as middle voice or deponent verb can be comprehended practically, with the experience of life. At last, we will intend establish dialogues, for that matter, between Latin and Portuguese language.O presente trabalho pretende discutir aspectos e possibilidades de leitura da voz média e sua extensão como verbo depoente em latim. A partir das contribuições de Suzanne Kemmer (1993 e de Rutger Allan (2002, ambas assentadas sob os postulados de Givón, veremos que a complexidade da matéria – de certa forma desprezada pelas gramáticas tradicionais das línguas clássicas – será mais bem entendida quando percebermos que sintaxe, semântica e pragmática cooperam para a eficácia do uso e do entendimento da linguagem e quando classificarmos voz média ou verbo depoente não a partir de definições generalizantes, antes a partir da concorrência das matérias citadas, tentando ver como voz média ou verbo depoente podem ser entendidos de forma prática, com as experiências de mundo. Por fim, tentaremos estabelecer diálogos, quanto ao assunto, entre latim e português.

  12. Barium isotope fractionation during experimental formation of the double carbonate BaMn[CO3](2) at ambient temperature.

    Science.gov (United States)

    Böttcher, Michael E; Geprägs, Patrizia; Neubert, Nadja; von Allmen, Katja; Pretet, Chloé; Samankassou, Elias; Nägler, Thomas F

    2012-09-01

    In this study, we present the first experimental results for stable barium (Ba) isotope ((137)Ba/(134)Ba) fractionation during low-temperature formation of the anhydrous double carbonate BaMn[CO(3)](2). This investigation is part of an ongoing work on Ba fractionation in the natural barium cycle. Precipitation at a temperature of 21±1°C leads to an enrichment of the lighter Ba isotope described by an enrichment factor of-0.11±0.06‰ in the double carbonate than in an aqueous barium-manganese(II) chloride/sodium bicarbonate solution, which is within the range of previous reports for synthetic pure BaCO (3) (witherite) formation.

  13. Critical currents and pinning forces in a-axis oriented EuBa2Cu3O7/PrBa2Cu3O7 superlattices

    Science.gov (United States)

    Vélez, M.; Martín, J. I.; Vicent, J. L.

    1995-11-01

    a-axis oriented EuBa2Cu3O7/PrBa2Cu3O7 (EBCO/PBCO) superlattices have been grown by dc sputtering. The critical current (JC) behavior is modified by the pinning force arising from the insulating PrBa2Cu3O7 layers, which in a-axis oriented superlattices are perpendicular to the Cu-O planes. Depending on the EBCO and PBCO layer thicknesses the pinning forces deviate from the usual scaling laws as a function of temperature observed in single films. When B is perpendicular to the sample, an exponential dependence of JC(B) appears as the PBCO thickness is increased (coupling is reduced), and also as the thickness of the EBCO layer is reduced.

  14. Substitution of Au or Hg into BaTl2 and BaIn2. New ternary examples of smaller CeCu2-type intermetallic phases.

    Science.gov (United States)

    Dai, Jing-Cao; Corbett, John D

    2006-03-06

    The compounds BaAu(0.40(2))Tl(1.60(7)) (1), BaAu(0.36(4))In(1.64(4)) (2), and BaHg(0.92(2))In(1.08(2)) (3) have been prepared by high-temperature techniques. Single-crystal X-ray diffraction shows that these have the orthorhombic CeCu(2)-type structure, Imma, Z = 4 (a = 5.140(1), 5.104(1), 5.145(1) A; b = 8.317(2), 8.461(2), 8.373(2) A; c = 8.809(2), 8.580(2), 8.715(2) A, respectively). The structure consists of a four-linked honeycomblike polyanion (4(2)6(3)8) of infinity3[Tr2]2- (Tr = In or Tl) with encapsulated Ba2+ cations. The Au or Hg randomly replace Tr in a single type of site. The two gold phases exhibit appreciable nonstoichiometry ranges. Band calculations (EHTB) demonstrate that the three compounds are electron-poor and metallic, and the latter has been confirmed for 1 through resistivity and magnetic susceptibility measurements. The orthorhombic structure of 1 contrasts with the hexagonal structure of BaTl2 (CaIn2-type, P6(3)/mmc), a change that appears to be driven by substitution of the smaller Au atoms into the polyanion network. Relativistic effects for the heavier Au and Hg are evidently responsible for decreases in lattice parameters and bond lengths from BaIn2 to those in isostructural 2 and 3.

  15. The BaBar Data Reconstruction Control System

    Energy Technology Data Exchange (ETDEWEB)

    Ceseracciu, A

    2005-04-20

    The BaBar experiment is characterized by extremely high luminosity and very large volume of data produced and stored, with increasing computing requirements each year. To fulfill these requirements a Control System has been designed and developed for the offline distributed data reconstruction system. The control system described in this paper provides the performance and flexibility needed to manage a large number of small computing farms, and takes full benefit of OO design. The infrastructure is well isolated from the processing layer, it is generic and flexible, based on a light framework providing message passing and cooperative multitasking. The system is distributed in a hierarchical way: the top-level system is organized in farms, farms in services, and services in subservices or code modules. It provides a powerful Finite State Machine framework to describe custom processing models in a simple regular language. This paper describes the design and evolution of this control system, currently in use at SLAC and Padova on {approx}450 CPUs organized in 9 farms.

  16. The Enriched Xenon Observatory: EXO-200 and Ba+ tagging

    Science.gov (United States)

    Dolinski, M. J.; EXO Collaboration

    2012-08-01

    The Enriched Xenon Observatory (EXO) is a proposed ton-scale double beta decay experiment with a tentative design sensitivity to the Majorana mass of ˜10 meV. The first phase of EXO is EXO-200, which uses 200 kg of Xe enriched to 80% in 136Xe to search for neutrinoless double beta decay. EXO-200 is a liquid Xe time projection chamber with the ability to detect both scintillation and ionization signals. The detector is constructed from ultra-low background materials and is currently installed at the Waste Isolation Pilot Plant, a salt mine with a 1600 meter water equivalent overburden. The projected 2 year sensitivity for EXO-200 is T1/20ν>6.4×1025 y at 90% confidence level. Looking toward a ton-scale EXO, one unique feature of the experiment is the proposal to identify the barium daughter produced by 136Xe double beta decay on an event-by-event basis. This technique will allow for the elimination of all backgrounds other than the background from the two-neutrino double beta decay spectrum. The EXO Collaboration is exploring a number of options to implement Ba-daughter tagging in the next generation EXO experiment.

  17. Zooplankton community of Parnaíba River, Northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Ludmilla Cavalcanti Antunes Lucena

    2015-03-01

    Full Text Available Aim:The objective of the present work is to present a list of species of zooplankton (Rotifera, Cladocera and Copepoda from the Parnaíba River. Additionally, we provide comments on their distribution along the river, and between dry and wet seasons.MethodsZooplankton was collected with a plankton net (60 µm mesh and concentrated into a volume of 80 mL for further analysis, during the dry (October 2010 and wet (April 2011 seasons. Sampling was restricted to the marginal areas at depths between 80 and 150 cm.ResultsA total of 132 species was recorded among the three zooplankton groups studied. During the dry season a total of 82 species was registered and 102 species was registered for the wet season. Rotifera contributed with 66.7% of the species, followed by Cladocera (26.5% and Copepoda (6.8%.ConclusionsThe richness of species observed was high compared to other large rivers in Brazil. In the context of current policies for water management and river diversions in northeastern Brazil, the present study highlights the importance of this river system for biodiversity conservation.

  18. Measurements of the CKM Angle Alpha at BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Stracka, Simone; /Milan U. /INFN, Milan

    2012-04-04

    The authors present improved measurements of the branching fractions and CP-asymmetries fin the B{sup 0} {yields} {pi}{sup +}{pi}{sup -}, B{sup 0} {yields} {pi}{sup 0}{pi}{sup 0}, and B{sup +} {yields} {rho}{sup +}{rho}{sup 0} decays, which impact the determination of {alpha}. The combined branching fractions of B {yields} K{sub 1}(1270){pi} and B {yields} K{sub 1}(1400){pi} decays are measured for the first time and allow a novel determination of {alpha} in the B{sup 0} {yields} {alpha}{sub 1}(1260){sup {+-}}{pi}{sup {-+}} decay channel. These measurements are performed using the final dataset collected by the BaBar detector at the PEP-II B-factory. The primary goal of the experiments based at the B factories is to test the Cabibbo-Kobayashi-Maskawa (CKM) picture of CP violation in the standard model of electroweak interactions. This can be achieved by measuring the angles and sides of the Unitarity Triangle in a redundant way.

  19. The use of ICTS in the BA in English teaching

    Directory of Open Access Journals (Sweden)

    Charpentier Jiménez, William

    2014-01-01

    Full Text Available El presente artículo examina el papel de las Tecnologías de la Información y de la Comunicación (TIC en la enseñanza del idioma inglés. A través de una encuesta electrónica, se analizaron las opiniones de cincuenta egresados del Bachillerato en la Enseñanza del Inglés de la Universidad de Costa Rica. Los resultados muestran que las Tecnologías de la Información y de la Comunicación juegan un papel esencial en el aprendizaje de un idioma para el desarrollo de las macro destrezas lingüísticas. Basándose en estos resultados, se concluye que, a pesar de su importancia, las TIC no están completamente incorporadas en esta carrera. This article examines the role of information and communication technologies (ICTs in language teaching. Through an electronic survey, the opinions of fifty ex-students of the B.A. in the Teaching of English at the University of Costa Rica were analyzed. The results show that information and communication technologies play an essential role in language learning to develop the macro linguistic skills. Based on these results, it can be concluded that, despite their importance, ICTs are not being fully incorporated in the major.

  20. Preparation and Characterization of Ag-Doped BaTiO3 Conductive Powders

    Directory of Open Access Journals (Sweden)

    Sue Hao

    2011-01-01

    Full Text Available BaTiO3 powders doped with Ag at different Ag/Ba molar ratios were prepared by sol-gel method. The resistivity reached the lowest point of 5.644 Ω·m when Ag concentration was 0.10 at% and the powders were calcined for two times at 800°C and 500°C. XRD and FTIR investigations showed that no new substance was formed after the doping and calcining process, but the particle size and the strength of Ti-O bond in modified BaTiO3 crystal cell all changed. The conductivity of Ag-doped BaTiO3 powders with different Ag concentrations and through different preparing methods was discussed by using defect theory.

  1. Magneto-transport and electronic structures of BaZnBi2

    Science.gov (United States)

    Wang, Yi-Yan; Guo, Peng-Jie; Yu, Qiao-He; Xu, Sheng; Liu, Kai; Xia, Tian-Long

    2017-12-01

    We report the magneto-transport properties and electronic structures of BaZnBi2. BaZnBi2 is a quasi-two-dimensional material with metallic behavior. Transverse magnetoresistance (MR) depends on magnetic field linearly and exhibits Shubnikov–de Haas (SdH) oscillation at low temperature and high field. The observed linear MR may originate from the disorder in samples or the edge conductivity in compensated two-component systems. The first-principles calculations reveal the absence of stable gapless Dirac fermion. Combined with the trivial Berry phase extracted from the SdH oscillation, BaZnBi2 is suggested as a topologically trivial semimetal. Nearly compensated electron-like Fermi surfaces (FSs) and hole-like FSs coexist in BaZnBi2.

  2. submitter Performance simulation of BaBar DIRC bar boxes in TORCH

    CERN Document Server

    Föhl, K; Castillo García, L; Cussans, D; Forty, R; Frei, C; Gao, R; Gys, T; Harnew, N; Piedigrossi, D; Rademacker, J; Ros García, A; van Dijk, M

    2017-01-01

    TORCH is a large-area precision time-of-flight detector based on the DIRC principle. The DIRC bar boxes of the BaBar experiment at SLAC could possibly be reused to form a part of the TORCH detector time-of-flight wall area, proposed to provide positive particle identification of low momentum kaons in the LHCb experiment at CERN. For a potential integration of BaBar bar boxes into TORCH, new imaging readout optics are required. From the several designs of readout optics that have been considered, two are used in this paper to study the effect of BaBar bar optical imperfections on the detector reconstruction performance. The kaon-pion separation powers obtained from analysing simulated photon hit patterns show the performance reduction for a BaBar bar of non-square geometry compared to a perfectly rectangular cross section.

  3. Ba{sub 2}TeO as an optoelectronic material: First-principles study

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Jifeng, E-mail: sun@magnet.fsu.edu [Materials Science and Technology Division, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States); Department of Chemical and Biomedical Engineering, College of Engineering, Florida Agricultural and Mechanical University-Florida State University, 2525 Pottsdamer St., Tallahassee, Florida 32310 (United States); National High Magnetic Field Laboratory, 1800 E. Paul Dirac Dr., Tallahassee, Florida 32310 (United States); Shi, Hongliang; Du, Mao-Hua; Singh, David J. [Materials Science and Technology Division, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States); Siegrist, Theo [Department of Chemical and Biomedical Engineering, College of Engineering, Florida Agricultural and Mechanical University-Florida State University, 2525 Pottsdamer St., Tallahassee, Florida 32310 (United States); National High Magnetic Field Laboratory, 1800 E. Paul Dirac Dr., Tallahassee, Florida 32310 (United States)

    2015-05-21

    The band structure, optical, and defects properties of Ba{sub 2}TeO are systematically investigated using density functional theory with a view to understanding its potential as an optoelectronic or transparent conducting material. Ba{sub 2}TeO crystallizes with tetragonal structure (space group P4/nmm) and with a 2.93 eV optical bandgap [Besara et al., J. Solid State Chem. 222, 60 (2015)]. We find relatively modest band masses for both electrons and holes suggesting applications. Optical properties show infrared-red absorption when doped. This could potentially be useful for combining wavelength filtering and transparent conducting functions. Furthermore, our defect calculations show that Ba{sub 2}TeO is intrinsically p-type conducting under Ba-poor condition. However, the spontaneous formation of the donor defects may constrain the p-type transport properties and would need to be addressed to enable applications.

  4. The magnetic properties of the Ln sub 2 BaCuO sub 5

    Energy Technology Data Exchange (ETDEWEB)

    Salinas-Sanchez, A.; Saez-Puche, R.; Alario-Franco, M.A. (Universidad Complutense de Madrid (ES). Facultad de Ciencias Quimicas)

    1991-01-01

    The temperature dependence of the magnetic susceptibility for the different Ln{sub 2}BaCuO{sub 5} oxides (green phases) where Ln is Gd, Dy and Ho which after appears as impurities in the synthesis of high temperature superconductors, reveals the existence of antiferromagnetic ordering for both Cu and Ln sublattices. In the case of the isostructural Lu{sub 2}BaCuO{sub 5} the Cu{sup 2+} ions are ordered at about the same temperature found for Y{sub 2}BaCuO{sub 5}. The specific magnetic behavior of Nd{sub 2}BaCuO{sub 5} can be explained by considering its different structure-type.

  5. Data of evolutionary structure change: 1ELTA-2V0BA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ELTA-2V0BA 1ELT 2V0B A A VVGGRVAQPNSWPWQISLQYKSGSSYYHTCGGSLIRQGW...VGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPY...E EEEEEEEEEEEE EEEEEEGG HHHHHHHHH 0 1ELT... A 1ELTA

  6. [Construction of a recombinant stable Ba/F3 cell strain containing Tpr-Met].

