WorldWideScience

Sample records for caesar-4 1-d multigroup

  1. EXTENSION OF THE 1D FOUR-GROUP ANALYTIC NODAL METHOD TO FULL MULTIGROUP

    Energy Technology Data Exchange (ETDEWEB)

    B. D. Ganapol; D. W. Nigg

    2008-09-01

    In the mid 80’s, a four-group/two-region, entirely analytical 1D nodal benchmark appeared. It was readily acknowledged that this special case was as far as one could go in terms of group number and still achieve an analytical solution. In this work, we show that by decomposing the solution to the multigroup diffusion equation into homogeneous and particular solutions, extension to any number of groups is a relatively straightforward exercise using the mathematics of linear algebra.

  2. CHARTB multigroup transport package

    Energy Technology Data Exchange (ETDEWEB)

    Baker, L.

    1979-03-01

    The physics and numerical implementation of the radiation transport routine used in the CHARTB MHD code are discussed. It is a one-dimensional (Cartesian, cylindrical, and spherical symmetry), multigroup,, diffusion approximation. Tests and applications will be discussed as well.

  3. MCNP: Multigroup/adjoint capabilities

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, J.C.; Redmond, E.L. II; Palmtag, S.P.; Hendricks, J.S.

    1994-04-01

    This report discusses various aspects related to the use and validity of the general purpose Monte Carlo code MCNP for multigroup/adjoint calculations. The increased desire to perform comparisons between Monte Carlo and deterministic codes, along with the ever-present desire to increase the efficiency of large MCNP calculations has produced a greater user demand for the multigroup/adjoint capabilities. To more fully utilize these capabilities, we review the applications of the Monte Carlo multigroup/adjoint method, describe how to generate multigroup cross sections for MCNP with the auxiliary CRSRD code, describe how to use the multigroup/adjoint capability in MCNP, and provide examples and results indicating the effectiveness and validity of the MCNP multigroup/adjoint treatment. This information should assist users in taking advantage of the MCNP multigroup/adjoint capabilities.

  4. Procedure to Generate the MPACT Multigroup Library

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kang Seog [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2015-12-17

    The CASL neutronics simulator MPACT is under development for the neutronics and T-H coupled simulation for the light water reactor. The objective of this document is focused on reviewing the current procedure to generate the MPACT multigroup library. Detailed methodologies and procedures are included in this document for further discussion to improve the MPACT multigroup library.

  5. Simulations of protostellar collapse using multigroup radiation hydrodynamics. I. The first collapse

    CERN Document Server

    Vaytet, Neil; Chabrier, Gilles; Commercon, Benoit; Masson, Jacques

    2012-01-01

    Radiative transfer plays a major role in the process of star formation. Many simulations of gravitational collapse of a cold gas cloud followed by the formation of a protostellar core use a grey treatment of radiative transfer coupled to the hydrodynamics. However, dust opacities which dominate extinction show large variations as a function of frequency. In this paper, we used frequency-dependent radiative transfer to investigate the influence of the opacity variations on the properties of Larson's first core. We used a multigroup M1 moment model in a 1D radiation hydrodynamics code to simulate the spherically symmetric collapse of a 1 solar mass cloud core. Monochromatic dust opacities for five different temperature ranges were used to compute Planck and Rosseland means inside each frequency group. The results are very consistent with previous studies and only small differences were observed between the grey and multigroup simulations. For a same central density, the multigroup simulations tend to produce fi...

  6. Gray and multigroup radiation transport through 3D binary stochastic media with different sphere radii distributions

    Science.gov (United States)

    Olson, Gordon L.

    2017-03-01

    Gray and multigroup radiation is transported through 3D media consisting of spheres randomly placed in a uniform background. Comparisons are made between using constant radii spheres and three different distributions of sphere radii. Because of the computational cost of 3D calculations, only the lowest angle order, n=1, is tested. If the mean chord length is held constant, using different radii distributions makes little difference. This is true for both gray and multigroup solutions. 3D transport solutions are compared to 2D and 1D solutions with the same mean chord lengths. 2D disk and 3D sphere media give solutions that are nearly identical while 1D slab solutions are fundamentally different.

  7. A multigroup radiation diffusion test problem: Comparison of code results with analytic solution

    Energy Technology Data Exchange (ETDEWEB)

    Shestakov, A I; Harte, J A; Bolstad, J H; Offner, S R

    2006-12-21

    We consider a 1D, slab-symmetric test problem for the multigroup radiation diffusion and matter energy balance equations. The test simulates diffusion of energy from a hot central region. Opacities vary with the cube of the frequency and radiation emission is given by a Wien spectrum. We compare results from two LLNL codes, Raptor and Lasnex, with tabular data that define the analytic solution.

  8. Multigroup Free-atom Doppler-broadening Approximation. Theory

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Mark Girard [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-11-06

    Multigroup cross sections at a one target temperature can be Doppler-broadened to multigroup cross sections at a higher target temperature by matrix multiplication if the group structure suf- ficiently resolves the original temperature continuous energy cross section. Matrix elements are the higher temperature group weighted averages of the integral over the lower temperature group boundaries of the free-atom Doppler-broadening kernel. The results match theory for constant and 1/v multigroup cross sections at 618 lanl group structure resolution.

  9. Modelling and simulations of macroscopic multi-group pedestrian flow

    CERN Document Server

    Mahato, Naveen K; Tiwari, Sudarshan

    2016-01-01

    We consider a multi-group microscopic model for pedestrian flow describing the behaviour of large groups. It is based on an interacting particle system coupled to an eikonal equation. Hydrodynamic multi-group models are derived from the underlying particle system as well as scalar multi-group models. The eikonal equation is used to compute optimal paths for the pedestrians. Particle methods are used to solve the macroscopic equations. Numerical test cases are investigated and the models and, in particular, the resulting evacuation times are compared for a wide range of different parameters.

  10. The Suppression of Energy Discretization Errors in Multigroup Transport Calculations

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Edward [Univ. of Michigan, Ann Arbor, MI (United States). Dept. of Nuclear Engineering and Radiological Sciences

    2013-06-17

    The Objective of this project is to develop, implement, and test new deterministric methods to solve, as efficiently as possible, multigroup neutron transport problems having an extremely large number of groups. Our approach was to (i) use the standard CMFD method to "coarsen" the space-angle grid, yielding a multigroup diffusion equation, and (ii) use a new multigrid-in-space-and-energy technique to efficiently solve the multigroup diffusion problem. The overall strategy of (i) how to coarsen the spatial an energy grids, and (ii) how to navigate through the various grids, has the goal of minimizing the overall computational effort. This approach yields not only the fine-grid solution, but also coarse-group flux-weighted cross sections that can be used for other related problems.

  11. Multigroup Moderation Test in Generalized Structured Component Analysis

    Directory of Open Access Journals (Sweden)

    Angga Dwi Mulyanto

    2016-05-01

    Full Text Available Generalized Structured Component Analysis (GSCA is an alternative method in structural modeling using alternating least squares. GSCA can be used for the complex analysis including multigroup. GSCA can be run with a free software called GeSCA, but in GeSCA there is no multigroup moderation test to compare the effect between groups. In this research we propose to use the T test in PLS for testing moderation Multigroup on GSCA. T test only requires sample size, estimate path coefficient, and standard error of each group that are already available on the output of GeSCA and the formula is simple so the user does not need a long time for analysis.

  12. Review of multigroup nuclear cross-section processing

    Energy Technology Data Exchange (ETDEWEB)

    Trubey, D.K.; Hendrickson, H.R. (comps.)

    1978-10-01

    These proceedings consist of 18 papers given at a seminar--workshop on ''Multigroup Nuclear Cross-Section Processing'' held at Oak Ridge, Tennessee, March 14--16, 1978. The papers describe various computer code systems and computing algorithms for producing multigroup neutron and gamma-ray cross sections from evaluated data, and experience with several reference data libraries. Separate abstracts were prepared for 13 of the papers. The remaining five have already been cited in ERA, and may be located by referring to the entry CONF-780334-- in the Report Number Index. (RWR)

  13. Multigroup Confirmatory Factor Analysis: Locating the Invariant Referent Sets

    Science.gov (United States)

    French, Brian F.; Finch, W. Holmes

    2008-01-01

    Multigroup confirmatory factor analysis (MCFA) is a popular method for the examination of measurement invariance and specifically, factor invariance. Recent research has begun to focus on using MCFA to detect invariance for test items. MCFA requires certain parameters (e.g., factor loadings) to be constrained for model identification, which are…

  14. SIMULATE-4 multigroup nodal code with microscopic depletion model

    Energy Technology Data Exchange (ETDEWEB)

    Bahadir, T. [Studsvik Scandpower, Inc., Newton, MA (United States); Lindahl, St.O. [Studsvik Scandpower AB, Vasteras (Sweden); Palmtag, S.P. [Studsvik Scandpower, Inc., Idaho Falls, ID (United States)

    2005-07-01

    SIMULATE-4 is a three-dimensional multigroup analytical nodal code with microscopic depletion capability. It has been developed employing 'first principal models' thus avoiding ad hoc approximations. The multigroup diffusion equations or, optionally, the simplified P{sub 3} equations are solved. Cross sections are described by a hybrid microscopic-macroscopic model that includes approximately 50 heavy nuclides and fission products. Heterogeneities in the axial direction of an assembly are treated systematically. Radially, the assembly is divided into heterogeneous sub-meshes, thereby overcoming the shortcomings of spatially-averaged assembly cross sections and discontinuity factors generated with zero net-current boundary conditions. Numerical tests against higher order transport methods and critical experiments show substantial improvements compared to results of existing nodal models. (authors)

  15. Coupling of Nod1D and HOTCHANNEL: static case; Acoplamiento de Nod1D y HOTCHANNEL: caso estatico

    Energy Technology Data Exchange (ETDEWEB)

    Gomez T, A.M. [IPN-ESFM, 07738 Mexico D.F. (Mexico); Ovando C, R. [IIE-Gcia. de Energia Nuclear, Cuernavaca, Morelos (Mexico)]. e-mail: rovando@iie.org.mx

    2003-07-01

    In this work the joining of the programs Nod1D and HOTCHANNEL, developed in the National Polytechnic Institute (IPN) and in the Electrical Research Institute (IIE) respectively is described. The first one allows to study the neutronic of a nuclear reactor and the second one allows to carry out the analysis of hot channel of a Boiling Water Reactor (BWR). Nod1 D is a program that it solves by nodal methods type finite element those diffusion equations in multigroup, and it is the static part of Nod Kin that it solves the diffusion equation in their time dependent part. For another side HOTCHANNEL is based on a mathematical model constituted by four conservation equations (two of mass conservation, one of motion quantity and one of energy), which are solved applying one discretization in implicit finite differences. Both programs have been verified in independent form using diverse test problems. In this work the modifications that were necessary to carry out to both for obtaining a coupled program that it provides the axial distribution of the neutron flux, the power, the burnup and the void fraction, among others parameters as much as neutronic as thermal hydraulics are described. Those are also mentioned limitations, advantages and disadvantages of the final product to which has been designated Nod1 D-HotChn. Diverse results for the Cycle 1 of the Laguna Verde Unit 1 reactor of the Nucleo electric central comparing them with those obtained directly with the CoreMasterPresto code are provided. (Author)

  16. MUXS: a code to generate multigroup cross sections for sputtering calculations

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, T.J.; Robinson, M.T.; Dodds, H.L. Jr.

    1982-10-01

    This report documents MUXS, a computer code to generate multigroup cross sections for charged particle transport problems. Cross sections generated by MUXS can be used in many multigroup transport codes, with minor modifications to these codes, to calculate sputtering yields, reflection coefficients, penetration distances, etc.

  17. Multigroup Equivalence Analysis for High-Dimensional Expression Data

    Science.gov (United States)

    Yang, Celeste; Bartolucci, Alfred A.; Cui, Xiangqin

    2015-01-01

    Hypothesis tests of equivalence are typically known for their application in bioequivalence studies and acceptance sampling. Their application to gene expression data, in particular high-dimensional gene expression data, has only recently been studied. In this paper, we examine how two multigroup equivalence tests, the F-test and the range test, perform when applied to microarray expression data. We adapted these tests to a well-known equivalence criterion, the difference ratio. Our simulation results showed that both tests can achieve moderate power while controlling the type I error at nominal level for typical expression microarray studies with the benefit of easy-to-interpret equivalence limits. For the range of parameters simulated in this paper, the F-test is more powerful than the range test. However, for comparing three groups, their powers are similar. Finally, the two multigroup tests were applied to a prostate cancer microarray dataset to identify genes whose expression follows a prespecified trajectory across five prostate cancer stages. PMID:26628859

  18. Multigroup Equivalence Analysis for High-Dimensional Expression Data.

    Science.gov (United States)

    Yang, Celeste; Bartolucci, Alfred A; Cui, Xiangqin

    2015-01-01

    Hypothesis tests of equivalence are typically known for their application in bioequivalence studies and acceptance sampling. Their application to gene expression data, in particular high-dimensional gene expression data, has only recently been studied. In this paper, we examine how two multigroup equivalence tests, the F-test and the range test, perform when applied to microarray expression data. We adapted these tests to a well-known equivalence criterion, the difference ratio. Our simulation results showed that both tests can achieve moderate power while controlling the type I error at nominal level for typical expression microarray studies with the benefit of easy-to-interpret equivalence limits. For the range of parameters simulated in this paper, the F-test is more powerful than the range test. However, for comparing three groups, their powers are similar. Finally, the two multigroup tests were applied to a prostate cancer microarray dataset to identify genes whose expression follows a prespecified trajectory across five prostate cancer stages.

  19. Multigroup covariance matrices for fast-reactor studies

    Energy Technology Data Exchange (ETDEWEB)

    Smith, J.D. III; Broadhead, B.L.

    1981-04-01

    This report presents the multigroup covariance matrices based on the ENDF/B-V nuclear data evaluations. The materials and reactions have been chosen according to the specifications of ORNL-5517. Several cross section covariances, other than those specified by that report, are included due to the derived nature of the uncertainty files in ENDF/B-V. The materials represented are Ni, Cr, /sup 16/O, /sup 12/C, Fe, Na, /sup 235/U, /sup 238/U, /sup 239/Pu, /sup 240/Pu, /sup 241/Pu, and /sup 10/B (present due to its correlation to /sup 238/U). The data have been originally processed into a 52-group energy structure by PUFF-II and subsequently collapsed to smaller subgroup strutures. The results are illustrated in 52-group correlation matrix plots and tabulated into thirteen groups for convenience.

  20. A multi-group firefly algorithm for numerical optimization

    Science.gov (United States)

    Tong, Nan; Fu, Qiang; Zhong, Caiming; Wang, Pengjun

    2017-08-01

    To solve the problem of premature convergence of firefly algorithm (FA), this paper analyzes the evolution mechanism of the algorithm, and proposes an improved Firefly algorithm based on modified evolution model and multi-group learning mechanism (IMGFA). A Firefly colony is divided into several subgroups with different model parameters. Within each subgroup, the optimal firefly is responsible for leading the others fireflies to implement the early global evolution, and establish the information mutual system among the fireflies. And then, each firefly achieves local search by following the brighter firefly in its neighbors. At the same time, learning mechanism among the best fireflies in various subgroups to exchange information can help the population to obtain global optimization goals more effectively. Experimental results verify the effectiveness of the proposed algorithm.

  1. Multi-group dynamic quantum secret sharing with single photons

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Hongwei [School of Science and State Key Laboratory of Information Photonics and Optical Communications, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Ma, Haiqiang, E-mail: hqma@bupt.edu.cn [School of Science and State Key Laboratory of Information Photonics and Optical Communications, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Wei, Kejin [School of Science and State Key Laboratory of Information Photonics and Optical Communications, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Yang, Xiuqing [School of Science, Beijing Jiaotong University, Beijing 100044 (China); Qu, Wenxiu; Dou, Tianqi; Chen, Yitian; Li, Ruixue; Zhu, Wu [School of Science and State Key Laboratory of Information Photonics and Optical Communications, Beijing University of Posts and Telecommunications, Beijing 100876 (China)

    2016-07-15

    In this letter, we propose a novel scheme for the realization of single-photon dynamic quantum secret sharing between a boss and three dynamic agent groups. In our system, the boss can not only choose one of these three groups to share the secret with, but also can share two sets of independent keys with two groups without redistribution. Furthermore, the security of communication is enhanced by using a control mode. Compared with previous schemes, our scheme is more flexible and will contribute to a practical application. - Highlights: • A multi-group dynamic quantum secret sharing with single photons scheme is proposed. • Any one of the groups can be chosen to share secret through controlling the polarization of photons. • Two sets of keys can be shared simultaneously without redistribution.

  2. Self-shielding phenomenon modelling in multigroup transport code Apollo-2; Modelisation du phenomene d'autoprotection dans le code de transport multigroupe Apollo 2

    Energy Technology Data Exchange (ETDEWEB)

    Coste-Delclaux, M

    2006-03-15

    This document describes the improvements carried out for modelling the self-shielding phenomenon in the multigroup transport code APOLLO2. They concern the space and energy treatment of the slowing-down equation, the setting up of quadrature formulas to calculate reaction rates, the setting-up of a method that treats directly a resonant mixture and the development of a sub-group method. We validate these improvements either in an elementary or in a global way. Now, we obtain, more accurate multigroup reaction rates and we are able to carry out a reference self-shielding calculation on a very fine multigroup mesh. To end, we draw a conclusion and give some prospects on the remaining work. (author)

  3. Development of a Multi-Group Neutron Cross Section Library Generation System for PWR

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kang Seog; Hong, Ser Gi; Song, Jae Seung; Lee, Kyung Hoon; Cho, Jin Young; Kim, Ha Yong; Koo, Bon Seung; Shim, Hyung Jin; Park, Sang Yoon

    2008-10-15

    This report describes a generation system of multi-group cross section library which is used in the KARMA lattice calculation code. In particular, the theoretical methodologies, program structures, and input preparations for the constituent programs of the system are described in detail. The library generation system consists of the following five programs : ANJOY, GREDIT, MERIT, SUBDATA, and LIBGEN. ANJOY generates automatically the NJOY input files and two batch files for automatic NJOY run for all the nuclides considered. The automatic NJOY run gives TAPE 23 (PENDF output file of BROADR module of NJOY) and TAPE24 (GENDF output file of GROUPR module of NJOY) files for each nuclide. GREDIT prepares a formatted multi-group cross section file in which the cross sections are tabulated versus temperature and background cross section after reading the TAPE24 file. MERIT generates the hydrogen equivalence factors and the resonance integral tables by solving the slowing down equation with ultra-fine group cross sections which are prepared with the TAPE 23 file. SUBDATA generates the subgroup data including subgroup levels and weights after reading the MERIT output file. Finally, LIBGEN generates the final multi-group library file by assembling the data prepared in the previous steps and by reading the other data such as fission product yield data and decay data.The multi-group cross section library includes general multi-group cross sections, resonance data, subgroup data, fission product yield data, kappa-values (energy release per fission), and all the data which are required in the depletion calculation. The addition or elimination of the cross sections for some nuclides can be easily done by changing the LIBGEN input file if the general multi-group cross section and the subgroup data files are prepared.

  4. Evaluation of the HTTR criticality and burnup calculations with continuous-energy and multigroup cross sections

    Energy Technology Data Exchange (ETDEWEB)

    Chiang, Min-Han; Wang, Jui-Yu [Institute of Nuclear Engineering and Science, National Tsing Hua University, 101, Section 2, Kung-Fu Road, Hsinchu 30013, Taiwan (China); Sheu, Rong-Jiun, E-mail: rjsheu@mx.nthu.edu.tw [Institute of Nuclear Engineering and Science, National Tsing Hua University, 101, Section 2, Kung-Fu Road, Hsinchu 30013, Taiwan (China); Department of Engineering System and Science, National Tsing Hua University, 101, Section 2, Kung-Fu Road, Hsinchu 30013, Taiwan (China); Liu, Yen-Wan Hsueh [Institute of Nuclear Engineering and Science, National Tsing Hua University, 101, Section 2, Kung-Fu Road, Hsinchu 30013, Taiwan (China); Department of Engineering System and Science, National Tsing Hua University, 101, Section 2, Kung-Fu Road, Hsinchu 30013, Taiwan (China)

    2014-05-01

    The High Temperature Engineering Test Reactor (HTTR) in Japan is a helium-cooled graphite-moderated reactor designed and operated for the future development of high-temperature gas-cooled reactors. Two detailed full-core models of HTTR have been established by using SCALE6 and MCNP5/X, respectively, to study its neutronic properties. Several benchmark problems were repeated first to validate the calculation models. Careful code-to-code comparisons were made to ensure that two calculation models are both correct and equivalent. Compared with experimental data, the two models show a consistent bias of approximately 20–30 mk overestimation in effective multiplication factor for a wide range of core states. Most of the bias could be related to the ENDF/B-VII.0 cross-section library or incomplete modeling of impurities in graphite. After that, a series of systematic analyses was performed to investigate the effects of cross sections on the HTTR criticality and burnup calculations, with special interest in the comparison between continuous-energy and multigroup results. Multigroup calculations in this study were carried out in 238-group structure and adopted the SCALE double-heterogeneity treatment for resonance self-shielding. The results show that multigroup calculations tend to underestimate the system eigenvalue by a constant amount of ∼5 mk compared to their continuous-energy counterparts. Further sensitivity studies suggest the differences between multigroup and continuous-energy results appear to be temperature independent and also insensitive to burnup effects.

  5. Multigroup Analysis in Partial Least Squares (PLS) Path Modeling: Alternative Methods and Empirical Results

    NARCIS (Netherlands)

    Sarstedt, Marko; Henseler, Jörg; Ringle, Christian M.

    2011-01-01

    Purpose – Partial least squares (PLS) path modeling has become a pivotal empirical research method in international marketing. Owing to group comparisons' important role in research on international marketing, we provide researchers with recommendations on how to conduct multigroup analyses in PLS p

  6. One-Dimensional (1-D) Nanoscale Heterostructures

    Institute of Scientific and Technical Information of China (English)

    Guozhen SHEN; Di CHEN; Yoshio BANDO; Dmitri GOLBERG

    2008-01-01

    One-dimensional (1-D) nanostructures have been attracted much attention as a result of their exceptional properties, which are different from bulk materials. Among 1-D nanostructures, 1-D heterostructures with modulated compositions and interfaces have recently become of particular interest with respect to potential applications in nanoscale building blocks of future optoelectronic devices and systems. Many kinds of methods have been developed for the synthesis of 1-D nanoscale heterostructures. This article reviews the most recent development, with an emphasize on our own recent efforts, on 1-D nanoscale heterostructures, especially those synthesized from the vapor deposition methods, in which all the reactive precursors are mixed together in the reaction chamber. Three types of 1-D nanoscale heterostructures, defined from their morphologies characteristics, are discussed in detail, which include 1-D co-axial core-shell heterostructures, 1-D segmented heterostructures and hierarchical heterostructures. This article begins with a brief survey of various methods that have been developed for synthesizing 1-D nanoscale heterostructures and then mainly focuses on the synthesis, structures and properties of the above three types of nanoscale heterostructures. Finally, this review concludes with personal views towards the topic of 1-D nanoscale heterostructures.

  7. Sample problems for the novice user of the AMPX-II system. [For generating coupled multigroup neutron--gamma libraries, in FORTRAN IV for IBM 360/91

    Energy Technology Data Exchange (ETDEWEB)

    Ford, W.E. III; Roussin, R.W.; Petrie, L.M.; Diggs, B.R.; Comolander, H.E.

    1979-01-01

    Contents of the IBM version of the APMX system distributed by the Radiation Shielding Information Center (APMX-II) are described. Sample problems which demonstrate the procedure for implementing AMPX-II modules to generate point cross sections; generate multigroup neutron, photon production, and photon interaction cross sections for various transport codes; collapse multigroup cross sections; check, edit, and punch multigroup cross sections; and execute a one-dimensional discrete ordinates transport calculation are detailed. 25 figures, 9 tables.

  8. Social exploration of 1D games

    DEFF Research Database (Denmark)

    Valente, Andrea; Marchetti, Emanuela

    2013-01-01

    In this paper the apparently meaningless concept of a 1 dimensional computer game is explored, via netnography. A small number of games was designed and implemented, in close contact with online communities of players and developers, providing evidence that 1 dimension is enough to produce...... interesting gameplay, to allow for level design and even to leave room for artistic considerations on 1D rendering. General techniques to re-design classic 2D games into 1D are also emerging from this exploration....

  9. Measurement invariance via multigroup SEM: Issues and solutions with chi-square-difference tests.

    Science.gov (United States)

    Yuan, Ke-Hai; Chan, Wai

    2016-09-01

    Multigroup structural equation modeling (SEM) plays a key role in studying measurement invariance and in group comparison. When population covariance matrices are deemed not equal across groups, the next step to substantiate measurement invariance is to see whether the sample covariance matrices in all the groups can be adequately fitted by the same factor model, called configural invariance. After configural invariance is established, cross-group equalities of factor loadings, error variances, and factor variances-covariances are then examined in sequence. With mean structures, cross-group equalities of intercepts and factor means are also examined. The established rule is that if the statistic at the current model is not significant at the level of .05, one then moves on to testing the next more restricted model using a chi-square-difference statistic. This article argues that such an established rule is unable to control either Type I or Type II errors. Analysis, an example, and Monte Carlo results show why and how chi-square-difference tests are easily misused. The fundamental issue is that chi-square-difference tests are developed under the assumption that the base model is sufficiently close to the population, and a nonsignificant chi-square statistic tells little about how good the model is. To overcome this issue, this article further proposes that null hypothesis testing in multigroup SEM be replaced by equivalence testing, which allows researchers to effectively control the size of misspecification before moving on to testing a more restricted model. R code is also provided to facilitate the applications of equivalence testing for multigroup SEM. (PsycINFO Database Record

  10. Simulate-HEX - The multi-group diffusion equation in hexagonal-z geometry

    Energy Technology Data Exchange (ETDEWEB)

    Lindahl, S. O. [Studsvik Scandpower, Stensborgsg. 4, SE-72132 Vaesteraes (Sweden)

    2013-07-01

    The multigroup diffusion equation is solved for the hexagonal-z geometry by dividing each hexagon into 6 triangles. In each triangle, the Fourier solution of the wave equation is approximated by 8 plane waves to describe the intra-nodal flux accurately. In the end an efficient Finite Difference like equation is obtained. The coefficients of this equation depend on the flux solution itself and they are updated once per power/void iteration. A numerical example demonstrates the high accuracy of the method. (authors)

  11. Asymptotic behavior of stochastic multi-group epidemic models with distributed delays

    Science.gov (United States)

    Liu, Qun; Jiang, Daqing; Shi, Ningzhong; Hayat, Tasawar; Alsaedi, Ahmed

    2017-02-01

    In this paper, we introduce stochasticity into multi-group epidemic models with distributed delays and general kernel functions. The stochasticity in the model is a standard technique in stochastic population modeling. When the perturbations are small, by using the method of stochastic Lyapunov functions, we carry out a detailed analysis on the asymptotic behavior of the stochastic model regarding of the basic reproduction number R0. If R0 ≤ 1, the solution of the stochastic system oscillates around the disease-free equilibrium E0, while if R0 > 1, the solution of the stochastic model fluctuates around the endemic equilibrium E∗. Moreover, we also establish sufficient conditions of these results.

  12. Multigroup radiation transport in one-dimensional Lagrangian radiation-hydrodynamics codes

    Energy Technology Data Exchange (ETDEWEB)

    Rottler, J.S.

    1987-01-01

    A new treatment of radiation transport has been added to the Lagrangian radiation-hydrodynamics code CHARTD. The new energy flow model was derived based on the assumption that the directional dependence of the radiation energy density can be represented by the first two terms of a spherical harmonic expansion, and that the photon energy spectrum can be partitioned into energy groups. The time derivative in the second moment equation, which is usually neglected, is retained in this implementation of the multigroup P-1 approximation. An accelerated iterative scheme is used to solve the difference equations. The new energy flow model and the iterative scheme will be described.

  13. Geospatial Data Fusion and Multigroup Decision Support for Surface Water Quality Management

    Science.gov (United States)

    Sun, A. Y.; Osidele, O.; Green, R. T.; Xie, H.

    2010-12-01

    Social networking and social media have gained significant popularity and brought fundamental changes to many facets of our everyday life. With the ever-increasing adoption of GPS-enabled gadgets and technology, location-based content is likely to play a central role in social networking sites. While location-based content is not new to the geoscience community, where geographic information systems (GIS) are extensively used, the delivery of useful geospatial data to targeted user groups for decision support is new. Decision makers and modelers ought to make more effective use of the new web-based tools to expand the scope of environmental awareness education, public outreach, and stakeholder interaction. Environmental decision processes are often rife with uncertainty and controversy, requiring integration of multiple sources of information and compromises between diverse interests. Fusing of multisource, multiscale environmental data for multigroup decision support is a challenging task. Toward this goal, a multigroup decision support platform should strive to achieve transparency, impartiality, and timely synthesis of information. The latter criterion often constitutes a major technical bottleneck to traditional GIS-based media, featuring large file or image sizes and requiring special processing before web deployment. Many tools and design patterns have appeared in recent years to ease the situation somewhat. In this project, we explore the use of Web 2.0 technologies for “pushing” location-based content to multigroups involved in surface water quality management and decision making. In particular, our granular bottom-up approach facilitates effective delivery of information to most relevant user groups. Our location-based content includes in-situ and remotely sensed data disseminated by NASA and other national and local agencies. Our project is demonstrated for managing the total maximum daily load (TMDL) program in the Arroyo Colorado coastal river basin

  14. Multi-group pin power reconstruction method based on colorset form functions

    Institute of Scientific and Technical Information of China (English)

    HUANG Hao

    2009-01-01

    A multi-group pin power reconstruction method that fully exploits nodal information obtained from global coarse mesh solution has been developed.It expands the intra-nodal flux distributions into nonseparable semi-analytic basis functions,and a colorset based form function generating method is proposed,which can accurately model the spectral interaction occurring at assembly interface.To demonstrate its accuracy and applicability to realistic problems,the new method is tested against two benchmark problems,including a mixed-oxide fuel problem.The results show that the new method is comparable in accuracy to fine-mesh methods.

  15. Global Stability of Multigroup SIRS Epidemic Model with Varying Population Sizes and Stochastic Perturbation around Equilibrium

    Directory of Open Access Journals (Sweden)

    Xiaoming Fan

    2014-01-01

    Full Text Available We discuss multigroup SIRS (susceptible, infectious, and recovered epidemic models with random perturbations. We carry out a detailed analysis on the asymptotic behavior of the stochastic model; when reproduction number ℛ0>1, we deduce the globally asymptotic stability of the endemic equilibrium by measuring the difference between the solution and the endemic equilibrium of the deterministic model in time average. Numerical methods are employed to illustrate the dynamic behavior of the model and simulate the system of equations developed. The effect of the rate of immunity loss on susceptible and recovered individuals is also analyzed in the deterministic model.

  16. Uncertainty in reactor lattice physics calculations. The effect of dilution on the covariance of multigroup cross sections

    Energy Technology Data Exchange (ETDEWEB)

    McEwan, C.; Ball, M.; Novog, D., E-mail: mcewac2@mcmaster.ca [McMaster Univ., Hamilton, Ontario (Canada)

    2013-07-01

    Simulation results are of little use if nothing is known about the uncertainty in the results. In order to assess the uncertainty in a set of output parameters due to uncertainty in a set of input parameters, knowledge of the covariance between input parameters is required. Current practice is to apply the covariance between multigroup cross sections at infinite dilution to all cross sections including those at non-infinite dilutions. In this work, the effect of dilution on multigroup cross section covariance is investigated as well as the effect on the covariance between the few group homogenized cross sections produced by lattice code DRAGON. (author)

  17. The group-level consequences of sexual conflict in multigroup populations.

    Directory of Open Access Journals (Sweden)

    Omar Tonsi Eldakar

    Full Text Available In typical sexual conflict scenarios, males best equipped to exploit females are favored locally over more prudent males, despite reducing female fitness. However, local advantage is not the only relevant form of selection. In multigroup populations, groups with less sexual conflict will contribute more offspring to the next generation than higher conflict groups, countering the local advantage of harmful males. Here, we varied male aggression within- and between-groups in a laboratory population of water striders and measured resulting differences in local population growth over a period of three weeks. The overall pool fitness (i.e., adults produced of less aggressive pools exceeded that of high aggression pools by a factor of three, with the high aggression pools essentially experiencing no population growth over the course of the study. When comparing the fitness of individuals across groups, aggression appeared to be under stabilizing selection in the multigroup population. The use of contextual analysis revealed that overall stabilizing selection was a product of selection favoring aggression within groups, but selected against it at the group-level. Therefore, this report provides further evidence to show that what evolves in the total population is not merely an extension of within-group dynamics.

  18. Consistent Multigroup Theory Enabling Accurate Course-Group Simulation of Gen IV Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rahnema, Farzad; Haghighat, Alireza; Ougouag, Abderrafi

    2013-11-29

    The objective of this proposal is the development of a consistent multi-group theory that accurately accounts for the energy-angle coupling associated with collapsed-group cross sections. This will allow for coarse-group transport and diffusion theory calculations that exhibit continuous energy accuracy and implicitly treat cross- section resonances. This is of particular importance when considering the highly heterogeneous and optically thin reactor designs within the Next Generation Nuclear Plant (NGNP) framework. In such reactors, ignoring the influence of anisotropy in the angular flux on the collapsed cross section, especially at the interface between core and reflector near which control rods are located, results in inaccurate estimates of the rod worth, a serious safety concern. The scope of this project will include the development and verification of a new multi-group theory enabling high-fidelity transport and diffusion calculations in coarse groups, as well as a methodology for the implementation of this method in existing codes. This will allow for a higher accuracy solution of reactor problems while using fewer groups and will reduce the computational expense. The proposed research represents a fundamental advancement in the understanding and improvement of multi- group theory for reactor analysis.

  19. Longitudinal multigroup invariance analysis of the satisfaction with food-related life scale in university students.

    Science.gov (United States)

    Schnettler, Berta; Miranda, Horacio; Miranda-Zapata, Edgardo; Salinas-Oñate, Natalia; Grunert, Klaus G; Lobos, Germán; Sepúlveda, José; Orellana, Ligia; Hueche, Clementina; Bonilla, Héctor

    2017-06-01

    This study examined longitudinal measurement invariance in the Satisfaction with Food-related Life (SWFL) scale using follow-up data from university students. We examined this measure of the SWFL in different groups of students, separated by various characteristics. Through non-probabilistic longitudinal sampling, 114 university students (65.8% female, mean age: 22.5) completed the SWFL questionnaire three times, over intervals of approximately one year. Confirmatory factor analysis was used to examine longitudinal measurement invariance. Two types of analysis were conducted: first, a longitudinal invariance by time, and second, a multigroup longitudinal invariance by sex, age, socio-economic status and place of residence during the study period. Results showed that the 3-item version of the SWFL exhibited strong longitudinal invariance (equal factor loadings and equal indicator intercepts). Longitudinal multigroup invariance analysis also showed that the 3-item version of the SWFL displays strong invariance by socio-economic status and place of residence during the study period over time. Nevertheless, it was only possible to demonstrate equivalence of the longitudinal factor structure among students of both sexes, and among those older and younger than 22 years. Generally, these findings suggest that the SWFL scale has satisfactory psychometric properties for longitudinal measurement invariance in university students with similar characteristics as the students that participated in this research. It is also possible to suggest that satisfaction with food-related life is associated with sex and age.

  20. Heat Capacity of 1D Molecular Chains

    Science.gov (United States)

    Bagatskii, M. I.; Barabashko, M. S.; Sumarokov, V. V.; Jeżowski, A.; Stachowiak, P.

    2017-04-01

    The heat capacity of 1D chains of nitrogen and methane molecules (adsorbed in the outer grooves of bundles of closed-cap single-walled carbon nanotubes) has been studied in the temperature ranges 2-40 and 2-60 K, respectively. The temperature dependence of the heat capacity of 1D chains of nitrogen molecules below 3 K is close to a linear. It was found that the rotational heat capacity of methane molecules is a significant part of the total heat capacity of the chains throughout the whole investigated temperature range, whereas in the case of nitrogen, the librations are significant only above 15 K. The dependence of the heat capacity for methane below 10 K indicates the presence of a Schottky anomaly caused by the tunneling between the lowest energy levels of the CH4 molecule rotational spectra. Characteristic features observed in the temperature dependence of the heat capacity of 1D methane crystals are also discussed.

  1. Application de la methode des sous-groupes au calcul Monte-Carlo multigroupe

    Science.gov (United States)

    Martin, Nicolas

    This thesis is dedicated to the development of a Monte Carlo neutron transport solver based on the subgroup (or multiband) method. In this formalism, cross sections for resonant isotopes are represented in the form of probability tables on the whole energy spectrum. This study is intended in order to test and validate this approach in lattice physics and criticality-safety applications. The probability table method seems promising since it introduces an alternative computational way between the legacy continuous-energy representation and the multigroup method. In the first case, the amount of data invoked in continuous-energy Monte Carlo calculations can be very important and tend to slow down the overall computational time. In addition, this model preserves the quality of the physical laws present in the ENDF format. Due to its cheap computational cost, the multigroup Monte Carlo way is usually at the basis of production codes in criticality-safety studies. However, the use of a multigroup representation of the cross sections implies a preliminary calculation to take into account self-shielding effects for resonant isotopes. This is generally performed by deterministic lattice codes relying on the collision probability method. Using cross-section probability tables on the whole energy range permits to directly take into account self-shielding effects and can be employed in both lattice physics and criticality-safety calculations. Several aspects have been thoroughly studied: (1) The consistent computation of probability tables with a energy grid comprising only 295 or 361 groups. The CALENDF moment approach conducted to probability tables suitable for a Monte Carlo code. (2) The combination of the probability table sampling for the energy variable with the delta-tracking rejection technique for the space variable, and its impact on the overall efficiency of the proposed Monte Carlo algorithm. (3) The derivation of a model for taking into account anisotropic

  2. First Observation of Upsilon(1D) States

    CERN Document Server

    Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Bornheim, A; Lipeles, E; Pappas, S P; Shapiro, A; Sun, W M; Weinstein, A J; Mahapatra, R; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G T; Vogel, H; Adam, N E; Alexander, J P; Berkelman, K; Boisvert, V; Cassel, David G; Drell, P S; Duboscq, J E; Ecklund, K M; Ehrlich, R; Galik, R S; Gibbons, L; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Magerkurth, A; Mahlke-Krüger, H; Meyer, T O; Mistry, N B; Nordberg, E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Thayer, J G; Urner, D; Viehhauser, G; Warburton, A; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Potlia, V; Stöck, H; Yelton, J; Brandenburg, G; Kim, D Y J; Wilson, R; Benslama, K; Eisenstein, B I; Ernst, J; Gollin, G D; Hans, R M; Karliner, I; Lowrey, N; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Ammar, R; Besson, D; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; Li, S Z; Poling, R A; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z V; Seth, K K; Tomaradze, A G; Zweber, P; Ahmed, S; Alam, M S; Jian, L; Saleem, M; Wappler, F; Eckhart, E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Thayer, J B; Von Törne, E; Wilksen, T; Zoeller, M M; Muramatsu, H; Richichi, S J; Severini, H; Skubic, P L; Dytman, S A; Müller, J A; Nam, S; Savinov, V; Chen, S; Hinson, J W; Lee, J; Miller, D H; Pavlunin, V; Shibata, E I; Shipsey, I P J; Cronin-Hennessy, D; Lyon, A L; Park, C S; Park, W; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Maravin, Y; Stroynowski, R; Artuso, M; Boulahouache, C; Bukin, K; Dambasuren, E; Khroustalev, K; Mountain, R; Nandakumar, R; Skwarnicki, T; Stone, S; Wang, J C; Mahmood, A H

    2002-01-01

    The CLEO III experiment has recently accumulated a large statistics sample of 4.73 x 10^6 Upsilon(3S) decays. We present the first evidence for the production of the triplet Upsilon(1D) states in the four-photon cascade, Upslion(3S) -> gamma chi_b(2P), chi_b(2P) -> gamma Upsilon(1D), Upsilon(1D) -> gamma chi_b(1P), chi_b(1P) -> gamma Upsilon(1S), followed by the Upsilon(1S) annihilation to e+ e- or mu+ mu-. The signal has a significance of 9.7 standard deviations. The measured product branching ratio for these five decays, (3.3 +- 0.6 +- 0.5) x 10^{-5}, is consistent with the theoretical estimates. We see a 6.8 standard deviation signal for a state with a mass of 10162.2 +- 1.6 MeV/c^2, consistent with the Upsilon(1D_2) assignment. We also present improved measurements of the Upsilon(3S) -> pi0 pi0 Upsilon(1S) branching ratio and the associated di-pion mass distribution.

  3. DESIGN PACKAGE 1D SYSTEM SAFETY ANALYSIS

    Energy Technology Data Exchange (ETDEWEB)

    L.R. Eisler

    1995-02-02

    The purpose of this analysis is to systematically identify and evaluate hazards related to the Yucca Mountain Project Exploratory Studies Facility (ESF) Design Package 1D, Surface Facilities, (for a list of design items included in the package 1D system safety analysis see section 3). This process is an integral part of the systems engineering process; whereby safety is considered during planning, design, testing, and construction. A largely qualitative approach was used since a radiological System Safety analysis is not required. The risk assessment in this analysis characterizes the accident scenarios associated with the Design Package 1D structures/systems/components in terms of relative risk and includes recommendations for mitigating all identified risks. The priority for recommending and implementing mitigation control features is: (1) Incorporate measures to reduce risks and hazards into the structure/system/component (S/S/C) design, (2) add safety devices and capabilities to the designs that reduce risk, (3) provide devices that detect and warn personnel of hazardous conditions, and (4) develop procedures and conduct training to increase worker awareness of potential hazards, on methods to reduce exposure to hazards, and on the actions required to avoid accidents or correct hazardous conditions. The scope of this analysis is limited to the Design Package 1D structures/systems/components (S/S/Cs) during normal operations excluding hazards occurring during maintenance and ''off normal'' operations.

  4. GLOBAL STABILITY OF EXTENDED MULTI-GROUP SIR EPIDEMIC MODELS WITH PATCHES THROUGH MIGRATION AND CROSS PATCH INFECTION

    Institute of Scientific and Technical Information of China (English)

    Yoshiaki MUROYA; Yoichi ENATSU; Toshikazu KUNIYA

    2013-01-01

    In this article,we establish the global stability of an endemic equilibrium of multi-group SIR epidemic models,which have not only an exchange of individuals between patches through migration but also cross patch infection between different groups.As a result,we partially generalize the recent result in the article [16].

  5. Calibration of a 1D/1D urban flood model using 1D/2D model results in the absence of field data.

    Science.gov (United States)

    Leandro, J; Djordjević, S; Chen, A S; Savić, D A; Stanić, M

    2011-01-01

    Recently increased flood events have been prompting researchers to improve existing coupled flood-models such as one-dimensional (1D)/1D and 1D/two-dimensional (2D) models. While 1D/1D models simulate sewer and surface networks using a one-dimensional approach, 1D/2D models represent the surface network by a two-dimensional surface grid. However their application raises two issues to urban flood modellers: (1) stormwater systems planning/emergency or risk analysis demands for fast models, and the 1D/2D computational time is prohibitive, (2) and the recognized lack of field data (e.g. Hunter et al. (2008)) causes difficulties for the calibration/validation of 1D/1D models. In this paper we propose to overcome these issues by calibrating a 1D/1D model with the results of a 1D/2D model. The flood-inundation results show that: (1) 1D/2D results can be used to calibrate faster 1D/1D models, (2) the 1D/1D model is able to map the 1D/2D flood maximum extent well, and the flooding limits satisfactorily in each time-step, (3) the 1D/1D model major differences are the instantaneous flow propagation and overestimation of the flood-depths within surface-ponds, (4) the agreement in the volume surcharged by both models is a necessary condition for the 1D surface-network validation and (5) the agreement of the manholes discharge shapes measures the fitness of the calibrated 1D surface-network.

  6. Glass-based 1-D dielectric microcavities

    Science.gov (United States)

    Chiasera, Alessandro; Scotognella, Francesco; Valligatla, Sreeramulu; Varas, Stefano; Jasieniak, Jacek; Criante, Luigino; Lukowiak, Anna; Ristic, Davor; Gonçalves, Rogeria Rocha; Taccheo, Stefano; Ivanda, Mile; Righini, Giancarlo C.; Ramponi, Roberta; Martucci, Alessandro; Ferrari, Maurizio

    2016-11-01

    We have developed a reliable RF sputtering techniques allowing to fabricate glass-based one dimensional microcavities, with high quality factor. This property is strongly related to the modification of the density of states due to the confinement of the gain medium in a photonic band gap structure. In this short review we present some of the more recent results obtained by our team exploiting these 1D microcavities. In particular we present: (1) Er3+ luminescence enhancement of the 4I13/2 → 4I15/2 transition; (2) broad band filters based on disordered 1-D photonic structures; (3) threshold defect-mode lasing action in a hybrid structure.

  7. YORP torques with 1D thermal model

    CERN Document Server

    Breiter, Slawomir; Czekaj, Maria

    2010-01-01

    A numerical model of the Yarkovsky-O'Keefe-Radzievskii-Paddack (YORP) effect for objects defined in terms of a triangular mesh is described. The algorithm requires that each surface triangle can be handled independently, which implies the use of a 1D thermal model. Insolation of each triangle is determined by an optimized ray-triangle intersection search. Surface temperature is modeled with a spectral approach; imposing a quasi-periodic solution we replace heat conduction equation by the Helmholtz equation. Nonlinear boundary conditions are handled by an iterative, FFT based solver. The results resolve the question of the YORP effect in rotation rate independence on conductivity within the nonlinear 1D thermal model regardless of the accuracy issues and homogeneity assumptions. A seasonal YORP effect in attitude is revealed for objects moving on elliptic orbits when a nonlinear thermal model is used.

  8. SIRIUS - A one-dimensional multigroup analytic nodal diffusion theory code

    Energy Technology Data Exchange (ETDEWEB)

    Forslund, P. [Westinghouse Atom AB, Vaesteraas (Sweden)

    2000-09-01

    In order to evaluate relative merits of some proposed intranodal cross sections models, a computer code called Sirius has been developed. Sirius is a one-dimensional, multigroup analytic nodal diffusion theory code with microscopic depletion capability. Sirius provides the possibility of performing a spatial homogenization and energy collapsing of cross sections. In addition a so called pin power reconstruction method is available for the purpose of reconstructing 'heterogeneous' pin qualities. consequently, Sirius has the capability of performing all the calculations (incl. depletion calculations) which are an integral part of the nodal calculation procedure. In this way, an unambiguous numerical analysis of intranodal cross section models is made possible. In this report, the theory of the nodal models implemented in sirius as well as the verification of the most important features of these models are addressed.

  9. Ethnic Residential Segregation: A Multilevel, Multigroup, Multiscale Approach Exemplified by London in 2011.

    Science.gov (United States)

    Jones, Kelvyn; Johnston, Ron; Manley, David; Owen, Dewi; Charlton, Chris

    2015-12-01

    We develop and apply a multilevel modeling approach that is simultaneously capable of assessing multigroup and multiscale segregation in the presence of substantial stochastic variation that accompanies ethnicity rates based on small absolute counts. Bayesian MCMC estimation of a log-normal Poisson model allows the calculation of the variance estimates of the degree of segregation in a single overall model, and credible intervals are obtained to provide a measure of uncertainty around those estimates. The procedure partitions the variance at different levels and implicitly models the dependency (or autocorrelation) at each spatial scale below the topmost one. Substantively, we apply the model to 2011 census data for London, one of the world's most ethnically diverse cities. We find that the degree of segregation depends both on scale and group.

  10. Radiation Transport for Explosive Outflows: A Multigroup Hybrid Monte Carlo Method

    CERN Document Server

    Wollaeger, Ryan T; Graziani, Carlo; Couch, Sean M; Jordan, George C; Lamb, Donald Q; Moses, Gregory A

    2013-01-01

    We explore the application of Implicit Monte Carlo (IMC) and Discrete Diffusion Monte Carlo (DDMC) to radiation transport in strong fluid outflows with structured opacity. The IMC method of Fleck & Cummings is a stochastic computational technique for nonlinear radiation transport. IMC is partially implicit in time and may suffer in efficiency when tracking Monte Carlo particles through optically thick materials. The DDMC method of Densmore accelerates an IMC computation where the domain is diffusive. Recently, Abdikamalov extended IMC and DDMC to multigroup, velocity-dependent neutrino transport with the intent of modeling neutrino dynamics in core-collapse supernovae. Densmore has also formulated a multifrequency extension to the originally grey DDMC method. In this article we rigorously formulate IMC and DDMC over a high-velocity Lagrangian grid for possible application to photon transport in the post-explosion phase of Type Ia supernovae. The method described is suitable for a large variety of non-mono...

  11. Global dynamics of a novel multi-group model for computer worms

    Institute of Scientific and Technical Information of China (English)

    Gong Yong-Wang; Song Yu-Rong; Jiang Guo-Ping

    2013-01-01

    In this paper,we study worm dynamics in computer networks composed of many autonomous systems.A novel multigroup SIQR (susceptible-infected-quarantined-removed) model is proposed for computer worms by explicitly considering anti-virus measures and the network infrastructure.Then,the basic reproduction number of worm R0 is derived and the global dynamics of the model are established.It is shown that if R0 is less than or equal to 1,the disease-free equilibrium is globally asymptotically stable and the worm dies out eventually,whereas,if R0 is greater than 1,one unique endemic equilibrium exists and it is globally asymptotically stable,thus the worm persists in the network.Finally,numerical simulations are given to illustrate the theoretical results.

  12. Validation of the Resilience Scale for Adolescents (READ) in Ireland: a multi-group analysis.

    Science.gov (United States)

    Kelly, Yvonne; Fitzgerald, Amanda; Dooley, Barbara

    2016-04-29

    Resilience is a process reflecting positive adaptation in the face of adversity. The Resilience Scale for Adolescence (READ) incorporates intrapersonal and interpersonal protective factors mapping onto the three salient domains of resilience, including individual, family and external environment. This study investigated the validity and reliability of the READ by means of factor analysis, multi-group analysis, inter-correlations and internal consistency measures. Participants were 6085 young people in Ireland aged 12-18 years. Participants completed the My World Survey - Second Level (MWS-SL), assessing risk and protective factors of mental health. Confirmatory factor analysis validated the original five-factor structure of the READ including Personal Competence, Social Competence, Structured Style, Family Cohesion, and Social Resources, χ(2) (340) = 6146.02, p resilience factors among adolescents in Ireland, demonstrating its applicability in a different cultural context and with a wider age range of adolescents. Copyright © 2016 John Wiley & Sons, Ltd.

  13. MINX: a multigroup interpretation of nuclear X-sections from ENDF/B

    Energy Technology Data Exchange (ETDEWEB)

    Weisbin, C.R.; Soran, P.D.; MacFarlane, R.E.; Harris, D.R.; LaBauve, R.J.; Hendricks, J.S.; White, J.E.; Kidman, R.B.

    1976-09-01

    MINX calculates fine-group averaged infinitely dilute cross sections, self-shielding factors, and group-to-group transfer matrices from ENDF/B-IV data. Its primary purpose is to generate pseudo-composition independent multigroup libraries in the standard CCCC-III interface formats for use in the design and analysis of nuclear systems. MINX incorporates and improves upon the resonance capabilities of existing codes such as ETOX and ENDRUN and the high-Legendre-order transfer matrices of ETOG and SUPERTOG. Group structure, Legendre order, weight function, temperature, dilutions, and processing tolerances are all under user control. Paging and variable dimensioning allow very large problems to be run. Both CDC and IBM versions of MINX are available.

  14. Global dynamics of a novel multi-group model for computer worms

    Science.gov (United States)

    Gong, Yong-Wang; Song, Yu-Rong; Jiang, Guo-Ping

    2013-04-01

    In this paper, we study worm dynamics in computer networks composed of many autonomous systems. A novel multi-group SIQR (susceptible-infected-quarantined-removed) model is proposed for computer worms by explicitly considering anti-virus measures and the network infrastructure. Then, the basic reproduction number of worm R0 is derived and the global dynamics of the model are established. It is shown that if R0 is less than or equal to 1, the disease-free equilibrium is globally asymptotically stable and the worm dies out eventually, whereas, if R0 is greater than 1, one unique endemic equilibrium exists and it is globally asymptotically stable, thus the worm persists in the network. Finally, numerical simulations are given to illustrate the theoretical results.

  15. Solution of the multilayer multigroup neutron diffusion equation in cartesian geometry by fictitious borders power method

    Energy Technology Data Exchange (ETDEWEB)

    Zanette, Rodrigo; Petersen, Caudio Zen [Univ. Federal de Pelotas, Capao do Leao (Brazil). Programa de Pos Graduacao em Modelagem Matematica; Schramm, Marcello [Univ. Federal de Pelotas (Brazil). Centro de Engenharias; Zabadal, Jorge Rodolfo [Univ. Federal do Rio Grande do Sul, Tramandai (Brazil)

    2017-05-15

    In this paper a solution for the one-dimensional steady state Multilayer Multigroup Neutron Diffusion Equation in cartesian geometry by Fictitious Borders Power Method and a perturbative analysis of this solution is presented. For each new iteration of the power method, the neutron flux is reconstructed by polynomial interpolation, so that it always remains in a standard form. However when the domain is long, an almost singular matrix arises in the interpolation process. To eliminate this singularity the domain segmented in R regions, called fictitious regions. The last step is to solve the neutron diffusion equation for each fictitious region in analytical form locally. The results are compared with results present in the literature. In order to analyze the sensitivity of the solution, a perturbation in the nuclear parameters is inserted to determine how a perturbation interferes in numerical results of the solution.

  16. Compilation of multigroup cross-section covariance matrices for several important reactor materials

    Energy Technology Data Exchange (ETDEWEB)

    Drischler, J.D.; Weisbin, C.R.

    1977-10-01

    Multigroup cross-section covariance matrices are presented for fission in /sup 235/U, /sup 238/U, /sup 239/Pu, and /sup 241/Pu; capture in /sup 235/U, /sup 238/U, /sup 239/Pu, /sup 240/Pu, and /sup 241/Pu; fission neutron yield (anti nu) for /sup 235/U, /sup 238/U, /sup 239/Pu, and /sup 240/Pu; elastic scattering for Na and Fe; non-elastic reactions for Na and Fe; first-level inelastic scattering for /sup 238/U; and all reactions provided in the ENDF/B-IV covariance description of N, O, and C. Other data files generated are included for reference but have not yet been tested. The report presents the nultigroup data in six, ten, and fifteen energy group forms corresponding to weighting of the covariance data with fission (GODIVA), LMFBR (ZPR-6/7) and 1/E spectra, respectively.

  17. Testing a new multigroup inference approach to reconstructing past environmental conditions

    Directory of Open Access Journals (Sweden)

    Maria RIERADEVALL

    2008-08-01

    Full Text Available A new, quantitative, inference model for environmental reconstruction (transfer function, based for the first time on the simultaneous analysis of multigroup species, has been developed. Quantitative reconstructions based on palaeoecological transfer functions provide a powerful tool for addressing questions of environmental change in a wide range of environments, from oceans to mountain lakes, and over a range of timescales, from decades to millions of years. Much progress has been made in the development of inferences based on multiple proxies but usually these have been considered separately, and the different numeric reconstructions compared and reconciled post-hoc. This paper presents a new method to combine information from multiple biological groups at the reconstruction stage. The aim of the multigroup work was to test the potential of the new approach to making improved inferences of past environmental change by improving upon current reconstruction methodologies. The taxonomic groups analysed include diatoms, chironomids and chrysophyte cysts. We test the new methodology using two cold-environment training-sets, namely mountain lakes from the Pyrenees and the Alps. The use of multiple groups, as opposed to single groupings, was only found to increase the reconstruction skill slightly, as measured by the root mean square error of prediction (leave-one-out cross-validation, in the case of alkalinity, dissolved inorganic carbon and altitude (a surrogate for air-temperature, but not for pH or dissolved CO2. Reasons why the improvement was less than might have been anticipated are discussed. These can include the different life-forms, environmental responses and reaction times of the groups under study.

  18. A new multigroup method for cross-sections that vary rapidly in energy

    Science.gov (United States)

    Haut, T. S.; Ahrens, C.; Jonko, A.; Lowrie, R.; Till, A.

    2017-01-01

    We present a numerical method for solving the time-independent thermal radiative transfer (TRT) equation or the neutron transport (NT) equation when the opacity (cross-section) varies rapidly in frequency (energy) on the microscale ε; ε corresponds to the characteristic spacing between absorption lines or resonances, and is much smaller than the macroscopic frequency (energy) variation of interest. The approach is based on a rigorous homogenization of the TRT/NT equation in the frequency (energy) variable. Discretization of the homogenized TRT/NT equation results in a multigroup-type system, and can therefore be solved by standard methods. We demonstrate the accuracy and efficiency of the approach on three model problems. First we consider the Elsasser band model with constant temperature and a line spacing ε =10-4 . Second, we consider a neutron transport application for fast neutrons incident on iron, where the characteristic resonance spacing ε necessitates ≈ 16 , 000 energy discretization parameters if Planck-weighted cross sections are used. Third, we consider an atmospheric TRT problem for an opacity corresponding to water vapor over a frequency range 1000-2000 cm-1, where we take 12 homogeneous layers between 1-15 km, and temperature/pressure values in each layer from the standard US atmosphere. For all three problems, we demonstrate that we can achieve between 0.1 and 1 percent relative error in the solution, and with several orders of magnitude fewer parameters than a standard multigroup formulation using Planck-weighted (source-weighted) opacities for a comparable accuracy.

  19. 1-D EQUILIBRIUM DISCRETE DIFFUSION MONTE CARLO

    Energy Technology Data Exchange (ETDEWEB)

    T. EVANS; ET AL

    2000-08-01

    We present a new hybrid Monte Carlo method for 1-D equilibrium diffusion problems in which the radiation field coexists with matter in local thermodynamic equilibrium. This method, the Equilibrium Discrete Diffusion Monte Carlo (EqDDMC) method, combines Monte Carlo particles with spatially discrete diffusion solutions. We verify the EqDDMC method with computational results from three slab problems. The EqDDMC method represents an incremental step toward applying this hybrid methodology to non-equilibrium diffusion, where it could be simultaneously coupled to Monte Carlo transport.