    Science.gov (United States)

    Shu, Ling-fei; Li, Wei; Zhan, Yi-qun; Xu, Wang-xiang; Yang, Xiao-ming; Li, Chang-yan

    2012-11-01

    To construct a stable cell strain encoding tumor-associated fused gene which expresses oncoprotein Tpr-Met. We transfected Tpr-Met vector into Ba/F3 cells and screened the cell strain stably expressing Tpr-Met. The interleukin 3 (IL-3) independent proliferation of the cells was measured using the MTS assay. The expression of Tpr-Met, the activity of downstream signal transduction pathway and SU11274-induced inhibition of the signal pathway were investigated by Western blotting. We obtained a Ba/F3 cell strain stably expressing Tpr-Met. The cells presented IL-3 independent proliferation, suggesting a malignant transformation of the cell line. In Tpr-Met transformed Ba/F3 cells, the phosphorylation of Met and ERK were enhanced; however, specific c-Met inhibitor SU11274 suppressed the cell proliferation and c-Met phosphorylation. Tpr-Met transformed Ba/F3 strain has been successfully constructed.

  7. Surfactant-assisted synthesis of BaTiO3 nanoparticles by micro-emulsion method

    Directory of Open Access Journals (Sweden)

    J. L. Gao

    2015-10-01

    Full Text Available Barium titanate (BaTiO3 nanoparticles were successfully synthesized by using a surfactant-assisted method. The various processing parameters, namely, th e species of surfactant, reaction temperature and micro-emusion concentration had been varied, and the effects on the micrographs and crystal structure of BaTiO3 particles had been analyzed by scanning electron microscope (SEM, transmission electron microscopy (TEM and X-ray diffraction (XRD. XRD analyses confirming the tetragonal structure of the BaTiO3 nanoparticles using hexadecyl trimethyl ammonium Bromide (CTAB or nonylphenol polyoxyethylene ether (NP-10 as surfactant. The SEM analysis showed that by changing the species of surfactant, grains with different dimensions could be synthesized. TEM analyses indicate that BaTiO3 nanoparticles with 15–20 nm in diameter were successfully synthesized.

  8. Formation and Photocatalytic Activity of BaTiO3 Nanocubes via Hydrothermal Process

    Directory of Open Access Journals (Sweden)

    Xinrun Xiong

    2015-01-01

    Full Text Available We reported a facile hydrothermal approach to synthesize BaTiO3 nanocubes with controlled sizes for degradation of methylene blue (MB. The nanocubes with reaction time of 48 hours exhibited the highest photocatalytic efficiency, owing to their narrower size distribution and better crystallinity compared to those of 24 hours and, at the meantime, smaller particle size than those of 72 hours. This work also demonstrated the degradation of methylene orange (MO using BaTiO3 nanocubes synthesized for 48 hours. Compared with the removal of MB, BaTiO3 had lower photocatalytic activity on MO, mainly due to the poorer absorption behavior of MO on the surface of BaTiO3 nanocubes. The degradation efficiency for each photocatalytic reaction was calculated. The possible mechanism of the photocatalytic decomposition on MB has been addressed as well.

  9. Hydrothermal synthesis of tetragonal BaTiO3 nanotube arrays with high dielectric performance.

    Science.gov (United States)

    Wang, Liming; Deng, Xiangyun; Li, Jianbao; Liao, Xinxing; Zhang, Guoqing; Wang, Chunpeng; Su, Kuifan

    2014-06-01

    Tetragonal Barium titanate (BaTiO3) nanotube arrays have been prepared using the template-assisted hydrothermal method combined with an annealing process. The in-situ chemical conversion of TiO2 nanotube array templates ensured that BaTiO3 maintained the morphology of the nanotube architectures. Moreover, X-ray diffraction and Raman spectrum characterization were used to confirm that the BaTiO3 nanotube arrays had a tetragonal phase after the use of a simple annealing technique. Typical hysteresis loops showed their ferroelectricity, with the remanent polarization and coercive fields being 2.57 microC/cm2 and 2.52 kV/cm, respectively. The relative dielectric constant of the tetragonal BaTiO3 nanotube arrays reached up to 1000 and the dielectric loss was as low as 0.02 at 1 kHz at room temperature.

  10. Formation of new structural states in compressed BaTiO3 nanopowders

    Science.gov (United States)

    Shmyt'ko, I. M.; Frolov, D. D.; Aronin, A. S.; Ganeeva, G. R.; Kedrov, V. V.

    2017-06-01

    The structural changes in BaTiO3 nanocrystal powder and tablets have been probed via X-ray diffraction, scanning electron and transmission microscopy, and differential calorimetry after successive hightemperature annealing in air. It is shown that, beginning with the annealing temperature of 1200°C, significant amount of the Ba2TiO4 phase forms in the tablets together with the BaTiO3 phase. This phase is equilibrium one; it practically vanishes when the annealing temperature decreases to 700-600°C; and this phase practically restored to the initial state when the annealing temperature is again increased to 1200°C. Annealing the powders causes no formation of new phases, but an increase in their crystallite sizes. A probable reason of the emergence of Ba2TiO4 phase in tablets and its absence in free powder is discussed, as well.

  11. Influence Cr on Crystallization and the Phase Transformations of the Bronze BA1044

    Directory of Open Access Journals (Sweden)

    B. P. Pisarek

    2007-07-01

    Full Text Available The investigations were introduced in the paper, method of thermal and derivative analysis (TDA, the process of crystallization and phase transformation in the solid state of the aluminium bronze CuA110Fe4Ni4 (BA1044 and with the addition 0.3% Cr. Two intermetallic phase were identified in the microstructure of the bronze BA1044: κFel - rich in Fe and Cu and κFe2 - rich in Fe, and in the microstructure of the bronze BA1044+0.3 % Cr only one phase κFel - rich in Fe, Cu and Cr. The presence of chrome in the bronze BA1044 reduce size the primary crystals of the phase β, reduces the dynamics of the processes of thermal phase transformation in the solid state and lengthens the time their of duration.

  12. Separation of Sr from Ca, Ba and Ra by means of Ca(OH)2 and Ba(Ra)Cl2 or Ba(Ra)SO4 for the determination of radiostrontium

    DEFF Research Database (Denmark)

    Chen, Q.J.; Hou, Xiaolin; Yu, Y.X.

    2002-01-01

    be completed. The new separation procedure has been successfully used for the determination of Sr-90 in samples with high Ca content, such as 451 of seawater and 2001 of drinking water. The analytical quality of the results is comparable to that of the traditional method using fuming nitric acid and BaCrO4...

  13. Ca, Sr and Ba stable isotopes reveal the fate of soil nutrients along a tropical climosequence

    Science.gov (United States)

    Bullen, Thomas D.; Chadwick, Oliver A.

    2016-01-01

    Nutrient biolifting is an important pedogenic process in which plant roots obtain inorganic nutrients such as phosphorus (P) and calcium (Ca) from minerals at depth and concentrate those nutrients at the surface. Here we use soil chemistry and stable isotopes of the alkaline earth elements Ca, strontium (Sr) and barium (Ba) to test the hypothesis that biolifting of P has been an important pedogenic process across a soil climosequence developed on volcanic deposits at Kohala Mountain, Hawaii. The geochemical linkage between these elements is revealed as generally positive site-specific relationships in soil mass gains and losses, particularly for P, Ba and Ca, using the ratio of immobile elements titanium and niobium (Ti/Nb) to link individual soil samples to a restricted compositional range of the chemically and isotopically diverse volcanic parent materials. At sites where P is enriched in surface soils relative to abundances in deeper soils, the isotope compositions of exchangeable Ca, Sr and Ba in the shallowest soil horizons (volcanic parent materials and trend toward those of plants growing on fresh volcanic deposits. In contrast the isotope composition of exchangeable Ba in deeper soil horizons (> 10 cm depth) at those sites is consistently heavier than the volcanic parent materials. The isotope compositions of exchangeable Ca and Sr trend toward heavier compositions with depth more gradually, reflecting increasing leakiness from these soils in the order Ba soils, a simple box model demonstrates that persistence of isotopically light exchangeable Ca, Sr and Ba in the shallowest soil horizons requires that the uptake flux to plants from those near-surface layers is less than the recycling flux returned to the surface as litterfall. This observation implicates an uptake flux from an additional source which we attribute to biolifting. We view the heavy exchangeable Ba relative to soil parent values in deeper soils at sites where P is enriched in surface soils

  14. Effect of magnetic field on the temperature gradient in Y1Ba2Cu3O7 - δ + Eu1Ba2Cu3O7 - δ rods

    Science.gov (United States)

    Churin, S. A.

    2009-05-01

    A method for growing Y1Ba2Cu3O7 - δ + Eu1Ba2Cu3O7 - δ (YBCO-EBCO) high-temperature superconductor rods is described. The temperature dependences of the resistance of rods in a magnetic field of B = 0.6 T and in the absence of the field ( B = 0 T) are presented. The current-voltage characteristics of YBCO-EBCO rods have been measured at liquid nitrogen temperature have been measured in the absence and presence of a magnetic field. It is shown that the magnetic field significantly decreases the temperature gradient arising when the rod leaves the superconducting state.

  15. Aspectos clínico-patológicos e controle da paratuberculose em rebanho bovino leiteiro

    Directory of Open Access Journals (Sweden)

    Elise M Yamasaki

    2010-11-01

    Full Text Available A paratuberculose ou doença de Johne é uma enterite granulomatosa causada por Mycobacterium avium subsp. paratuberculosis. Descrevem-se os aspectos epidemiológicos, clínico-patológicos e laboratoriais da paratuberculose em rebanho bovino leiteiro no município de Rio Claro, região Sul do Estado do Rio de Janeiro. No período de 2006 a 2009, oito vacas adultas da raça Girolanda apresentaram diarreia crônico-intermitente e perda progressiva de peso. À necropsia, observaram-se linfonodos mesentéricos aumentados de volume e úmidos ao corte, vasos linfáticos subserosos das alças intestinais proeminentes, serosa do intestino com aspecto anelado e cerebroide e a mucosa espessada, pregueada e com aspecto microgranular. À microscopia havia, desde o duodeno até o reto, inflamação granulomatosa difusa, marcada dilatação dos vasos linfáticos no ápice das vilosidades, linfangiectasia e linfangite granulomatosa na submucosa, muscular e serosa. A inflamação granulomatosa também foi vista nos linfonodos mesentéricos. A coloração de Ziehl-Neelsen revelou variável quantidade de bacilos álcool-ácido resistentes no interior de macrófagos, de células gigantes de Langhans e livres na mucosa e submucosa dos intestinos delgado e grosso e em linfonodos mesentéricos. Em alguns animais, a lâmina própria da mucosa, principalmente do jejuno e íleo exibia acentuada hipertrofia. Mycobacterium avium subsp. paratuberculosis foi isolado em cultivo bacteriano de Herrold com micobactina, a partir de amostras de fezes, de raspado de mucosa intestinal e de leite e identificado pela técnica de PCR IS900. Através da avaliação sorológica semestral, foram analisadas 298 vacas do mesmo rebanho a partir de três anos de idade, observou-se cerca de 40% de animais reagentes ao teste ELISA indireto no período estudado. O diagnóstico da paratuberculose foi baseado nos dados clínico-patológicos, na sorologia, no isolamento e identificação do

  16. Scanning Auger microscopy analysis of 90 K Y--Ba--Cu--O superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Cota, L.; Morales de la Garza, L.; Hirata, G.; Martinez, L.; Orozco, E.; Carrillo, E.; Mendoza, A.; Albarran, J.L.; Fuentes-Maya, J.; Boldu, J.L.; and others

    1988-05-01

    The oxide superconductor Y--Ba--Cu--O is studied using Auger scanning microscopy. The chemical depth profiles of the samples were obtained. It is concluded that two phases are present in the sample, one corresponding to the standard composition and another that is Ba enriched. The first shows a platelet shape and the second a granular appearence that covers the surface of the sample.

  17. Resistance to micro-plastic deformation in superconducting Y-Ba-Cu-O

    Science.gov (United States)

    Nishi, Yoshitake; Tokunaga, Shigeki; Toyama, Toshinobu

    1988-01-01

    The stress-strain behavior of a Y-Ba-Cu-O superconducting ceramic (Tc above 90 K) is investigated experimentally under conditions of microplastic deformation using X-ray diffraction analysis and Vickers hardness measurements. The resistance of YBa2Cu3O(9-y) specimens to microplastic deformation is estimated at HV 520 at the surface and 300 in the bulk. It is further shown that polishing increases Tc by removing a surface layer of sintered Y-Ba-Cu oxide.

  18. Lithium insertion in Ba sub 2 YCu sub 3 O sub 7-y

    Energy Technology Data Exchange (ETDEWEB)

    Alario-Franco, M.A.; Moran, E.; Varez, A. (Dept. de Quimica Inorganica 1, Univ. Complutense, Madrid (Spain)); Santamaria, J.; Sanchez-Quesada, F. (Dept. de Fisica Aplicada 3, Univ. Complutense, Madrid (Spain))

    1990-12-01

    Novel materials, Li{sub x}Ba{sub 2}YCu{sub 3}O{sub 7-y}(0{<=}x{<=}2), have been obtained by reaction of Ba{sub 2}YCu{sub 3}O{sub 7-y} with n-butyllithium. The most striking feature of these materials is the coexistence of both ionic conductivity and superconductivity for 0

  19. Characterization, dielectric and electrical behaviour of BaTiO3 ...

    Indian Academy of Sciences (India)

    Administrator

    thick suspension of BaTiO3 nanoparticles were spread on a carbon conductive tape attached to the surface of SEM brass stub. The particles on the stub were coated with gold–palladium by plasma sputtering for 3 min for the preparation for FE–SEM imaging. The FE–SEM image of. BaTiO3 nanoparticles prepared is shown ...

  20. Characterization, dielectric and electrical behaviour of BaTiO3 ...

    Indian Academy of Sciences (India)

    A new sol-precipitation technique for the preparation of nano BaTiO3 crystallite has been developed by reacting 0.2 M each of Ti(IV) triethanolaminato isopropoxide and hydrated barium hydroxide in methanol such that the molar ratio of Ba : Ti is 1.02 at 80 °C under stirring (1200 rpm) for one hour in alkaline media using ...

  1. How Extended Is Wernicke's Area? Meta-Analytic Connectivity Study of BA20 and Integrative Proposal

    OpenAIRE

    Alfredo Ardila; Byron Bernal; Monica Rosselli

    2016-01-01

    Understanding the functions of different brain areas has represented a major endeavor of contemporary neurosciences. The purpose of this paper was to pinpoint the connectivity of Brodmann area 20 (BA20) (inferior temporal gyrus, fusiform gyrus) in language tasks. A meta-analysis was conducted to assess the language network in which BA20 is involved. The DataBase of Brainmap was used; 11 papers corresponding to 12 experimental conditions with a total of 207 subjects were included in this analy...

  2. Fabrication of Perovskite-type Oxide BaPbO Nanoparticles and their ...

    African Journals Online (AJOL)

    NICO

    ized by XRD, TEM, SEM, EDX and IR techniques. The photocatalytic activity of ... (BaPbO3) is crystal at 700 °C. The XRD, TEM and SEM revealed that BaPbO3 particles are prepared in the nano-size regime. The results show that the ... colour).4 Dyes are classi- fied according to chemical structure and type of application.

  3. Microcalorimetric study of carbon dioxide adsorption in BaY zeolite

    OpenAIRE

    RAKHMATKARIEVA FERUZA; RAKHMATKARIEV GAIRAT; GURO VITALY PAVLOVICH

    2015-01-01

    Differential heats and isotherm of carbon dioxide adsorption in a zeolite ВaY have been measured by Tian-Calvet-type microcalorimeter and volumetric system at 303 K. Based on the data obtained, the mechanism of (CO2)n/Ba 2+ complexes formation in the zeolitic matrix of BaY is revealed. The adsorption isotherm is quantitatively reproduced by VOM theory equations.