  20. Conception and development of an adaptive energy mesher for multigroup library generation of the transport codes; Conception et developpement d'un mailleur energetique adaptatif pour la generation des bibliotheques multigroupes des codes de transport

    Energy Technology Data Exchange (ETDEWEB)

    Mosca, P.

    2009-12-15

    The deterministic transport codes solve the stationary Boltzmann equation in a discretized energy formalism called multigroup. The transformation of continuous data in a multigroup form is obtained by averaging the highly variable cross sections of the resonant isotopes with the solution of the self-shielding models and the remaining ones with the coarse energy spectrum of the reactor type. So far the error of such an approach could only be evaluated retrospectively. To remedy this, we studied in this thesis a set of methods to control a priori the accuracy and the cost of the multigroup transport computation. The energy mesh optimisation is achieved using a two step process: the creation of a reference mesh and its optimized condensation. In the first stage, by refining locally and globally the energy mesh, we seek, on a fine energy mesh with subgroup self-shielding, a solution equivalent to a reference solver (Monte Carlo or pointwise deterministic solver). In the second step, once fixed the number of groups, depending on the acceptable computational cost, and chosen the most appropriate self-shielding models to the reactor type, we look for the best bounds of the reference mesh minimizing reaction rate errors by the particle swarm optimization algorithm. This new approach allows us to define new meshes for fast reactors as accurate as the currently used ones, but with fewer groups. (author)

  1. A multigroup diffusion solver using pseudo transient continuation for a radiation-hydrodynamic code with patch-based AMR

    CERN Document Server

    Shestakov, A I

    2007-01-01

    We present a scheme to solve the nonlinear multigroup radiation diffusion (MGD) equations. The method is incorporated into a massively parallel, multidimensional, Eulerian radiation-hydrodynamic code with adaptive mesh refinement (AMR). The patch-based AMR algorithm refines in both space and time creating a hierarchy of levels, coarsest to finest. The physics modules are time-advanced using operator splitting. On each level, separate level-solve packages advance the modules. Our multigroup level-solve adapts an implicit procedure which leads to a two-step iterative scheme that alternates between elliptic solves for each group with intra-cell group coupling. For robustness, we introduce pseudo transient continuation (PTC). We analyze the magnitude of the PTC parameter to ensure positivity of the resulting linear system, diagonal dominance and convergence of the two-step scheme. For AMR, a level defines a subdomain for refinement. For diffusive processes such as MGD, the refined level uses Dirichet boundary dat...

  2. Diamond-based 1-D imaging arrays

    Energy Technology Data Exchange (ETDEWEB)

    Lansley, S.P.; Williams, O.A.; Ye, H. [Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Rizvi, N.; Whitfield, M.D.; Jackman, R.B. [Exitech Limited, Hanborough Park, Long Hanborough, Oxford OX8 8LH (United Kingdom); McKeag, R.D. [Centronic Ltd., Centronic House, King Henry' s Drive, New Addington, Croydon CR9 OBG (United Kingdom)

    2002-10-16

    Diamond has shown great promise for the fabrication of high sensitivity, low dark current, fast and visible-blind deep UV photodetectors. In addition to careful choice of substrate material, defect passivation treatments applied to the diamond after growth have been found to considerably enhance the detector characteristics achieved. In this paper we report on the first purposefully designed 1-D CVD diamond imaging array for the detection of nanosecond 193 nm excimer laser pulses using this approach. It is shown to perform extremely well, giving less than 2% pixel-to-pixel variation in signal response, and is fast enough to avoid any sign of charge build up during prolonged operation. (Abstract Copyright [2002], Wiley Periodicals, Inc.)

  3. An analytical representation for the solution of neutron kinetic transport equation in slab-geometry multigroup discrete ordinates formulation

    Energy Technology Data Exchange (ETDEWEB)

    Tomaschewski, Fernanda K.; Segatto, Cynthia F., E-mail: fernandasls_89@hotmail.com, E-mail: cynthia.segatto@ufrgs.br [Universidade Federal do Rio Grande do Sul (UFRS), Porto Alegre, RS (Brazil). Programa de Pos-Graduacao em Matematica Aplicada; Barros, Ricardo C., E-mail: rcbarros@pq.cnpq.br [Universidade do Estado do Rio de Janeiro (UERJ), Nova Friburgo, RJ (Brazil). Departamento de Modelagem Computacional

    2015-07-01

    Presented here is a decomposition method based on series representation of the group angular fluxes and delayed neutron precursors in smoothly continuous functions for energy multigroups, slab-geometry discrete ordinates kinetics equations supplemented with a prescribed number of delayed neutron precursors. Numerical results to a non-reflected sub-critical slab stabilized by steady-state sources are given to illustrate the accuracy and efficiency of the o offered method. (author)

  4. Validation of multigroup neutron cross sections and calculational methods for the advanced neutron source against the FOEHN critical experiments measurements

    Energy Technology Data Exchange (ETDEWEB)

    Smith, L.A.; Gallmeier, F.X. [Oak Ridge Institute for Science and Energy, TN (United States); Gehin, J.C. [Oak Ridge National Lab., TN (United States)] [and others

    1995-05-01

    The FOEHN critical experiment was analyzed to validate the use of multigroup cross sections and Oak Ridge National Laboratory neutronics computer codes in the design of the Advanced Neutron Source. The ANSL-V 99-group master cross section library was used for all the calculations. Three different critical configurations were evaluated using the multigroup KENO Monte Carlo transport code, the multigroup DORT discrete ordinates transport code, and the multigroup diffusion theory code VENTURE. The simple configuration consists of only the fuel and control elements with the heavy water reflector. The intermediate configuration includes boron endplates at the upper and lower edges of the fuel element. The complex configuration includes both the boron endplates and components in the reflector. Cross sections were processed using modules from the AMPX system. Both 99-group and 20-group cross sections were created and used in two-dimensional models of the FOEHN experiment. KENO calculations were performed using both 99-group and 20-group cross sections. The DORT and VENTURE calculations were performed using 20-group cross sections. Because the simple and intermediate configurations are azimuthally symmetric, these configurations can be explicitly modeled in R-Z geometry. Since the reflector components cannot be modeled explicitly using the current versions of these codes, three reflector component homogenization schemes were developed and evaluated for the complex configuration. Power density distributions were calculated with KENO using 99-group cross sections and with DORT and VENTURE using 20-group cross sections. The average differences between the measured values and the values calculated with the different computer codes range from 2.45 to 5.74%. The maximum differences between the measured and calculated thermal flux values for the simple and intermediate configurations are {approx} 13%, while the average differences are < 8%.

  5. New multigroup Monte Carlo scattering algorithm suitable for neutral- and charged-particle Boltzmann and Fokker-Planck calculations

    Energy Technology Data Exchange (ETDEWEB)

    Sloan, D.P.

    1983-05-01

    Morel (1981) has developed multigroup Legendre cross sections suitable for input to standard discrete ordinates transport codes for performing charged-particle Fokker-Planck calculations in one-dimensional slab and spherical geometries. Since the Monte Carlo neutron transport code, MORSE, uses the same multigroup cross section data that discrete ordinates codes use, it was natural to consider whether Fokker-Planck calculations could be performed with MORSE. In order to extend the unique three-dimensional forward or adjoint capability of MORSE to Fokker-Planck calculations, the MORSE code was modified to correctly treat the delta-function scattering of the energy operator, and a new set of physically acceptable cross sections was derived to model the angular operator. Morel (1979) has also developed multigroup Legendre cross sections suitable for input to standard discrete ordinates codes for performing electron Boltzmann calculations. These electron cross sections may be treated in MORSE with the same methods developed to treat the Fokker-Planck cross sections. The large magnitude of the elastic scattering cross section, however, severely increases the computation or run time. It is well-known that approximate elastic cross sections are easily obtained by applying the extended transport (or delta function) correction to the Legendre coefficients of the exact cross section. An exact method for performing the extended transport cross section correction produces cross sections which are physically acceptable. Sample calculations using electron cross sections have demonstrated this new technique to be very effective in decreasing the large magnitude of the cross sections.

  6. Multi-Group Reductions of LTE Air Plasma Radiative Transfer in Cylindrical Geometries

    Science.gov (United States)

    Scoggins, James; Magin, Thierry Edouard Bertran; Wray, Alan; Mansour, Nagi N.

    2013-01-01

    Air plasma radiation in Local Thermodynamic Equilibrium (LTE) within cylindrical geometries is studied with an application towards modeling the radiative transfer inside arc-constrictors, a central component of constricted-arc arc jets. A detailed database of spectral absorption coefficients for LTE air is formulated using the NEQAIR code developed at NASA Ames Research Center. The database stores calculated absorption coefficients for 1,051,755 wavelengths between 0.04 µm and 200 µm over a wide temperature (500K to 15 000K) and pressure (0.1 atm to 10.0 atm) range. The multi-group method for spectral reduction is studied by generating a range of reductions including pure binning and banding reductions from the detailed absorption coefficient database. The accuracy of each reduction is compared to line-by-line calculations for cylindrical temperature profiles resembling typical profiles found in arc-constrictors. It is found that a reduction of only 1000 groups is sufficient to accurately model the LTE air radiation over a large temperature and pressure range. In addition to the reduction comparison, the cylindrical-slab formulation is compared with the finite-volume method for the numerical integration of the radiative flux inside cylinders with varying length. It is determined that cylindrical-slabs can be used to accurately model most arc-constrictors due to their high length to radius ratios.

  7. Concepts of Confidence in Tendency Survey Research: An Assessment with Multi-group Confirmatory Factor Analysis.

    Science.gov (United States)

    Białowolski, Piotr

    In this paper, we investigate the link between the formal definition of confidence in tendency surveys and its measurement. We advocate for the use of reflective measures in an assessment of the confidence level in both consumer and industrial indicators. Based on the data from Poland's tendency survey research, we use a multi-group confirmatory factor analytical approach to demonstrate that the set of indicators proposed by the European Commission methodology that is currently used might be not appropriate to measure the concept of confidence consistently, both within and between periods. The conclusion is true for the confidence indicator in the area of consumer tendency surveys and for the tendency survey in the manufacturing industry. We search for possible amendments that help either to find the sources of instability for the indicators proposed by the guidelines of the European Commission or to select a different set of indicators for the concept of confidence. However, we determine that the differences between the newly proposed indicator that describe industrial confidence and the indicators based on the European Commission methodology are small in terms of correlations and predictive validity.

  8. Sample-size calculations for multi-group comparison in population pharmacokinetic experiments.

    Science.gov (United States)

    Ogungbenro, Kayode; Aarons, Leon

    2010-01-01

    This paper describes an approach for calculating sample size for population pharmacokinetic experiments that involve hypothesis testing based on multi-group comparison detecting the difference in parameters between groups under mixed-effects modelling. This approach extends what has been described for generalized linear models and nonlinear population pharmacokinetic models that involve only binary covariates to more complex nonlinear population pharmacokinetic models. The structural nonlinear model is linearized around the random effects to obtain the marginal model and the hypothesis testing involving model parameters is based on Wald's test. This approach provides an efficient and fast method for calculating sample size for hypothesis testing in population pharmacokinetic models. The approach can also handle different design problems such as unequal allocation of subjects to groups and unbalanced sampling times between and within groups. The results obtained following application to a one compartment intravenous bolus dose model that involved three different hypotheses under different scenarios showed good agreement between the power obtained from NONMEM simulations and nominal power.

  9. Multigroup radiation hydrodynamics with flux-limited diffusion and adaptive mesh refinement

    CERN Document Server

    González, Matthias; Commerçon, Benoît; Masson, Jacques

    2015-01-01

    Radiative transfer plays a key role in the star formation process. Due to a high computational cost, radiation-hydrodynamics simulations performed up to now have mainly been carried out in the grey approximation. In recent years, multi-frequency radiation-hydrodynamics models have started to emerge, in an attempt to better account for the large variations of opacities as a function of frequency. We wish to develop an efficient multigroup algorithm for the adaptive mesh refinement code RAMSES which is suited to heavy proto-stellar collapse calculations. Due to prohibitive timestep constraints of an explicit radiative transfer method, we constructed a time-implicit solver based on a stabilised bi-conjugate gradient algorithm, and implemented it in RAMSES under the flux-limited diffusion approximation. We present a series of tests which demonstrate the high performance of our scheme in dealing with frequency-dependent radiation-hydrodynamic flows. We also present a preliminary simulation of a three-dimensional p...

  10. Modelling diseases with relapse and nonlinear incidence of infection: a multi-group epidemic model

    Science.gov (United States)

    Wang, Jinliang; Pang, Jingmei; Liu, Xianning

    2014-01-01

    In this paper, we introduce a basic reproduction number for a multi-group SIR model with general relapse distribution and nonlinear incidence rate. We find that basic reproduction number plays the role of a key threshold in establishing the global dynamics of the model. By means of appropriate Lyapunov functionals, a subtle grouping technique in estimating the derivatives of Lyapunov functionals guided by graph-theoretical approach and LaSalle invariance principle, it is proven that if it is less than or equal to one, the disease-free equilibrium is globally stable and the disease dies out; whereas if it is larger than one, some sufficient condition is obtained in ensuring that there is a unique endemic equilibrium which is globally stable and thus the disease persists in the population. Furthermore, our results suggest that general relapse distribution are not the reason of sustained oscillations. Biologically, our model might be realistic for sexually transmitted diseases, such as Herpes, Condyloma acuminatum, etc. PMID:24963980

  11. Modelling diseases with relapse and nonlinear incidence of infection: a multi-group epidemic model.

    Science.gov (United States)

    Wang, Jinliang; Pang, Jingmei; Liu, Xianning

    2014-01-01

    In this paper, we introduce a basic reproduction number for a multi-group SIR model with general relapse distribution and nonlinear incidence rate. We find that basic reproduction number plays the role of a key threshold in establishing the global dynamics of the model. By means of appropriate Lyapunov functionals, a subtle grouping technique in estimating the derivatives of Lyapunov functionals guided by graph-theoretical approach and LaSalle invariance principle, it is proven that if it is less than or equal to one, the disease-free equilibrium is globally stable and the disease dies out; whereas if it is larger than one, some sufficient condition is obtained in ensuring that there is a unique endemic equilibrium which is globally stable and thus the disease persists in the population. Furthermore, our results suggest that general relapse distribution are not the reason of sustained oscillations. Biologically, our model might be realistic for sexually transmitted diseases, such as Herpes, Condyloma acuminatum, etc.

  12. Young Adults’ Attitude Towards Advertising: a multi-group analysis by ethnicity

    Directory of Open Access Journals (Sweden)

    Hiram Ting

    2015-08-01

    Full Text Available Objective – This study aims to investigate the attitude of Malaysian young adults towards advertising. How this segment responds to advertising, and how ethnic/cultural differences moderate are assessed. Design/methodology/approach – A quantitative questionnaire is used to collect data at two universities. Purposive sampling technique is adopted to ensure the sample represents the actual population. Structural equation modelling (SEM and multi-group analysis (MGA are utilized in analysis. Findings - The findings show that product information, hedonism, and good for economy are significant predictors of attitude towards advertising among young adults. Additionally, falsity is found to be significant among the Chinese, while social role and materialism among the Dayaks. No difference is observed in the effect of attitude on intention towards advertising by ethnicity. While homogeneity in advertising beliefs is assumed across ethnic groups, the Chinese and Dayak young adults are different in some of their advertising beliefs. Practical implications – Despite cultural effect being well-documented, young adults today seem to have similar beliefs and attitude towards advertising. Knowing what is shared and what is not for this segment is essential. Hence, it is imperative to keep track of their values in diversified communities to ensure effective communication process in advertising. Originality/value – In addition to the theory of reasoned action, MGA is utilized to assess the moderating effect of ethnic/culture on the whole model. This affords a more comprehensive understanding on the subject matter in multi-ethnic and cultural countries.

  13. Three-dimensional h-adaptivity for the multigroup neutron diffusion equations

    KAUST Repository

    Wang, Yaqi

    2009-04-01

    Adaptive mesh refinement (AMR) has been shown to allow solving partial differential equations to significantly higher accuracy at reduced numerical cost. This paper presents a state-of-the-art AMR algorithm applied to the multigroup neutron diffusion equation for reactor applications. In order to follow the physics closely, energy group-dependent meshes are employed. We present a novel algorithm for assembling the terms coupling shape functions from different meshes and show how it can be made efficient by deriving all meshes from a common coarse mesh by hierarchic refinement. Our methods are formulated using conforming finite elements of any order, for any number of energy groups. The spatial error distribution is assessed with a generalization of an error estimator originally derived for the Poisson equation. Our implementation of this algorithm is based on the widely used Open Source adaptive finite element library deal.II and is made available as part of this library\\'s extensively documented tutorial. We illustrate our methods with results for 2-D and 3-D reactor simulations using 2 and 7 energy groups, and using conforming finite elements of polynomial degree up to 6. © 2008 Elsevier Ltd. All rights reserved.

  14. Non-Regenerative Multi-Antenna Multi-Group Multi-Way Relaying

    Directory of Open Access Journals (Sweden)

    Klein Anja

    2011-01-01

    Full Text Available Abstract We consider non-regenerative multi-group multi-way (MGMW relaying. A half-duplex non-regenerative multi-antenna relay station (RS assists multiple communication groups. In each group, multiple half-duplex nodes exchange messages. In our proposal, the required number of communication phases is equal to the maximum number of nodes among the groups. In the first phase, all nodes transmit simultaneously to the RS. Assuming perfect channel state information is available at the RS, in the following broadcast (BC phases the RS applies transceive beamforming to its received signal and transmits simultaneously to all nodes. We propose three BC strategies for the BC phases: unicasting, multicasting and hybrid uni/multicasting. For the multicasting strategy, network coding is applied to maintain the same number of communication phases as for the other strategies. We address transceive beamforming maximising the sum rate of non-regenerative MGMW relaying. Due to the high complexity of finding the optimum transceive beamforming maximising the sum rate, we design generalised low complexity transceive beamforming algorithms for all BC strategies: matched filter, zero forcing, minimisation of mean square error and BC-strategy-aware transceive beamforming. It is shown that the sum rate performance of non-regenerative MGMW relaying depends both on the chosen BC strategies and the applied transceive beamforming at the RS.

  15. Simulations of protostellar collapse using multigroup radiation hydrodynamics. II. The second collapse

    CERN Document Server

    Vaytet, N; Audit, E; Commercon, B; Masson, J; Ferguson, J; Delahaye, F

    2013-01-01

    Star formation begins with the gravitational collapse of a dense core inside a molecular cloud. As the collapse progresses, the centre of the core begins to heat up as it becomes optically thick. The temperature and density in the centre eventually reach high enough values where fusion reactions can ignite; the protostar is born. This sequence of events entail many physical processes, of which radiative transfer is of paramount importance. Many simulations of protostellar collapse make use of a grey treatment of radiative transfer coupled to the hydrodynamics. However, interstellar gas and dust opacities present large variations as a function of frequency. In this paper, we follow-up on a previous paper on the collapse and formation of Larson's first core using multigroup radiation hydrodynamics (Paper I) by extending the calculations to the second phase of the collapse and the formation of Larson's second core. We have made the use of a non-ideal gas equation of state as well as an extensive set of spectral ...

  16. MENDF71x. Multigroup Neutron Cross Section Data Tables Based upon ENDF/B-VII.1

    Energy Technology Data Exchange (ETDEWEB)

    Conlin, Jeremy Lloyd [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Parsons, Donald Kent [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Gardiner, Steven J. [Univ. of California, Davis, CA (United States); Gray, Mark Girard [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Lee, Mary Beth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); White, Morgan Curtis [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-12-17

    A new multi-group neutron cross section library has been released along with the release of NDI version 2.0.20. The library is named MENDF71x and is based upon the evaluations released in ENDF/B-VII.1 which was made publicly available in December 2011. ENDF/B-VII.1 consists of 423 evaluations of which ten are excited states evaluations and 413 are ground state evaluations. MENDF71x was created by processing the 423 evaluations into 618-group, downscatter only NDI data tables. The ENDF/B evaluation files were processed using NJOY version 99.393 with the exception of 35Cl and 233U. Those two isotopes had unique properties that required that we process the evaluation using NJOY version 2012. The MENDF71x library was only processed to room temperature, i.e., 293.6 K. In the future, we plan on producing a multi-temperature library based on ENDF/B-VII.1 and compatible with MENDF71x.

  17. Offensive Strategy in the 2D Soccer Simulation League Using Multi-Group Ant Colony Optimization

    Directory of Open Access Journals (Sweden)

    Shengbing Chen

    2016-02-01

    Full Text Available The 2D soccer simulation league is one of the best test beds for the research of artificial intelligence (AI. It has achieved great successes in the domain of multi-agent cooperation and machine learning. However, the problem of integral offensive strategy has not been solved because of the dynamic and unpredictable nature of the environment. In this paper, we present a novel offensive strategy based on multi-group ant colony optimization (MACO-OS. The strategy uses the pheromone evaporation mechanism to count the preference value of each attack action in different environments, and saves the values of success rate and preference in an attack information tree in the background. The decision module of the attacker then selects the best attack action according to the preference value. The MACO-OS approach has been successfully implemented in our 2D soccer simulation team in RoboCup competitions. The experimental results have indicated that the agents developed with this strategy, along with related techniques, delivered outstanding performances.

  18. Longitudinal multigroup invariance analysis of the satisfaction with food-related life scale in university students

    DEFF Research Database (Denmark)

    Schnettler, Berta; Miranda, Horacio; Miranda-Zapata, Edgardo

    2017-01-01

    This study examined longitudinal measurement invariance in the Satisfaction with Food-related Life (SWFL) scale using follow-up data from university students. We examined this measure of the SWFL in different groups of students, separated by various characteristics. Through non-probabilistic long......This study examined longitudinal measurement invariance in the Satisfaction with Food-related Life (SWFL) scale using follow-up data from university students. We examined this measure of the SWFL in different groups of students, separated by various characteristics. Through non......-probabilistic longitudinal sampling, 114 university students (65.8% female, mean age: 22.5) completed the SWFL questionnaire three times, over intervals of approximately one year. Confirmatory factor analysis was used to examine longitudinal measurement invariance. Two types of analysis were conducted: first, a longitudinal...... invariance by time, and second, a multigroup longitudinal invariance by sex, age, socio-economic status and place of residence during the study period. Results showed that the 3-item version of the SWFL exhibited strong longitudinal invariance (equal factor loadings and equal indicator intercepts...

  19. Testing the Nursing Worklife Model in Canada and Australia: a multi-group comparison study.

    Science.gov (United States)

    Roche, Michael A; Spence Laschinger, Heather K; Duffield, Christine

    2015-02-01

    To test a model derived from the Nursing Worklife Model linking elements of supportive practice environments to nurses' turnover intentions and behaviours in Canada and Australia. With the worldwide shortage of nurses, retaining nurses within fiscally challenged health care systems is critical to sustaining the future of the nursing workforce and ultimately safe patient care. The Nursing Worklife Model describes a pattern of relationships amongst environmental factors that support nursing practice and link to nurse turnover. This model has been tested in north American settings but not in other countries. A secondary analysis of data collected in two cross-sectional studies in Canadian and Australian hospitals (N=4816) was conducted to test our theoretical model. Multigroup structural equation modelling techniques were used to determine the validity of our model in both countries and to identify differences between countries. The hypothesized model relationships were supported in both countries with few differences between groups. Components of supportive professional practice work environments, particularly resources, were significantly linked to nurses' turnover intentions and active search for new jobs. Leadership played a critical role in shaping the pattern of relationships to other components of supportive practice environments and ultimately turnover behaviours. The Nursing Worklife Model was shown to be valid in both countries, suggesting that management efforts to ensure that features of supportive practice environments are in place to promote the retention of valuable nursing resources. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. Testing of the ABBN-RF multigroup data library in photon transport calculations

    Directory of Open Access Journals (Sweden)

    Koscheev Vladimir

    2017-01-01

    Full Text Available Gamma radiation is produced via both of nuclear fuel and shield materials. Photon interaction is known with appropriate accuracy, but secondary gamma ray production known much less. The purpose of this work is studying secondary gamma ray production data from neutron induced reactions in iron and lead by using MCNP code and modern nuclear data as ROSFOND, ENDF/B-7.1, JEFF-3.2 and JENDL-4.0. Results of calculations show that all of these nuclear data have different photon production data from neutron induced reactions and have poor agreement with evaluated benchmark experiment. The ABBN-RF multigroup cross-section library is based on the ROSFOND data. It presented in two forms of micro cross sections: ABBN and MATXS formats. Comparison of group-wise calculations using both ABBN and MATXS data to point-wise calculations with the ROSFOND library shows a good agreement. The discrepancies between calculation and experimental C/E results in neutron spectra are in the limit of experimental errors. For the photon spectrum they are out of experimental errors. Results of calculations using group-wise and point-wise representation of cross sections show a good agreement both for photon and neutron spectra.

  1. Testing of the ABBN-RF multigroup data library in photon transport calculations

    Science.gov (United States)

    Koscheev, Vladimir; Lomakov, Gleb; Manturov, Gennady; Tsiboulia, Anatoly

    2017-09-01

    Gamma radiation is produced via both of nuclear fuel and shield materials. Photon interaction is known with appropriate accuracy, but secondary gamma ray production known much less. The purpose of this work is studying secondary gamma ray production data from neutron induced reactions in iron and lead by using MCNP code and modern nuclear data as ROSFOND, ENDF/B-7.1, JEFF-3.2 and JENDL-4.0. Results of calculations show that all of these nuclear data have different photon production data from neutron induced reactions and have poor agreement with evaluated benchmark experiment. The ABBN-RF multigroup cross-section library is based on the ROSFOND data. It presented in two forms of micro cross sections: ABBN and MATXS formats. Comparison of group-wise calculations using both ABBN and MATXS data to point-wise calculations with the ROSFOND library shows a good agreement. The discrepancies between calculation and experimental C/E results in neutron spectra are in the limit of experimental errors. For the photon spectrum they are out of experimental errors. Results of calculations using group-wise and point-wise representation of cross sections show a good agreement both for photon and neutron spectra.

  2. VENTURE/PC manual: A multidimensional multigroup neutron diffusion code system

    Energy Technology Data Exchange (ETDEWEB)

    Shapiro, A.; Huria, H.C.; Cho, K.W. (Cincinnati Univ., OH (United States))

    1991-12-01

    VENTURE/PC is a recompilation of part of the Oak Ridge BOLD VENTURE code system, which will operate on an IBM PC or compatible computer. Neutron diffusion theory solutions are obtained for multidimensional, multigroup problems. This manual contains information associated with operating the code system. The purpose of the various modules used in the code system, and the input for these modules are discussed. The PC code structure is also given. Version 2 included several enhancements not given in the original version of the code. In particular, flux iterations can be done in core rather than by reading and writing to disk, for problems which allow sufficient memory for such in-core iterations. This speeds up the iteration process. Version 3 does not include any of the special processors used in the previous versions. These special processors utilized formatted input for various elements of the code system. All such input data is now entered through the Input Processor, which produces standard interface files for the various modules in the code system. In addition, a Standard Interface File Handbook is included in the documentation which is distributed with the code, to assist in developing the input for the Input Processor.

  3. VENTURE/PC manual: A multidimensional multigroup neutron diffusion code system. Version 3

    Energy Technology Data Exchange (ETDEWEB)

    Shapiro, A.; Huria, H.C.; Cho, K.W. [Cincinnati Univ., OH (United States)

    1991-12-01

    VENTURE/PC is a recompilation of part of the Oak Ridge BOLD VENTURE code system, which will operate on an IBM PC or compatible computer. Neutron diffusion theory solutions are obtained for multidimensional, multigroup problems. This manual contains information associated with operating the code system. The purpose of the various modules used in the code system, and the input for these modules are discussed. The PC code structure is also given. Version 2 included several enhancements not given in the original version of the code. In particular, flux iterations can be done in core rather than by reading and writing to disk, for problems which allow sufficient memory for such in-core iterations. This speeds up the iteration process. Version 3 does not include any of the special processors used in the previous versions. These special processors utilized formatted input for various elements of the code system. All such input data is now entered through the Input Processor, which produces standard interface files for the various modules in the code system. In addition, a Standard Interface File Handbook is included in the documentation which is distributed with the code, to assist in developing the input for the Input Processor.

  4. Stability analysis of multi-group deterministic and stochastic epidemic models with vaccination rate

    Science.gov (United States)

    Wang, Zhi-Gang; Gao, Rui-Mei; Fan, Xiao-Ming; Han, Qi-Xing

    2014-09-01

    We discuss in this paper a deterministic multi-group MSIR epidemic model with a vaccination rate, the basic reproduction number ℛ0, a key parameter in epidemiology, is a threshold which determines the persistence or extinction of the disease. By using Lyapunov function techniques, we show if ℛ0 is greater than 1 and the deterministic model obeys some conditions, then the disease will prevail, the infective persists and the endemic state is asymptotically stable in a feasible region. If ℛ0 is less than or equal to 1, then the infective disappear so the disease dies out. In addition, stochastic noises around the endemic equilibrium will be added to the deterministic MSIR model in order that the deterministic model is extended to a system of stochastic ordinary differential equations. In the stochastic version, we carry out a detailed analysis on the asymptotic behavior of the stochastic model. In addition, regarding the value of ℛ0, when the stochastic system obeys some conditions and ℛ0 is greater than 1, we deduce the stochastic system is stochastically asymptotically stable. Finally, the deterministic and stochastic model dynamics are illustrated through computer simulations.

  5. Relaxation of a 1-D gravitational system

    CERN Document Server

    Valageas, P

    2006-01-01

    We study the relaxation towards thermodynamical equilibrium of a 1-D gravitational system. This OSC model shows a series of critical energies $E_{cn}$ where new equilibria appear and we focus on the homogeneous ($n=0$), one-peak ($n=\\pm 1$) and two-peak ($n=2$) states. Using numerical simulations we investigate the relaxation to the stable equilibrium $n=\\pm 1$ of this $N-$body system starting from initial conditions defined by equilibria $n=0$ and $n=2$. We find that in a fashion similar to other long-range systems the relaxation involves a fast violent relaxation phase followed by a slow collisional phase as the system goes through a series of quasi-stationary states. Moreover, in cases where this slow second stage leads to a dynamically unstable configuration (two peaks with a high mass ratio) it is followed by a new sequence ``violent relaxation/slow collisional relaxation''. We obtain an analytical estimate of the relaxation time $t_{2\\to \\pm 1}$ through the mean escape time of a particle from its potent...

  6. 1D-1D Coulomb drag in a 6 Million Mobility Bi-layer Heterostructure

    Science.gov (United States)

    Bilodeau, Simon; Laroche, Dominique; Xia, Jian-Sheng; Lilly, Mike; Reno, John; Pfeiffer, Loren; West, Ken; Gervais, Guillaume

    We report Coulomb drag measurements in vertically-coupled quantum wires. The wires are fabricated in GaAs/AlGaAs bilayer heterostructures grown from two different MBE chambers: one at Sandia National Laboratories (1.2M mobility), and the other at Princeton University (6M mobility). The previously observed positive and negative drag signals are seen in both types of devices, demonstrating the robustness of the result. However, attempts to determine the temperature dependence of the drag signal in the 1D regime proved challenging in the higher mobility heterostructure (Princeton), in part because of difficulties in aligning the wires within the same transverse subband configuration. Nevertheless, this work, performed at the Microkelvin laboratory of the University of Florida, is an important proof-of-concept for future investigations of the temperature dependence of the 1D-1D drag signal down to a few mK. Such an experiment could confirm the Luttinger charge density wave interlocking predicted to occur in the wires. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under Contract DE-AC04-94AL8500.

  7. Symmetry breaking in the opinion dynamics of a multi-group project organization

    Science.gov (United States)

    Zhu, Zhen-Tao; Zhou, Jing; Li, Ping; Chen, Xing-Guang

    2012-10-01

    A bounded confidence model of opinion dynamics in multi-group projects is presented in which each group's opinion evolution is driven by two types of forces: (i) the group's cohesive force which tends to restore the opinion back towards the initial status because of its company culture; and (ii) nonlinear coupling forces with other groups which attempt to bring opinions closer due to collaboration willingness. Bifurcation analysis for the case of a two-group project shows a cusp catastrophe phenomenon and three distinctive evolutionary regimes, i.e., a deadlock regime, a convergence regime, and a bifurcation regime in opinion dynamics. The critical value of initial discord between the two groups is derived to discriminate which regime the opinion evolution belongs to. In the case of a three-group project with a symmetric social network, both bifurcation analysis and simulation results demonstrate that if each pair has a high initial discord, instead of symmetrically converging to consensus with the increase of coupling scale as expected by Gabbay's result (Physica A 378 (2007) p. 125 Fig. 5), project organization (PO) may be split into two distinct clusters because of the symmetry breaking phenomenon caused by pitchfork bifurcations, which urges that apart from divergence in participants' interests, nonlinear interaction can also make conflict inevitable in the PO. The effects of two asymmetric level parameters are tested in order to explore the ways of inducing dominant opinion in the whole PO. It is found that the strong influence imposed by a leader group with firm faith on the flexible and open minded follower groups can promote the formation of a positive dominant opinion in the PO.

  8. Symmetry breaking in the opinion dynamics of a multi-group project organization

    Institute of Scientific and Technical Information of China (English)

    Zhu Zhen-Tao; Zhou Jing; Li Ping; Chen Xing-Guang

    2012-01-01

    A bounded confidence model of opinion dynamics in multi-group projects is presented in which each group's opinion evolution is driven by two types of forces:(i) the group's cohesive force which tends to restore the opinion back towards the initial status because of its company culture; and (ii) nonlinear coupling forces with other groups which attempt to bring opinions closer due to collaboration willingness.Bifurcation analysis for the case of a two-group project shows a cusp catastrophe phenomenon and three distinctive evolutionary regimes,i.e.,a deadlock regime,a convergence regime,and a bifurcation regime in opinion dynamics.The critical value of initial discord between the two groups is derived to discriminate which regime the opinion evolution belongs to.In the case of a three-group project with a symmetric social network,both bifurcation analysis and simulation results demonstrate that if each pair has a high initial discord,instead of symmetrically converging to consensus with the increase of coupling scale as expected by Gabbay's result (Physica A 378 (2007) p.125 Fig.5),project organization (PO) may be split into two distinct clusters because of the symmetry breaking phenomenon caused by pitchfork bifurcations,which urges that apart from divergence in participants' interests,nonlinear interaction can also make conflict inevitable in the PO.The effects of two asymmetric level parameters are tested in order to explore the ways of inducing dominant opinion in the whole PO.It is found that the strong influence imposed by a leader group with firm faith on the flexible and open minded follower groups can promote the formation of a positive dominant opinion in the PO.

  9. Analysis list: Nr1d2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1d2 Liver + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.1.tsv... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d...2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d2.Liver.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Liver.gml ...

  10. Analysis list: Nr1d1 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1d1 Adipocyte,Cardiovascular,Liver,Neural + mm9 http://dbarchive.biosciencedbc.jp.../kyushu-u/mm9/target/Nr1d1.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.5.tsv http://db...archive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1....Adipocyte.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.C...ardiovascular.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.Liver.tsv,http://dbarchive.biosc

  11. Questionnaires for Students with Special Educational Needs in the Area of Learning: Results from Multi-Group Analysis

    Directory of Open Access Journals (Sweden)

    Lena Nusser

    2015-05-01

    Full Text Available This article focuses on measurement invariance of the assessment of educationally relevant constructs via written questionnaires for students at special schools and at low track schools attending 5th grade. To examine optimal conditions of administration for students with special educational needs in the area of learning an experimental design was implemented. If accommodated questionnaires, different school enrollments as well as competence differences allow equivalent assessment of reading motivation and academic self-concepts will be investigated with multi-group comparison of confirmatory factor analysis. The results indicate that comparisons between groups of students at special schools and low track schools are meaningful for certain constructs.

  12. Multi-group acculturation orientations in a changing context: Palestinian Christian Arab adolescents in Israel after the lost decade.

    Science.gov (United States)

    Munayer, Salim J; Horenczyk, Gabriel

    2014-10-01

    Grounded in a contextual approach to acculturation of minorities, this study examines changes in acculturation orientations among Palestinian Christian Arab adolescents in Israel following the "lost decade of Arab-Jewish coexistence." Multi-group acculturation orientations among 237 respondents were assessed vis-à-vis two majorities--Muslim Arabs and Israeli Jews--and compared to 1998 data. Separation was the strongest endorsed orientation towards both majority groups. Comparisons with the 1998 data also show a weakening of the Integration attitude towards Israeli Jews, and also distancing from Muslim Arabs. For the examination of the "Westernisation" hypothesis, multi-dimensional scaling (MDS) analyses of perceptions of Self and group values clearly showed that, after 10 years, Palestinian Christian Arabs perceive Israeli Jewish culture as less close to Western culture, and that Self and the Christian Arab group have become much closer, suggesting an increasing identification of Palestinian Christian Arab adolescents with their ethnoreligious culture. We discuss the value of a multi-group, multi-method, and multi-wave approach to the examination of the role of the political context in acculturation processes.

  13. 2D Multi-Angle, Multi-Group Neutrino Radiation-Hydrodynamic Simulations of Postbounce Supernova Cores

    CERN Document Server

    Ott, Christian D; Dessart, Luc; Livne, Eli

    2008-01-01

    We perform axisymmetric (2D) multi-angle, multi-group neutrino radiation-hydrodynamics calculations of the postbounce phase of core-collapse supernovae using a genuinely 2D discrete-ordinate (S_n) method. We follow the long-term postbounce evolution of the cores of one nonrotating and one rapidly-rotating 20-solar-mass stellar model for ~400 milliseconds from 160 ms to ~550 ms after bounce. We present a multi-D analysis of the multi-angle neutrino radiation fields and compare in detail with counterpart simulations carried out in the 2D multi-group flux-limited diffusion (MGFLD) approximation to neutrino transport. We find that 2D multi-angle transport is superior in capturing the global and local radiation-field variations associated with rotation-induced and SASI-induced aspherical hydrodynamic configurations. In the rotating model, multi-angle transport predicts much larger asymptotic neutrino flux asymmetries with pole to equator ratios of up to ~2.5, while MGFLD tends to sphericize the radiation fields al...

  14. A 1D version of EllipSys

    DEFF Research Database (Denmark)

    van der Laan, Paul; Sørensen, Niels N.

    2017-01-01

    A one-dimensional version of EllipSys, labeled as EllipSys1D is presented. Three atmospheric boundary layer test cases are used to show that results of EllipSys1D are exactly the same or very similar as results of EllipSys3D, while EllipSys1D uses 3 to 4 orders of magnitude less CPU hours compared...

  15. Diffusion and particle mobility in 1D system

    NARCIS (Netherlands)

    Borman, V. D.; Johansson, B.; Skorodumova, N. V.; Tronin, I. V.; Tronin, V. N.; Troyan, V. I.

    2006-01-01

    The transport properties of one-dimensional (1D) systems have been studied theoretically. Contradictory experimental results on molecular transport in quasi-1D systems, such as zeolite structures, when both diffusion transport acceleration and the existence of the diffusion mode with lower particle

  16. Multi-Population Invariance with Dichotomous Measures: Combining Multi-Group and MIMIC Methodologies in Evaluating the General Aptitude Test in the Arabic Language

    Science.gov (United States)

    Sideridis, Georgios D.; Tsaousis, Ioannis; Al-harbi, Khaleel A.

    2015-01-01

    The purpose of the present study was to extend the model of measurement invariance by simultaneously estimating invariance across multiple populations in the dichotomous instrument case using multi-group confirmatory factor analytic and multiple indicator multiple causes (MIMIC) methodologies. Using the Arabic version of the General Aptitude Test…

  17. A Multigroup diffusion solver using pseudo transient continuation for a radiation-hydrodynamic code with patch-based AMR

    Energy Technology Data Exchange (ETDEWEB)

    Shestakov, A I; Offner, S R

    2006-09-21

    We present a scheme to solve the nonlinear multigroup radiation diffusion (MGD) equations. The method is incorporated into a massively parallel, multidimensional, Eulerian radiation-hydrodynamic code with adaptive mesh refinement (AMR). The patch-based AMR algorithm refines in both space and time creating a hierarchy of levels, coarsest to finest. The physics modules are time-advanced using operator splitting. On each level, separate 'level-solve' packages advance the modules. Our multigroup level-solve adapts an implicit procedure which leads to a two-step iterative scheme that alternates between elliptic solves for each group with intra-cell group coupling. For robustness, we introduce pseudo transient continuation ({Psi}tc). We analyze the magnitude of the {Psi}tc parameter to ensure positivity of the resulting linear system, diagonal dominance and convergence of the two-step scheme. For AMR, a level defines a subdomain for refinement. For diffusive processes such as MGD, the refined level uses Dirichet boundary data at the coarse-fine interface and the data is derived from the coarse level solution. After advancing on the fine level, an additional procedure, the sync-solve (SS), is required in order to enforce conservation. The MGD SS reduces to an elliptic solve on a combined grid for a system of G equations, where G is the number of groups. We adapt the 'partial temperature' scheme for the SS; hence, we reuse the infrastructure developed for scalar equations. Results are presented. We consider a multigroup test problem with a known analytic solution. We demonstrate utility of {Psi}tc by running with increasingly larger timesteps. Lastly, we simulate the sudden release of energy Y inside an Al sphere (r = 15 cm) suspended in air at STP. For Y = 11 kT, we find that gray radiation diffusion and MGD produce similar results. However, if Y = 1 MT, the two packages yield different results. Our large Y simulation contradicts a long-standing theory

  18. A Multigroup diffusion Solver Using Pseudo Transient Continuation for a Radiaiton-Hydrodynamic Code with Patch-Based AMR

    Energy Technology Data Exchange (ETDEWEB)

    Shestakov, A I; Offner, S R

    2007-03-02

    We present a scheme to solve the nonlinear multigroup radiation diffusion (MGD) equations. The method is incorporated into a massively parallel, multidimensional, Eulerian radiation-hydrodynamic code with adaptive mesh refinement (AMR). The patch-based AMR algorithm refines in both space and time creating a hierarchy of levels, coarsest to finest. The physics modules are time-advanced using operator splitting. On each level, separate 'level-solve' packages advance the modules. Our multigroup level-solve adapts an implicit procedure which leads to a two-step iterative scheme that alternates between elliptic solves for each group with intra-cell group coupling. For robustness, we introduce pseudo transient continuation ({Psi}tc). We analyze the magnitude of the {Psi}tc parameter to ensure positivity of the resulting linear system, diagonal dominance and convergence of the two-step scheme. For AMR, a level defines a subdomain for refinement. For diffusive processes such as MGD, the refined level uses Dirichet boundary data at the coarse-fine interface and the data is derived from the coarse level solution. After advancing on the fine level, an additional procedure, the sync-solve (SS), is required in order to enforce conservation. The MGD SS reduces to an elliptic solve on a combined grid for a system of G equations, where G is the number of groups. We adapt the 'partial temperature' scheme for the SS; hence, we reuse the infrastructure developed for scalar equations. Results are presented. We consider a multigroup test problem with a known analytic solution. We demonstrate utility of {Psi}tc by running with increasingly larger timesteps. Lastly, we simulate the sudden release of energy Y inside an Al sphere (r = 15 cm) suspended in air at STP. For Y = 11 kT, we find that gray radiation diffusion and MGD produce similar results. However, if Y = 1 MT, the two packages yield different results. Our large Y simulation contradicts a long-standing theory

  19. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    Energy Technology Data Exchange (ETDEWEB)

    Popovic, Marta; Zaja, Roko [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia); Fent, Karl [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology (ETH Zürich), Department of Environmental System Sciences, Institute of Biogeochemistry and Pollution Dynamics, CH-8092 Zürich (Switzerland); Smital, Tvrtko, E-mail: smital@irb.hr [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia)

    2014-10-01

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  20. Nuclear Data Uncertainty Propagation in Depletion Calculations Using Cross Section Uncertainties in One-group or Multi-group

    Science.gov (United States)

    Díez, C. J.; Cabellos, O.; Martínez, J. S.

    2015-01-01

    Several approaches have been developed in last decades to tackle nuclear data uncertainty propagation problems of burn-up calculations. One approach proposed was the Hybrid Method, where uncertainties in nuclear data are propagated only on the depletion part of a burn-up problem. Because only depletion is addressed, only one-group cross sections are necessary, and hence, their collapsed one-group uncertainties. This approach has been applied successfully in several advanced reactor systems like EFIT (ADS-like reactor) or ESFR (Sodium fast reactor) to assess uncertainties on the isotopic composition. However, a comparison with using multi-group energy structures was not carried out, and has to be performed in order to analyse the limitations of using one-group uncertainties.

  1. Time-dependent Multi-group Multidimensional Relativistic Radiative Transfer Code Based On Spherical Harmonic Discrete Ordinate Method

    CERN Document Server

    Tominaga, Nozomu; Blinnikov, Sergei I

    2015-01-01

    We develop a time-dependent multi-group multidimensional relativistic radiative transfer code, which is required to numerically investigate radiation from relativistic fluids involved in, e.g., gamma-ray bursts and active galactic nuclei. The code is based on the spherical harmonic discrete ordinate method (SHDOM) that evaluates a source function including anisotropic scattering in spherical harmonics and implicitly solves the static radiative transfer equation with a ray tracing in discrete ordinates. We implement treatments of time dependence, multi-frequency bins, Lorentz transformation, and elastic Thomson and inelastic Compton scattering to the publicly available SHDOM code. Our code adopts a mixed frame approach; the source function is evaluated in the comoving frame whereas the radiative transfer equation is solved in the laboratory frame. This implementation is validated with various test problems and comparisons with results of a relativistic Monte Carlo code. These validations confirm that the code ...

  2. An improved and fully implicit multi-group non-local electron transport model and its validations

    Science.gov (United States)

    Sijoy, C. D.; Mishra, V.; Chaurasia, S.

    2017-09-01

    The combined effect of thermal flux inhibition and non-local electron heat flux in the radiation hydrodynamics (RHD) simulation of laser-driven systems can be accurately predicted by using non-local electron transport (NLET) models. These models can avoid commonly used space and time-independent ad-hoc flux-limiting procedures. However, the use of classical electron collision frequency in these models is rigorously valid for high temperature non-degenerate plasmas. In laser-driven systems, the electron thermal energy transport is important in regions between the critical density and ablation surface where the plasma is partially degenerate. Therefore, an improved model for electron collision frequency in this regime is required to accurately predict the thermal energy transport. Previously, we have reported an improved single group non-local electron transport model by using a wide-range electron collision frequency model valid from warm-dense matter (WDM) to fully ionized plasmas. In this work, we have extended this idea into a two-dimensional multi-group non-local electron transport (MG-NLET) model. Moreover, we have used a fully implicit numerical integration scheme in which the models for multi-group thermal radiation transport, laser absorption, electron-ion thermal energy relaxation and ion heat conduction are included in a single step. The performance of this improved MG-NLET model has been assessed by comparing the simulated foil trajectories with the reported experimental data for laser-driven plastic foils. The results indicate that the improved model yields results that are in better agreement with the experimental data.

  3. The Gain Properties of 1-D Active Photonic Crystal

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The terminology 'ID frequency'(w ID) is proposed after analyzing the 1D active photonic crystal based on the transfer matrix method. The relationship between wID and the structure parameters of the photonic crystal is investigated.

  4. Severe Hypertriglyceridemia in Glut1D on Ketogenic Diet.

    Science.gov (United States)

    Klepper, Joerg; Leiendecker, Baerbel; Heussinger, Nicole; Lausch, Ekkehart; Bosch, Friedrich

    2016-04-01

    High-fat ketogenic diets are the only treatment available for Glut1 deficiency (Glut1D). Here, we describe an 8-year-old girl with classical Glut1D responsive to a 3:1 ketogenic diet and ethosuximide. After 3 years on the diet a gradual increase of blood lipids was followed by rapid, severe asymptomatic hypertriglyceridemia (1,910 mg/dL). Serum lipid apheresis was required to determine liver, renal, and pancreatic function. A combination of medium chain triglyceride-oil and a reduction of the ketogenic diet to 1:1 ratio normalized triglyceride levels within days but triggered severe myoclonic seizures requiring comedication with sultiam. Severe hypertriglyceridemia in children with Glut1D on ketogenic diets may be underdiagnosed and harmful. In contrast to congenital hypertriglyceridemias, children with Glut1D may be treated effectively by dietary adjustments alone.

  5. IMPROVEMENTS OF RIVER MODELING 1D DATA PREPARATION

    Directory of Open Access Journals (Sweden)

    ION-MARIAN MOISOIU

    2012-11-01

    Full Text Available Improvements of river modeling 1D data preparation. The importance of hydrographical networks data and the need for detailed studies do generate an increase of projects in this specialized area and a diversification of river mathematical modeling software. River mathematical modeling can be done in two ways, namely; the "2D mode" and the “1D mode”. The “2D mode” is where a digital terrain model of a full hydrographical basin must be produced and "1D mode" is where only cross sections, long sections and structures elevations needs to be presented in a graphical environment and in a specific formats for the mathematical modeling software. This paper will show the principle of a custom built GIS, specially created to help the preparation of 1D river modeling data. The benefits are; elimination of human errors, automated processing, increasing productivity, flexible output and cost reduction.

  6. Supported plasma-made 1D heterostructures: perspectives and applications

    OpenAIRE

    Borras, Ana; Macias-Montero, Manuel; Romero-Gomez, Pablo; Gonzalez-Elipe, Agustin R.

    2011-01-01

    Abstract Plasma related methods have been widely used in the fabrication of carbon nanotubes and nanofibres and semiconducting inorganic nanowires. A natural progression of the research in the field of 1D nanostructures is the synthesis of multicomponent nanowires and nanofibres. In this article we review the state of the art of the fabrication by plasma methods of 1D heterostructures including applications and perspectives. Furthermore, recent developments on the use of metal seeds (Ag, A...

  7. 1D photonic crystal sensor integrated in a microfluidic system

    DEFF Research Database (Denmark)

    Nunes, Pedro; Mortensen, Asger; Kutter, Jörg Peter

    2009-01-01

    A refractive index sensor was designed as a 1D resonator incorporated in a microfluidic channel, where aqueous solutions were injected. A sensitivity of 480 nm/RIU and a minimum difference of Deltan = 0.002 were determined.......A refractive index sensor was designed as a 1D resonator incorporated in a microfluidic channel, where aqueous solutions were injected. A sensitivity of 480 nm/RIU and a minimum difference of Deltan = 0.002 were determined....

  8. TBC1D24 genotype–phenotype correlation

    Science.gov (United States)

    Balestrini, Simona; Milh, Mathieu; Castiglioni, Claudia; Lüthy, Kevin; Finelli, Mattea J.; Verstreken, Patrik; Cardon, Aaron; Stražišar, Barbara Gnidovec; Holder, J. Lloyd; Lesca, Gaetan; Mancardi, Maria M.; Poulat, Anne L.; Repetto, Gabriela M.; Banka, Siddharth; Bilo, Leonilda; Birkeland, Laura E.; Bosch, Friedrich; Brockmann, Knut; Cross, J. Helen; Doummar, Diane; Félix, Temis M.; Giuliano, Fabienne; Hori, Mutsuki; Hüning, Irina; Kayserili, Hulia; Kini, Usha; Lees, Melissa M.; Meenakshi, Girish; Mewasingh, Leena; Pagnamenta, Alistair T.; Peluso, Silvio; Mey, Antje; Rice, Gregory M.; Rosenfeld, Jill A.; Taylor, Jenny C.; Troester, Matthew M.; Stanley, Christine M.; Ville, Dorothee; Walkiewicz, Magdalena; Falace, Antonio; Fassio, Anna; Lemke, Johannes R.; Biskup, Saskia; Tardif, Jessica; Ajeawung, Norbert F.; Tolun, Aslihan; Corbett, Mark; Gecz, Jozef; Afawi, Zaid; Howell, Katherine B.; Oliver, Karen L.; Berkovic, Samuel F.; Scheffer, Ingrid E.; de Falco, Fabrizio A.; Oliver, Peter L.; Striano, Pasquale; Zara, Federico

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients carried diagnoses of focal (25%), multifocal (2%), generalized (4%), and unclassified epilepsy (6%), and early-onset epileptic encephalopathy (25%). Most patients had drug-resistant epilepsy. We detail EEG, neuroimaging, developmental, and cognitive features, treatment responsiveness, and physical examination. In silico evaluation revealed 7 different highly conserved motifs, with the most common pathogenic mutation located in the first. Neuronal outgrowth assays showed that some TBC1D24 mutations, associated with the most severe TBC1D24-associated disorders, are not necessarily the most disruptive to this gene function. Conclusions: TBC1D24-related epilepsy syndromes show marked phenotypic pleiotropy, with multisystem involvement and severity spectrum ranging from isolated deafness (not studied here), benign myoclonic epilepsy restricted to childhood with complete seizure control and normal intellect, to early-onset epileptic encephalopathy with severe developmental delay and early death. There is no distinct correlation with mutation type or location yet, but patterns are emerging. Given the phenotypic breadth observed, TBC1D24 mutation screening is indicated in a wide variety of epilepsies. A TBC1D24 consortium was formed to develop further research on this gene and its associated phenotypes. PMID:27281533

  9. Multigroup and few-group cross sections for ENDF/B-IV fission products; the TOAFEW collapsing code and data file of 154-group fission-product cross sections. [In FORTRAN

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, W.B.; England, T.R.; LaBauve, R.J.

    1978-02-01

    The ENDF/B-IV fission-product data file includes data describing 824 nuclides. Cross sections, given for 181 of these nuclides, were processed into 154 neutron energy groups. The production of the data file is described. The TOAFEW code, useful in collapsing the multigroup values to few-group cross sections, is presented with instructions and examples of its use. The file of multigroup cross sections is available on request. 3 figures, 11 tables.

  10. The high-energy multi-group HEST1.0 library based on ENDF/B-VII.0: development, verification and preliminary application

    Science.gov (United States)

    Wu, Jun; Chen, Yi-Xue; Wang, Wei-Jin; Yin, Wen; Liang, Tian-Jiao; Jia, Xue-Jun

    2012-03-01

    ENDF/B-VII.0, which was released by the USA Cross Section Evaluation Working Group (CSEWG) in December 2006, was demonstrated to perform much better than previous ENDF evaluations over a broad range of benchmark experiments. A high-energy (up to 150 MeV) multi-group library set named HEST1.0 with 253-neutron and 48-photon groups has been developed based on ENDF/B-VII.0 using the NJOY code. This paper provides a summary of the procedure to produce the library set and a detailed description of the verification of the multi-group library set by several shielding benchmark devices, in particular for high-energy neutron data. In addition, the first application of HEST1.0 to the shielding design of the China Spallation Neutron Source (CSNS) is demonstrated.

  11. The high-energy multi-group HEST1.0 library based on ENDF/B-Ⅶ.0: development, verification and preliminary application

    Institute of Scientific and Technical Information of China (English)

    WU Jun; CHEN Yi-Xue; WANG Wei-Jin; YIN Wen; LIANG Tian-Jiao; JIA Xue-Jun

    2012-01-01

    ENDF/B-Ⅶ.0,which was released by the USA Cross Section Evaluation Working Group (CSEWG)in December 2006,was demonstrated to perform much better than previous ENDF evaluations over a broad range of benchmark experiments.A high-energy (up to 150 MeV) multi-group library set named HEST1.0with 253-neutron and 48-photon groups has been developed based on ENDF/B-Ⅶ.0 using the N JOY code.This paper provides a summary of the procedure to produce the library set and a detailed description of the verification of the multi-group library set by several shielding benchmark devices,in particular for high-energy neutron data.In addition,the first application of HEST1.0 to the shielding design of the China Spallation Neutron Source (CSNS) is demonstrated.

  12. Flexible Photodetectors Based on 1D Inorganic Nanostructures

    Science.gov (United States)

    Lou, Zheng

    2015-01-01

    Flexible photodetectors with excellent flexibility, high mechanical stability and good detectivity, have attracted great research interest in recent years. 1D inorganic nanostructures provide a number of opportunities and capabilities for use in flexible photodetectors as they have unique geometry, good transparency, outstanding mechanical flexibility, and excellent electronic/optoelectronic properties. This article offers a comprehensive review of several types of flexible photodetectors based on 1D nanostructures from the past ten years, including flexible ultraviolet, visible, and infrared photodetectors. High‐performance organic‐inorganic hybrid photodetectors, as well as devices with 1D nanowire (NW) arrays, are also reviewed. Finally, new concepts of flexible photodetectors including piezophototronic, stretchable and self‐powered photodetectors are examined to showcase the future research in this exciting field. PMID:27774404

  13. 1D nanocrystals with precisely controlled dimensions, compositions, and architectures.

    Science.gov (United States)

    Pang, Xinchang; He, Yanjie; Jung, Jaehan; Lin, Zhiqun

    2016-09-16

    The ability to synthesize a diverse spectrum of one-dimensional (1D) nanocrystals presents an enticing prospect for exploring nanoscale size- and shape-dependent properties. Here we report a general strategy to craft a variety of plain nanorods, core-shell nanorods, and nanotubes with precisely controlled dimensions and compositions by capitalizing on functional bottlebrush-like block copolymers with well-defined structures and narrow molecular weight distributions as nanoreactors. These cylindrical unimolecular nanoreactors enable a high degree of control over the size, shape, architecture, surface chemistry, and properties of 1D nanocrystals. We demonstrate the synthesis of metallic, ferroelectric, upconversion, semiconducting, and thermoelectric 1D nanocrystals, among others, as well as combinations thereof.

  14. Quantum electrodynamics with 1D arti cial atoms

    DEFF Research Database (Denmark)

    Javadi, Alisa

    A 1D atom, a single quantum emitter coupled to a single optical mode, exhibits rich quantum electrodynamic (QED) e_ects and is thought to be the key ingredient for many applications in quantuminformation processing. Single quantum dots (QD) in photonic-crystal waveguides (PCW) constitute a robust...... platform for realizing a 1D atom, and are the subject of theoretical and experimental investigations in this thesis. We use _nite element method in 3D to calculate the local density of states (LDOS) in photonic-crystal membranes. The detailed spatial maps show strong inhibition of LDOS in the bandgap...... atom. One of the signatures and functions of a 1D atom is the nonlinear optical response at the single-photon level. A PCW chip is designed to experimentally study the transmission spectrum of an embedded QD. The transmission spectrum is shown to be modi_ed by 30% around the resonance of the QD...