  4. The relationship of structure to superconductivity in the Pr-Ba-Cu-O system

    Energy Technology Data Exchange (ETDEWEB)

    Minseo, Park [Iowa State Univ., Ames, IA (United States)

    1994-05-10

    The relation of structure to lack of superconductivity in Pr-Ba-Cu-O was systematically investigated. First, the phase equilibria of this system was studied to find the processing parameters which maximize the cation-site ordering between Pr and Ba ions. Second, a comparative study between superconducting Nd-Ba-Cu-0 and non- superconducting Pr-Ba-Cu-0 was performed by forming solid-solution Nd- Pr-Ba-Cu-0. The relation between structure and superconductivity in Ndb1-xPrxBa2Cu3O7-δ is investigated. Tc decreases monotonically with increasing x and superconductivity disappears at around x=0.3-0.4. Tc is enhanced by 10K when the sample is processed at an oxygen partial pressure (PO2) of 0.01 atm, followed by oxygenation at 450C. Depression of (Tc) as a function of x and PO 2 is explained in terms of a charge-transfer model. It is suggested that destruction of superconductivity in the RE1-xPrxBa2CU3O7-δ (RE=rare-earth) system can be viewed as disruption of four-fold planar coordinated Cu ions in the chain-site due to permanent occupation of extra Pr ions on Ba sites.

  5. Structural Distortion Stabilizing the Antiferromagnetic and Semiconducting Ground State of BaMn2As2

    Directory of Open Access Journals (Sweden)

    Ekkehard Krüger

    2016-09-01

    Full Text Available We report evidence that the experimentally found antiferromagnetic structure as well as the semiconducting ground state of BaMn 2 As 2 are caused by optimally-localized Wannier states of special symmetry existing at the Fermi level of BaMn 2 As 2 . In addition, we find that a (small tetragonal distortion of the crystal is required to stabilize the antiferromagnetic semiconducting state. To our knowledge, this distortion has not yet been established experimentally.

  6. Introduction of Culex Toxicity into Bacillus thuringiensis Cry4Ba by Protein Engineering

    OpenAIRE

    Abdullah, Mohd Amir F.; Alzate, Oscar; Mohammad, Marwan; McNall, Rebecca J.; Adang, Michael J.; Dean, Donald H.

    2003-01-01

    Bacillus thuringiensis mosquitocidal toxin Cry4Ba has no significant natural activity against Culex quinquefasciatus or Culex pipiens (50% lethal concentrations [LC50], >80,000 and >20,000 ng/ml, respectively). We introduced amino acid substitutions in three putative loops of domain II of Cry4Ba. The mutant proteins were tested on four different species of mosquitoes, Aedes aegypti, Anopheles quadrimaculatus, C. quinquefasciatus, and C. pipiens. Putative loop 1 and 2 exchanges eliminated acti...

  7. Photoluminescence of water-soluble NdF nanoparticles by codoping Li or Ba ions

    Science.gov (United States)

    Fan, Ting; Lü, Jiantao; Li, Na; Han, Dingan

    2013-02-01

    Water-soluble NdF3, NdF3:Li+, and NdF3:Ba nanoparticles coated with polyvinylpyrrolidone were synthesized by a simple hydrothermal method. The products were characterized by x-ray diffraction, field-emission scanning electron microscopy, and photoluminescence spectra at room temperature. Codoping with Li+ ions does not change the emission intensity of water-soluble NdF3 nanoparticles, whereas codoping with Ba ions improves the near-infrared emissions.

  8. Ba2ErNbO6: A new perovskite ceramic substrate for Bi (2223 ...

    Indian Academy of Sciences (India)

    Barium erbium niobate (Ba2ErNbO6) has been developed as a new substrate for (Bi,Pb)2Sr2Ca2Cu3O [Bi(2223)] superconductor film. Ba2ErNbO6 (BENO) has a cubic perovskite structure with lattice constant, = 8.318 Å. The Bi(2223) superconductor does not show any detectable chemical reaction with BENO even ...

  9. Plastic debris ingestion by sea turtle in Paraíba, Brazil.

    Science.gov (United States)

    Mascarenhas, Rita; Santos, Robson; Zeppelini, Douglas

    2004-08-01

    Coastal gill net entanglement and debris intake are important threats to the survival of sea turtles. Two sea turtles (Lepidochelys olivacea and Chelonia mydas) were found stranded along the coast of Paraíba. After necropsy, plastic debris were found in the stomach. The debris is described. This is the first record of this sort of problem for the Paraíba littoral.

  10. Aspectos morfométricos do timo em gatos domésticos (Felis domesticus

    Directory of Open Access Journals (Sweden)

    Camila E. Barroso

    2012-12-01

    Full Text Available O timo é um órgão linfático primário que desenvolve sua atividade em organismos jovens. Apesar de sua função ser responsável por mecanismos fundamentais na aquisição das defesas e conseqüentes respostas orgânicas, ela ainda não está totalmente esclarecida, nem tampouco as bases morfológicas que respondem por tais funções, como o processo de desenvolvimento e involução do órgão. Objetivou-se analisar e caracterizar os aspectos morfológicos do timo, tais como seu tamanho e volume, e aspectos histológicos do timo em gatos, correlacionando o sexo e o desenvolvimento etário. Doze timos provenientes de fetos de gatos domésticos (Felis domesticus sem raça definida (SRD, machos e fêmeas, separados em três grupos etários. O timo apresentou-se com uma coloração rosa-pálida e com duas porções, a torácica e a cervical, sendo que cada uma delas possuía um lobo direito e um lobo esquerdo em sua maioria. A porção torácica localizava-se em região de mediastino cranial, entre os pulmões e à base do coração. E a porção cervical estendia-se além das costelas em sentido cranial, estando localizada ventralmente à traqueia. A estrutura celular do timo demonstrou-se organizada com a presença de agregados concêntricos, os chamados corpúsculos tímicos, formados por células epiteliais, sustentada por uma cápsula de tecido conjuntivo de onde partiam septos que ao penetrar no órgão dividia-o em lóbulos. Ocorreram variações significativas quanto à lobação e as dimensões do timo entre indivíduos da mesma faixa etária, e entre sexos diferentes. Os valores relativos ao comprimento, espessura e largura, de maneira geral, apresentaram aumento, em conformidade ao desenvolvimento dos animais, mas com diferenças entre os sexos.

  11. Estrategia Guiada por Modelos para incluir Aspectos de Seguridad en Sistemas Empotrados Basados en Servicios Web

    Directory of Open Access Journals (Sweden)

    Juan Pedro Silva Gallino

    2014-01-01

    Full Text Available Resumen: En los sistemas distribuidos modernos, como la Internet o Web de las Cosas, la seguridad juega un papel preponderante. Debe prestarse especial atencio’n a la consideracio’n de estos aspectos en las primeras etapas de desarrollo. En este contexto, el desarrollo guiado por modelos de requisitos no funcionales (NF presenta especial intere's, ya que aborda dichas caracter’ısticas NF en la etapa de diseño, cuando todav’ıa se pueden realizar ana’lisis, y au’n hay margen para modificaciones antes de que e'stas sean muy costosas. El uso de estas metodolog’ıas guiadas por modelos ofrece beneficios tales como el aumento de la productividad, una mayor reutilizacio’n de los elementos de diseño, o una mejor mantenibilidad del sistema. Este art’ıculo presenta una estrategia de desarrollo que permite integrar aspectos NF de seguridad (confidencialidad, integridad, y control de acceso en los sistemas de software empotrado. Abstract: In modern distributed systems, such as in the Internet or Web of Things, security plays a fundamental role. Special atention must be placed, then, in considering these aspects in the first stages of development. In this context, the model-driven development of non functional (NF requirements is of great interest, as it addresses those NF characteristics in the design stage, when analyses can be performed, and there is room for changes while they are still not too costly. The use of modeldriven methodologies brings with them some intrinsic benefits, such as the increase in productivity, a greater reuse of design elements, or an improved maintainability of the system. This paper presents a development strategy that allows integrating non-functional security aspects (such as as confidentiality, integrity, or access control in embedded systems design. Palabras clave: Desarrollo Guiado por Modelos, Perfil de Dispositivos para Servicios Web, Pol’ıticas de

  12. Aspectos nutricionais relacionados ao ciclo menstrual Nutritional aspects related to menstrual cycle

    Directory of Open Access Journals (Sweden)

    Helena Alves de Carvalho SAMPAIO

    2002-09-01

    Full Text Available O objetivo da presente revisão é apresentar os principais tópicos discutidos na literatura quanto à associação da nutrição com o ciclo menstrual, contribuindo para a implementação do atendimento nutricional de mulheres. São revisados aspectos referentes à fisiologia da menstruação, alterações metabólicas durante o ciclo menstrual e comportamentos alimentares associados a ele. Considerando-se o ciclo menstrual dividido em duas fases, a folicular e a lútea, é nesta última que são descritas mais alterações, como retenção de água, elevação de peso, aumento de demanda energética, modificações no perfil lipídico e no metabolismo de vitamina D, cálcio, magnésio e ferro, hipersensibilidade emocional, dores generalizadas e mudança do comportamento alimentar. Em relação a este último item, podem ocorrer maior ingestão energética e o desenvolvimento de compulsões alimentares, principalmente por chocolate, doces e alimentos muito salgados. É fundamental que todos os aspectos citados sejam investigados durante a consulta nutricional, a fim de serem adotadas condutas mais específicas.The aim of the present review is to show the most important topics discussed in literature about the association between nutrition and menstrual cycle, contributing to improve the nutritional care for women. Aspects related to physiology of the menstruation, metabolic changes and feeding behavior during the menstrual cycle are reviewed. Considering the menstrual cycle divided in two phases, follicular and luteal, it is in this last one that more alterations are described, like fluid retention, weight gain, increase in caloric needs, modifications in the lipid profile and in the metabolism of vitamin D, calcium, magnesium and iron, emotional hypersensitivity, aches and changes in feeding behavior. In relation to this last item, it can occur a higher caloric intake and the development of food cravings, mainly for chocolate, candies and

  13. Aspectos psicosociales del embarazo en la adolescencia, año 2000

    Directory of Open Access Journals (Sweden)

    Elena Ávila Gálvez

    2002-12-01

    Full Text Available Se realizó un estudio explicativo-observacional, de tipo estudio de casos y controles, en adolescentes entre 10 y 19 años, del sexo femenino, provenientes del Policlínico Docente "Wilfredo Pérez Pérez", en el año 2000, compartidos en 2 grupos: el estudio, con 53 casos que se embarazaron, y el control con 106 adolescentes que no lo hicieron. Se compararon diferentes aspectos de la sexualidad, esfera familiar y sociodemográficos, con el fin de determinar la influencia de algunos aspectos psicosociales del embarazo en la adolescencia. La mayoría de las adolescentes del grupo estudio se incluían en la adolescencia tardía, con inestabilidad en la pareja, mejor nivel de instrucción de los padres, mayor porcentaje que no estudiaba ni trabajaba, con padres divorciados, criadas solamente por la madre, de familias disfuncionales, con inicio precoz de la actividad sexual sin anticonceptivos, con problemas psicológicos que se enmarcaban en el hogar y la familia.An explanatory-observational case-control type-study was performed on female adolescents aged 10-19 years from "Wilfredo Pérez Pérez Teaching Polyclinics in the year 2000. They were divided into two groups: the study group comprising 53 pregnant patients and the control group including 106 adolescents who were not pregnant. Several aspects related to sexuality, family environment and also socio-demographic questions were compared to determine the impact of some psychosocial aspects of pregnancy in adolescence. Most of the adolescents in the study group were in their late adolescence, they had no permanent partner, their parents had a higher level of education; a high number of them neither studied nor worked, their parents were mostly divorced, they were raised by their mothers only, they were from dysfunctional families, with early beginning of sexual intercourse without contraceptives and psychological problems involving the family and the house.

  14. Aspectos epidemiológicos do câncer cervical Epidemiological aspects of cervical cancer

    Directory of Open Access Journals (Sweden)

    Antonio Aleixo Neto

    1991-08-01

    Full Text Available Foi efetuada revisão dos aspectos epidemiológicos do câncer cervical, um dos mais freqüentes em mulheres de países em desenvolvimento. No Brasil a incidência varia de 23,7/100.000, em Porto Alegre, a 83,2/100.000, em Recife. Nos Estados Unidos a incidência em 1978 foi de 6,8/100.000 entre as mulheres brancas e de 14,7/100.000 entre as negras. Várias observações sugerem a hipótese de que o câncer cervical esteja relacionado com algum aspecto da atividade sexual, possivelmente algum agente transmitido por via venérea. As evidências têm implicado o papilomavirus humano (HPV como o principal agente etiológico deste câncer. Vários trabalhos foram analisados quanto à validade desta hipótese etiológica, mostrando que há uma relação entre HPV e o câncer cervical. Foram analisados os fatores de risco mais conhecidos, tais como o comportamento sexual, o tabagismo e a contracepção, diante das várias possibilidades etiológicas existentes.A review concerning the epidemiological issues relating to cervical cancer, one of the most frequent in the women of developing countries, was undertaken in - Brazil, the incidence rate varies from 23.7/100,000 in Porto Alegre to 83.2/100,000 in Recife. In the United States, the 1978 incidence rate was 6.8/100,000 in white women and 14.7/100,000 among black women. Several studies have suggested the hypotheses that cervical cancer could be related to some venereal agent. The evidences have shown the human papillomavirus (HPV to be the main etiological agent. Several studies on the validity of such a hypotheses were realyzed and it became clear that there does infact exist a relationship between the HPV and cervical cancer. Finally, the better known risk factors, such as sexual behaviour, smoking and the contraception were studied in the light of the various etiological hypotheses.

  15. Aspectos de la cultura política del carlismo en el siglo XX

    Directory of Open Access Journals (Sweden)

    Josep Miralles Climent

    2005-01-01

    Full Text Available A través de unas cuantas pinceladas de tíectios y acontecimientos que se han dado en el movimiento carlista durante el siglo XX, he intentado plasmar el desarrollo o evolución de su cultura política. He partido de la base de que el carlismo es un movimiento más complejo de analizar de lo que a simple vista parece; que su evolución no ha sido lineal, y que no se puede hablar de uno, sino de varios carlismos. En este trabajo me he centrado en los acontecimientos que ha venido reivindicando el sector más progresista del mismo, y que de alguna manera son la justificación de su evolución hacia la izquierda, pero sin desdeñar otros aspectos que estarían más próximos al sector tradicionalista. He focalizado la evolución político-cultural del carlismo en los siguientes aspectos: la religiosidad; la sociabilidad en los Círculos Culturales; la defensa de las culturas autóctonas periféricas; la cultura obrera y sindical; la cultura juvenil y estudiantil; la cultura de la violencia; fiestas, ritos y conmemoraciones carlistas; y la evolución cultural e ideológica, incluyendo el papel de las mujeres.Across a few facts and events that have been given in the carlist movement during the 20th century, I have tried to shape the development or evolution of its political culture. I have started from the base that carlism is a more complex movement to analize that at first sight seems, that its evolution has not been linear, and one cannot speak aboutjust one carlism but several ones. In this work I have centred on the events that have been reivlndicated by carlism more progressive sector, and that somehow, are the justiflcatlon ofits evolution towards the left side ofpolitics, but without disdaining other aspects closer to the traditionalist sector I focused the carlism political and cultural evolution in the following aspects: the religiousness; sociableness in the Cultural Circles; autochthonous peripheral cultures defense; the labour and

  16. ASPECTOS COMPOSICIONAIS, PROPRIEDADES FUNCIONAIS, NUTRICIONAIS E SENSORIAIS DO LEITE DE CABRA: UMA REVISÃO

    Directory of Open Access Journals (Sweden)

    Danielle Barros Cenachi

    2011-10-01

    Full Text Available O objetivo deste trabalho foi realizar uma revisão de literatura sobre aspectos composicionais e propriedades funcionais, nutricionais e sensoriais do leite de cabra aplicados à sua tecnologia de processamento. A escassez de publicações contendo informações específicas sobre o leite de cabra motivou a realização deste artigo. Para a realização da revisão bibliográfica foi feita uma busca de artigos científicos nas bases de dados da SpringLink, Nature, Scientific Electronic Library Online, principalmente, acessados através do portal de periódicos da Coordenação de Aperfeiçoamento de Pessoal de Nível Superior por intermédio do Sistema Integrado de Gestão Acadêmica da UFJF. As principais palavras-chave utilizadas como descritor do assunto foram "leite de cabra" em português, em inglês "goat milk" e em espanhol "leche de cabra". O leite de cabra tem um importante papel como fonte de cálcio, de gordura de elevada digestibilidade, de proteína de alto valor biológico e hipoalergenicidade. Comparando o leite caprino com o leite bovino em relação aos aspectos composicionais, observou-se que os leites das duas espécies são distintos. Informações específicas sobre o leite de cabra facilitam o seu processamento e desenvolvimento de novos produtos a partir deste. As propriedades nutricionais e funcionais do leite de cabra justificam sua singularidade e demonstram que o leite caprino e seus produtos representam um nicho promissor para diversificar e inovar a indústria láctea. As propriedades sensoriais relativas ao sabor e odor do leite de cabra representam dificuldades para a sua aceitação, sendo necessárias pesquisas para melhorar estas características.

  17. Aspectos psicobiológicos do comportamento alimentar Psychobiological aspects of feeding behavior

    Directory of Open Access Journals (Sweden)

    Rosana Passos Beinner Cambraia

    2004-06-01

    Full Text Available Esta revisão aborda alguns aspectos psicobiológicos ligados à manifestação do comportamento alimentar, e tem como objetivo evidenciar a relação entre os principais processos neuropsicológicos e a neurociência nutricional. Algumas estruturas neurais estão associadas ao controle alimentar por mecanismos distintos e correlatos que ocorrem no hipotálamo, hipocampo e em outras áreas como no cerebelo, bulbo olfatório, glândulas pituitária e pineal que exercem funções distintas, porém influênciam o comportamento alimentar, intermediadas geralmente por neurotransmissores comuns. Os precursores dos neuroquímicos apresentam funções específicas, sendo a influência na alimentação relevante no contexto comportamental da escolha de alimentos. Os processos sensoriais na alimentação como paladar, olfato, visão e audição interagem entre si e com outras estruturas e vias neurais, participando também do controle do apetite e da saciedade, que culminam na iniciação e no término da alimentação. A interação entre aspectos neurais no processo de consumo de alimento promove a manifestação do comportamento alimentar específico para cada espécie em seu ambiente.This review shows how some psychobiological aspects are related to feeding behavior manifestation, and has as it objective to provide evidence as to the relation between neuropsychological processes and nutritional neuroscience. Several neural structures are associated with alimentary controls, which are distinct but correlated mechanisms; for example: hypothalamus, hypocampus, cerebellum, olfactory bulb, pituitary and pineal glands, all presenting distinct functions, but affecting feeding behavior directly or indirectly through common neurotransmitters. Neurochemical precursors present specific functions and their influence on feeding is evident in behavioral food selection. The sensory processes in feeding, principally taste, olfaction, vision and hearing, interact with

  18. Atores profissionais e estudantes de teatro: aspectos vocais relacionados à prática

    Directory of Open Access Journals (Sweden)

    Juliana Richinitti Vilanova

    Full Text Available RESUMO Objetivo: identificar e comparar, em atores profissionais e estudantes de teatro, os aspectos relacionados à prática profissional, ao uso profissional da voz, hábitos e cuidados vocais, hábitos de saúde e condições ambientais no trabalho. Métodos: participaram 60 sujeitos de ambos os sexos, subdivididos em 2 grupos: Grupo Profissional - atores profissionais de teatro e Grupo Alunos - alunos de teatro sem experiência profissional teatral. Ambos os grupos responderam a um questionário que abordou aspectos relacionados à prática profissional, à voz, hábitos vocais, de saúde, condições ambientais e cuidados vocais. Resultados: os indivíduos do Grupo Profissional apresentaram maior ocorrência de rouquidão; maior ocorrência dos hábitos de usar a voz profissional quando está gripado, em posturas corporais e com respiração inadequadas, gritar, e permanecer em local com mofo ou pouca ventilação, fechado e empoeirado, e realizar ensaio em local diferente do local do espetáculo. O hábito de saúde de ingerir bebidas geladas foi maior no Grupo Alunos. O número de sujeitos que não possuem dificuldade em cena e que realizam aquecimento vocal é significantemente maior no Grupo Profissional. O tipo de aquecimento realizado significantemente mais pelo Grupo Profissional foi som de "s", respiração costo-diafragmática, som basal e vogais. Conclusão: constatou-se que ambos os grupos realizam hábitos prejudiciais e estão expostos a ambiente de trabalho inadequado para saúde vocal. Estes dados apontam a necessidade de ações de saúde vocal, a fim de minimizar o risco de alterações vocais nos profissionais e preparar os estudantes para o aumento da demanda vocal.

  19. An investigation of new infrared nonlinear optical material: BaCdSnSe4, and three new related centrosymmetric compounds: Ba2SnSe4, Mg2GeSe4, and Ba2Ge2S6.

    Science.gov (United States)

    Wu, Kui; Su, Xin; Yang, Zhihua; Pan, Shilie

    2015-12-14

    A series of new metal chalcongenides, BaCdSnSe4 (1), Ba2SnSe4 (2), Mg2GeSe4 (3), and Ba2Ge2S6 (4), were successfully synthesized for the first time. Among them, compounds 2 and 4 were prepared by a molten flux method with Zn as the flux. In their structures, all of them have MQ4 (M = Sn, Ge; Q = S, Se) units. For compound 1, the CdSe4 and SnSe4 groups are connected to form CdSnSe6 layers and these layers are linked together by the Ba atoms. Compounds 2 and 3 are composed of isolated MSe4 (M = Sn, Ge) units and charge-balanced by the Ba or Mg atoms, respectively, while compound 4 has infinite ∞(GeS3)n chains, which is different from the structures of the other three compounds that only have isolated MSe4 (M = Sn, Ge) units. The measured IR and Raman data of the title compounds show wide infrared transmission ranges. The experimental band gaps of compounds 1, 2, 3 and were determined to be 1.79, 1.90, and 2.02 eV, respectively. Band structures were also calculated and indicate that their tetrahedral units, such as [SnSe4], [GeS4] and [GeSe4], determine the energy band gaps of the title compounds, respectively. As for compound 1, based on fundamental light at 2.09 μm, the experimental second harmonic generation (SHG) response is about 1.6 times that of the benchmark AgGaS2, which is also consistent with the calculated value. Based on the above results, compound 1 has promising applications in the IR field as a NLO material.

  20. About room temperature ferromagnetic behavior in BaTiO{sub 3} perovskite

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez, G., E-mail: memodin@yahoo.com [Departamento de Física, CINVESTAV-IPN, A.P. 14-740, México DF 07360, México (Mexico); Escuela Superior de Física y Matemáticas del Instituto Politécnico Nacional, U.P.A.L.M, Edificio 9, Av. Instituto Politécnico Nacional S/N, San Pedro Zacatenco, México DF 07738, México (Mexico); Conde-Gallardo, A. [Departamento de Física, CINVESTAV-IPN, A.P. 14-740, México DF 07360, México (Mexico); Montiel, H. [Centro de Ciencias Aplicadas y Desarrollo Tecnológico de la Universidad Nacional Autónoma de México, Cd. Universitaria, A.P. 70-186, México DF 04510, México (Mexico); Zamorano, R. [Escuela Superior de Física y Matemáticas del Instituto Politécnico Nacional, U.P.A.L.M, Edificio 9, Av. Instituto Politécnico Nacional S/N, San Pedro Zacatenco, México DF 07738, México (Mexico)

    2016-03-01

    A ferromagnetic behavior at room temperature is detected in micro-, submicro- and nano-powders of BaTiO{sub 3} perovskite by means of magnetization measurements, where the magnetic response is originated of different sources, depending on nature of the sample. For BaTiO{sub 3} micropowders is associated with the presence of a magnetic impurity, while for submicro- and nano-powders of BaTiO{sub 3} perovskite, the ferromagnetism is due to magnetic moments arising from the oxygen vacancies on the particles surface. We carry out an additional experimental confirmation of our asseverations by means of the electron paramagnetic resonance (EPR) and the low-field microwave absorption (LFMA), at X-band (8.8–9.8 GHz) and 300 K, indicating the presence of a magnetic impurity in BaTiO{sub 3} micropowders and the existence of oxygen vacancies in BaTiO{sub 3} nanopowders. - Highlights: • Ferromagnetism at 300 K is detected in diverse powders of BaTiO{sub 3} perovskite. • EPR and LFMA techniques are used to investigate the origin of this ferromagnetism. • We discuss on presence of a magnetic impurity and oxygen vacancies in these powders.

  1. Thermoelectric properties of Cu/Ag doped type-III Ba24Ge100 clathrates

    Science.gov (United States)

    Fu, Jiefei; Su, Xianli; Yan, Yonggao; Liu, Wei; Zhang, Zhengkai; She, Xiaoyu; Uher, Ctirad; Tang, Xinfeng

    2017-09-01

    Type-III Ba24Ge100 clathrates possess low thermal conductivity and high electrical conductivity at room temperature and, as such, have a great potential as thermoelectric materials for power generation. However, the Seebeck coefficient is very low due to the intrinsically high carrier concentration. In this paper, a series of Ba24CuxGe100-x and Ba24AgyGe100-y specimens were prepared by vacuum melting combined with the subsequent spark plasma sintering (SPS) process. Doping Cu or Ag on the Ge site not only suppresses the concentration of electrons but it also decreases the thermal conductivity. In addition, the carrier mobility and the Seebeck coefficient increase due to the decrease in the carrier concentration. Thus, the power factor is greatly improved, leading to an improvement in the dimensionless figure of merit ZT. Cu-doped Ba24Cu6Ge94 reaches the maximum ZT value of about 0.17 at 873 K, while Ag-doped Ba24Ag6Ge94 attains the dimensionless figure of merit ZT of 0.31 at 873 K, more than 2 times higher value compared to un-doped Ba24Ge100.

  2. Enhanced resistive memory in Nb-doped BaTiO3 ferroelectric diodes

    Science.gov (United States)

    Jin, Qiao; Zheng, Chunyan; Zhang, Yongcheng; Lu, Chaojing; Dai, Jiyan; Wen, Zheng

    2017-07-01

    In this study, we report on enhanced resistive memory in BaTiO3-based ferroelectric diodes due to the doping of donors. A large ON/OFF current ratio of ˜2000, about two orders of magnitude higher than that of Au/BaTiO3/SrRuO3, is achieved in a Au/Nb:BaTiO3/SrRuO3 diode at room temperature. This can be ascribed to the enhanced ferroelectric-modulation on the potential barrier at the Nb:BaTiO3/SrRuO3 interface associated with the (NbTi4+ 5 +) . donors, which gives rise to an efficient control of device transport between a bulk-limited current in the ON state and an interface-limited Schottky emission in the OFF state. In contrast, the resistance switching is suppressed in a Au/Fe:BaTiO3/SrRuO3 device since the (FeTi4+ 3 +) ' acceptors suppress semiconducting character of the BaTiO3 thin film and make the polarization-modulation of the band diagram negligible. The present work facilitates the design of high-performance resistive memory devices based on ferroelectric diodes with controllable charged defects.

  3. Synthesis and luminescent properties of novel BaGd2O4:Eu3+ scintillating phosphor.

    Science.gov (United States)

    Sun, Xin-Yuan; Wang, Wen-Feng; Sun, Shou-Qiang; Lin, Liang-Wu; Li, De-Yi; Zhou, Ling-Ping

    2013-01-01

    BaGd2-x O4:xEu(3+) and Ba1-y Gd1.79-2y Eu0.21 Na3y O4 phosphors were synthesized at 1300°C in air by conventional solid-state reaction method. Phosphors were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), photoluminescence excitation (PLE) spectra, photoluminescence (PL) spectra and thermoluminescence (TL) spectra. Optimal PL intensity for BaGd2-x O4 :xEu(3+) and Ba1-y Gd1.79-2y Eu0.21 Na3y O4 phosphors at 276 nm excitation were found to be x = 0.24 and y = 0.125, respectively. The PL intensity of Eu(3+) emission could only be enhanced by 1.3 times with incorporation of Na(+) into the BaGd2 O4 host. Enhanced luminescence was attributed to the flux effect of Na(+) ions. However, when BaGd2 O4:Eu(3+) phosphors were codoped with Na(+) ions, the induced defects confirmed by TL spectra impaired the emission intensity of Eu(3+) ions. Copyright © 2012 John Wiley & Sons, Ltd.

  4. Aspectos éticos da experimentação animal Aspectos éticos de la experimentación animal Ethics and animal experiments

    Directory of Open Access Journals (Sweden)

    Taylor Brandão Schnaider

    2003-04-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: O tema abordado é de suma importância, pois almeja-se que o ser humano atinja seu bem-estar físico, mental, social e espiritual, sem esquecer os sagrados direitos de todos os animais. A maioria dos códigos internacionais que tratam das normas de pesquisa na área da saúde cita que a pesquisa desenvolvida em seres humanos deve estar fundamentada na experimentação prévia realizada em animais, em laboratórios ou em outros fatos científicos. O presente artigo tem por objetivo explanar os aspectos éticos da experimentação animal. CONTEÚDO: Os autores revêem os conceitos de dissertação e tese, tese experimental, ensaio experimental ou experiência piloto e de biotério. A seguir fazem uma retrospectiva histórica acerca da primeira tentativa para se estabelecer normas em relação à pesquisa experimental, ocorrida em meados do século XIX em Londres. É ressaltado que alguns critérios definidos àquela época persistem até o presente. A primeira comissão de ética em pesquisa animal foi criada na Suécia em 1979, e a seguir nos EUA em 1984. No Brasil, os comitês de ética em pesquisa animal foram constituídos a partir da década de noventa. Desde maio de 1979 existe a Lei Federal 6638 que estabelece normas para a prática didático-científica da vivissecção de animais. Essa lei, entretanto, ainda aguarda regulamentação. Além dela, tramitam no Congresso Nacional alguns anteprojetos dispondo sobre o uso de animais para atividades de ensino e pesquisa. Finalmente, são apresentadas na íntegra as normas adotadas pelo Colégio Brasileiro de Experimentação Animal e a Declaração Universal dos Direitos dos Animais. CONCLUSÕES: Os docentes, pós-graduandos, residentes e graduandos de uma Faculdade de Medicina, envolvidos em pesquisas realizadas em animais, devem conhecer os princípios éticos que visam proteger os animais selecionados para a realização de um trabalho científico.JUSTIFICATIVA Y

  5. Environmental stress-dependent effects of deletions encompassing Hsp70Ba on canalization and quantitative trait asymmetry in Drosophila melanogaster.

    Directory of Open Access Journals (Sweden)

    Kazuo H Takahashi

    Full Text Available Hsp70 genes may influence the expression of wing abnormalities in Drosophila melanogaster but their effects on variability in quantitative characters and developmental instability are unclear. In this study, we focused on one of the six Hsp70 genes, Hsp70Ba, and investigated its effects on within- and among-individual variability in orbital bristle number, sternopleural bristle number, wing size and wing shape under different environmental conditions. To do this, we studied a newly constructed deletion, Df(3RED5579, which encompasses Hsp70Ba and nine non-Hsp genes, in the heterozygous condition and another, Hsp70Ba(304, which deletes only Hsp70Ba, in the homozygous condition. We found no significant effect of both deletions on within-individual variation quantified by fluctuating asymmetry (FA of morphological traits. On the other hand, the Hsp70Ba(304/Hsp70Ba(304 genotype significantly increased among-individual variation quantified by coefficient of variation (CV of bristle number and wing size in female, while the Df(3RED5579 heterozygote showed no significant effect. The expression level of Hsp70Ba in the deletion heterozygote was 6 to 20 times higher than in control homozygotes, suggesting that the overexpression of Hsp70Ba did not influence developmental stability or canalization significantly. These findings suggest that the absence of expression of Hsp70Ba increases CV of some morphological traits and that HSP70Ba may buffer against environmental perturbations on some quantitative traits.