  15. 1D nanocrystals with precisely controlled dimensions, compositions, and architectures

    Science.gov (United States)

    Pang, Xinchang; He, Yanjie; Jung, Jaehan; Lin, Zhiqun

    2016-09-01

    The ability to synthesize a diverse spectrum of one-dimensional (1D) nanocrystals presents an enticing prospect for exploring nanoscale size- and shape-dependent properties. Here we report a general strategy to craft a variety of plain nanorods, core-shell nanorods, and nanotubes with precisely controlled dimensions and compositions by capitalizing on functional bottlebrush-like block copolymers with well-defined structures and narrow molecular weight distributions as nanoreactors. These cylindrical unimolecular nanoreactors enable a high degree of control over the size, shape, architecture, surface chemistry, and properties of 1D nanocrystals. We demonstrate the synthesis of metallic, ferroelectric, upconversion, semiconducting, and thermoelectric 1D nanocrystals, among others, as well as combinations thereof.

  16. Quantum electrodynamics with 1D arti cial atoms

    DEFF Research Database (Denmark)

    Javadi, Alisa

    atom. One of the signatures and functions of a 1D atom is the nonlinear optical response at the single-photon level. A PCW chip is designed to experimentally study the transmission spectrum of an embedded QD. The transmission spectrum is shown to be modi_ed by 30% around the resonance of the QD......A 1D atom, a single quantum emitter coupled to a single optical mode, exhibits rich quantum electrodynamic (QED) e_ects and is thought to be the key ingredient for many applications in quantuminformation processing. Single quantum dots (QD) in photonic-crystal waveguides (PCW) constitute a robust...... platform for realizing a 1D atom, and are the subject of theoretical and experimental investigations in this thesis. We use _nite element method in 3D to calculate the local density of states (LDOS) in photonic-crystal membranes. The detailed spatial maps show strong inhibition of LDOS in the bandgap...

  17. Status report on multigroup cross section generation code development for high-fidelity deterministic neutronics simulation system.

    Energy Technology Data Exchange (ETDEWEB)

    Yang, W. S.; Lee, C. H. (Nuclear Engineering Division)

    2008-05-16

    Under the fast reactor simulation program launched in April 2007, development of an advanced multigroup cross section generation code was initiated in July 2007, in conjunction with the development of the high-fidelity deterministic neutron transport code UNIC. The general objectives are to simplify the existing multi-step schemes and to improve the resolved and unresolved resonance treatments. Based on the review results of current methods and the fact that they have been applied successfully to fast critical experiment analyses and fast reactor designs for last three decades, the methodologies of the ETOE-2/MC{sup 2}-2/SDX code system were selected as the starting set of methodologies for multigroup cross section generation for fast reactor analysis. As the first step for coupling with the UNIC code and use in a parallel computing environment, the MC{sup 2}-2 code was updated by modernizing the memory structure and replacing old data management package subroutines and functions with FORTRAN 90 based routines. Various modifications were also made in the ETOE-2 and MC{sup 2}-2 codes to process the ENDF/B-VII.0 data properly. Using the updated ETOE-2/MC{sup 2}-2 code system, the ENDF/B-VII.0 data was successfully processed for major heavy and intermediate nuclides employed in sodium-cooled fast reactors. Initial verification tests of the MC{sup 2}-2 libraries generated from ENDF/B-VII.0 data were performed by inter-comparison of twenty-one group infinite dilute total cross sections obtained from MC{sup 2}-2, VIM, and NJOY. For almost all nuclides considered, MC{sup 2}-2 cross sections agreed very well with those from VIM and NJOY. Preliminary validation tests of the ENDF/B-VII.0 libraries of MC{sup 2}-2 were also performed using a set of sixteen fast critical benchmark problems. The deterministic results based on MC{sup 2}-2/TWODANT calculations were in good agreement with MCNP solutions within {approx}0.25% {Delta}{rho}, except a few small LANL fast assemblies

  18. Diffusion and particle mobility in 1D system

    Energy Technology Data Exchange (ETDEWEB)

    Borman, V.D. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation); Johansson, B. [Condensed Matter Theory Group, Department of Physics, Box 530, Uppsala University, S-75121 Uppsala (Sweden); Applied Materials Physics, Department of Materials and Engineering, Royal Institute of Technology (KTH), S-10044 Stockholm (Sweden); Skorodumova, N.V. [Condensed Matter Theory Group, Department of Physics, Box 530, Uppsala University, S-75121 Uppsala (Sweden); Tronin, I.V. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation)]. E-mail: ivt@rbcmail.ru; Tronin, V.N. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation); Troyan, V.I. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation)

    2006-12-04

    The transport properties of one-dimensional (1D) systems have been studied theoretically. Contradictory experimental results on molecular transport in quasi-1D systems, such as zeolite structures, when both diffusion transport acceleration and the existence of the diffusion mode with lower particle mobility (single-file diffusion ({approx}t{sup 1/2})) have been reported, are consolidated in a consistent model. Transition from the single-file diffusion mode to an Einstein-like diffusion {approx}t with diffusion coefficient increasing with the density has been predicted to occur at large observation times.

  19. GIS-BASED 1-D DIFFUSIVE WAVE OVERLAND FLOW MODEL

    Energy Technology Data Exchange (ETDEWEB)

    KALYANAPU, ALFRED [Los Alamos National Laboratory; MCPHERSON, TIMOTHY N. [Los Alamos National Laboratory; BURIAN, STEVEN J. [NON LANL

    2007-01-17

    This paper presents a GIS-based 1-d distributed overland flow model and summarizes an application to simulate a flood event. The model estimates infiltration using the Green-Ampt approach and routes excess rainfall using the 1-d diffusive wave approximation. The model was designed to use readily available topographic, soils, and land use/land cover data and rainfall predictions from a meteorological model. An assessment of model performance was performed for a small catchment and a large watershed, both in urban environments. Simulated runoff hydrographs were compared to observations for a selected set of validation events. Results confirmed the model provides reasonable predictions in a short period of time.

  20. On the D1-D5 conformal field theory

    Science.gov (United States)

    Dijkgraaf, Robbert

    2000-03-01

    I give a review of some aspects of the D1-D5 conformal field theory that is dual to string theory on AdS 3 . Particular attention is paid to the gravitational interpretation of the elliptic genus as a sum over 3-manifolds.

  1. Nonclassical Particle Transport in the 1-D Diffusive Limit

    CERN Document Server

    Vasques, Richard; Krycki, Kai

    2016-01-01

    This paper provides numerical results that demonstrate the validity of the nonclassical diffusion approximation to the nonclassical transport equation in certain 1-D diffusive systems. This result provides a more solid foundation in which to improve this theory for relevant nuclear applications.

  2. Quantitative 1D saturation profiles on chalk by NMR

    DEFF Research Database (Denmark)

    Olsen, Dan; Topp, Simon; Stensgaard, Anders;

    1996-01-01

    Quantitative one-dimensional saturation profiles showing the distribution of water and oil in chalk core samples are calculated from NMR measurements utilizing a 1D CSI spectroscopy pulse sequence. Saturation profiles may be acquired under conditions of fluid flow through the sample. Results reveal...

  3. Ultracold spherical horizons in gauged N=1, d=4 supergravity

    Energy Technology Data Exchange (ETDEWEB)

    Meessen, Patrick, E-mail: meessenpatrick@uniovi.e [Department of Physics, University of Oviedo, Avda. Calvo Sotelo s/n, E-33007 Oviedo (Spain); Ortin, Tomas, E-mail: Tomas.Ortin@cern.c [Instituto de Fisica Teorica UAM/CSIC, Facultad de Ciencias C-XVI, C.U. Cantoblanco, E-28049 Madrid (Spain)

    2010-10-04

    We show that the near-horizon limit of ultracold magnetic Reissner-Nordstroem-De Sitter black holes, whose geometry is the direct product of 2-dimensional Minkowski spacetime and a 2-sphere, preserves half of the supersymmetries of minimal R-gauged N=1, d=4 supergravity.

  4. Active damping of the 1D rocking mode

    NARCIS (Netherlands)

    Babakhani, B.; de Vries, Theodorus J.A.

    Active damping of a rotational vibration mode in the linear guidance of a precision machine in a one dimensional (1D) setting is considered in this paper. This so-called rocking mode presents itself in machines having linear actuation. The limitation this vibration mode imposes on the machine

  5. Energy harvesting and storage in 1D devices

    Science.gov (United States)

    Sun, Hao; Zhang, Ye; Zhang, Jing; Sun, Xuemei; Peng, Huisheng

    2017-06-01

    Power systems and electronic devices that are bulky and rigid are not practical for use in wearable applications that require flexibility and breathability. To address this, a range of 1D energy harvesting and storage devices have been fabricated that show promise for such applications compared with their 2D and 3D counterparts. These 1D devices are based on fibres that are flexible and can accommodate deformation, for example, by twisting and stretching. The fibres can be woven into textiles and fabrics that breathe freely or can be integrated into different materials that fit the curved surface of the human body. In this Review, the development of fibre-based energy harvesting and storage devices is presented, focusing on dye-sensitized solar cells, lithium-ion batteries, supercapacitors and their integrated devices. An emphasis is placed on the interface between the active materials and the electrodes or electrolyte in the 1D devices. The differing properties of these interfaces compared with those in 2D and 3D devices are derived from the curved surface and long charge transport path in 1D electrodes.

  6. Simulation of Organic Solar Cells Using AMPS-1D Program

    Directory of Open Access Journals (Sweden)

    Samah G. Babiker

    2012-03-01

    Full Text Available The analysis of microelectronic and photonic structure in one dimension program [AMPS-1D] program has been successfully used to study inorganic solar cells. In this work the program has been used to optimize the performance of the organic solar cells. The cells considered consist of poly(2-methoxy-5-(3,7- dimethyloctyloxy-1,4-phenylenevinylene [MDMO-PPV

  7. Suppression of spin-orbit effects in 1D system

    OpenAIRE

    Entin, M. V.; Magarill, L. I.

    2004-01-01

    We report the absence of spin effects such as spin-galvanic effect, spin polarization and spin current under static electric field and inter-spin-subband absorption in 1D system with spin-orbit interaction of arbitrary form. It was also shown that the accounting for the direct interaction of electron spin with magnetic field violates this statement.

  8. Inverse parameter identification for a branching 1D arterial network

    CSIR Research Space (South Africa)

    Bogaers, Alfred EJ

    2012-07-01

    Full Text Available In this paper we investigate the invertability of a branching 1D arterial blood flow network. We limit our investigation to a single bifurcating vessel, where the material properties, unloaded areas and variables characterizing the input and output...

  9. Active damping of the 1D rocking mode

    NARCIS (Netherlands)

    Babakhani, Bayan; Vries, de Theo

    2010-01-01

    Active damping of a rotational vibration mode in the linear guidance of a precision machine in a one dimensional (1D) setting is considered in this paper. This so-called rocking mode presents itself in machines having linear actuation. The limitation this vibration mode imposes on the machine precis

  10. Pathways among exposure to violence, maternal depression, family structure, and child outcomes through parenting: a multigroup analysis.

    Science.gov (United States)

    Westbrook, T'pring R; Harden, Brenda Jones

    2010-07-01

    The present study examined the impact of proximal (maternal depression, family structure) and distal (exposure to violence) risk factors on parenting characteristics (warmth, control), which were in turn hypothesized to affect child social-emotional functioning. Using the Family and Child Experiences Study (FACES) 2000 cohort, findings revealed that study variables were significant predictors of child social-emotional functioning. Despite limited significant pathways in the structural equation models, the cumulative effect of the variables resulted in models accounting for 21%-37% of the outcome. Multigroup analysis revealed that although the amount of variance explained varied, the model held across subgroups. Findings support theories such as the family stress model that suggest that family risk factors negatively influencing children's development through influencing parenting behaviors. Findings also support considering both warmth and control as key parenting dimensions. It may be impractical for practitioners to address the myriad of potential risks encountered by low-income families, but parents can be equipped with mental health services, parent education, and other assistance to help them maintain positive parenting practices in the face of challenges.

  11. Multi-Group Formulation of the Temperature-Dependent Resonance Scattering Model and its Impact on Reactor Core Parameters

    Energy Technology Data Exchange (ETDEWEB)

    Ghrayeb, Shadi Z. [Pennsylvania State Univ., University Park, PA (United States). Dept. of Mechanical and Nuclear Engineering; Ougouag, Abderrafi M. [Idaho National Laboratory (INL), Idaho Falls, ID (United States); Ouisloumen, Mohamed [Westinghouse Electric Company, Cranberry Township, PA (United States); Ivanov, Kostadin N. [Pennsylvania State Univ., University Park, PA (United States). Dept. of Mechanical and Nuclear Engineering

    2014-01-01

    A multi-group formulation for the exact neutron elastic scattering kernel is developed. It incorporates the neutron up-scattering effects, stemming from lattice atoms thermal motion and accounts for it within the resulting effective nuclear cross-section data. The effects pertain essentially to resonant scattering off of heavy nuclei. The formulation, implemented into a standalone code, produces effective nuclear scattering data that are then supplied directly into the DRAGON lattice physics code where the effects on Doppler Reactivity and neutron flux are demonstrated. The correct accounting for the crystal lattice effects influences the estimated values for the probability of neutron absorption and scattering, which in turn affect the estimation of core reactivity and burnup characteristics. The results show an increase in values of Doppler temperature feedback coefficients up to -10% for UOX and MOX LWR fuels compared to the corresponding values derived using the traditional asymptotic elastic scattering kernel. This paper also summarizes the results done on this topic to date.

  12. An Investigation of Neutrino-Driven Convection and the Core Collapse Supernova Mechanism Using Multigroup Neutrino Transport

    CERN Document Server

    Mezzacappa, A; Bruenn, S W; Blondin, J M; Guidry, M W; Strayer, M R; Umar, A S

    1996-01-01

    We investigate neutrino-driven convection in core collapse supernovae and its ramifications for the explosion mechanism. We begin with an ``optimistic'' 15 solar mass precollapse model, which is representative of the class of stars with compact iron cores. This model is evolved through core collapse and bounce in one dimension using multigroup (neutrino-energy--dependent) flux-limited diffusion (MGFLD) neutrino transport and Lagrangian hydrodynamics, providing realistic initial conditions for the postbounce convection and evolution. Our two-dimensional simulation begins at 106 ms after bounce at a time when there is a well-developed gain region, and proceeds for 400 ms. We couple two-dimensional (PPM) hydrodynamics to one-dimensional MGFLD neutrino transport. At 225 ms after bounce we see large-scale convection behind the shock, characterized by high-entropy, mushroom-like, expanding upflows and dense, low-entropy, finger-like downflows. The upflows reach the shock and distort it from sphericity. The radial c...

  13. A Multigroup Confirmatory Factor Analysis of the Patient Health Questionnaire-9 among English- and Spanish-speaking Latinas

    Science.gov (United States)

    Merz, Erin L.; Malcarne, Vanessa L.; Roesch, Scott C.; Riley, Natasha; Sadler, Georgia Robins

    2014-01-01

    Depression is a significant problem for ethnic minorities that remains understudied partly due to a lack of strong measures with established psychometric properties. One screening tool, the Patient Health Questionnaire-9 (PHQ-9), which was developed for use in primary care has also gained popularity in research settings. The reliability and validity of the PHQ-9 has been well established among predominantly Caucasian samples, in addition to many minority groups. However, there is little evidence regarding its utility among Hispanic Americans, a large and growing cultural group in the United States. In this study, we investigated the reliability and structural validity of the PHQ-9 in Hispanic American women. A community sample of 479 Latina women from southern California completed the PHQ-9 in their preferred language of English or Spanish. Cronbach’s alphas suggested that there was good internal consistency for both the English- and Spanish-language versions. Structural validity was investigated using multigroup confirmatory factor analysis (CFA). Results support a similar one-factor structure with equivalent response patterns and variances among English- and Spanish-speaking Latinas. These results suggest that the PHQ-9 can be used with confidence in both English and Spanish versions to screen Latinas for depression. PMID:21787063

  14. Knowledge extraction algorithm for variances handling of CP using integrated hybrid genetic double multi-group cooperative PSO and DPSO.

    Science.gov (United States)

    Du, Gang; Jiang, Zhibin; Diao, Xiaodi; Yao, Yang

    2012-04-01

    Although the clinical pathway (CP) predefines predictable standardized care process for a particular diagnosis or procedure, many variances may still unavoidably occur. Some key index parameters have strong relationship with variances handling measures of CP. In real world, these problems are highly nonlinear in nature so that it's hard to develop a comprehensive mathematic model. In this paper, a rule extraction approach based on combing hybrid genetic double multi-group cooperative particle swarm optimization algorithm (PSO) and discrete PSO algorithm (named HGDMCPSO/DPSO) is developed to discovery the previously unknown and potentially complicated nonlinear relationship between key parameters and variances handling measures of CP. Then these extracted rules can provide abnormal variances handling warning for medical professionals. Three numerical experiments on Iris of UCI data sets, Wisconsin breast cancer data sets and CP variances data sets of osteosarcoma preoperative chemotherapy are used to validate the proposed method. When compared with the previous researches, the proposed rule extraction algorithm can obtain the high prediction accuracy, less computing time, more stability and easily comprehended by users, thus it is an effective knowledge extraction tool for CP variances handling.

  15. 1D Josephson quantum interference grids: diffraction patterns and dynamics

    Science.gov (United States)

    Lucci, M.; Badoni, D.; Corato, V.; Merlo, V.; Ottaviani, I.; Salina, G.; Cirillo, M.; Ustinov, A. V.; Winkler, D.

    2016-02-01

    We investigate the magnetic response of transmission lines with embedded Josephson junctions and thus generating a 1D underdamped array. The measured multi-junction interference patterns are compared with the theoretical predictions for Josephson supercurrent modulations when an external magnetic field couples both to the inter-junction loops and to the junctions themselves. The results provide a striking example of the analogy between Josephson phase modulation and 1D optical diffraction grid. The Fiske resonances in the current-voltage characteristics with voltage spacing {Φ0}≤ft(\\frac{{\\bar{c}}}{2L}\\right) , where L is the total physical length of the array, {Φ0} the magnetic flux quantum and \\bar{c} the speed of light in the transmission line, demonstrate that the discrete line supports stable dynamic patterns generated by the ac Josephson effect interacting with the cavity modes of the line.

  16. D1-D5-P microstates at the cap

    CERN Document Server

    Giusto, Stefano; Mathur, Samir D; Turton, David

    2012-01-01

    The geometries describing D1-D5-P bound states in string theory have three regions: flat asymptotics, an anti-de Sitter throat, and a 'cap' region at the bottom of the throat. We identify the CFT description of a known class of supersymmetric D1-D5-P microstate geometries which describe degrees of freedom in the cap region. The class includes both regular solutions and solutions with conical defects, and generalizes configurations with known CFT descriptions: a parameter related to spectral flow in the CFT is generalized from integer to fractional values. We provide strong evidence for this identification by comparing the massless scalar excitation spectrum between gravity and CFT and finding exact agreement.

  17. New D1-D5-P geometries from string amplitudes

    CERN Document Server

    Giusto, Stefano; Turton, David

    2011-01-01

    We derive the long range supergravity fields sourced by a D1-D5-P bound state from disk amplitudes for massless closed string emission. We suggest that since the parameter controlling the string perturbation expansion for this calculation decreases with distance from the bound state, the resulting asymptotic fields are valid even in the regime of parameters in which there is a classical black hole solution with the same charges. The supergravity fields differ from the black hole solution by multipole moments and are more general than those contained within known classes of solutions in the literature, whilst still preserving four supersymmetries. Our results support the conjecture that the black hole solution should be interpreted as a coarse-grained description rather than an exact description of the gravitational field sourced by D1-D5-P bound states in this regime of parameters.

  18. Developing 1D nanostructure arrays for future nanophotonics

    Directory of Open Access Journals (Sweden)

    Cooke DG

    2006-01-01

    Full Text Available AbstractThere is intense and growing interest in one-dimensional (1-D nanostructures from the perspective of their synthesis and unique properties, especially with respect to their excellent optical response and an ability to form heterostructures. This review discusses alternative approaches to preparation and organization of such structures, and their potential properties. In particular, molecular-scale printing is highlighted as a method for creating organized pre-cursor structure for locating nanowires, as well as vapor–liquid–solid (VLS templated growth using nano-channel alumina (NCA, and deposition of 1-D structures with glancing angle deposition (GLAD. As regards novel optical properties, we discuss as an example, finite size photonic crystal cavity structures formed from such nanostructure arrays possessing highQand small mode volume, and being ideal for developing future nanolasers.

  19. Iron-based 1D nanostructures by electrospinning process.

    Science.gov (United States)

    Eid, Cynthia; Brioude, Arnaud; Salles, Vincent; Plenet, Jean-Claude; Asmar, Roy; Monteil, Yves; Khoury, Randa; Khoury, Antonio; Miele, Philippe

    2010-03-26

    Iron-based 1D nanostructures have been successfully prepared using an electrospinning technique and varying the pyrolysis atmospheres. Hematite (Fe(2)O(3)) nanotubes and polycrystalline Fe(3)C nanofibers were obtained by simple air or mixed gas (H(2), Ar) annealing treatments. Using the air annealing treatment, a high control of the morphology as well as of the wall thickness of the nanotubes was demonstrated with a direct influence of the starting polymer concentration. When mixed gases (H(2) and Ar) were used for the annealing treatments, for the first time polycrystalline Fe(3)C nanofibers composed of carbon graphitic planes were obtained, ensuring Fe(3)C nanoparticle stability and nanofiber cohesion. The morphology and structural properties of all these iron-based 1D nanostructures were fully characterized by SEM, TEM, XRD and Raman spectroscopy.

  20. Phase diagram of a bulk 1d lattice Coulomb gas

    Science.gov (United States)

    Démery, V.; Monsarrat, R.; Dean, D. S.; Podgornik, R.

    2016-01-01

    The exact solution, via transfer matrix, of the simple one-dimensional lattice Coulomb gas (1d LCG) model can reproduce peculiar features of ionic liquid capacitors, such as overscreening, layering, and camel- and bell-shaped capacitance curves. Using the same transfer matrix method, we now compute the bulk properties of the 1d LCG in the constant voltage ensemble. We unveil a phase diagram with rich structure exhibiting low-density disordered and high-density ordered phases, separated by a first-order phase transition at low temperature; the solid state at full packing can be ordered or not, depending on the temperature. This phase diagram, which is strikingly similar to its three-dimensional counterpart, also sheds light on the behaviour of the confined system.

  1. Ultrahigh-Q nanocavity with 1D photonic gap.

    Science.gov (United States)

    Notomi, M; Kuramochi, E; Taniyama, H

    2008-07-21

    Recently, various wavelength-sized cavities with theoretical Q values of approximately 10(8) have been reported, however, they all employ 2D or 3D photonic band gaps to realize strong light confinement. Here we numerically demonstrate that ultrahigh-Q (2.0x10(8)) and wavelength-sized (V(eff) approximately 1.4(lambda/n)3) cavities can be achieved by employing only 1D periodicity.

  2. Polaron in a quasi 1D cylindrical quantum wire

    Directory of Open Access Journals (Sweden)

    I.Nsangou

    2005-01-01

    Full Text Available Polaron states in a quasi 1D cylindrical quantum wire with a parabolic confinement potential are investigated applying the Feynman variational principle. The effect of the wire radius on the polaron ground state energy level, the mass and the Fröhlich electron-phonon-coupling constant are obtained for the case of a quasi 1D cylindrical quantum wire. The effect of anisotropy of the structure on the polaron ground state energy level and the mass are also investigated. It is observed that as the wire radius tends to zero, the polaron mass and energy diverge logarithmically. The polaron mass and energy differ from the canonical strong-coupling behavior by the Fröhlich electron-phonon coupling constant and the radius of the quasi 1D cylindrical quantum wire that are expressed through a logarithmic function. Moreover, it is observed that the polaron energy and mass for strong coupling for the case of the quasi 1D cylindrical quantum wire are greater than those for bulk crystals. It is also observed that the anisotropy of the structure considerably affects both the polaron ground state energy level and the mass. It is found that as the radius of the cylindrical wire reduces, the regimes of the weak and intermediate coupling polaron shorten while the region of the strong coupling polaron broadens and extends into those of the weak and intermediate ones. Analytic expressions for the polaron ground state energy level and mass are derived for the case of strong coupling polarons.

  3. Supported plasma-made 1D heterostructures: perspectives and applications

    Energy Technology Data Exchange (ETDEWEB)

    Borras, Ana; Macias-Montero, Manuel; Romero-Gomez, Pablo; Gonzalez-Elipe, Agustin R, E-mail: anaisabel.borras@icmse.csic.es [Materials Science Institute of Seville (CSIC-Universidad Sevilla), C/Americo Vespucio 49 41092, Sevilla (Spain)

    2011-05-04

    Plasma-related methods have been widely used in the fabrication of carbon nanotubes and nanofibres (NFs) and semiconducting inorganic nanowires (NWs). A natural progression of the research in the field of 1D nanostructures is the synthesis of multicomponent NWs and NFs. In this paper we review the state of the art of the fabrication by plasma methods of 1D heterostructures including applications and perspectives. Furthermore, recent developments on the use of metal seeds (Ag, Au, Pt) to obtain metal-oxide nanostructures are also extensively described. Results are shown for various metal substrates, either metal foils or supported nanoparticles/thin films of the metal where the effects of the size, surface coverage, percolation degree and thickness of the metal seeds have been systematically evaluated. The possibilities of the process are illustrated by the preparation of nanostructured films and supported NFs of different metal-oxides (Ag, Au and SiO{sub 2}, TiO{sub 2}, ZnO). Particularly, in the case of silver, the application of an oxygen plasma treatment prior to the deposition of the oxide was critical for efficiently controlling the growth of the 1D heterostructures. A phenomenological model is proposed to account for the thin-film nanostructuring and fibre formation by considering basic phenomena such as stress relaxation, inhomogeneities in the plasma sheath electrical field and the local disturbance of the oxide growth.

  4. Enhancing Solar Cell Efficiencies through 1-D Nanostructures

    Directory of Open Access Journals (Sweden)

    Yu Kehan

    2008-01-01

    Full Text Available Abstract The current global energy problem can be attributed to insufficient fossil fuel supplies and excessive greenhouse gas emissions resulting from increasing fossil fuel consumption. The huge demand for clean energy potentially can be met by solar-to-electricity conversions. The large-scale use of solar energy is not occurring due to the high cost and inadequate efficiencies of existing solar cells. Nanostructured materials have offered new opportunities to design more efficient solar cells, particularly one-dimensional (1-D nanomaterials for enhancing solar cell efficiencies. These 1-D nanostructures, including nanotubes, nanowires, and nanorods, offer significant opportunities to improve efficiencies of solar cells by facilitating photon absorption, electron transport, and electron collection; however, tremendous challenges must be conquered before the large-scale commercialization of such cells. This review specifically focuses on the use of 1-D nanostructures for enhancing solar cell efficiencies. Other nanostructured solar cells or solar cells based on bulk materials are not covered in this review. Major topics addressed include dye-sensitized solar cells, quantum-dot-sensitized solar cells, and p-n junction solar cells.

  5. The stability of 1-D soliton in transverse direction

    Science.gov (United States)

    Verma, Deepa; Bera, Ratan Kumar; Das, Amita; Kaw, Predhiman

    2016-12-01

    The complete characterization of the exact 1-D solitary wave solutions (both stationary and propagating) for light plasma coupled system have been studied extensively in the parameter space of light frequency and the group speed [Poornakala et al., Phys. Plasmas 9(5), 1820 (2002)]. It has been shown in 1-D that solutions with single light wave peak and paired structures are stable and hence long lived. However, solutions having multiple peaks of light wave are unstable due to Raman scattering instability [Saxena et al., Phys. Plasmas 14, 072307 (2007)]. Here, we have shown with the help of 2-D fluid simulation that single peak and paired solutions too get destabilized by the transverse filamentation instability. The numerical growth rates obtained from simulations is seen to compare well with the analytical values. It is also shown that multiple peaks solitons first undergo the regular 1-D forward Raman scattering instability. Subsequently, they undergo a distinct second phase of destabilization through transverse filamentation instability. This is evident from the structure as well as the plot of the perturbed energy which shows a second phase of growth after saturating initially. The growth rate of the filamentation instability being comparatively slower than the forward Raman instability this phase comes quite late and is clearly distinguishable.

  6. Development of 1D Liner Compression Code for IDL

    Science.gov (United States)

    Shimazu, Akihisa; Slough, John; Pancotti, Anthony

    2015-11-01

    A 1D liner compression code is developed to model liner implosion dynamics in the Inductively Driven Liner Experiment (IDL) where FRC plasmoid is compressed via inductively-driven metal liners. The driver circuit, magnetic field, joule heating, and liner dynamics calculations are performed at each time step in sequence to couple these effects in the code. To obtain more realistic magnetic field results for a given drive coil geometry, 2D and 3D effects are incorporated into the 1D field calculation through use of correction factor table lookup approach. Commercial low-frequency electromagnetic fields solver, ANSYS Maxwell 3D, is used to solve the magnetic field profile for static liner condition at various liner radius in order to derive correction factors for the 1D field calculation in the code. The liner dynamics results from the code is verified to be in good agreement with the results from commercial explicit dynamics solver, ANSYS Explicit Dynamics, and previous liner experiment. The developed code is used to optimize the capacitor bank and driver coil design for better energy transfer and coupling. FRC gain calculations are also performed using the liner compression data from the code for the conceptual design of the reactor sized system for fusion energy gains.