  6. Effect of Glow-to-Arc Transition on Loss Mechanism of Ba Atoms from Electrode of Fluorescent Lamp

    Science.gov (United States)

    Ueda, Takashi; Samir, Ahmed; Egashira, Yuichi; Yamashita, Go; Shimada, Shozaburo; Yamagata, Yukihiko; Uchino, Kiichiro; Manabe, Yoshio

    2007-10-01

    The loss of Ba atoms from the electrode of a fluorescent lamp was measured while the lamp was operated in the glow and arc discharge modes at 60 Hz. A laser-induced fluorescence (LIF) technique was applied to the measurements of the temporal and spatial distributions of Ba atoms in the vicinity of the electrode. Ground-state (61S0) Ba atoms were excited to a 51P1 level by a frequency-doubled dye laser beam (350.1 nm), and the subsequent fluorescence (51P1-51D2, 582.6 nm) was detected. The temporal and spatial distributions of Ba atoms were found to be completely different in the two discharge modes. Temporally; in the arc discharge mode, the density of the Ba atoms was found to have two peaks, and the number of Ba atoms emitted in the anode half-cycle was about twofold larger than that emitted in the cathode half-cycle. In the glow discharge mode, the number of Ba atoms emitted in the anode half-cycle was found to be negligible compared with that emitted in the cathode half-cycle. Spatially; in the arc discharge mode, Ba atoms were found to be emitted mainly from the hot spot of the filament electrode. In the glow discharge mode, Ba atoms were found to be emitted from all parts of the filament electrodes homogeneously. The mechanism of Ba atom loss in both modes was discussed.

  7. Environmental Stress-Dependent Effects of Deletions Encompassing Hsp70Ba on Canalization and Quantitative Trait Asymmetry in Drosophila melanogaster

    Science.gov (United States)

    Takahashi, Kazuo H.; Daborn, Phillip J.; Hoffmann, Ary A.; Takano-Shimizu, Toshiyuki

    2011-01-01

    Hsp70 genes may influence the expression of wing abnormalities in Drosophila melanogaster but their effects on variability in quantitative characters and developmental instability are unclear. In this study, we focused on one of the six Hsp70 genes, Hsp70Ba, and investigated its effects on within-and among-individual variability in orbital bristle number, sternopleural bristle number, wing size and wing shape under different environmental conditions. To do this, we studied a newly constructed deletion, Df(3R)ED5579, which encompasses Hsp70Ba and nine non-Hsp genes, in the heterozygous condition and another, Hsp70Ba304, which deletes only Hsp70Ba, in the homozygous condition. We found no significant effect of both deletions on within-individual variation quantified by fluctuating asymmetry (FA) of morphological traits. On the other hand, the Hsp70Ba304/Hsp70Ba304 genotype significantly increased among-individual variation quantified by coefficient of variation (CV) of bristle number and wing size in female, while the Df(3R)ED5579 heterozygote showed no significant effect. The expression level of Hsp70Ba in the deletion heterozygote was 6 to 20 times higher than in control homozygotes, suggesting that the overexpression of Hsp70Ba did not influence developmental stability or canalization significantly. These findings suggest that the absence of expression of Hsp70Ba increases CV of some morphological traits and that HSP70Ba may buffer against environmental perturbations on some quantitative traits. PMID:21541022

  8. Core–shell-structure Ag–BaTiO{sub 3} composite nanopowders prepared directly by flame spray pyrolysis

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Seung Ho; Ko, You Na; Lee, Jung-Kul [Department of Chemical Engineering, Konkuk University, 1 Hwayang-dong, Gwangjin-gu, Seoul 143-701 (Korea, Republic of); Park, Byung Kyu [Suncheon Center, Korea Basic Science Institute, Suncheon 540-742 (Korea, Republic of); Kang, Yun Chan, E-mail: yckang@konkuk.ac.kr [Department of Chemical Engineering, Konkuk University, 1 Hwayang-dong, Gwangjin-gu, Seoul 143-701 (Korea, Republic of)

    2013-06-15

    Core–shell-structure Ag–BaTiO{sub 3} composite nanopowders are prepared directly by flame spray pyrolysis. The single-crystalline Ag was located in the core part of the composite powder, and the Ba and Ti components are uniformly distributed in the shell part. The X-ray diffraction (XRD) patterns of the Ag–BaTiO{sub 3} composite powders have the main crystal peaks of Ag and broad peaks at around 28°. The Ag–BaTiO{sub 3} pellets with low Ag contents (below 20 wt%) have a dense structure and fine grain size. Abnormal grain growth of the Ag(30 wt%)–BaTiO{sub 3} pellets occurs even at a low sintering temperature of 1000 °C. The Ag–BaTiO{sub 3} pellet had a mixed crystal structure of BaTiO{sub 3} and Ag phases. Silver is uniformly distributed in the BaTiO{sub 3} matrix without phase separation. The dielectric constants of the BaTiO{sub 3}, Ag(10 wt%)–BaTiO{sub 3}, and Ag(30 wt%)–BaTiO{sub 3} pellets are 830, 2130, and 4680, respectively. - Highlights: • Core–shell-structure Ag–BaTiO{sub 3} nanopowders are prepared by flame spray pyrolysis. • The single-crystalline Ag is located in the core part of the composite nanopowders. • The dielectric constant of the Ag(30 wt%)–BaTiO{sub 3} pellet is high as 4680.

  9. Um aspecto da diversidade cultural do caboclo amazônico: a religião

    Directory of Open Access Journals (Sweden)

    Raymundo Heraldo Maués

    2005-04-01

    Full Text Available ESTE TRABALHO trata de um aspecto da diversidade cultural do caboclo amazônico, isto é, a religião. Esta se constitui numa espécie de catolicismo popular, que mantém relações com o xamanismo nativo - a pajelança cabocla -, e que se originou de antigas práticas e crenças dos índios Tupinambás, que habitaram parte da região amazônica no período colonial, bem como de influências portuguesas e africanas.HIS PAPER deals with a particular aspect of the Amazon caboclo's cultural diversity, namely, religion. Caboclo religion represents a form of folk Catholicism, witch is related to native shamanism - pajelança cabocla -, originating from practices and beliefs of the Tupinambá Indians, who inhabited part of the Amazon Region in colonial times, and cultural influences from Portuguese colonialists and African slaves.

  10. O processo de internacionalização e os aspectos socioambientais: o caso Embraer

    Directory of Open Access Journals (Sweden)

    Isak Kruglianskas

    2008-04-01

    Full Text Available O objetivo deste trabalho é colaborar para que se compreenda se a capacidade de uma organização competir em um mercado internacional pode ser influenciada por questões relacionadas aos aspectos socioambientais que a envolvem, com base nos diferentes contextos em que esta passa a operar. O estudo, de caráter exploratório e descritivo, trata da análise do processo de internacionalização da Embraer, e pautou-se na estratégia de um estudo de caso único e, como meio de coleta de dados, foi escolhida a entrevista pessoal em profundidade, além de utilização de dados de fontes secundárias. O ponto de destaque como resultado é a necessidade da indústria de aviação se reestruturar sob um novo enfoque, que valorize as variáveis sociais e ambientais, sob pena de sua própria sobrevivência em longo prazo.

  11. Aspectos relacionados à ocorrência e mecanismo de ação de fumonisinas

    Directory of Open Access Journals (Sweden)

    Pozzi Claudia Rodrigues

    2002-01-01

    Full Text Available As fumonisinas são micotoxinas produzidas por fungos do gênero Fusarium, um dos principais fitopatógenos de grãos de milho. Isoladas em 1988, a partir de amostras de milho mofado proveniente de região com alta incidência de câncer do esôfago na África, foram relacionadas à ocorrência de leucoencefalomalácia eqüina e hidrotórax e edema pulmonar suíno, e outras patologias animais. A presente revisão aborda aspectos da ocorrência natural das fumonisinas em grãos de milho, características físico-química das moléculas e efeitos toxicológicos em eqüinos, suínos, aves e bovinos, além do provável mecanismo de ação das micotoxinas.

  12. Aspectos histológicos y moleculares del tendón como matriz extracelular extramuscular

    Directory of Open Access Journals (Sweden)

    Doris Rosero

    2016-06-01

    Full Text Available Los tendones corresponden a la matriz extracelular intramuscular junto con las fascias ylas aponeurosis, los cuales se encuentran constantemente sometidos a cargas mecánicas ytensión, lo que genera modificaciones en las características que constituyen el tejido conectivoque los conforman. En estos conceptos, se encuentra el fundamento de alteracionescomo las rupturas tendinosas y las tendinopatías, por lo cual en esta revisión se describieronlos aspectos relacionados con el desarrollo y, la organización de la matriz extracelular,con el fin de ser aplicados a las perspectivas de tratamiento en las que actualmente se estáinvestigando, no sólo desde el punto de vista biomédico, sino clínico, dada su importanciapara el desempeño cotidiano de los seres humanos. Los mecanismos de lesión, reparacióny regeneración, así como los relacionados con la biología mecánica, son los que despiertanel interés de quienes se ocupan de la investigación en esta área.

  13. Aspectos de la infección urinaria en el adulto

    Directory of Open Access Journals (Sweden)

    Daisy María Contreras Duverger

    1998-02-01

    Full Text Available Se realiza una revisión bibliográfica de aspectos importantes de la infección urinaria inespecífica, que se consideran de interés para la mejor preparación del médico general integral. Se describen las terminologías microbiológicas y las utilizadas para evaluar la respuesta al tratamiento, así como la clasificación más actual de esta entidad. Se mencionan los tipos de tratamiento y las drogas más utilizadas, y se enfatiza en el uso de las quinolonasIt is made a bibliographic review of some important aspects of unspecific urinary infection that are considered of interest for a better training of the general comprehensive physician. A description is made of the microbiological terminolgies and of those used to evaluate the response to the treatment, as well as of the latest classification of this disease. The different types of treatment and the most used drugs are mentioned here. Emphasis is made on the use of quinolines

  14. Aspectos genéticos y neuroendocrinos en el trastorno del espectro autista

    Directory of Open Access Journals (Sweden)

    Norma Oviedo

    2015-01-01

    Full Text Available El autismo, hoy en día definido como trastornos del espectro autista, fue descrito inicialmente en 1943. Se caracteriza por alteraciones en la comunicación, la interacción social y un espectro restringido de intereses del paciente. Generalmente se identifica en etapas tempranas del desarrollo a partir de los 18 meses de edad. Actualmente el autismo se considera un desorden neurológico con un espectro que abarca diferentes grados que se asocian con factores genéticos, no genéticos y del medio ambiente. Dentro de los factores genéticos se han referido diversos síndromes relacionados con este trastorno. Asimismo, el autismo se ha estudiado a nivel genético, neurofisiológico, neuroquímico y neuropatológico. Las técnicas de neuroimagen han mostrado múltiples anormalidades estructurales en estos pacientes. También se han observado alteraciones relacionadas en los sistemas serotoninérgico, GABAérgico, catecolaminérgico y colinérgico. En este trabajo se presenta una actualización de la información de los aspectos genéticos y neuroendocrinos del trastorno del espectro autista.

  15. Reconhecimento dos aspectos tacêsicos para o cuidado afetivo e de qualidade ao idoso hospitalizado

    Directory of Open Access Journals (Sweden)

    Teresa Cristina Gioia Schimidt

    2013-04-01

    Full Text Available Verificar os aspectos tacêsicos importantes para serem observados ao tocar o idoso. Estudo de campo, qualitativo e exploratório desenvolvido com 117 graduandos e profissionais de saúde participantes da capacitação em comunicação não verbal em gerontologia. Os resultados revelam que a maioria conseguiu identificar, pelo menos, um fator de atenção que precisa ser respeitado ao tocar o idoso. Os discursos permitiram a construção de nove categorias apontando condições necessárias ao cuidado afetivo e de qualidade prestado no âmbito da tacêsica; quais sejam: autorização para que o toque ocorra; localização do toque; intensidade do toque; condição do idoso; intencionalidade e tipo de toque; duração do toque; sexo e idade de quem toca e quem é tocado; frequência do toque e características das mãos que tocam. O tocar faz parte do cotidiano dos profissionais da saúde e expressa zelo e sentimentos consequentemente, revela a qualidade da assistência prestada.

  16. Aspectos históricos e socioculturais da população surda

    Directory of Open Access Journals (Sweden)

    Soraya Bianca Reis Duarte

    2013-12-01

    Full Text Available Resgata, contextualiza e caracteriza os aspectos sócio-históricos e culturais da comunidade surda que usa a Língua Brasileira de Sinais com enfoque no modelo socioantropológico. O objetivo deste estudo foi realizar a revisão bibliográfica em livros-textos e artigos científicos disponíveis na Biblioteca Virtual de Saúde, independentemente da data de publicação. Foram encontrados 102 artigos e 53 livros, dos quais 33 livros-textos e 26 artigos (quatro da base de dados Lilacs e 22 da Medline constituíram a amostra. Hoje, em contraste com o passado, há leis que asseguram o direito de comunicação e atendimento por meio da Língua Brasileira de Sinais. É urgente a repercussão, aceitação e inserção, nas políticas de saúde, do que estabelecem as leis brasileiras.

  17. Aspectos de Ortega y Gasset en la formación de ciudadanos

    Directory of Open Access Journals (Sweden)

    Miguel RUMAYOR

    2016-05-01

    Full Text Available José Ortega y Gasset no puede ser clasificado como teórico o filósofo de la educación, aunque sus obras poseen importantes reflexiones en ese ámbito del conocimiento. Concretamente en este artículo se pone de manifiesto el valor de la filosofía racio-vitalista y la formación de ciudadanos en la perspectiva personal, lo cual contribuirá a la construcción de la sociedad y a la vida democrática. Además, a la luz del liberalismo político de este autor en el artículo se analizan, ente otras, sus importantes ideas sobre la libertad, el patriotismo, la ciudadanía, la elegancia y la tolerancia, como grandes aportaciones conceptuales a la tarea educativa. Básicamente todo el pensamiento de Ortega se concretará en formar profundamente la intimidad personal de los ciudadanos. Este elemento se muestra como el centro y el objetivo de la formación y en torno a él giran los aspectos sociales y personales de la educación de ciudadanos analizados en este escrito.

  18. Aspectos claves relacionados con la gestión del e.Learning

    Directory of Open Access Journals (Sweden)

    Francisco Lupiáñez Villanueva

    Full Text Available La introducción y uso de las Tecnologías de la Información y la Comunicación, especialmente Internet, en el ámbito de la salud, la medicina y los sistemas sanitarios enfrenta a todos los agentes e instituciones ante numerosos retos. La educación y la formación, como actividades claves tanto de la sociedad de la información como de los sistemas sanitarios, también se ven afectadas por este proceso de cambio. La finalidad de este artículo es identificar y analizar algunos de los aspectos claves relacionados con la introducción de las TIC e Internet en el ámbito de la educación médica continuada desde el punto de vista organizacional. Esta visión nos permite combinar factores pedagógicos, tecnológicos y organizativos. Todos ellos necesarios a la hora de abordar las complejas interacciones que se producen en la implantación de un proyecto de e.Learning.

  19. Aspectos claves relacionados con la gestión del e.Learning

    Directory of Open Access Journals (Sweden)

    Francisco Lupiáñez Villanueva

    2006-12-01

    Full Text Available La introducción y uso de las Tecnologías de la Información y la Comunicación, especialmente Internet, en el ámbito de la salud, la medicina y los sistemas sanitarios enfrenta a todos los agentes e instituciones ante numerosos retos. La educación y la formación, como actividades claves tanto de la sociedad de la información como de los sistemas sanitarios, también se ven afectadas por este proceso de cambio. La finalidad de este artículo es identificar y analizar algunos de los aspectos claves relacionados con la introducción de las TIC e Internet en el ámbito de la educación médica continuada desde el punto de vista organizacional. Esta visión nos permite combinar factores pedagógicos, tecnológicos y organizativos. Todos ellos necesarios a la hora de abordar las complejas interacciones que se producen en la implantación de un proyecto de e.Learning.

  20. Cambio organizacional: Aspecto trascendental para las instituciones de educación superior en Venezuela

    Directory of Open Access Journals (Sweden)

    Nelson Labarca

    2006-01-01

    Full Text Available El artículo presenta el estudio de aspectos teóricos gerenciales para el cambio organizacional en el contexto de las instituciones de educación superior en Venezuela. En primer lugar, se plantea la resistencia al cambio, tanto individual como organizacional. En segundo lugar, el camino para superar la resistencia al mismo, los modelos gerenciales para administrar dicho proceso, así como la Universidad desde la perspectiva de la complejidad. Se concluye que la actual dinámica económica, política, social y cultural del país le exige a las instituciones de educación superior adoptar un proceso de revisión y reorganización administrativa, cuyo principales objetivos deben dirigirse a establecer una organización funcional, eficaz y eficiente que simplifique la toma de decisiones y mejore los procesos de seguimiento, evaluación y control administrativo, sin olvidar el ámbito académico. Lo cual exige una nueva relación Estado-sociedad-Universidad donde las teorías gerenciales basadas en el cambio organizacional son claves para tales fines

  1. Aspectos psicossociais do trabalho e transtornos mentais comuns em pilotos civis

    Directory of Open Access Journals (Sweden)

    Denise Feijó

    2014-11-01

    Full Text Available O objetivo foi investigar a associação entre aspectos psicossociais do trabalho e prevalência de transtornos mentais comuns (TMC em pilotos da aviação civil brasileira. Estudo transversal quantitativo utilizando os instrumentos de autopreenchimento Job Content Questionnaire (JCQ e Self-Reporting Questionnaire (SRQ-20. Foram avaliados 778 pilotos. No modelo de regressão logística múltipla se observa forte associação entre alta exigência e prevalência de TMC, quando comparada com baixa exigência, definida como referência (OR ajustado = 29,0. No modelo ajustado final permaneceram estatisticamente associadas às variáveis carga de trabalho e prática regular de exercício físico. A prevalência esperada de TMC nos pilotos do subgrupo de alta exigência, com carga pesada de trabalho e que não realizavam exercícios físicos, foi de 39,7%, enquanto que para os indivíduos de baixa exigência, que praticam exercícios e têm carga leve de trabalho foi de 0,4%. As condições de trabalho podem ser consideradas como potenciais fatores contribuintes para o surgimento de TMC, com provável impacto na segurança de voo.

  2. Insuficiencia cardíaca: Aspectos básicos de una epidemia en aumento

    Directory of Open Access Journals (Sweden)

    Javier E. Pereira-Rodríguez

    2016-03-01

    Full Text Available La insuficiencia cardíaca representa un gran problema de salud pública en el mundo, ya sea por su creciente prevalencia, como por el costo que implica el tratamiento adecuado de los pacientes que la padecen. Esta afectación es un complejo problema que se origina de un desorden estructural o funcional y deteriora la capacidad de llenado o expulsión ventricular de la sangre. Se caracteriza a su vez, por la presencia de síntomas cardinales, como la disnea, fatiga y retención de líquido. Las principales causas de la insuficiencia cardíaca son la enfermedad isquémica, la cardiopatía hipertensiva, las cardiomiopatías dilatadas y las valvulopatias. En las etapas iniciales, la función cardíaca puede ser normal en reposo, pero no aumenta adecuadamente con el ejercicio; en estadios avanzados se vuelve anormal también en reposo. En esta revisión se resumen los aspectos básicos principales de este síndrome.

  3. Aspectos eticos em estudos longitudinais: o caso do ELSA-Brasil

    Directory of Open Access Journals (Sweden)

    Estela M L Aquino

    2013-06-01

    Full Text Available Historicamente a discussão acerca da eticidade dos atos em pesquisas com seres humanos privilegiou os estudos experimentais, pelo maior potencial de danos aos sujeitos envolvidos. Todavia, os estudos observacionais também envolvem riscos e suscitam questões relevantes. Neste artigo pretende-se apresentar e discutir aspectos éticos do desenvolvimento do ELSA-Brasil, um estudo longitudinal e multicêntrico, com financiamento público, no qual os sujeitos da pesquisa e pesquisadores pertencem às mesmas instituições. São descritos os procedimentos adotados para atender às exigências e compromissos éticos e a casuística que orientou as ações segundo seus princípios norteadores (beneficência, autonomia e justiça social. São apresentados alguns problemas morais que exigiram ponderação sobre riscos e benefícios na confluência com os objetivos do estudo e comentam-se peculiaridades de um estudo longitudinal e seus potenciais benefícios.

  4. Provas da função pulmonar. Controlo de qualidade. Aspectos gerais (1a Parte

    Directory of Open Access Journals (Sweden)

    J.M. Reis Ferreira

    1999-07-01

    Full Text Available RESUMO: Os autores procuraram neste artigo sensibilizar todos os que lidam de perto com a realização dos testes da função respiratória, para a importância da qualidade e dos meios disponiveis para conseguir o seu controlo. Foram deste modo encarados os diferentes factores intervenientes na qualidade, analisandoos de acordo com os dados fornecidos fundamentalmente pela experiência. Foram assim focados, neste primeiro artigo, apenas aspectos gerais trazidos pela prática do dia a dia, a que se seguirá a publicação de novo texto em que serão, dentro do mesmo âmbito, encaradas as diferentes técnicas actualmente usadas para a avaliação da Função Respiratória.REV PORT PNEUMOL 1999; V (4: 393-404 ABSTRACT: The authors claim for the importance of the quality control in order to assure clinically useful results and a well-functioning lung function laboratory, and analyse briefly the different general factors that could be involved in the lack of quality.REV PORTPNEUMOL 1999; V (4: 393-404 Key-words: Quality control, Equipment, Calibration, Accuracity, Colaboration, Palavras-chave: Controlo de qualidade, Equipamento, Calibração, Precisão, Exactidão;Colaboração

  5. Aspectos estructurales del comercio fronterizo entre México y Estados Unidos

    Directory of Open Access Journals (Sweden)

    Bernardo González-Aréchiga

    1985-01-01

    Full Text Available El objetivo de esta presentación es discutir algunos aspectos estructurales de la frontera y someter a discusión la estrategia de investigación del Departamento de Estudios Económicos de CEFNOMEX. Aquí se explica cómo la frontera norte cuenta con una estructura comercial dual con patrones variables de consumo de servicios en Estados Unidos, tales como los educacionales, médicos, asistenciales, etc., que han afectado a la creación de una infraestructura local, y que la zona fronteriza del norte de México exhibe importantes distorsiones estructurales que deben estudiarse para entender sus funcionamiento económico. Es importante mejorar la base informativa con recolección directa. La investigación económica de la región requiere tanto del estudio de sus instituciones, como del monitoreo constante y cuidadoso de sus signos vitales. Una estrategia adecuada de investigación debe combinar ambos y aprovechar las complementariedades de los dos tipos de estudio.

  6. ASPECTOS QUÍMICOS E MICROBIOLÓGICOS DE VINHOS DO RIO GRANDE DO SUL

    Directory of Open Access Journals (Sweden)

    Plinho Francisco Hertz

    1992-12-01

    Full Text Available Foram estudados aspectos químicos e microbiológicos de cem (100 diferentes vinhos adquiridos no comércio do Rio Grande do Sul. Valores mínimos, máximos e médios de anidrido sulfuroso livre e total, etanol, acidez volátil e total, açúcares e pH são descritos para cinqüenta e um (51 vinhos brancos, quarenta e dois (42 tintos e sete rosados, assim como a quantidade de leveduras, fungos e bactérias acéticas e lácticas. Valores médios elevados de anidrido sulfuroso total e livre (124,2 e 18,9mg/l respectivamente foram encontradas em vinhos brancos. Houve correlação direta entre a maior contaminação de amostras com o baixo teor de anidrido sulfuroso livre, como esperado. Vinhos tintos estavam mais contaminados com leveduras que os brancos, o que não era esperado.

  7. Aspectos Estruturais e Fitoquímicos de partes vegetativas de Costus spicatus (Jacq. Sw. (Costaceae

    Directory of Open Access Journals (Sweden)

    L.S. Paes

    2013-01-01

    Full Text Available As folhas de Costus spicatus são amplamente empregadas na medicina popular para o tratamento de várias doenças entre elas: malária, hepatite e doença do aparelho urinário. O objetivo deste trabalho foi identificar aspectos da anatomia dos órgãos vegetativos (folhas, caules, raízes e rizomas associados à triagem fitoquímica visando contribuir com informações relevantes para o desenvolvimento de estudos taxonômicos e farmacológicos. A análise anatômica por meio da microscopia óptica e de varredura evidenciou folha anfi-hipoestomática, com estômatos e tricomas tectores filamentosos simples. O mesofilo é constituído por parênquima clorofiliano, que se divide em duas regiões intercaladas por cordão de fibras e feixes vasculares. O caule é do tipo atactostélico como no rizoma. A raiz é poliarca. Os testes histoquímicos indicaram a presença de amido, proteínas estruturais, alcaloides, cristais de oxalato de cálcio. A prospecção química com extratos hidroalcoólico e aquoso constatou a presença de saponinas, taninos, alcaloides, compostos fenólicos e heterosídeos cianogênicos.

  8. Aspectos celulares en el diagnóstico y tratamiento de los defectos faciales

    Directory of Open Access Journals (Sweden)

    Sara Elena Panizo Bruzón

    2014-11-01

    Full Text Available El manejo de los defectos congénitos refleja globalmente el estilo de vida y la cultura de los diferentes pueblos. Aunque los defectos faciales no constituyan peligro para la vida, existe el daño psicológico y estético para el niño y la angustia para la familia. Se realizó una revisión bibliográfica de los aspectos celulares novedosos, alternativas para el diagnóstico y tratamiento de los defectos congénitos faciales, empleando los recursos disponibles en la red infomed. Se reporta la fisura labio palatina, como uno de los defectos congénitos faciales más frecuentes; en su diagnóstico resulta de gran utilidad la ultrasonografía 3D y doppler color. Existen innovadoras alternativas de tratamiento: ortopedia tridimensional, distracción osteogénica alveolar, plasma rico en factores de crecimiento y coronas telescópicas

  9. Aspectos socioeconómicos de la evaluación de impacto ambiental

    Directory of Open Access Journals (Sweden)

    Echavarren, José Manuel

    2007-08-01

    Full Text Available This article reviews the methodology and background of the socioeconomic dimension in environment impact evaluations. This text examines the pertinence of Social Sciences in the study of environmental assessment. Likewise, the article deals with the main techniques applied to this field. Special attention is drawn to the concept and research of landscape as a social factor of environment as well as to public participation in the processes of Environmental Impact Assessment research.

    El presente artículo revisa la metodología y el fundamento del estudio de los aspectos socioeconómicos de las Evaluaciones de Impacto Ambiental. Se examina la pertinencia de las Ciencias Sociales dentro de los estudios de impacto ambiental, así como las técnicas principales que se aplican en la práctica investigadora al respecto. Se presta atención especial al concepto y al estudio del paisaje como elemento social del medio ambiente, así como a los mecanismos de participación dentro de las dinámicas de las Evaluaciones de Impacto Ambiental.

  10. Aspectos da sexualidade na adolescência Aspects of sexuality in adolescence

    Directory of Open Access Journals (Sweden)

    José Roberto da Silva Brêtas

    2011-07-01

    Full Text Available O estudo envolveu 920 adolescentes entre 12 e 19 anos de idade em escolas de ensino fundamental e médio da região de Santo Eduardo do município de Embu, São Paulo. Teve por objetivo identificar aspectos da sexualidade de adolescentes de ambos os sexos. Os dados foram obtidos por meio de um questionário estruturado, cujos resultados demonstraram a equivalência entre garotas e rapazes com relação à busca de informações específicas sobre sexualidade; 39% dos rapazes e 17% das garotas tinham prática sexual, destes, 77% dos rapazes e 84% das garotas utilizavam preservativo.The study involved 920 adolescents between 12 and 19 years of age in junior and senior high schools of the region of Santo Eduardo of the city of Embu, São Paulo. The objective was to identify aspects of sexuality of adolescents of both sexes. Data were collected through a structured questionnaire, the results of which established the difference between boys and girls with respect to their quest for specific information about sexuality; 39% of boys and 17% of girls practiced sexual intercourse, and among these, 77% of boys and 84% of girls used preservativos.

  11. Aspectos energéticos da teoria cinética dos gases

    Directory of Open Access Journals (Sweden)

    Robert Saraiva Matos

    2014-12-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE Neste artigo, discutem-se aspectos energéticos relacionados à Teoria Cinética dos Gases (TCG. Trata-se de um estudo de revisão bibliográfica. Os dados foram coletados através do levantamento das fontes, por meio de textos técnicos, publicações científicas e livros didáticos. Através da interpretação energética da TCG foi possível discutir a rota para o equilíbrio térmico, a transferência de partículas entre níveis de energia devido à variação na temperatura e também demonstrar a distribuição de Maxwell-Boltzmann-Gibbs. Além disso, notou-se que a visão energética das TCG fornece uma ponte entre colisões e transações financeiras. Conclui-se que a abordagem energética da TCG possui importância crucial para o entendimento dos fundamentos da Física Térmica, sobretudo no Ensino Médio, onde estes estudos possuem uma demanda significativa na disciplina de Física

  12. Aspectos de vida, trabalho e saúde de trabalhadores do setor de rochas ornamentais

    Directory of Open Access Journals (Sweden)

    Marcela Almeida Baptistini

    2013-07-01

    Full Text Available O processo saúde-doença é determinado socialmente, sendo o trabalho um fator que influencia fortemente o perfil de morbimortalidade. O objetivo deste artigo é estudar a relação entre as condições de trabalho e saúde referidas por trabalhadores da indústria de rochas ornamentais, moradores de um distrito de Cachoeiro de Itapemirim (ES. Estudo epidemiológico, transversal, com coleta de dados realizada através de questionário aplicado a 187 trabalhadores em seus domicílios. A análise utilizou métodos estatísticos descritivos e analíticos. Grande percentual de trabalhadores referiu morbidade aguda (45,5% e crônica (44,9%, percebida por eles como relacionada ao trabalho (56,5% e 51,2%, respectivamente. Apesar da maior percepção dos riscos de insalubridade ambiental por parte dos trabalhadores, os que referiram morbidade relacionaram principalmente os aspectos ergonômicos do trabalho ao principal grupo de transtornos apresentados, os osteomusculares. O elevado percentual de morbidade é resultado da inserção desses indivíduos em um processo de trabalho onde as condições e a organização do trabalho geram desgaste físico e mental, sendo determinada pela divisão social do trabalho no setor.

  13. Aspectos clínicos de la Blastomicosis sudamericana (Paracoccidioidomicosis en el Perú

    Directory of Open Access Journals (Sweden)

    Zuño Burstein Alva

    2002-01-01

    Full Text Available En esta revisión se presentan las características más notorias del cuadro clínico de la Blastomicosis Sudamericana en el Perú, tomando como fuente informativa nuestro trabajo del año 1971 (VII Congreso Ibero Latinoamericano de Dermatología, realizado en Caracas, Venezuela que presentó la mayor casuística publicada hasta la actualidad en nuestro medio totalizando 111 casos al recopilar la información de Pesce H., desde el año 1937 hasta 1965, con 71 casos, y la nuestra con 40 casos nuevos del Servicio Académico Asistencial de Dermatología de la Universidad Nacional Mayor de San Marcos en el Hospital Dos de Mayo de Lima, estudiados hasta el año 1971. Con esta casuística se analizan la distribución geográfica, edad, sexo, ocupación, evolución clínica, aspectos y formas clínicas de esta enfermedad.