  7. Homogenization of 1D and 2D magnetoelastic lattices

    Directory of Open Access Journals (Sweden)

    Schaeffer Marshall

    2015-01-01

    Full Text Available This paper investigates the equivalent in-plane mechanical properties of one dimensional (1D and two dimensional (2D, periodic magneto-elastic lattices. A lumped parameter model describes the lattices using magnetic dipole moments in combination with axial and torsional springs. The homogenization procedure is applied to systems linearized about stable configurations, which are identified by minimizing potential energy. Simple algebraic expressions are derived for the properties of 1D structures. Results for 1D lattices show that a variety of stiffness changes are possible through reconfiguration, and that magnetization can either stiffen or soften a structure. Results for 2D hexagonal and re-entrant lattices show that both reconfigurations and magnetization have drastic effects on the mechanical properties of lattice structures. Lattices can be stiffened or softened and the Poisson’s ratio can be tuned. Furthermore for certain hexagonal lattices the sign of Poisson’s ratio can change by varying the lattice magnetization. In some cases presented, analytical and numerically estimated equivalent properties are validated through numerical simulations that also illustrate the unique characteristics of the investigated configurations.

  8. Effective MIMO Model Zero-Forcing Decoding for Multi-group Space-Time Coding in HF Communications%短波通信多组空时编码中等效MIMO模型ZF解码

    Institute of Scientific and Technical Information of China (English)

    康瑞琪; 葛利嘉; 张振宇

    2016-01-01

    面向短波通信提出了多组空时编码( MGSTC )的一种等效多输入多输出( MIMO )模型迫零( ZF)解码算法。该算法以降低运算复杂度为目的,将原多时隙MIMO系统拆分为多个多时隙单输入多输出( SIMO)系统并分别等效为多个新的单时隙MIMO系统模型,通过各自左乘等效信道矩阵的共轭转置后进行最大比合并( MRC)以及ZF解码获得发送信号估计值,避免了球形解码( SD)中对高阶矩阵的QR分解。仿真结果表明,与虚拟MIMO模型SD解码算法相比,等效MIMO模型ZF解码算法在误码率( BER)性能1 dB损耗的情况下,运算量降低一个数量级以上。%This paper proposes an effective multiple-input multiple-output( MIMO) model zero-forcing( ZF) decoding algorithm for multi-group space-time coding( MGSTC) in high frequency( HF) communications. To reduce the computation complexity,the algorithm divides the original multiple-time-slot MIMO system into some multiple time slot single-input multiple-output( SIMO) systems each of which is equivalent to new sin-gle-time-slot MIMO system model. After left multiplying transpose of effective channel matrix separately, maximal ratio combine( MRC) and ZF decoding are performed to obtain signal estimation,thus avoiding high-order matrix QR decomposition in sphere decoding(SD). The simulation results show that compared with virtual MIMO model SD decoding algorithm,the effective MIMO model ZF decoding has lower than one order of magnitude in computation complexity with 1 dB loss in bit error rate( BER) performance.

  9. Molecular characterization of zebrafish Oatp1d1 (Slco1d1), a novel organic anion-transporting polypeptide.

    Science.gov (United States)

    Popovic, Marta; Zaja, Roko; Fent, Karl; Smital, Tvrtko

    2013-11-22

    The organic anion-transporting polypeptide (OATP/Oatp) superfamily includes a group of polyspecific transporters that mediate transport of large amphipathic, mostly anionic molecules across cell membranes of eukaryotes. OATPs/Oatps are involved in the disposition and elimination of numerous physiological and foreign compounds. However, in non-mammalian species, the functional properties of Oatps remain unknown. We aimed to elucidate the role of Oatp1d1 in zebrafish to gain insights into the functional and structural evolution of the OATP1/Oatp1 superfamily. We show that diversification of the OATP1/Oatp1 family occurs after the emergence of jawed fish and that the OATP1A/Oatp1a and OATP1B/Oatp1b subfamilies appeared at the root of tetrapods. The Oatp1d subfamily emerged in teleosts and is absent in tetrapods. The zebrafish Oatp1d1 is similar to mammalian OATP1A/Oatp1a and OATP1B/Oatp1b members, with the main physiological role in transport and balance of steroid hormones. Oatp1d1 activity is dependent upon pH gradient, which could indicate bicarbonate exchange as a mode of transport. Our analysis of evolutionary conservation and structural properties revealed that (i) His-79 in intracellular loop 3 is conserved within OATP1/Oatp1 family and is crucial for the transport activity; (ii) N-glycosylation impacts membrane targeting and is conserved within the OATP1/Oatp1 family with Asn-122, Asn-133, Asn-499, and Asn-512 residues involved; (iii) the evolutionarily conserved cholesterol recognition interaction amino acid consensus motif is important for membrane localization; and (iv) Oatp1d1 is present in dimeric and possibly oligomeric form in the cell membrane. In conclusion, we describe the first detailed characterization of a new Oatp transporter in zebrafish, offering important insights into the functional evolution of the OATP1/Oatp1 family and the physiological role of Oatp1d1.

  10. Tensor network simulation of QED on infinite lattices: Learning from (1 +1 ) d , and prospects for (2 +1 ) d

    Science.gov (United States)

    Zapp, Kai; Orús, Román

    2017-06-01

    The simulation of lattice gauge theories with tensor network (TN) methods is becoming increasingly fruitful. The vision is that such methods will, eventually, be used to simulate theories in (3 +1 ) dimensions in regimes difficult for other methods. So far, however, TN methods have mostly simulated lattice gauge theories in (1 +1 ) dimensions. The aim of this paper is to explore the simulation of quantum electrodynamics (QED) on infinite lattices with TNs, i.e., fermionic matter fields coupled to a U (1 ) gauge field, directly in the thermodynamic limit. With this idea in mind we first consider a gauge-invariant infinite density matrix renormalization group simulation of the Schwinger model—i.e., QED in (1 +1 ) d . After giving a precise description of the numerical method, we benchmark our simulations by computing the subtracted chiral condensate in the continuum, in good agreement with other approaches. Our simulations of the Schwinger model allow us to build intuition about how a simulation should proceed in (2 +1 ) dimensions. Based on this, we propose a variational ansatz using infinite projected entangled pair states (PEPS) to describe the ground state of (2 +1 ) d QED. The ansatz includes U (1 ) gauge symmetry at the level of the tensors, as well as fermionic (matter) and bosonic (gauge) degrees of freedom both at the physical and virtual levels. We argue that all the necessary ingredients for the simulation of (2 +1 ) d QED are, a priori, already in place, paving the way for future upcoming results.

  11. BGK electron solitary waves: 1D and 3D

    Directory of Open Access Journals (Sweden)

    L.-J. Chen

    2002-01-01

    Full Text Available This paper presents new results for 1D BGK electron solitary wave (phase-space electron hole solutions and, based on the new results, extends the solutions to include the 3D electrical interaction (E ~ 1/r 2 of charged particles. Our approach for extending to 3D is to solve the nonlinear 3D Poisson and 1D Vlasov equations based on a key feature of 1D electron hole (EH solutions; the positive core of an EH is screened by electrons trapped inside the potential energy trough. This feature has not been considered in previous studies. We illustrate this key feature using an analytical model and argue that the feature is independent of any specific model. We then construct azimuthally symmetric EH solutions under conditions where electrons are highly field-aligned and ions form a uniform background along the magnetic field. Our results indicate that, for a single humped electric potential, the parallel cut of the perpendicular component of the electric field (E⊥ is unipolar and that of the parallel component (E|| bipolar, reproducing the multi-dimensional features of the solitary waves observed by the FAST satellite. Our analytical solutions presented in this article capture the 3D electric interaction and the observed features of (E|| and E⊥. The solutions predict a dependence of the parallel width-amplitude relation on the perpendicular size of EHs. This dependence can be used in conjunction with experimental data to yield an estimate of the typical perpendicular size of observed EHs; this provides important information on the perpendicular span of the source region as well as on how much electrostatic energy is transported by the solitary waves.

  12. Automatic simulation of 1D and 2D chaotic oscillators

    Energy Technology Data Exchange (ETDEWEB)

    Tlelo-Cuautle, E; Munoz-Pacheco, J-M [Department of Electronics, INAOE, Luis Enrique Erro No. 1, Tonantzintla, Puebla, 72840 MEXICO (Mexico)], E-mail: e.tlelo@ieee.org, E-mail: mpacheco@inaoep.mx

    2008-02-15

    A new method is introduced for automatic simulation of three kinds of chaotic oscillators: Chua's circuit, generalized Chua's circuit and chaotic oscillator implemented with saturated functions. The former generates the double-scroll, and the others 1D n-scroll attractors. The third chaotic oscillator is modified to generate 2D n-scrolls attractors. The oscillators are modelled by applying state variables and piecewise-linear approximation. Basically, the method computes the eigenvalues of the oscillators to begin time simulation and to make control of step-size automatically.

  13. Main: 1D6R [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D6R 大豆 Soybean Glycine max (L.) Merrill Bowman-Birk Type Proteinase Inhibitor Precursor Glycine Ma...x Molecule: Trypsinogen; Chain: A; Fragment: Cationic Precursor; Molecule: Bowman-Birk Prote...inase Inhibitor Precursor; Chain: I Hydrolase 3.4.21.4 (Bowman-Birk Proteinase Inhibitor Precursor) J.Koepke...r Crystal Structure Of Cancer Chemopreventive Bowman-Birk Inhibitor In Ternary Complex With Bovine Trypsin A... 477 2000 Protease Inhibitor, Serine Protease, Bowman-Birk Inhibitor SWS:TRY1_BOV

  14. Nonlocal order parameters for the 1D Hubbard model.

    Science.gov (United States)

    Montorsi, Arianna; Roncaglia, Marco

    2012-12-07

    We characterize the Mott-insulator and Luther-Emery phases of the 1D Hubbard model through correlators that measure the parity of spin and charge strings along the chain. These nonlocal quantities order in the corresponding gapped phases and vanish at the critical point U(c)=0, thus configuring as hidden order parameters. The Mott insulator consists of bound doublon-holon pairs, which in the Luther-Emery phase turn into electron pairs with opposite spins, both unbinding at U(c). The behavior of the parity correlators is captured by an effective free spinless fermion model.

  15. 1D superconductivity in porous Nb ultrathin films

    Energy Technology Data Exchange (ETDEWEB)

    Trezza, M., E-mail: trezza@sa.infn.it [CNR-SPIN Salerno and Dipartimento di Fisica, ' E. R. Caianiello' , Universita degli Studi di Salerno, Via Ponte don Melillo, Fisciano I-84084 (Italy); Prischepa, S.L. [State University of Informatics and RadioElectronics, P. Brovka Street 6, Minsk 220013 (Belarus); Cirillo, C.; Attanasio, C. [CNR-SPIN Salerno and Dipartimento di Fisica, ' E. R. Caianiello' , Universita degli Studi di Salerno, Via Ponte don Melillo, Fisciano I-84084 (Italy)

    2012-09-15

    We report on the measurements of the transport properties of superconducting Nb ultrathin bridges grown by UHV magnetron sputtering on porous Si substrates. The films are about 10 nm thick and inherit from the substrate a structure made of holes with diameter of 10 nm and interpore spacing in the range 20-40 nm. Due to their reduced dimensions, they are sensitive to thermal fluctuations typical of 1D superconductors and exhibit a nonzero resistance below the superconducting transition temperature, T{sub c}. Clear hysteresis and finite jumps in the I-V curves are also observed.

  16. ESO science data product standard for 1D spectral products

    Science.gov (United States)

    Micol, Alberto; Arnaboldi, Magda; Delmotte, Nausicaa A. R.; Mascetti, Laura; Retzlaff, Joerg

    2016-07-01

    The ESO Phase 3 process allows the upload, validation, storage, and publication of reduced data through the ESO Science Archive Facility. Since its introduction, 2 million data products have been archived and published; 80% of them are one-dimensional extracted and calibrated spectra. Central to Phase3 is the ESO science data product standard that defines metadata and data format of any product. This contribution describes the ESO data standard for 1d-spectra, its adoption by the reduction pipelines of selected instrument modes for in-house generation of reduced spectra, the enhanced archive legacy value. Archive usage statistics are provided.

  17. Restrained Dark $U(1)_d$ at Low Energies

    CERN Document Server

    Correia, F C

    2016-01-01

    We investigate a spontaneously broken $U(1)_d$ gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, $\\phi$, and a dark gauge boson, $V$, can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Secondly, by assuming that $V$ must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low energy constraints coming from $ K \\to \\mu X$, electron $(g-2)_e$, $K \\to \\mu \

  18. Breakdown of 1D water wires inside Charged Carbon Nanotubes

    CERN Document Server

    Pant, Shashank

    2016-01-01

    Using Molecular Dynamics approach we investigated the structure, dynamics of water confined inside pristine and charged 6,6 carbon nanotubes (CNTs). This study reports the breakdown of 1D water wires and the emergence of triangular faced water on incorporating charges in 6,6 CNTs. Incorporation of charges results in high potential barriers to the flipping of water molecules due to the formation of a large number of hydrogen bonds. The PMF analyses show the presence of ~2 kcal/mol barrier for the movement of water inside pristine CNT and almost negligible barrier in charged CNTs.

  19. Modeling atrazine transport in soil columns with HYDRUS-1D

    Directory of Open Access Journals (Sweden)

    John Leju CELESTINO LADU

    2011-09-01

    Full Text Available Both physical and chemical processes affect the fate and transport of herbicides. It is useful to simulate these processes with computer programs to predict solute movement. Simulations were run with HYDRUS-1D to identify the sorption and degradation parameters of atrazine through calibration from the breakthrough curves (BTCs. Data from undisturbed and disturbed soil column experiments were compared and analyzed using the dual-porosity model. The study results show that the values of dispersivity are slightly lower in disturbed columns, suggesting that the more heterogeneous the structure is, the higher the dispersivity. Sorption parameters also show slight variability, which is attributed to the differences in soil properties, experimental conditions and methods, or other ecological factors. For both of the columns, the degradation rates were similar. Potassium bromide was used as a conservative non-reactive tracer to characterize the water movement in columns. Atrazine BTCs exhibited significant tailing and asymmetry, indicating non-equilibrium sorption during solute transport. The dual-porosity model was verified to best fit the BTCs of the column experiments. Greater or lesser concentration of atrazine spreading to the bottom of the columns indicated risk of groundwater contamination. Overall, HYDRUS-1D successfully simulated the atrazine transport in soil columns.

  20. Study of 1D Strange Charmed Meson Family Using HQET

    Directory of Open Access Journals (Sweden)

    Pallavi Gupta

    2016-01-01

    Full Text Available Recently LHCb predicted spin 1 and spin 3 states Ds1⁎(2860 and Ds3⁎(2860 which are studied through their strong decays and are assigned to fit the 13D1 and 13D3 states in the charm spectroscopy. In this paper, using the heavy quark effective theory, we state that assigning Ds1⁎(2860 as the mixing of 13D1-23S1 states is rather a better justification to its observed experimental values than a pure state. We study its decay modes variation with hadronic coupling constant gxh and the mixing angle θ. We appoint spin 3 state Ds3⁎(2860 as the missing 1D  3-JP state and also study its decay channel behavior with coupling constant gyh. To appreciate the above results, we check the variation of decay modes for their spin partners states, that is, 1D2 and 1D2′, with their masses and strong coupling constant, that is, gxh and gyh. Our calculation using HQET approach gives mixing angle of the 13D1-23S1 state for Ds1⁎(2860 to lie in the range (-1.6 radians ≤θ≤-1.2 radians. Our calculation for coupling constant values gives gxh to lie within value range of 0.17–0.20 and gyh to be 0.40. We expect from experiments to observe this mixing angle to verify our results.

  1. A Framework for Low-Communication 1-D FFT

    Directory of Open Access Journals (Sweden)

    Ping Tak Peter Tang

    2013-01-01

    Full Text Available In high-performance computing on distributed-memory systems, communication often represents a significant part of the overall execution time. The relative cost of communication will certainly continue to rise as compute-density growth follows the current technology and industry trends. Design of lower-communication alternatives to fundamental computational algorithms has become an important field of research. For distributed 1-D FFT, communication cost has hitherto remained high as all industry-standard implementations perform three all-to-all internode data exchanges (also called global transposes. These communication steps indeed dominate execution time. In this paper, we present a mathematical framework from which many single-all-to-all and easy-to-implement 1-D FFT algorithms can be derived. For large-scale problems, our implementation can be twice as fast as leading FFT libraries on state-of-the-art computer clusters. Moreover, our framework allows tradeoff between accuracy and performance, further boosting performance if reduced accuracy is acceptable.

  2. Tunability and Sensing Properties of Plasmonic/1D Photonic Crystal.

    Science.gov (United States)

    Shaban, Mohamed; Ahmed, Ashour M; Abdel-Rahman, Ehab; Hamdy, Hany

    2017-02-08

    Gold/one-dimensional photonic crystal (Au/1D-PC) is fabricated and applied for sensitive sensing of glucose and different chemical molecules of various refractive indices. The Au layer thickness is optimized to produce surface plasmon resonance (SPR) at the right edge of the photonic band gap (PBG). As the Au deposition time increased to 60 sec, the PBG width is increased from 46 to 86 nm in correlation with the behavior of the SPR. The selectivity of the optimized Au/1D-PC sensor is tested upon the increase of the environmental refractive index of the detected molecules. The resonance wavelength and the PBG edges increased linearly and the transmitted intensity increased nonlinearly as the environment refractive index increased. The SPR splits to two modes during the detection of chloroform molecules based on the localized capacitive coupling of Au particles. Also, this structure shows high sensitivity at different glucose concentrations. The PBG and SPR are shifted to longer wavelengths, and PBG width is decreased linearly with a rate of 16.04 Å/(μg/mm(3)) as the glucose concentration increased. The proposed structure merits; operation at room temperature, compact size, and easy fabrication; suggest that the proposed structure can be efficiently used for the biomedical and chemical application.

  3. Entanglement and Nonlocality in Infinite 1D Systems

    Science.gov (United States)

    Wang, Zizhu; Singh, Sukhwinder; Navascués, Miguel

    2017-06-01

    We consider the problem of detecting entanglement and nonlocality in one-dimensional (1D) infinite, translation-invariant (TI) systems when just near-neighbor information is available. This issue is deeper than one might think a priori, since, as we show, there exist instances of local separable states (classical boxes) which admit only entangled (nonclassical) TI extensions. We provide a simple characterization of the set of local states of multiseparable TI spin chains and construct a family of linear witnesses which can detect entanglement in infinite TI states from the nearest-neighbor reduced density matrix. Similarly, we prove that the set of classical TI boxes forms a polytope and devise a general procedure to generate all Bell inequalities which characterize it. Using an algorithm based on matrix product states, we show how some of them can be violated by distant parties conducting identical measurements on an infinite TI quantum state. All our results can be easily adapted to detect entanglement and nonlocality in large (finite, not TI) 1D condensed matter systems.

  4. Error analysis of subaperture processing in 1-D ultrasound arrays.

    Science.gov (United States)

    Zhao, Kang-Qiao; Bjåstad, Tore Gruner; Kristoffersen, Kjell

    2015-04-01

    To simplify the medical ultrasound system and reduce the cost, several techniques have been proposed to reduce the interconnections between the ultrasound probe and the back-end console. Among them, subaperture processing (SAP) is the most straightforward approach and is widely used in commercial products. This paper reviews the most important error sources of SAP, such as static focusing, delay quantization, linear delay profile, and coarse apodization, and the impacts introduced by these errors are shown. We propose to use main lobe coherence loss as a simple classification of the quality of the beam profile for a given design. This figure-ofmerit (FoM) is evaluated by simulations with a 1-D ultrasound subaperture array setup. The analytical expressions and the coherence loss can work as a quick guideline in subaperture design by equalizing the merit degradations from different error sources, as well as minimizing the average or maximum loss over ranges. For the evaluated 1-D array example, a good balance between errors and cost was achieved using a subaperture size of 5 elements, focus at 40 mm range, and a delay quantization step corresponding to a phase of π/4.

  5. Tunability and Sensing Properties of Plasmonic/1D Photonic Crystal

    Science.gov (United States)

    Shaban, Mohamed; Ahmed, Ashour M.; Abdel-Rahman, Ehab; Hamdy, Hany

    2017-01-01

    Gold/one-dimensional photonic crystal (Au/1D-PC) is fabricated and applied for sensitive sensing of glucose and different chemical molecules of various refractive indices. The Au layer thickness is optimized to produce surface plasmon resonance (SPR) at the right edge of the photonic band gap (PBG). As the Au deposition time increased to 60 sec, the PBG width is increased from 46 to 86 nm in correlation with the behavior of the SPR. The selectivity of the optimized Au/1D-PC sensor is tested upon the increase of the environmental refractive index of the detected molecules. The resonance wavelength and the PBG edges increased linearly and the transmitted intensity increased nonlinearly as the environment refractive index increased. The SPR splits to two modes during the detection of chloroform molecules based on the localized capacitive coupling of Au particles. Also, this structure shows high sensitivity at different glucose concentrations. The PBG and SPR are shifted to longer wavelengths, and PBG width is decreased linearly with a rate of 16.04 Å/(μg/mm3) as the glucose concentration increased. The proposed structure merits; operation at room temperature, compact size, and easy fabrication; suggest that the proposed structure can be efficiently used for the biomedical and chemical application. PMID:28176799

  6. Transformation of 1-D Chiral-chained Titanium Phosphate to 2-D Layer Structure Through a 1-D Zigzag Chain

    Institute of Scientific and Technical Information of China (English)

    CHEN Chao; YANG Yu-lin; LI Wei-sheng; LIU Yun-ling; YI Zhuo; GUO Yang-hong; PANG Wen-qin

    2005-01-01

    The transformation of titanium phosphate from 1-D chiral- chain(JTP-A) to 2-D layer(TP-J1) has been carefully investigated. Through a hydrolysis-condensation self-assembly pathway, the crystals of TP-J1 can be obtained from the JTP-A phase under hydrothermal conditions. An intermediate material with zigzag chain during the transformation was observed by XRD characterization. A hypothesis of the transformation mechanism is also described in this article. It is noteworthy that ethylenediamine plays an important role in the transformation.

  7. Employee critical psychological states as determinants of employee brand equity in banking: a multi-group analysis

    Directory of Open Access Journals (Sweden)

    Mohsin Altaf

    2017-09-01

    Full Text Available The objective of the study is to investigate the moderating role of affective sentiments of brand psychological ownership of an employee in the relationship among the cognitive sentiments of employee brand understanding and employee brand equity of conventional and Islamic banks. Survey method was adopted to collect data from respondents from conventional and Islamic banks. Data were collected from 279 employees from the banking sector using two-stage probability sampling. Disproportionate stratified random sampling and simple random sampling were employed to collect responses. To analyze the data, multi-group analysis was applied using PLS-SEM technique through SmartPLS 3.0. Results demonstrated that congruence between brand image and individuals has a moderating effect on the relationship between brand confidence and employee brand equity in conventional banking. Responsibility to maintain brand image has a moderating effect on the relationship between brand knowledge and employee brand equity in conventional banking. In case of Islamic banking, only congruence between brand image and individuals exhibited a moderating role on the relationship between brand knowledge and employee brand equity. The importance of brand understanding of employees and psychological ownership of a brand has been widely discussed in branding literature. However, only a few studies investigated the relationship between dimensions of employee brand understanding and the employee brand psychological ownership with employee brand equity. The cognitive and affective sentiments of both exogenous latent constructs, their relationships, and the interaction effect of cognitive and affective sentiments were seldom discussed in branding literature. This study covers the in-depth view and investigation of brand understanding of employ¬ees and the affective and cognitive sentiments of brand psychological ownership with em¬ployee behavior toward a brand. This study also

  8. Phenomenological predictions of 3+1d anisotropic hydrodynamics

    CERN Document Server

    Nopoush, Mohammad; Ryblewski, Radoslaw

    2016-01-01

    We make phenomenological predictions for particle spectra and elliptic flow in heavy-ion collisions using 3+1d anisotropic hydrodynamics (aHydro) including the effects of both shear and bulk viscosities. The dynamical equations necessary are derived by taking moments of the Boltzmann equation allowing for three distinct (diagonal) momentum-space anisotropy parameters. The formulation is based on relaxation-time approximation for the collisional kernel and a lattice-QCD-based equation of state. Evolving the system to late times, we calculate particle production using THERMINATOR 2, modified to account for an ellipsoidal distribution function. We obtain particle spectra for different particle species such as pions, kaons, and protons, and elliptic flow $v_2$ as a function of centrality, transverse momentum, and rapidity. In our model, we have four free parameters, i.e. freeze-out temperature, initial central energy density, initial momentum-space anisotropies, and shear viscosity to entropy density ratio. Using...

  9. Effective theory of Black Holes in the 1/D expansion

    CERN Document Server

    Emparan, Roberto; Suzuki, Ryotaku; Tanabe, Kentaro; Tanaka, Takahiro

    2015-01-01

    The gravitational field of a black hole is strongly localized near its horizon when the number of dimensions D is very large. In this limit, we can effectively replace the black hole with a surface in a background geometry (eg Minkowski or Anti-deSitter space). The Einstein equations determine the effective equations that this 'black hole surface' (or membrane) must satisfy. We obtain them up to next-to-leading order in 1/D for static black holes of the Einstein-(A)dS theory. To leading order, and also to next order in Minkowski backgrounds, the equations of the effective theory are the same as soap-film equations, possibly up to a redshift factor. In particular, the Schwarzschild black hole is recovered as a spherical soap bubble. Less trivially, we find solutions for 'black droplets', ie black holes localized at the boundary of AdS, and for non-uniform black strings.

  10. Effective theory of black holes in the 1/D expansion

    Science.gov (United States)

    Emparan, Roberto; Shiromizu, Tetsuya; Suzuki, Ryotaku; Tanabe, Kentaro; Tanaka, Takahiro

    2015-06-01

    The gravitational field of a black hole is strongly localized near its horizon when the number of dimensions D is very large. In this limit, we can effectively replace the black hole with a surface in a background geometry (e.g. Minkowski or Anti-deSitter space). The Einstein equations determine the effective equations that this `black hole surface' (or membrane) must satisfy. We obtain them up to next-to-leading order in 1/ D for static black holes of the Einstein-(A)dS theory. To leading order, and also to next order in Minkowski backgrounds, the equations of the effective theory are the same as soap-film equations, possibly up to a redshift factor. In particular, the Schwarzschild black hole is recovered as a spherical soap bubble. Less trivially, we find solutions for `black droplets', i.e. black holes localized at the boundary of AdS, and for non-uniform black strings.

  11. Identification of a T1D Susceptibility Gene

    Directory of Open Access Journals (Sweden)

    Grant Morahan

    2001-01-01

    Full Text Available It is not known what causes type 1 diabetes (T1D, which affects over 1 million people in the U.S. alone. Each year, 30,000 young people in the U.S. develop this disease and depend on insulin injections thereafter. Because of the huge cost to the individual, the family, and to society in increased health care costs, it is important to find what makes these people susceptible. The disease process itself is clear: the individual’s immune system — T lymphocytes in particular — attack and destroy the body’s insulin-producing cells. But how and why this autoimmune process starts or proceeds unregulated is still not known.

  12. Microlens Masses from 1-D Parallaxes and Heliocentric Proper Motions

    CERN Document Server

    Gould, Andrew

    2014-01-01

    One-dimensional (1-D) microlens parallaxes can be combined with heliocentric lens-source relative proper motion measurements to derive the lens mass and distance, as suggested by Ghosh et al. (2004). Here I present the first mathematical anlysis of this procedure, which I show can be represented as a quadratic equation. Hence, it is formally subject to a two-fold degeneracy. I show that this degeneracy can be broken in many cases using the relatively crude 2-D parallax information that is often available for microlensing events. I also develop an explicit formula for the region of parameter space where it is more difficult to break this degeneracy. Although no mass/distance measurements have yet been made using this technique, it is likely to become quite common over the next decade.

  13. 1D-transport properties of single superconducting lead nanowires

    DEFF Research Database (Denmark)

    Michotte, S.; Mátéfi-Tempfli, Stefan; Piraux, L.

    2003-01-01

    We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter of the nan......We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter...... of the nanowire is small enough to ensure a 1D superconducting regime in a wide temperature range below T. The non-zero resistance in the superconducting state and its variation caused by fluctuations of the superconducting order parameter were measured versus temperature, magnetic field, and applied DC current...

  14. 1-D array of perforated diode neutron detectors

    Energy Technology Data Exchange (ETDEWEB)

    McNeil, Walter J. [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States)], E-mail: wjm4444@ksu.edu; Bellinger, Steven L.; Unruh, Troy C.; Henderson, Chris M.; Ugorowski, Phil; Morris-Lee, Bryce [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States); Taylor, Russell D. [Electronics Design Laboratory, Kansas State University, Manhattan, KS 66506 (United States); McGregor, Douglas S. [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States)], E-mail: mcgregor@ksu.edu

    2009-06-01

    Performance of a 4 cm long 64-pixel perforated diode neutron detector array is compared with an identical array of thin-film coated diodes. The perforated neutron detector design has been adapted to a 1-D pixel array capable of 120 {mu}m spatial resolution and counting efficiency greater than 12%. Deep vertical trenches filled with {sup 6}LiF provide outstanding improvement in efficiency over thin-film coated diode designs limited to only 4.5%. This work marks the final step towards the construction of a much larger array consisting of 1024 pixels spanning 10 cm. The larger detector array will be constructed with a sub-array of 64-pixel sensors, and will be used for small-angle neutron scattering experiments at the Spallation Neutron Source of Oak Ridge National Laboratory.

  15. Coherent thermal conductance of 1-D photonic crystals

    Energy Technology Data Exchange (ETDEWEB)

    Tschikin, Maria [Institut für Physik, Carl von Ossietzky Universität, D-26111 Oldenburg (Germany); Ben-Abdallah, Philippe [Laboratoire Charles Fabry, UMR 8501, Institut d' Optique, CNRS, Université Paris-Sud, 2, Avenue Augustin Fresnel, RD128, 91127 Palaiseau Cedex (France); Biehs, Svend-Age, E-mail: biehs@theorie.physik.uni-oldenburg.de [Institut für Physik, Carl von Ossietzky Universität, D-26111 Oldenburg (Germany)

    2012-10-01

    We present an exact calculation of coherent thermal conductance in 1-D multilayer photonic crystals using the S-matrix method. In particular, we study the thermal conductance in a bilayer structure of Si/vacuum or Al{sub 2}O{sub 3}/vacuum slabs by means of the exact radiative heat flux expression. Based on the results obtained for the Al{sub 2}O{sub 3}/vacuum structure we show by comparison with previous works that the material losses and (localized) surface modes supported by the inner layers play a fundamental role and cannot be omitted in the definition of thermal conductance. Our results could have significant implications in the conception of efficient thermal barriers.

  16. Data of evolutionary structure change: 1D6QA-2G4QA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D6QA-2G4QA 1D6Q 2G4Q A A KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYN...GRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTD-GSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQA...bID> A 2G4QA NRNTD-GS...> 1D6Q A 1D6QA

  17. Anisotropies in the Neutrino Fluxes and Heating Profiles in Two-dimensional, Time-dependent, Multi-group Radiation Hydrodynamics Simulations of Rotating Core-Collapse Supernovae

    CERN Document Server

    Walder, R; Ott, C D; Livne, E; Jarrah, M

    2004-01-01

    Using the 2D multi-group, flux-limited diffusion version of the code VULCAN/2D, that also incorporates rotation, we have calculated the collapse, bounce, shock formation, and early post-bounce evolutionary phases of a core-collapse supernova for a variety of initial rotation rates. This is the first series of such multi-group calculations undertaken in supernova theory with fully multi-D tools. We find that though rotation generates pole-to-equator angular anisotropies in the neutrino radiation fields, the magnitude of the asymmetries is not as large as previously estimated. Moreover, we find that the radiation field is always more spherically symmetric than the matter distribution, with its plumes and convective eddies. We present the dependence of the angular anisotropy of the neutrino fields on neutrino species, neutrino energy, and initial rotation rate. Only for our most rapidly rotating model do we start to see qualitatively different hydrodynamics, but for the lower rates consistent with the pre-collap...

  18. Advanced Neutron Source Cross Section Libraries (ANSL-V): ENDF/B-V based multigroup cross-section libraries for advanced neutron source (ANS) reactor studies

    Energy Technology Data Exchange (ETDEWEB)

    Ford, W.E. III; Arwood, J.W.; Greene, N.M.; Moses, D.L.; Petrie, L.M.; Primm, R.T. III; Slater, C.O.; Westfall, R.M.; Wright, R.Q.

    1990-09-01

    Pseudo-problem-independent, multigroup cross-section libraries were generated to support Advanced Neutron Source (ANS) Reactor design studies. The ANS is a proposed reactor which would be fueled with highly enriched uranium and cooled with heavy water. The libraries, designated ANSL-V (Advanced Neutron Source Cross Section Libraries based on ENDF/B-V), are data bases in AMPX master format for subsequent generation of problem-dependent cross-sections for use with codes such as KENO, ANISN, XSDRNPM, VENTURE, DOT, DORT, TORT, and MORSE. Included in ANSL-V are 99-group and 39-group neutron, 39-neutron-group 44-gamma-ray-group secondary gamma-ray production (SGRP), 44-group gamma-ray interaction (GRI), and coupled, 39-neutron group 44-gamma-ray group (CNG) cross-section libraries. The neutron and SGRP libraries were generated primarily from ENDF/B-V data; the GRI library was generated from DLC-99/HUGO data, which is recognized as the ENDF/B-V photon interaction data. Modules from the AMPX and NJOY systems were used to process the multigroup data. Validity of selected data from the fine- and broad-group neutron libraries was satisfactorily tested in performance parameter calculations.

  19. Assembling carbon fiber-graphene-carbon fiber hetero-structures into 1D-2D-1D junction fillers and patterned structures for improved microwave absorption

    Science.gov (United States)

    Li, Huimin; Liu, Lin; Li, Hai-Bing; Song, Wei-Li; Bian, Xing-Ming; Zhao, Quan-Liang; Chen, Mingji; Yuan, Xujin; Chen, Haosen; Fang, Daining

    2017-04-01

    Since carbon-based structures of various dimensions, including one-dimensional (1D) carbon nanotubes, two-dimensional (2D) graphene and three-dimensional (3D) carbon foams, have attracted significant attention as microwave absorption fillers, we present an exceptional hetero-junction filler with a 1D-2D-1D feature, achieved by manipulating 2D graphene into 1D carbon fibers in the fiber-extruding process under the electric field. The as-fabricated 1D-2D-1D structural fillers exhibited much-improved dielectric properties and promoted microwave absorption performance in their composites, which is linked to the establishment of enhanced polarization capability, the generation of increased electric loss pathway and the creation of more favorable electromagnetic energy consumption conditions. The results suggest that employing 2D graphene in the 1D-2D-1D nanostructures played the critical role in tuning the electromagnetic response ability, because of its intrinsic electric advantages and dimensional features. To broaden the effective absorption bandwidth, periodic pattern-absorbing structures were designed, which showed combined absorption advantages for various thicknesses. Our strategy for fabricating 1D-2D-1D structural fillers illuminates a universal approach for manipulating dimensions and structures in the nanotechnology.

  20. Dynamic decoupling in the presence of 1D random walk

    Science.gov (United States)

    Chakrabarti, Arnab; Chakraborty, Ipsita; Bhattacharyya, Rangeet

    2016-05-01

    In the recent past, many dynamic decoupling sequences have been proposed for the suppression of decoherence of spins connected to thermal baths of various natures. Dynamic decoupling schemes for suppressing decoherence due to Gaussian diffusion have also been developed. In this work, we study the relative performances of dynamic decoupling schemes in the presence of a non-stationary Gaussian noise such as a 1D random walk. Frequency domain analysis is not suitable to determine the performances of various dynamic decoupling schemes in suppressing decoherence due to such a process. Thus, in this work, we follow a time domain calculation to arrive at the following conclusions: in the presence of such a noise, we show that (i) the traditional Carr-Purcell-Meiboom-Gill (CPMG) sequence outperforms Uhrig’s dynamic decoupling scheme, (ii) CPMG remains the optimal sequence for suppression of decoherence due to random walk in the presence of an external field gradient. Later, the theoretical predictions are experimentally verified by using nuclear magnetic resonance spectroscopy on spin 1/2 particles diffusing in a liquid medium.

  1. 1-D Modeling of Massive Particle Injection (MPI) in Tokamaks

    Science.gov (United States)

    Wu, W.; Parks, P. B.; Izzo, V. A.

    2008-11-01

    A 1-D Fast Current Quench (FCQ) model is developed to study current evolution and runaway electron suppression under massive density increase. The model consists of coupled toroidal electric field and energy equations, and it is solved numerically for DIII-D and ITER operating conditions. Simulation results suggest that fast shutdown by D2 liquid jet/pellet injection is in principle achievable for the desired plasma cooling time (˜15 ms for DIII-D and ˜50 ms for ITER) under ˜150x or higher densification. The current density and pressure profile are practically unaltered during the initial phase of jet propagation when dilution cooling dominates. With subsequent radiation cooling, the densified discharge enters the strongly collisional regime where Pfirsch-Schluter thermal diffusion can inhibit current contraction on the magnetic axis. Often the 1/1 kink instability, addressed by Kadomtsev's magnetic reconnection model, can be prevented. Our results are compared with NIMROD simulations in which the plasma is suddenly densified by ˜100x and experiences instantaneous dilution cooling, allowing for use of actual (lower) Lundquist numbers.

  2. An implicit solver for 1D arterial network models.

    Science.gov (United States)

    Carson, Jason; Van Loon, Raoul

    2017-07-01

    In this study, the 1D blood flow equations are solved using a newly proposed enhanced trapezoidal rule method (ETM), which is an extension to the simplified trapezoidal rule method. At vessel junctions, the conservation of mass and conservation of total pressure are held as system constraints using Lagrange multipliers that can be physically interpreted as external flow rates. The ETM scheme is compared with published arterial network benchmark problems and a dam break problem. Strengths of the ETM scheme include being simple to implement, intuitive connection to lumped parameter models, and no restrictive stability criteria such as the Courant-Friedrichs-Lewy (CFL) number. The ETM scheme does not require the use of characteristics at vessel junctions, or for inlet and outlet boundary conditions. The ETM forms an implicit system of equations, which requires only one global solve per time step for pressure, followed by flow rate update on the elemental system of equations; thus, no iterations are required per time step. Consistent results are found for all benchmark cases, and for a 56-vessel arterial network problem, it gives very satisfactory solutions at a spatial and time discretization that results in a maximum CFL of 3, taking 4.44 seconds per cardiac cycle. By increasing the time step and element size to produce a maximum CFL number of 15, the method takes only 0.39 second per cardiac cycle with only a small compromise on accuracy. Copyright © 2016 John Wiley & Sons, Ltd.

  3. 1-D Numerical Analysis of RBCC Engine Performance

    Science.gov (United States)

    Han, Samuel S.

    1998-01-01

    An RBCC engine combines air breathing and rocket engines into a single engine to increase the specific impulse over an entire flight trajectory. Considerable research pertaining to RBCC propulsion was performed during the 1960's and these engines were revisited recently as a candidate propulsion system for either a single-stage-to-orbit (SSTO) or two-stage-to-orbit (TSTO) launch vehicle. There are a variety of RBCC configurations that had been evaluated and new designs are currently under development. However, the basic configuration of all RBCC systems is built around the ejector scramjet engine originally developed for the hypersonic airplane. In this configuration, a rocket engine plays as an ejector in the air-augmented initial acceleration mode, as a fuel injector in scramjet mode and the rocket in all rocket mode for orbital insertion. Computational fluid dynamics (CFD) is a useful tool for the analysis of complex transport processes in various components in RBCC propulsion systems. The objective of the present research was to develop a transient 1-D numerical model that could be used to predict flow behavior throughout a generic RBCC engine following a flight path.

  4. Towards a consistent picture for quasi-1D organic superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Doiron-Leyraud, N. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Auban-Senzier, P. [Laboratoire de Physique des Solides, UMR 8502, CNRS - Univ. Paris-Sud, Bat. 510, 91405 Orsay (France); Rene de Cotret, S. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Bechgaard, K. [Department of Chemistry, H.C. Orsted Institute, Copenhagen (Denmark); Jerome, D., E-mail: jerome@lps.u-psud.f [Laboratoire de Physique des Solides, UMR 8502, CNRS - Univ. Paris-Sud, Bat. 510, 91405 Orsay (France); Canadian Institute for Advanced Research, Toronto, Ontario, M5G 1Z8 (Canada); Taillefer, L. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Canadian Institute for Advanced Research, Toronto, Ontario, M5G 1Z8 (Canada)

    2010-06-01

    The electrical resistivity of the quasi-1D organic superconductor (TMTSF){sub 2}PF{sub 6} was recently measured at low temperature from the critical pressure needed to suppress the spin-density-wave state up to a pressure where superconductivity has almost disappeared. This data revealed a direct correlation between the onset of superconductivity at T{sub c} and the strength of a non-Fermi-liquid linear term in the normal-state resistivity, going as {rho}(T)={rho}{sub 0}+AT+BT{sup 2} at low temperature, so that A{yields}0 as T{sub c{yields}}0. Here we show that the contribution of low-frequency antiferromagnetic fluctuations to the spin-lattice relaxation rate is also correlated with this non-Fermi-liquid term AT in the resistivity. These correlations suggest that anomalous scattering and pairing have a common origin, both rooted in the low-frequency antiferromagnetic fluctuations measured by NMR. A similar situation may also prevail in the recently discovered iron-pnictide superconductors.

  5. Sulfur chemistry: 1D modeling in massive dense cores

    CERN Document Server

    Wakelam, V; Herpin, F

    2011-01-01

    The main sulfur-bearing molecules OCS, H2S, SO, SO2, and CS have been observed in four high mass dense cores (W43-MM1, IRAS 18264, IRAS 05358, and IRAS 18162). Our goal is to put some constraints on the relative evolutionary stage of these sources by comparing these observations with time-dependent chemical modeling. We used the chemical model Nahoon, which computes the gas-phase chemistry and gas-grain interactions of depletion and evaporation. Mixing of the different chemical compositions shells in a 1D structure through protostellar envelope has been included since observed lines suggest nonthermal supersonic broadening. Observed radial profiles of the temperature and density are used to compute the chemistry as a function of time. With our model, we underproduce CS by several orders of magnitude compared to the other S-bearing molecules, which seems to contradict observations, although some uncertainties in the CS abundance observed at high temperature remain. The OCS/SO2, SO/SO2, and H2S/SO2 abundance ra...

  6. Cavitation Influence in 1D Part-load Vortex Models

    Science.gov (United States)

    Dörfler, P. K.

    2016-11-01

    Residual swirl in the draft tube of Francis turbines may cause annoying low- frequency pulsation of pressure and power output, in particular during part-load operation. A 1D analytical model for these dynamic phenomena would enable simulation by some conventional method for computing hydraulic transients. The proper structure of such a model has implications for the prediction of prototype behaviour based on laboratory tests. The source of excitation as well as the dynamic transmission behaviour of the draft tube flow may both be described either by lumped or distributed parameters. The distributed version contains more information and, due to limited possibilities of identification, some data must be estimated. The distributed cavitation compliance is an example for this dilemma. In recent publications, the customary assumption of a constant wave speed has produced dubious results. The paper presents a more realistic model for distributed compressibility. The measured influence of the Thoma number is applied with the local cavitation factor. This concept is less sensitive to modelling errors and explains both the Thoma and Froude number influence. The possible effect of the normally unknown non-condensable gas content in the vortex cavity is shortly commented. Its measurement in future tests is recommended. It is also recommended to check the available analytical vortex models for possible dispersion effects.

  7. Nonclassical Particle Transport in 1-D Random Periodic Media

    CERN Document Server

    Vasques, Richard; Slaybaugh, Rachel N

    2016-01-01

    We investigate the accuracy of the recently proposed nonclassical transport equation. This equation contains an extra independent variable compared to the classical transport equation (the path-length $s$), and models particle transport taking place in homogenized random media in which a particle's distance-to-collision is not exponentially distributed. To solve the nonclassical equation one needs to know the $s$-dependent ensemble-averaged total cross section, $\\Sigma_t(\\mu,s)$, or its corresponding path-length distribution function, $p(\\mu,s)$. We consider a 1-D spatially periodic system consisting of alternating solid and void layers, randomly placed in the $x$-axis. We obtain an analytical expression for $p(\\mu,s)$ and use this result to compute the corresponding $\\Sigma_t(\\mu,s)$. Then, we proceed to numerically solve the nonclassical equation for different test problems in rod geometry; that is, particles can move only in the directions $\\mu=\\pm 1$. To assess the accuracy of these solutions, we produce ...

  8. Modeling of 1D Anomalous Diffusion in Fractured Nanoporous Media

    Directory of Open Access Journals (Sweden)

    Albinali Ali

    2016-07-01

    Full Text Available Fractured nanoporous reservoirs include multi-scale and discontinuous fractures coupled with a complex nanoporous matrix. Such systems cannot be described by the conventional dual-porosity (or multi-porosity idealizations due to the presence of different flow mechanisms at multiple scales. More detailed modeling approaches, such as Discrete Fracture Network (DFN models, similarly suffer from the extensive data requirements dictated by the intricacy of the flow scales, which eventually deter the utility of these models. This paper discusses the utility and construction of 1D analytical and numerical anomalous diffusion models for heterogeneous, nanoporous media, which is commonly encountered in oil and gas production from tight, unconventional reservoirs with fractured horizontal wells. A fractional form of Darcy’s law, which incorporates the non-local and hereditary nature of flow, is coupled with the classical mass conservation equation to derive a fractional diffusion equation in space and time. Results show excellent agreement with established solutions under asymptotic conditions and are consistent with the physical intuitions.

  9. Synthesis of 1-D ZnO nanorods and polypyrrole/1-D ZnO nanocomposites for photocatalysis and gas sensor applications

    Indian Academy of Sciences (India)

    PRITAM PATIL; GANESH GAIKWAD; D R PATIL; JITENDRA NAIK

    2016-06-01

    1-D ZnO nanorods and PPy/1-D ZnO nanocomposites were prepared by the surfactant-assisted precipitation and in situ polymerization method, respectively. The synthesized nanorods and nanocomposites were characterized by UV–Vis spectrophotometer, Fourier transform-infrared spectroscopy (FTIR), X-ray diffraction (XRD) and field emission scanning electron microscope (FE-SEM), which gave the evidence of 1-D ZnO nanorods, polymerization of pyrrole monomer and strong interaction between PPy and 1-D ZnO nanorods, respectively. Photocatalytic activity of 1-D ZnO nanorods was conducted by $3^3$ level full-factorial design to evaluate the effect of three independent process variables viz., dye concentration (crystal violet), catalyst concentration (1-D ZnO nanorods) and the reaction time on the preferred response: photodegradation efficiency (%). The PPy/1-D ZnO nanocompositeswere used for the sensing of NH$_3$, LPG, CO$_2$ and H$_2$S gases, respectively, at room temperature. It was observed that PPy/1-D ZnO nanocomposites with different 1-D ZnO nanorod weight ratios (15 and 25%) had better selectivity and sensitivity towards NH3 at room temperature.

  10. Absolute rate constant determinations for the deactivation of O/1D/ by time resolved decay of O/1D/ yields O/3P/ emission

    Science.gov (United States)

    Davidson, J. A.; Sadowski, C. M.; Schiff, H. I.; Howard, C. J.; Schmeltekopf, A. L.; Jennings, D. A.; Streit, G. E.

    1976-01-01

    Absolute rate constants for the deactivation of O(1D) atoms by some atmospheric gases have been determined by observing the time-resolved emission of O(1D) at 630 nm. O(1D) atoms were produced by the dissociation of ozone via repetitive laser pulses at 266 nm. Absolute rate constants for the relaxation of O(1D) at 298 K are reported for N2, O2, CO2, O3, H2, D2, CH4, HCl, NH3, H2O, N2O, and Ne. The results obtained are compared with previous relative and absolute measurements reported in the literature.

  11. Benchmarking of a 1D Scrape-off layer code SOLF1D with SOLPS and its use in modelling long-legged divertors

    CERN Document Server

    Havlickova, E; Subba, F; Coster, D; Wischmeier, M; Fishpool, G

    2013-01-01

    A 1D code modelling SOL transport parallel to the magnetic field (SOLF1D) is benchmarked with 2D simulations of MAST-U SOL performed via the SOLPS code for two different collisionalities. Based on this comparison, SOLF1D is then used to model the effects of divertor leg stretching in 1D, in support of the planned Super-X divertor on MAST. The aim is to separate magnetic flux expansion from volumetric power losses due to recycling neutrals by stretching the divertor leg either vertically or radially.

  12. Modeling shear band interaction in 1D torsion

    Science.gov (United States)

    Partom, Yehuda; Hanina, Erez

    2017-01-01

    When two shear bands are being formed at close distance from each other they interact, and further development of one of them may be quenched down. As a result there should be a minimum distance between shear bands. In the literature there are at least three analytical models for this minimum distance. Predictions of these models do not generally agree with each other and with test results. Recently we developed a 1D numerical scheme to predict the formation of shear bands in a torsion test of a thin walled pipe. We validated our code by reproducing results of the pioneering experiments of Marchand and Duffy, and then used it to investigate the mechanics of shear localization and shear band formation. We describe our shear band code in a separate publication, and here we use it only as a tool to investigate the interaction between two neighboring shear bands during the process of their formation. We trigger the formation of shear bands by specifying two perturbations of the initial strength. We vary the perturbations in terms of their amplitude and/or their width. Usually, the stronger perturbation triggers a faster developing shear band, which then prevails and quenches the development of the other shear band. We change the distance between the two shear bands and find, that up to a certain distance one of the shear bands becomes fully developed, and the other stays only partially developed. Beyond this distance the two shear bands are both fully developed. Finally, we check the influence of certain material and loading parameters on the interaction between the two shear bands, and compare the results to predictions of the analytical models from the literature.

  13. Evidence against dopamine D1/D2 receptor heteromers

    Science.gov (United States)

    Frederick, Aliya L.; Yano, Hideaki; Trifilieff, Pierre; Vishwasrao, Harshad D.; Biezonski, Dominik; Mészáros, József; Sibley, David R.; Kellendonk, Christoph; Sonntag, Kai C.; Graham, Devon L.; Colbran, Roger J.; Stanwood, Gregg D.; Javitch, Jonathan A.

    2014-01-01

    Hetero-oligomers of G-protein-coupled receptors have become the subject of intense investigation because their purported potential to manifest signaling and pharmacological properties that differ from the component receptors makes them highly attractive for the development of more selective pharmacological treatments. In particular, dopamine D1 and D2 receptors have been proposed to form hetero-oligomers that couple to Gαq proteins, and SKF83959 has been proposed to act as a biased agonist that selectively engages these receptor complexes to activate Gαq and thus phospholipase C. D1/D2 heteromers have been proposed as relevant to the pathophysiology and treatment of depression and schizophrenia. We used in vitro bioluminescence resonance energy transfer (BRET), ex vivo analyses of receptor localization and proximity in brain slices, and behavioral assays in mice to characterize signaling from these putative dimers/oligomers. We were unable to detect Gαq or Gα11 protein coupling to homomers or heteromers of D1 or D2 receptors using a variety of biosensors. SKF83959-induced locomotor and grooming behaviors were eliminated in D1 receptor knockout mice, verifying a key role for D1-like receptor activation. In contrast, SKF83959-induced motor responses were intact in D2 receptor and Gαq knockout mice, as well as in knock-in mice expressing a mutant Ala286-CaMKIIα, that cannot autophosphorylate to become active. Moreover, we found that in the shell of the nucleus accumbens, even in neurons in which D1 and D2 receptor promoters are both active, the receptor proteins are segregated and do not form complexes. These data are not compatible with SKF83959 signaling through Gαq or through a D1–D2 heteromer and challenge the existence of such a signaling complex in the adult animals that we used for our studies. PMID:25560761

  14. Spatio-temporal stability of 1D Kerr cavity solitons

    Science.gov (United States)

    Gelens, L.; Parra-Rivas, P.; Leo, F.; Gomila, D.; Matias, Manuel A.; Coen, S.

    2014-05-01

    The Lugiato-Lefever equation (LLE) has been extensively studied since its derivation in 1987, when this meanfield model was introduced to describe nonlinear optical cavities. The LLE was originally derived to describe a ring cavity or a Fabry-Perot resonator with a transverse spatial extension and partially filled with a nonlinear medium but it has also been shown to be applicable to other types of cavities, such as fiber resonators and microresonators. Depending on the parameters used, the LLE can present a monostable or bistable input-output response curve. A large number of theoretical studies have been done in the monostable regime, but the bistable regime has remained widely unexplored. One of the reasons for this was that previous experimental setups were not able to works in such regimes of the parameter space. Nowadays the possibility of reaching such parameter regimes experimentally has renewed the interest in the LLE. In this contribution, we present an in-depth theoretical study of the different dynamical regimes that can appear in parameter space, focusing on the dynamics of localized solutions, also known as cavity solitons (CSs). We show that time-periodic oscillations of a 1D CS appear naturally in a broad region of parameter space. More than this oscillatory regime, which has been recently demonstrated experimentally,1 we theoretically report on several kinds of chaotic dynamics. We show that the existence of CSs and their dynamics is related with the spatial dynamics of the system and with the presence of a codimension-2 point known as a Fold-Hopf bifurcation point. These dynamical regimes can become accessible by using devices such as microresonators, for instance widely used for creating optical frequency combs.

  15. Restrained dark U (1 )d at low energies

    Science.gov (United States)

    Correia, Fagner C.; Fajfer, Svjetlana

    2016-12-01

    We investigate a spontaneously broken U (1 )d gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, ϕ , and a dark gauge boson, V , can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Second, by assuming that V must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low-energy constraints coming from K →μ X , electron (g -2 )e, K →μ νμe+e-, K →μ νμμ+μ-, and τ →ντμ νμe+e-. We focus on the scenario where the V mass is below ˜2 mμ and the ϕ mass runs from few MeV to 250 MeV, with V -photon mixing of the order ˜O (10-3). Among weak process at low energies, we check the influence of the new light vector on kaon decays as well as on the scattering e+e-→μ+μ-e+e- and discuss the impact of the dark Higgs on e+e-→μ+μ-μ+μ-. Finally, we consider contributions of the V -photon mixing in the decays π0→γ e+e-, η →γ e+e-, ρ →π e+e-, K*→K e+e-, and ϕ (1020 )→η e+e-.

  16. Resolution-optimized NMR measurement of (1)D(CH), (1)D(CC) and (2)D(CH) residual dipolar couplings in nucleic acid bases.

    Science.gov (United States)

    Boisbouvier, Jérôme; Bryce, David L; O'neil-Cabello, Erin; Nikonowicz, Edward P; Bax, Ad

    2004-11-01

    New methods are described for accurate measurement of multiple residual dipolar couplings in nucleic acid bases. The methods use TROSY-type pulse sequences for optimizing resolution and sensitivity, and rely on the E.COSY principle to measure the relatively small two-bond (2)D(CH) couplings at high precision. Measurements are demonstrated for a 24-nt stem-loop RNA sequence, uniformly enriched in (13)C, and aligned in Pf1. The recently described pseudo-3D method is used to provide homonuclear (1)H-(1)H decoupling, which minimizes cross-correlation effects and optimizes resolution. Up to seven (1)H-(13)C and (13)C-(13)C couplings are measured for pyrimidines (U and C), including (1)D(C5H5), (1)D(C6H6), (2)D(C5H6), (2)D(C6H5), (1)D(C5C4), (1)D(C5C6), and (2)D(C4H5). For adenine, four base couplings ((1)D(C2H2), (1)D(C8H8), (1)D(C4C5), and (1)D(C5C6)) are readily measured whereas for guanine only three couplings are accessible at high relative accuracy ((1)D(C8H8), (1)D(C4C5), and (1)D(C5C6)). Only three dipolar couplings are linearly independent in planar structures such as nucleic acid bases, permitting cross validation of the data and evaluation of their accuracies. For the vast majority of dipolar couplings, the error is found to be less than +/-3% of their possible range, indicating that the measurement accuracy is not limiting when using these couplings as restraints in structure calculations. Reported isotropic values of the one- and two-bond J couplings cluster very tightly for each type of nucleotide.

  17. Data of evolutionary structure change: 1D3AB-1LLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D3AB-1LLDA 1D3A 1LLD B A -TKVSVVGAAGTVGAAAGYNIALRDIADEVVFVDIPDKE...PNAIYMLITNPVDIATHVAQKLTGLPENQIFGSGTNLDSARLRFLIAQQTGVNVKNVHAYIAGEHGDSEVPLWESATIGGVPMSDWTPLPGHDPLDADKREEIHQEVK... 1LLD A 1LLDA...> 1 1LLD A 1LLDA

  18. An Extended Decomposed Theory of Planned Behaviour to Predict the Usage Intention of the Electric Car: A Multi-Group Comparison

    Directory of Open Access Journals (Sweden)

    Ingrid Moons

    2015-05-01

    Full Text Available An Extended Decomposed Theory of Planned Behaviour (DTPB is developed that integrates emotions towards car driving and electric cars as well as car driving habits of the DTPB, and is empirically validated in a Belgian sample (n = 1023. Multi-group comparisons explore how the determinants of usage intention are different between groups of consumers differing in environmentally-friendly behaviour, environmental concern, innovativeness and personal values. Besides attitudes, media, perceived complexity, compatibility and relative advantage, emotions towards the electric car and reflective emotions towards car driving have a strong effect on usage intention. Car driving habits and perceived behavioural control (facilitators and constraints do not substantially affect usage intention. Only people differing in personal values show a different motivational structure for a number of important drivers of usage intention.