  14. ASPECTOS DA PRÁTICA MUSICOTERAPÊUTICA: CONTEXTO SOCIAL E COMUNITÁRIO EM PERSPECTIVA

    Directory of Open Access Journals (Sweden)

    Andressa Dias Arndt

    2016-08-01

    Full Text Available Resumo Este artigo propõe uma discussão sobre os pressupostos que fundamentam a prática da Musicoterapia, especificamente quando esta se identifica como uma ação de base social e comunitária. A partir de uma localização histórica, desenvolvem-se reflexões críticas acerca dos principais conceitos que balizam a práxis musicoterapêutica em contexto social e comunitário. A discussão apresentou o termo musicoterapia social e comunitária como uma tentativa de abranger fundamentos da psicologia, sobretudo em uma vertente crítica e sócio-histórica, que abordam uma prática centrada nas relações humanas, na grupalidade e na ação democrática. Temas como lugar, espaço e ação musicoterapêutica foram discutidos. Concluiu-se que tal prática pretende a modificação da realidade social por meio do convívio mediado da criação de sonoridades, em um processo ativo fundamentado na cultura e em aspectos da vivência cotidiana.

  15. ASPECTOS DA PRODUÇÃO CIENTÍFICA SOBRE CONTROLE GERENCIAL

    Directory of Open Access Journals (Sweden)

    Cleyton de Oliveira Ritta

    2017-09-01

    Full Text Available O objetivo geral da pesquisa é avaliar aspectos da produção científica sobre controle gerencial na perspectiva da contabilidade gerencial nos periódicos internacionais da base de dados da Web of Science, disponíveis até 2014. A pesquisa caracteriza-se como descritiva com abordagem quantitativa por meio de estudo bibliométrico. Os procedimentos de coleta resultaram em 32 artigos disponíveis em 8 periódicos. Os resultados da pesquisa mostraram que: maioria dos artigos foi do tipo empírico e de natureza exploratória. O foco das pesquisas tem como temas a funcionalidade de artefatos contábeis e da estrutura do sistema de controle gerencial. A teoria da Contingência foi a principal base teórica do constructo dos artigos. Conclui-se que as pesquisas sobre controle gerencial possuem amplo campo de assuntos para futuras pesquisas. Os fenômenos organizacionais contemporâneos e as novas estruturas organizacionais demandam por estudos exploratórios para compreender a função do sistema de controle gerencial na condução dos negócios.

  16. ASPECTOS DA PRODUÇÃO E CONSUMO DE FLORES E PLANTAS ORNAMENTAIS NO BRASIL

    Directory of Open Access Journals (Sweden)

    AUGUSTO AKI

    2002-08-01

    Full Text Available O presente artigo tem por objetivo uma análise sobre a constituição do mercado de flores e plantas ornamentais no Brasil, aspectos de marketing envolvidos nessa evolução e a sistematização de informações sobre produção e consumo. Inicialmente, é apresentada a evolução desse mercado, elaborada a partir de estudos de técnicos e consultores da área. Segue-se a apresentação de dados e informações de estudos e pesquisas elaborados sobre a evolução da produção. A maioria das informações apresentada consta da pesquisa de campo “Prospecção de Produtos e Mercados: Cadeia Produtiva Nacional”, levada a efeito pelo Instituto Brasileiro de Floricultura (IBRAFLOR com o apoio da Agência de Promoção de Exportações (APEX, e publicada no início de 2003. Com base na estruturação do mercado, produção e consumo, são sugeridas ações visando à maior eficiência da cadeia.

  17. Reconhecimento dos aspectos tacêsicos para o cuidado afetivo e de qualidade ao idoso hospitalizado

    Directory of Open Access Journals (Sweden)

    Teresa Cristina Gioia Schimidt

    Full Text Available Verificar os aspectos tacêsicos importantes para serem observados ao tocar o idoso. Estudo de campo, qualitativo e exploratório desenvolvido com 117 graduandos e profissionais de saúde participantes da capacitação em comunicação não verbal em gerontologia. Os resultados revelam que a maioria conseguiu identificar, pelo menos, um fator de atenção que precisa ser respeitado ao tocar o idoso. Os discursos permitiram a construção de nove categorias apontando condições necessárias ao cuidado afetivo e de qualidade prestado no âmbito da tacêsica; quais sejam: autorização para que o toque ocorra; localização do toque; intensidade do toque; condição do idoso; intencionalidade e tipo de toque; duração do toque; sexo e idade de quem toca e quem é tocado; frequência do toque e características das mãos que tocam. O tocar faz parte do cotidiano dos profissionais da saúde e expressa zelo e sentimentos consequentemente, revela a qualidade da assistência prestada.

  18. Aspectos celulares novedosos en los mecanismos de embriogénesis

    Directory of Open Access Journals (Sweden)

    Sara Elena Panizo Bruzón

    2014-08-01

    Full Text Available La decodificación del genoma humano inició una nueva era en la investigación científica, sobre todo en aquellos campos que involucran eventos celulares y, por consiguiente, a los mecanismos morfogenéticos básicos. Por su importancia, se realiza una revisión bibliográfica, con el objetivo de actualizar en aspectos relacionados con los fundamentos de los mecanismos morfogenéticos básicos. Para la revisión se emplearon los recursos disponibles en la red Infomed, se consultaron las bases de datos Medline y PubMed. En el estudio se indica que los mecanismos morfogenéticos son eventos celulares o fenómenos biológicos, cuya investigación actual intenta explicar, desde un nivel celular, subcelular o molecular, por qué se desencadenan las transformaciones expuestas por la embriología. Se describen los mecanismos morfogenéticos, teniendo en cuenta los últimos conocimientos generados al respecto, evidenciándose que cuando existen deficiencias en ellos, aparecen los defectos en el desarrollo. Se hace referencia a investigaciones que utilizan estos conocimientos a nivel celular, para comprender la génesis de enfermedades y desarrollar novedosos tratamientos

  19. La profesionalización del recurso humano policial. Aspectos curriculares que se deben contemplar

    Directory of Open Access Journals (Sweden)

    María Gabriela Arce Navarro

    2008-01-01

    Full Text Available Este artículo desarrolla una propuesta de organización curricular que garantice el alcance de los objetivos, metas y funciones encomendadas a la Escuela Nacional de Policía, entidad a la que le ha sido conferida la potestad para formar y capacitar a las personas encargadas de velar por la seguridad ciudadana de nuestro país. La propuesta considera elementos aún no establecidos por este centro educativo, aportando avances curriculares significativos para la futura implementación del currículo. Por otro lado, describe los componentes que caracterizan el actual currículo de la Escuela, develando aspectos relevantes sobre la formación y capacitación policial, así como la apertura de esta Institución a los enfoques por competencias laborales, campo en el que incursionó con la implementación del actual Curso Básico Policial por Competencias Laborales.

  20. O Controle Externo das Obras Públicas: Um Panorama Sobre os Principais Aspectos Relacionados ao Tema

    Directory of Open Access Journals (Sweden)

    Glinton José Bezerra de Carvalho Ferreira

    2011-12-01

    Full Text Available O forte avanço das obras públicas nos dias atuais se constitui em elemento propulsor da economia nacional, contribuindo para o desenvolvimento da infraestrutura e favorecendo o crescimento do país. Na contramão da história, permanecemos ainda contaminados pela ganância de alguns gestores, que se utilizam indevidamente do poder publico para a satisfação de interesses particulares, quando deveriam administrar buscando a proteção do patrimônio publico e do interesse social, haja vista estar sob a responsabilidade coletiva o pagamento dos tributos que garantem a receita estatal. Os mecanismos de controle surgem como uma das esperanças da sociedade para manter a predominância do interesse publico sobre o particular. No âmbito do controle externo, os Tribunais de Contas começam a ganhar maior notoriedade e respeito social, em razão do trabalho técnico, ético e fundamentado com que avaliam os atos dos gestores concernentes aos dispêndios públicos realizados, em especial no que se refere as obras públicas, em razão das vultosas cifras aplicadas. Neste contexto, o presente trabalho pretende mostrar um panorama dos principais aspectos relacionados a atuação do controle externo na fiscalização das obras públicas.

  1. Aspectos clínicos da etiologia da hipersensibilidade dentinária cervical

    Directory of Open Access Journals (Sweden)

    SOBRAL Maria Angela Pita

    1999-01-01

    Full Text Available Esta pesquisa visa o estudo dos aspectos clínicos da hipersensibilidade dentinária cervical (HSDC. Um total de 32 pacientes com sintomas de HSDC foram examinados para identificar sua etiologia, sendo avaliados clinicamente 97 dentes. Com base na anamnese e exames clínicos efetuados, classificamos as lesões de acordo com suas principais características em: abrasão, erosão ou abfração. Os seguintes fatores puderam ser associados ao desencadeamento da HSDC: melhor e constante higienização, tratamento periodontal, consumo de alimentos ácidos e trauma oclusal. Concluímos que as lesões pequenas e radiculares estão mais associadas à HSDC, sendo os pré-molares os dentes mais afetados. Alguns hábitos alimentares e de higienização, bem como situações oclusais não-harmônicas e o tratamento periodontal, foram os fatores que predispõem os elementos dentais à HSDC, e os pré-molares, neste estudo, os dentes mais acometidos por esses fatores. Concluímos que as lesões por abrasão foram aquelas que mais manifestaram HSDC.

  2. Aspectos sobre as desigualdades sócio-raciais no Brasil e no Amapá

    Directory of Open Access Journals (Sweden)

    João Paulo da Conceição Alves

    2011-03-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4 Este trabalho constitui-se parte da pesquisa de mestrado intitulada Perspectivas dos alunos negros da escola pública sobre sua inserção no mundo do trabalho. Apresenta como problema as circunstâncias vividas pela população negra na sociedade brasileira e amapaense, analisando aspectos históricos, e o debate contemporâneo sobre as desigualdades sócio-raciais na sociedade brasileira e sua repercussão e (res significação no estado do Amapá. Como resultados, verificou-se que há todo um processo exposto de subjugação sócio-racial no Brasil e no Amapá, reafirmado pelo antagonismo dos índices de desenvolvimento social quando analisados sob o critério racial. O aprofundamento desses índices recaíam de maneira mais intensa sobre a população negra, o que nos aponta, que a implementação de políticas afirmativas fincadas na perspectiva de ressarcimento social, ainda não representam efetivamente uma factual ruptura com o abismo social que separa negros e brancos no Brasil, e particularmente no Amapá. Palavras-chave: Desníveis Sociais. População Negra. Contexto educacional.

  3. Aspectos Estructurales de Bosque de Cativo en la Región del Bajo Atrato, Colombia

    Directory of Open Access Journals (Sweden)

    Gonzalez P Humberto

    1991-09-01

    Full Text Available El planteamiento de sistemas de manejo de los bosques tropicales, requiere del conocimiento tanto de la estructura actual, como de la estimación racional de la respuesta probable del sistema a prácticas culturales que la modifiquen. En este trabajo se hace un análisis de algunos de los parámetros estructurales más relevantes de una asociación vegetal conocida en Colombia con el nombre de catival. Los aspectos que se analizan tienen que ver tanto con características estáticas como dinámicas de dos tipos de bosques sujetos a diferentes grados de inundación. Los resultados muestran que las agrupaciones presentan diferencias sustanciales tanto en términos de la estructura de diámetros y de la diversidad florística como en el grado de importancia y en el patrón de distribución espacial de la especie predominante (PrioriacopaiferaG. Además, las tasas de crecimiento difieren significativamente entre las dos comunidades siendo aproximadamente tre veces superior en el catival A2, que en el catival A1. El estudio además de proporcionar información que permite alimentar planteamientos para el manejo de los cativales, describe las aplicaciones de metodologías para su evaluación y análisis.

  4. Formación en recreación en Colombia: aspectos fundamentales para el estudio

    Directory of Open Access Journals (Sweden)

    Juan Manuel Carreño Cardozo

    2010-12-01

    Full Text Available El escrito presenta la reflexión fundamental de la investigación Estado del arte de los conceptos de recreación en Colombia, en Instituciones de educación técnica-tecnológica y de pregrado en recreación y afines originado en la línea de Investigación formar - Formación de Maestros en Recreación3 del programa Licenciatura en Recreación de la Facultad de Educación Física en la Universidad Pedagógica Nacional. La reflexión contiene los aspectos fundamentales que se postulan en la investigación para el acercamiento de la formación profesional en recreación en Colombia. Con este fin se desarrollan: I. La construcción de objetos sobre formación, II. La formación profesional en recreación, III. Marcos normativos y lineamientos y IV. investigaciones previas. Sobre estos apartes se pretende establecer una base de antecedentes que faciliten la aproximación de la formación en recreación como espacio particular de estudio, orientada a la consolidación del campo de la recreación, articulado a sus posibilidades laborales y académicas.

  5. REPRESENTAÇÕES DE UM GRUPO DE DOCENTES SOBRE DROGAS: ALGUNS ASPECTOS

    Directory of Open Access Journals (Sweden)

    Cláudia Virginia Galindo Cavalcante

    Full Text Available O abuso de drogas é atualmente um grave problema de saúde pública e a escola básica deve contribuir com a sua prevenção. O objetivo do trabalho foi identificar as representações sociais dos professores de um grupo de professores de educação básica sobre drogas. Utilizamos como instrumento de coleta de dados um formulário que continha a seguinte sentença: Para você, drogas são... , aplicado a um grupo de 75 docentes. Utilizando procedimentos da análise de conteúdo buscamos identificar alguns aspectos das representações destes profissionais. Verificamos que estes entendem drogas como algo extremamente maléfico, que produz danos muitas vezes irreversíveis. Programas de formação inicial e continuada devem levar em consideração estas representações e colaborar na ampliação destas.

  6. Condições de trabalho de enfermeiras obstetras: aspectos de uma realidade

    Directory of Open Access Journals (Sweden)

    Isa Maria Nunes

    2002-12-01

    Full Text Available O objetivo deste trabalho foi descrever as condições de trabalho da enfermeira obstetra, suas especificidades, transformações e contradições. A amostra foi constituída de dez enfermeiras habilitadas e/ou especialistas em enfermagem obstétrica, atuantes em seis instituições públicas de Salvador sendo quatro maternidades e dois hospitais gerais. Foram utilizadas a entrevista e a observação participante, como técnicas de coleta de dados. Os resultados, sobre as condições de trabalho são apresentados através dos seguintes componentes: jornada de trabalho; remuneração; alimentação e repouso, recursos humanos; estrutura física equipamentos e mobiliário; materiais e outros aspectos. Constata-se a existência de muitas inadequações nas condições oferecidas para o trabalho da enfermeira obstetra relacionadas à prestação da assistência à mulher durante o parto. Foram encontrados ainda relatos acríticos em relação às condições existentes para o trabalho, expondo contradições inerentes ao trabalho em saúde entendido como prática social.

  7. ESTUDIO DE ASPECTOS RELEVANTES DE LOS HABITANTES DE CAZUCÁ (SECTOR 4

    Directory of Open Access Journals (Sweden)

    Gregorio Clavijo Parrado

    2007-01-01

    Full Text Available Esta investigación de tipo descriptivo tuvo como objetivo general el acercamiento a la realidad social, económi - ca y demográfica de un sector de la comunidad de Cazucá, en aspectos considerados relevantes, tales como: vivienda, educación, ocupación, ingresos, gastos, edad y otros. Aunque la observación de campo se realizó en el sector cuatro de Cazucá (Soacha/Cundinamarca, se podría considerar como una muestra representativa de lo que podría estar sucediendo con el total de la comunidad. Dadas las características socioeconómicas de las familias, como unidades de observación, los resultados de - tectaron su vulnerabilidad a través de dimensiones tangibles y no tangibles relacionadas con la pobreza que, posteriormente, podrían ser objeto de indagación más profunda. Los resultados se socializarán con la comunidad y con las entidades y organismos que en Cazucá están o estén adelantando programas culturales, educativos, microempresariales y otros.

  8. Limitación del esfuerzo terapéutico: aspectos religiosos y culturales

    Directory of Open Access Journals (Sweden)

    Gilberto de Jesús Betancourt Betancourt

    Full Text Available La comprensión de la muerte varía según la época, la cultura, la religión y la edad. Con anterioridad al desarrollo que la ciencia médica ha experimentado desde finales del siglo XIX, en la mayoría de las culturas y religiones había una aceptación de la muerte y se consideraba como parte del ciclo vital de la persona donde se trascendía a una forma celestial y puramente sobrenatural. Los avances científicos de la medicina han venido a cambiar esta situación. La muerte se empezó a ver como un enemigo y dio comienzo a una lucha encarnizada entre ambas. El concepto de "muerte natural" se sustituyó por el de "muerte intervenida," dando origen a numerosas cuestiones relacionadas con la toma de decisiones y actuaciones a realizar en pacientes ingresados y en situación terminal. En este trabajo se realiza una reflexión teórica que tiene como objetivo el análisis bioético acerca de las diferencias entre los aspectos religiosos y culturales relacionados con la práctica de la limitación del esfuerzo terapéutico.

  9. La histerectomía laparoscópica y sus aspectos fundamentales

    Directory of Open Access Journals (Sweden)

    Raysy Sardiñas Ponce

    Full Text Available La histerectomía es una de las técnicas quirúrgicas empleada con mayor frecuencia para tratar las enfermedades uterinas benignas, en nuestro país el abordaje por mínimo acceso para su tratamiento gana terreno en el campo de la cirugía ginecológica. Se realizó una revisión bibliográfica para resumir información sobre la histerectomía laparoscópica. Se expuso los aspectos fundamentales sobre su evolución, la técnica quirúrgica, sus indicaciones, contraindicaciones y complicaciones, así como ventajas y desventajas respecto a otras vías de abordaje para la histerectomía. Todo esto con el fin de crear un material de apoyo actualizado sobre este tema para residentes de especialidades quirúrgicas que practiquen esta intervención. Se concluyó que la histerectomía laparoscópica es una alternativa eficaz y segura para pacientes que cumplan los criterios para esta vía de abordaje.

  10. Considerations on scanography of orbital masses Aspecto escanográfico de algunas masas orbitarias

    Directory of Open Access Journals (Sweden)

    Guillermo Velásquez

    1990-01-01

    Full Text Available

    We report on our experience with 75 patients with orbital masses, studied with Computerized Tomography (CT, at the Ophtalmology and Radiology Services, Hospital Universitario San Vicente de Paúl, and University of Antioquia, School of Medicine, Medellín, Colombia. The most frequent lesions were: retinoblastoma, vascular lesions, infectious lesions, tumors of the lacrymal gland, mucocele, meningloma, melanoma, and metastatic masses. On the basis of our experience we highly recommend CT as the most valuable diagnostic procedure for the study of patients with proptosis and clinical signs of an orbital mass.

    En este artículo se presenta una casuística de 75 masas orbitarias estudiadas en el Hospital Universitario San Vicente de Paúl, de Medellín, mediante la Tomografía Axial Computada y se incluyen imágenes ilustrativas de ocho de ellas; las entidades más frecuentes fueron: retinoblastoma, lesiones vasculares, lesiones Infecciosas y neoplasias de la glándula lacrimal; se mencionan aspectos clínicos seleccionados y se discuten las ventajas de la tomografía para el estudio de este problema; finalmente, se consignan recomendaciones para el uso racional del procedimiento.

  11. Aspectos críticos de gestão em empresas desenvolvedoras de software

    Directory of Open Access Journals (Sweden)

    Leonardo Rocha Oliviera

    2011-12-01

    Full Text Available Uma das características das empresas de desenvolvimento de software é a origem técnica dos seus gestores, o que ocasiona alguns problemas na condução da gestão destas empresas. Fatores relacionados com os profissionais envolvidos na prestação do serviço de desenvolvimento de software também possuem impacto na condução da empresa. O objetivo deste trabalho é identificar os diferentes tipos de desafios enfrentados no dia a dia de trabalho destas empresas. Para isso foi realizada revisão de literatura e entrevistados seis profissionais envolvidos em diferentes níveis de gestão em empresas de Porto Alegre/RS. Pelas respostas obtidas nas entrevistas é possível concluir que os principais aspectos críticos envolvidos na gestão de empresas desenvolvedoras de software são similares aos indicados na revisão de literatura como pontos que merecem atenção especial em atividades de gestão.

  12. Aspectos básicos de la nutrición enteral en el paciente quemado

    Directory of Open Access Journals (Sweden)

    Carlos Manuel Collado Hernández

    Full Text Available El tratamiento nutricional es un elemento importante en la terapia combinada de las lesiones por quemaduras severas, permitiendo un control del catabolismo en el paciente. En los pacientes quemados el hipermetabolismo estimula el aumento de las necesidades proteico calóricas, la influencia del inicio precoz de la nutrición apoya la estabilidad hemodinámica. El objetivo de esta revisión es describir los aspectos esenciales y actuales de la nutrición enteral en el paciente gran quemado como su concepto, vías de administración, importancia de su aplicación, fórmulas principales para el cálculo proteico energético, tratamiento con macronutrientes y micronutrientes para garantizar una nutrición adecuada y acorde a las necesidades. La nutrición enteral continua siendo la vía más importante y segura en el paciente gran quemado para la administración de macronutrientes y micronutrientes necesarios en los procesos metabólicos que garantizan la cicatrización y curación de los mismos.

  13. ASPECTOS SOCIOAMBIENTAIS NA COMUNIDADE DO MORRO DA MARIQUINHA EM FLORIANÓPOLIS/SC

    Directory of Open Access Journals (Sweden)

    Claudia Xavier MACHADO

    2004-12-01

    Full Text Available Neste artigo são apresentados e discutidos os problemas socioambientais do Morro da Mariquinha – comunidade inserida no maciço central de Florianópolis. Foram realizadas entrevistas e levantamento de notícias em jornal e do histórico da ocupação, posteriormente, foi feita uma análise do modo como a mídia retrata o morro e foi elaborado um perfil da comunidade dentro dos aspectos analisados. Socio-environmental aspects in the Mariquinha’s Mount at Florianópolis/SC Abstract This article analyzes the socio-environmental problems in the Mariquinha´s Mount; inserted community in the central bulk of Florianópolis. Interviews had been carried through and survey of news in newspapers survey of job history, later, was made an analysis concerning the way as the press shows the mount and a profile of the situation in the community was elaborated.

  14. ASPECTOS HIDROAMBIENTAIS DO CÓRREGO BARBADO EM CUIABÁ-MT

    Directory of Open Access Journals (Sweden)

    Tayana Carolina Vieira Kreischer

    2012-03-01

    Full Text Available O córrego Barbado, em Cuiabá-MT, a exemplo de outros córregos urbanos, tem sofrido todos os tipos de ações antrópicas, desde obras de canalizações e desvios de seu leito natural, quanto despejos de efluentes domésticos, lixos, destruição de sua mata ciliar e assoreamento. O objetivo deste trabalho foi avaliar alguns aspectos da problemática hidroambiental deste córrego, de sua nascente até a sua foz, usando o monitoramento da qualidade de suas aguas por parâmetros físico-químicos, e por meio da análise da percepção dos moradores do seu entorno. Concluiu-se que o córrego Barbado necessita de projetos de recuperação que incluam desde a conscientização dos moradores do seu entorno sobre a sua importância para o meio ambiente, quanto de investimentos no setor de saneamento básico que priorize a coleta e tratamento de efluentes e a coleta de resíduos sólidos dos bairros que o circundam.

  15. Ba(Mg1/3Nb2/3)O3−xBa(Mg1/8Nb3/4)

    Indian Academy of Sciences (India)

    2017-09-05

    Sep 5, 2017 ... which have application in wireless communications. Their high permittivity (εr), high quality ... ture disorders. High-temperature treatment also results into secondary phases that deteriorate dielectric properties. Kolo- diazhnyi et al [7] reported ordering for BMN ceramics at. 1620. ◦. C, along with Ba3Nb5O15 ...

  16. The Scale Formation of Barite (BaSO4) from Laminar Flowing Water in The Presence of Tartaric Acid and Ba2+ Concentration Variation of Solution

    Science.gov (United States)

    Fatra, F.; Ivanto, G.; Dera, N. S.; Muryanto, S.; Bayuseno, A. P.

    2017-05-01

    The barite (BaSO4) scale is a mineral deposit that can be precipitated during the process of drilling oil and gas in the offshore. Deposite scale in pipes can cause a narrowing of the diameter of pipes, and can reduce water flowing in the pipe. The aim of this study is to investigation the effect of the tartaric acid additive and Ba2+ concentration on the growth o the scale formation of barite in the laminar flow of the piping system. Solution forming barite crystal was prepared by mixing equimolar solutions of barium chloride (BaCl2) and sodium sulfate (Na2SO4) with concentration variations of Ba2+ of 3000, 3500, 4000, 4500, and 5000 ppm. The flow rate of solution is 40 ml/min at temperature of 50 °C. Various concentrations of tartaric acid (C4H6O6) of 0 ppm, 5 ppm and 10 ppm were added to the solutions. The formation of barite from the solution was observed by ion conductivity measurement. The obtained barite crystals before and after adding tartaric acid were dried and characterized by using SEM/EDX for morphology and elemental analysis, and XRD for phase identification. The SEM results show that the morphology of the crystals are star-like particles, while XRD analysis confirmed that the barite crystals were produced during the experiments are high purity. Moreover, the tartaric acid can inhibit the crystal growth of barite.

  17. Zoneamento agroecológico do município de Lagoa Seca, PB Agroecological zoning of the municipal district of Lagoa Seca, Paraíba State

    Directory of Open Access Journals (Sweden)

    Íris do S. Barbosa

    2009-10-01

    Full Text Available Visa-se, cinzelar, neste estudo um zoneamento em que se considerem os aspectos agrícolas, ecológicos e sociais inerentes ao município de Lagoa Seca, PB, elaborado através da análise dos vários cenários apresentados na área. O uso de um conjunto de recursos, como fotointerpretação, processamento de imagens georreferenciadas, posicionamento por satélites, associados à teoria sistêmica de Bertrand, possibilitou a identificação, delimitação e análise das áreas de uso antrópico, agrícola e das áreas com remanescentes vegetais significativos, que caracterizam o município. Foram elaborados para a área em estudo, arquivos digitais georreferenciados, relativos aos temas: limite municipal, áreas urbanizadas, infra-estrutura viária, rede de drenagem, altimetria, cobertura vegetal natural, uso agrícola do solo e zoneamento. Os resultados obtidos evidenciaram que o município apresenta quatro regiões com aspectos distintos, as quais foram identificadas como regiões agroecológicas, de acordo com o fator que mais se destacou em cada área.This work sought to perfect zoning which concerns the agricultural, ecological and social aspects in the municipality of Lagoa Seca in the State of Paraíba through the study of several scenarios in that area. It consisted of a set of approaches such as photo interpretation, geo-referenced image processing, and satellite positioning associated with Bertrand's Systemic Theory that allowed the identification, delimitation and analysis of areas of anthropic and agricultural usage as well as of those with remaining significant vegetation, which characterize the municipality. Digital geo-referenced files were elaborated for the studied area comprising basic data about the municipal limit, urbanized areas, road systems, drainage system, altimetry, cover of natural vegetation, soil farming usage and zoning of agroecological regions. The study showed that the municipality of Lagoa Seca has four regions

  18. Improvement in magnetic properties of La substituted BaFe{sub 12}O{sub 19} particles prepared with an unusually low Fe/Ba molar ratio

    Energy Technology Data Exchange (ETDEWEB)

    Soezeri, H., E-mail: huseyin.sozeri@ume.tubitak.gov.t [TUBITAK-UME, National Metrology Institute, PO Box 54, TR-41470, Gebze-Kocaeli (Turkey); Kuecuek, I. [Physics Department, Faculty of Arts and Sciences, Uludag University, Gorukle Campus, 16059 Bursa (Turkey); Ozkan, H. [Physics Department, Middle East Technical University, 06531 Ankara (Turkey)

    2011-07-15

    In this study, effect of lanthanum substitution on the phase composition, lattice parameters and magnetic properties of barium hexaferrite has been studied in samples synthesized in ammonium nitrate melt. Samples, prepared with different lanthanum amount and having various initial Fe/(Ba+La) ratios in between 12 and 2 {l_brace}(Ba{sub 1-x}La{sub x}).n Fe{sub 2}O{sub 3}, where 0{<=}x{<=}1 and 1{<=}n{<=}6){r_brace}, are sintered at temperatures from 800 to 1200 {sup o}C. The lattice parameters, both a and c, decreases with increasing La amount which results in a decrease of the unit cell volume. The scanning electron microscope micrographs show that the pure and La-substituted sample with x=0.3, both calcinated at 1000 {sup o}C, have grain sizes smaller than 1 {mu}m. The coercivities of the La-substituted samples increase with increasing La amount and reaches to a maximum value of 5.73 kOe, when x=0.3. Sintering at higher temperatures (above 1000 {sup o}C) decreases the coercivity, resembling a transition from single to multi-domain behavior of the particles, while saturation magnetization of the samples continues to increase due to the increasing grain size. Magnetization measurements of the samples prepared with different Fe/(Ba+La) molar ratios, n's, revealed that the specific saturation magnetization slightly increases with decreasing n, while coercivities fluctuates around 5.5 kOe. However, a sharp increase in the saturation magnetization has been observed in the sample having n=1 and washed in HCl. It was measured as 59.2 emu/g at 15 kOe, which is higher than that of the pure sample (57.5 emu/g). Thus, the magnetic parameters are optimized in the sample Ba{sub 0.7}La{sub 0.3}Fe{sub 12}O{sub 19} so as to maximize both coercivity and specific saturation magnetization in the HCl-washed sample synthesized by starting with an unusually low Fe/(Ba+La) molar ratio of 2 (or n=1). - Research highlights: Effect of lanthanum substitution on the phase composition

  19. Aproximación Neuropsicológica al Constructo de Empatía: Aspectos Cognitivos y Neuroanatómicos

    OpenAIRE

    Vanessa Arán Filippetti; Mariana B. López; María Cristina Richaud

    2012-01-01

    Los modelos integradores definen a la empatía como un constructo multidimensional que incluye aspectos afectivos (EA; empatía afectiva) y aspectos cognitivos (EC; empatía cognitiva). El objetivo del presente trabajo es exponer el estado del arte de la asociación entre la empatía y las funciones ejecutivas (FE) y tratar de proponer una integración de las ideas al respecto. Para esto, se adopta un marco conceptual y se revisan estudios que conciben a la EA y a la EC como aspectos complementario...

  20. Tecno-pedagogia: os aspectos lúdicos e pedagógicos da comunicação digital

    OpenAIRE

    Leandro Key Higuchi Yanaze

    2009-01-01

    Esta pesquisa se insere nas linhas de investigação do Centro de Pesquisa ATOPOS, da Escola de Comunicação e Artes da Universidade de São Paulo (ECA/USP) sobre os aspectos teóricos das mídias digitais. Explora a interdisciplinaridade da comunicação digital, ressaltando os aspectos lúdicos e pedagógicos presentes na relação dialógica entre o homem e a tecnologia. Para tanto, desenvolve-se a discussão teórica de vários autores que tratam sobre tecnologia, comunicação digital, ludicidade e pedago...