  19. Using Multigroup-Multiphase Latent State-Trait Models to Study Treatment-Induced Changes in Intra-Individual State Variability: An Application to Smokers' Affect.

    Science.gov (United States)

    Geiser, Christian; Griffin, Daniel; Shiffman, Saul

    2016-01-01

    Sometimes, researchers are interested in whether an intervention, experimental manipulation, or other treatment causes changes in intra-individual state variability. The authors show how multigroup-multiphase latent state-trait (MG-MP-LST) models can be used to examine treatment effects with regard to both mean differences and differences in state variability. The approach is illustrated based on a randomized controlled trial in which N = 338 smokers were randomly assigned to nicotine replacement therapy (NRT) vs. placebo prior to quitting smoking. We found that post quitting, smokers in both the NRT and placebo group had significantly reduced intra-individual affect state variability with respect to the affect items calm and content relative to the pre-quitting phase. This reduction in state variability did not differ between the NRT and placebo groups, indicating that quitting smoking may lead to a stabilization of individuals' affect states regardless of whether or not individuals receive NRT.

  20. Using Multigroup-Multiphase Latent State-Trait Models to Study Treatment-Induced Changes in Intra-Individual State Variability: An Application to Smokers’ Affect

    Directory of Open Access Journals (Sweden)

    Christian Geiser

    2016-07-01

    Full Text Available Sometimes, researchers are interested in whether an intervention, experimental manipulation, or other treatment causes changes in intra-individual state variability. The authors show how multigroup-multiphase latent state-trait (MG-MP-LST models can be used to examine treatment effects with regard to both mean differences and differences in state variability. The approach is illustrated based on a randomized controlled trial in which N = 338 smokers were randomly assigned to nicotine replacement therapy (NRT versus placebo prior to quitting smoking. We found that post quitting, smokers in both the NRT and placebo group had significantly reduced intra-individual affect variability with respect to the affect items calm and content relative to the pre-quitting phase. This reduction in state variability did not differ between the NRT and placebo groups, indicating that quitting smoking may lead to a stabilization of individuals’ affect states regardless of whether or not individuals receive NRT.

  1. On an evaluation of the continuous flux and dominant Eigenvalue problem for the steady state multi-group multi-layer neutron diffusion equation

    Energy Technology Data Exchange (ETDEWEB)

    Ceolin, C.; Schramm, M.; Vilhena, M.T.; Bodmann, B.E.J., E-mail: celina.ceolin@gmail.com, E-mail: marceloschramm@hotmail.com, E-mail: vilhena@pq.cnpq.br, E-mail: bardo.bodmann@ufrgs.br [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil). Programa de Pos-Graduacao em Engenharia Mecanica

    2013-07-01

    In this work the authors solved the steady state neutron diffusion equation for a multi-layer slab assuming the multi-group energy model. The method to solve the equation system is based on a expansion in Taylor Series, which was proven to be useful in [1] [2] [3]. The results obtained can be used as initial condition for neutron space kinetics problems. The neutron scalar flux was expanded in a power series, and the coefficients were found by using the ordinary differential equation and the boundary and interface conditions. The effective multiplication factor k was evaluated using the power method [4]. We divided the domain into several slabs to guarantee the convergence with a low truncation order. We present the formalism together with some numerical simulations. (author)

  2. On an analytical evaluation of the flux and dominant eigenvalue problem for the steady state multi-group multi-layer neutron diffusion equation

    Energy Technology Data Exchange (ETDEWEB)

    Ceolin, Celina; Schramm, Marcelo; Bodmann, Bardo Ernst Josef; Vilhena, Marco Tullio Mena Barreto de [Universidade Federal do Rio Grande do Sul, Porto Alegre (Brazil). Programa de Pos-Graduacao em Engenharia Mecanica; Bogado Leite, Sergio de Queiroz [Comissao Nacional de Energia Nuclear, Rio de Janeiro (Brazil)

    2014-11-15

    In this work the authors solved the steady state neutron diffusion equation for a multi-layer slab assuming the multi-group energy model. The method to solve the equation system is based on an expansion in Taylor Series resulting in an analytical expression. The results obtained can be used as initial condition for neutron space kinetics problems. The neutron scalar flux was expanded in a power series, and the coefficients were found by using the ordinary differential equation and the boundary and interface conditions. The effective multiplication factor k was evaluated using the power method. We divided the domain into several slabs to guarantee the convergence with a low truncation order. We present the formalism together with some numerical simulations.

  3. From nonfinite to finite 1D arrays of origami tiles.

    Science.gov (United States)

    Wu, Tsai Chin; Rahman, Masudur; Norton, Michael L

    2014-06-17

    average solution structures for blocks is more readily achieved using computer models than using direct imaging methods. The development of scalable 1D-origami arrays composed of uniquely addressable components is a logical, if not necessary, step in the evolution of higher order fully addressable structures. Our research into the fabrication of arrays has led us to generate a listing of several important areas of future endeavor. Of high importance is the re-enforcement of the mechanical properties of the building blocks and the organization of multiple arrays on a surface of technological importance. While addressing this short list of barriers to progress will prove challenging, coherent development along each of these lines of inquiry will accelerate the appearance of commercial scale molecular manufacturing.

  4. Comparison of a 3-D multi-group SN particle transport code with Monte Carlo for intracavitary brachytherapy of the cervix uteri.

    Science.gov (United States)

    Gifford, Kent A; Wareing, Todd A; Failla, Gregory; Horton, John L; Eifel, Patricia J; Mourtada, Firas

    2009-12-03

    A patient dose distribution was calculated by a 3D multi-group S N particle transport code for intracavitary brachytherapy of the cervix uteri and compared to previously published Monte Carlo results. A Cs-137 LDR intracavitary brachytherapy CT data set was chosen from our clinical database. MCNPX version 2.5.c, was used to calculate the dose distribution. A 3D multi-group S N particle transport code, Attila version 6.1.1 was used to simulate the same patient. Each patient applicator was built in SolidWorks, a mechanical design package, and then assembled with a coordinate transformation and rotation for the patient. The SolidWorks exported applicator geometry was imported into Attila for calculation. Dose matrices were overlaid on the patient CT data set. Dose volume histograms and point doses were compared. The MCNPX calculation required 14.8 hours, whereas the Attila calculation required 22.2 minutes on a 1.8 GHz AMD Opteron CPU. Agreement between Attila and MCNPX dose calculations at the ICRU 38 points was within +/- 3%. Calculated doses to the 2 cc and 5 cc volumes of highest dose differed by not more than +/- 1.1% between the two codes. Dose and DVH overlays agreed well qualitatively. Attila can calculate dose accurately and efficiently for this Cs-137 CT-based patient geometry. Our data showed that a three-group cross-section set is adequate for Cs-137 computations. Future work is aimed at implementing an optimized version of Attila for radiotherapy calculations.

  5. Data of evolutionary structure change: 1D0GD-2RJLA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D0GD-2RJLA 1D0G 2RJL D A PQRVAAHITGTRGEKALGRKINSWESSRSGHSFLS-NLH...LRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTS-YPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDM-DHEASFFGAFLVG GD...KPRAHLTVVRQTPTQFPALHWEHEL--GLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRG--------MKPDSITVVITKVTDS...YPEPTQLLMGTKSVS-EVG-SNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL- ...D0G D 1D0GD HSFLS-NLHLR

  6. Analysis of the rotational structure in the high-resolution infrared spectra of trans-hexatriene-1,1-d2 and -cis-1-d1

    Science.gov (United States)

    Craig, Norman C.; Fuson, Hannah A.; Tian, Hengfeng; Blake, Thomas A.

    2012-09-01

    Mixtures of trans-hexatriene-1,1-d2, -cis-1-d1, and -trans-1-d1 have been synthesized. Anharmonic frequencies and harmonic intensities were predicted with the B3LYP/cc-pVTZ model for the out-of-plane (a″) modes of the three isotopologues. Assignments are proposed for most of the a″ vibrational modes above 500 cm-1. Ground state (GS) rotational constants have been determined for the 1,1-d2 and cis-1-d1 species from the analysis of rotational structure of C-type bands in the high-resolution (0.0015 cm-1) infrared spectra in a mixture of the three isotopologues. The GS constants for the 1,1-d2 species are A0 = 0.8018850(6), B0 = 0.0418540(6), and C0 = 0.0397997(4) cm-1. The GS constants for the cis-1-d1 species are A0 = 0.809388(1), B0 = 0.043532(2), and C0 = 0.041320(1) cm-1. Small inertial defects confirm planarity for both species. These ground state rotational constants are intended for use in determining a semiexperimental equilibrium structure and evaluating the influence of chain length on π-electron delocalization in polyenes.

  7. Acute exercise and physiological insulin induce distinct phosphorylation signatures on TBC1D1 and TBC1D4 in human skeletal muscle

    DEFF Research Database (Denmark)

    Treebak, Jonas Thue; Pehmøller, Christian; Kristensen, Jonas Møller

    2014-01-01

    We investigated the phosphorylation signatures of two Rab GTPase activating proteins TBC1D1 and TBC1D4 in human skeletal muscle in response to physical exercise and physiological insulin levels induced by a carbohydrate rich meal using a paired experimental design. Eight healthy male volunteers...... in response to physiological stimuli in human skeletal muscle and support the idea that Akt and AMPK are upstream kinases. TBC1D1 phosphorylation signatures were comparable between in vitro contracted mouse skeletal muscle and exercised human muscle, and we show that AMPK was regulating phosphorylation...... of these sites in mouse muscle. Contraction and exercise elicited a different phosphorylation pattern of TBC1D4 in mouse compared with human muscle, and although different circumstances in our experimental setup may contribute to this difference, the observation exemplifies that transferring findings between...

  8. Zerumbone modulates CD1d expression and lipid antigen presentation pathway in breast cancer cells.

    Science.gov (United States)

    Shyanti, Ritis K; Sehrawat, Anuradha; Singh, Shivendra V; Mishra, J P N; Singh, Rana P

    2017-10-01

    Natural Killer T (NKT) cells based cancer immunotherapy is an evolving area of cancer therapy, but tumors escape from this treatment modality by altering CD1d expression and its antigen presentation pathway. Here, we have studied the relation of CD1d expression in various breast cancer cell lines to their viability and progression. We observed a novel phenomenon that CD1d expression level increases with the progressive stage of the cancer. A small molecule, zerumbone (ZER) caused down-regulation of CD1d that was accompanied by breast cancer cell growth in vitro. The growth inhibitory effect of ZER against breast cancer cells was augmented by treatment with anti-CD1d mAb. This effect was mediated by G1-phase cell cycle arrest and apoptosis induction coupled with an increase in mitochondrial membrane depolarization. CD1d expression and cell proliferation were inhibited by both CD1d siRNA and ZER. The α-galactosylceramide, a ligand for CD1d, showed increased CD1d expression as well as cell proliferation which was opposite to the effects of ZER. This study shows that, CD1d overexpression is associated with the progressive stages of breast cancer and ZER could be an adjuvant to potentiate cancer immunotherapy. Copyright © 2017. Published by Elsevier Ltd.

  9. The Rab-GTPase-activating protein TBC1D1 regulates skeletal muscle glucose metabolism

    DEFF Research Database (Denmark)

    Szekeres, Ferenc; Chadt, Alexandra; Tom, Robby Z

    2012-01-01

    The Rab-GTPase-activating protein TBC1D1 has emerged as a novel candidate involved in metabolic regulation. Our aim was to determine whether TBC1D1 is involved in insulin as well as energy-sensing signals controlling skeletal muscle metabolism. TBC1D1-deficient congenic B6.SJL-Nob1.10 (Nob1.10(SJL...... be explained partly by a 50% reduction in GLUT4 protein, since proximal signaling at the level of Akt, AMPK, and acetyl-CoA carboxylase (ACC) was unaltered. Paradoxically, in vivo insulin-stimulated 2-deoxyglucose uptake was increased in EDL and tibialis anterior muscle from TBC1D1-deficient mice....... In conclusion, TBC1D1 plays a role in regulation of glucose metabolism in skeletal muscle. Moreover, functional TBC1D1 is required for AICAR- or contraction-induced metabolic responses, implicating a role in energy-sensing signals....

  10. Expression of CD1d protein in human testis showing normal and abnormal spermatogenesis.

    Science.gov (United States)

    Adly, Mohamed A; Abdelwahed Hussein, Mahmoud-Rezk

    2011-05-01

    CD1d is a member of CD1 family of transmembrane glycoproteins, which represent antigen-presenting molecules. Immunofluorescent staining methods were utilized to examine expression pattern of CD1d in human testicular specimens. In testis showing normal spermatogenesis, a strong CD1d cytoplasmic expression was seen the Sertoli cells, spermatogonia, and Leydig cells. A moderate expression was observed in the spermatocytes. In testes showing maturation arrest, CD1d expression was strong in the Sertoli cells and weak in spermatogonia and spermatocytes compared to testis with normal spermatogenesis. In Sertoli cell only syndrome, CD1d expression was strong in the Sertoli and Leydig cells. This preliminary study displayed testicular infertility-related changes in CD1d expression. The ultrastructural changes associated with with normal and abnormal spermatogenesis are open for further investigations.

  11. TBC1D24 genotype-phenotype correlation: Epilepsies and other neurologic features

    OpenAIRE

    Balestrini, S; Milh, M.; Castiglioni, C.; Lüthy, K.; Finelli, M. J.; Verstreken, P.; Cardon, A; Stražišar, B. G.; Holder, J. L.; Lesca, G; Mancardi, M. M.; Poulat, A. L.; Repetto, G. M.; Banka, S.; Bilo, L.

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients...

  12. Examination of 1D Solar Cell Model Limitations Using 3D SPICE Modeling: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    McMahon, W. E.; Olson, J. M.; Geisz, J. F.; Friedman, D. J.

    2012-06-01

    To examine the limitations of one-dimensional (1D) solar cell modeling, 3D SPICE-based modeling is used to examine in detail the validity of the 1D assumptions as a function of sheet resistance for a model cell. The internal voltages and current densities produced by this modeling give additional insight into the differences between the 1D and 3D models.

  13. The Planar Sandwich and Other 1D Planar Heat Flow Test Problems in ExactPack

    Energy Technology Data Exchange (ETDEWEB)

    Singleton, Jr., Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-01-24

    This report documents the implementation of several related 1D heat flow problems in the verification package ExactPack [1]. In particular, the planar sandwich class defined in Ref. [2], as well as the classes PlanarSandwichHot, PlanarSandwichHalf, and other generalizations of the planar sandwich problem, are defined and documented here. A rather general treatment of 1D heat flow is presented, whose main results have been implemented in the class Rod1D. All planar sandwich classes are derived from the parent class Rod1D.

  14. Tunable Design of Structural Colors Produced by Pseudo-1D Photonic Crystals of Graphene Oxide.

    Science.gov (United States)

    Tong, Liping; Qi, Wei; Wang, Mengfan; Huang, Renliang; Su, Rongxin; He, Zhimin

    2016-07-01

    It is broadly observed that graphene oxide (GO) films appear transparent with a thickness of about several nanometers, whereas they appear dark brown or almost black with thickness of more than 1 μm. The basic color mechanism of GO film on a sub-micrometer scale, however, is not well understood. This study reports on GO pseudo-1D photonic crystals (p1D-PhCs) exhibiting tunable structural colors in the visible wavelength range owing to its 1D Bragg nanostructures. Striking structural colors of GO p1D-PhCs could be tuned by simply changing either the volume or concentration of the aqueous GO dispersion during vacuum filtration. Moreover, the quantitative relationship between thickness and reflection wavelength of GO p1D-PhCs has been revealed, thereby providing a theoretical basis to rationally design structural colors of GO p1D-PhCs. The spectral response of GO p1D-PhCs to humidity is also obtained clearly showing the wavelength shift of GO p1D-PhCs at differently relative humidity values and thus encouraging the integration of structural color printing and the humidity-responsive property of GO p1D-PhCs to develop a visible and fast-responsive anti-counterfeiting label. The results pave the way for a variety of potential applications of GO in optics, structural color printing, sensing, and anti-counterfeiting.

  15. Analysis of Rotational Structure in the High-Resolution Infrared Spectra of the TRANS-HEXATRIENE-1,1-D2 and -CIS-1-D1 Species

    Science.gov (United States)

    Craig, Norman C.; Fuson, Hannah A.; Tian, Hengfeng; Blake, Thomas A.

    2011-06-01

    Hexatriene-1,1-D2 with some admixture of the cis-1-D1 and trans-1-D1 species was synthesized by reaction of 2,4-pentadienal and (methyl-D3)-triphenylphosphonium iodide (Wittig reagent). The trans isomer was isolated by preparative gas chromatography, and the high-resolution (0.0015 Cm-1) infrared spectrum was recorded on a Bruker IFS 125HR instrument. The rotational structure in two C-type bands for the 1,1-D2 species was analyzed. For this species the bands at 902.043 and 721.864 Cm-1 yielded composite ground state rotational constants of A0 = 0.801882(1), B0 = 0.041850(2), and C0 = 0.039804(1) Cm-1. For the cis-1-D1 species the C-type band at 803.018 Cm-1 gave A0 = 0.809384(2), B0 = 0.043530(3), and C0 = 0.041321(2) Cm-1. By iodine-catalyzed isomerization, we have obtained some of the much less favored cis isomer and hope to obtain microwave spectra for its three deuterium-substituted species. The rotational constants reported here contribute to data needed for determining a semi-experimental structure for trans-hexatriene, which should show that the structural consequences of pi-electron delocalization increase with the chain length of polyenes.

  16. Mapping of the serotonin 5-HT{sub 1D{alpha}} autoreceptor gene (HTR1D) on chromosome 1 using a silent polymorphism in the coding region

    Energy Technology Data Exchange (ETDEWEB)

    Ozaki, N.; Lappalainen, J.; Linnoila, M. [National Institute on Alcohol Abuse and Alcoholism, Rockville, MD (United States)] [and others

    1995-04-24

    Serotonin (5-HT){sub ID} receptors are 5-HT release-regulating autoreceptors in the human brain. Abnormalities in brain 5-HT function have been hypothesized in the pathophysiology of various psychiatric disorders, including obsessive-compulsive disorder, autism, mood disorders, eating disorders, impulsive violent behavior, and alcoholism. Thus, mutations occurring in 5-HT autoreceptors may cause or increase the vulnerability to any of these conditions. 5-HT{sub 1D{alpha}} and 5-HT{sub 1D{Beta}} subtypes have been previously localized to chromosomes 1p36.3-p34.3 and 6q13, respectively, using rodent-human hybrids and in situ localization. In this communication, we report the detection of a 5-HT{sub 1D{alpha}} receptor gene polymorphism by single strand conformation polymorphism (SSCP) analysis of the coding sequence. The polymorphism was used for fine scale linkage mapping of 5-HT{sub 1D{alpha}} on chromosome 1. This polymorphism should also be useful for linkage studies in populations and in families. Our analysis also demonstrates that functionally significant coding sequence variants of the 5-HT{sub 1D{alpha}} are probably not abundant either among alcoholics or in the general population. 14 refs., 1 fig., 1 tab.

  17. Potent neutralizing anti-CD1d antibody reduces lung cytokine release in primate asthma model.

    Science.gov (United States)

    Nambiar, Jonathan; Clarke, Adam W; Shim, Doris; Mabon, David; Tian, Chen; Windloch, Karolina; Buhmann, Chris; Corazon, Beau; Lindgren, Matilda; Pollard, Matthew; Domagala, Teresa; Poulton, Lynn; Doyle, Anthony G

    2015-01-01

    CD1d is a receptor on antigen-presenting cells involved in triggering cell populations, particularly natural killer T (NKT) cells, to release high levels of cytokines. NKT cells are implicated in asthma pathology and blockade of the CD1d/NKT cell pathway may have therapeutic potential. We developed a potent anti-human CD1d antibody (NIB.2) that possesses high affinity for human and cynomolgus macaque CD1d (KD ∼100 pM) and strong neutralizing activity in human primary cell-based assays (IC50 typically <100 pM). By epitope mapping experiments, we showed that NIB.2 binds to CD1d in close proximity to the interface of CD1d and the Type 1 NKT cell receptor β-chain. Together with data showing that NIB.2 inhibited stimulation via CD1d loaded with different glycolipids, this supports a mechanism whereby NIB.2 inhibits NKT cell activation by inhibiting Type 1 NKT cell receptor β-chain interactions with CD1d, independent of the lipid antigen in the CD1d antigen-binding cleft. The strong in vitro potency of NIB.2 was reflected in vivo in an Ascaris suum cynomolgus macaque asthma model. Compared with vehicle control, NIB.2 treatment significantly reduced bronchoalveolar lavage (BAL) levels of Ascaris-induced cytokines IL-5, IL-8 and IL-1 receptor antagonist, and significantly reduced baseline levels of GM-CSF, IL-6, IL-15, IL-12/23p40, MIP-1α, MIP-1β, and VEGF. At a cellular population level NIB.2 also reduced numbers of BAL lymphocytes and macrophages, and blood eosinophils and basophils. We demonstrate that anti-CD1d antibody blockade of the CD1d/NKT pathway modulates inflammatory parameters in vivo in a primate inflammation model, with therapeutic potential for diseases where the local cytokine milieu is critical.

  18. Programs Lucky and Lucky{sub C} - 3D parallel transport codes for the multi-group transport equation solution for XYZ geometry by Pm Sn method

    Energy Technology Data Exchange (ETDEWEB)

    Moriakov, A. [Russian Research Centre, Kurchatov Institute, Moscow (Russian Federation); Vasyukhno, V.; Netecha, M.; Khacheresov, G. [Research and Development Institute of Power Engineering, Moscow (Russian Federation)

    2003-07-01

    Powerful supercomputers are available today. MBC-1000M is one of Russian supercomputers that may be used by distant way access. Programs LUCKY and LUCKY{sub C} were created to work for multi-processors systems. These programs have algorithms created especially for these computers and used MPI (message passing interface) service for exchanges between processors. LUCKY may resolved shielding tasks by multigroup discreet ordinate method. LUCKY{sub C} may resolve critical tasks by same method. Only XYZ orthogonal geometry is available. Under little space steps to approximate discreet operator this geometry may be used as universal one to describe complex geometrical structures. Cross section libraries are used up to P8 approximation by Legendre polynomials for nuclear data in GIT format. Programming language is Fortran-90. 'Vector' processors may be used that lets get a time profit up to 30 times. But unfortunately MBC-1000M has not these processors. Nevertheless sufficient value for efficiency of parallel calculations was obtained under 'space' (LUCKY) and 'space and energy' (LUCKY{sub C}) paralleling. AUTOCAD program is used to control geometry after a treatment of input data. Programs have powerful geometry module, it is a beautiful tool to achieve any geometry. Output results may be processed by graphic programs on personal computer. (authors)

  19. Gender and Acceptance of E-Learning: A Multi-Group Analysis Based on a Structural Equation Model among College Students in Chile and Spain.

    Science.gov (United States)

    Ramírez-Correa, Patricio E; Arenas-Gaitán, Jorge; Rondán-Cataluña, F Javier

    2015-01-01

    The scope of this study was to evaluate whether the adoption of e-learning in two universities, and in particular, the relationship between the perception of external control and perceived ease of use, is different because of gender differences. The study was carried out with participating students in two different universities, one in Chile and one in Spain. The Technology Acceptance Model was used as a theoretical framework for the study. A multi-group analysis method in partial least squares was employed to relate differences between groups. The four main conclusions of the study are: (1) a version of the Technology Acceptance Model has been successfully used to explain the process of adoption of e-learning at an undergraduate level of study; (2) the finding of a strong and significant relationship between perception of external control and perception of ease of use of the e-learning platform; (3) a significant relationship between perceived enjoyment and perceived ease of use and between results demonstrability and perceived usefulness is found; (4) the study indicates a few statistically significant differences between males and females when adopting an e-learning platform, according to the tested model.

  20. Development of Galerkin Finite Element Method Three-dimensional Computational Code for the Multigroup Neutron Diffusion Equation with Unstructured Tetrahedron Elements

    Directory of Open Access Journals (Sweden)

    Seyed Abolfazl Hosseini

    2016-02-01

    Full Text Available In the present paper, development of the three-dimensional (3D computational code based on Galerkin finite element method (GFEM for solving the multigroup forward/adjoint diffusion equation in both rectangular and hexagonal geometries is reported. Linear approximation of shape functions in the GFEM with unstructured tetrahedron elements is used in the calculation. Both criticality and fixed source calculations may be performed using the developed GFEM-3D computational code. An acceptable level of accuracy at a low computational cost is the main advantage of applying the unstructured tetrahedron elements. The unstructured tetrahedron elements generated with Gambit software are used in the GFEM-3D computational code through a developed interface. The forward/adjoint multiplication factor, forward/adjoint flux distribution, and power distribution in the reactor core are calculated using the power iteration method. Criticality calculations are benchmarked against the valid solution of the neutron diffusion equation for International Atomic Energy Agency (IAEA-3D and Water-Water Energetic Reactor (VVER-1000 reactor cores. In addition, validation of the calculations against the P1 approximation of the transport theory is investigated in relation to the liquid metal fast breeder reactor benchmark problem. The neutron fixed source calculations are benchmarked through a comparison with the results obtained from similar computational codes. Finally, an analysis of the sensitivity of calculations to the number of elements is performed.

  1. School belongingness and mental health functioning across the primary-secondary transition in a mainstream sample: multi-group cross-lagged analyses.

    Directory of Open Access Journals (Sweden)

    Sharmila Vaz

    Full Text Available The relationship between school belongingness and mental health functioning before and after the primary-secondary school transition has not been previously investigated in students with and without disabilities. This study used a prospective longitudinal design to test the bi-directional relationships between these constructs, by surveying 266 students with and without disabilities and their parents, 6-months before and after the transition to secondary school. Cross-lagged multi-group analyses found student perception of belongingness in the final year of primary school to contribute to change in their mental health functioning a year later. The beneficial longitudinal effects of school belongingness on subsequent mental health functioning were evident in all student subgroups; even after accounting for prior mental health scores and the cross-time stability in mental health functioning and school belongingness scores. Findings of the current study substantiate the role of school contextual influences on early adolescent mental health functioning. They highlight the importance for primary and secondary schools to assess students' school belongingness and mental health functioning and transfer these records as part of the transition process, so that appropriate scaffolds are in place to support those in need. Longer term longitudinal studies are needed to increase the understanding of the temporal sequencing between school belongingness and mental health functioning of all mainstream students.

  2. MCNP - transport calculations in ducts using multigroup albedo coefficients; Calculos de transporte em dutos utilizando coeficientes de albedo multigrupo no codigo MCNP

    Energy Technology Data Exchange (ETDEWEB)

    Ono, Shizuca; Vieira, Wilson J.; Garcia, Roberto D.M. [Centro Tecnico Aeroespacial (CTA-IEAv), Sao Jose dos Campos, SP (Brazil). Inst. de Estudos Avancados

    2000-07-01

    In this work, the use of multigroup albedo coefficients in Monte Carlo calculations of particle reflection and transmission by ducts is investigated. The procedure consists in modifying the MCNP code so that an albedo matrix computed previously by deterministic methods or Monte Carlo is introduced into the program to describe particle reflection by a surface. This way it becomes possible to avoid the need of considering particle transport in the duct wall explicitly, changing the problem to a problem of transport in the duct interior only and reducing significantly the difficulty of the real problem. The probability of particle reflection at the duct wall is given, for each group, as the sum of the albedo coefficients over the final groups. The calculation is started by sampling a source particle and simulating its reflection on the duct wall by sampling a group for the emerging particle. The particle weight is then reduced by the reflection probability. Next, a new direction and trajectory for the particle is selected. Numerical results obtained for the model are compared with results from a discrete ordinates code and results from Monte Carlo simulations that take particle transport in the wall into account. (author)

  3. Data of evolutionary structure change: 1B99C-2AZ1D [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available GSDS--VESAN >E --HHHHH> ATOM 316...>D 2AZ1D HGSDHEDEGANE >E HHH...pdbID>1B99 C 1B99C EELLT-EVKPN ...> - > ATOM 3319 CA GLU C 141 17.330 5.755...DChain>2AZ1D DELVDWDRDAS re>GG EEGGHcture

  4. A rational route to SCM materials based on a 1-D cobalt selenocyanato coordination polymer.

    Science.gov (United States)

    Boeckmann, Jan; Näther, Christian

    2011-07-07

    Thermal annealing of a discrete complex with terminal SeCN anions and monodentate coligands enforces the formation of a 1D cobalt selenocyanato coordination polymer that shows slow relaxation of the magnetization. Therefore, this approach offers a rational route to 1D materials that might show single chain magnetic behaviour.

  5. Data of evolutionary structure change: 1D07A-2PSEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D07A-2PSEA 1D07 2PSE A A ---------GA----KPFGEKKFIEIKGRRMAYIDEGTG...MPI-EWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGT-PADVVAIARDYAGWLSESP-IPKLF...entryChain> 2PSE A 2PSEA VAL CA 328 2PSE A 2PSEA...dbChain> 2PSEA LRASDDLPKLF HH EEE

  6. Quasiperiodicity and 2D topology in 1D charge-ordered materials

    NARCIS (Netherlands)

    Flicker, F.; van Wezel, J.

    2015-01-01

    The mathematical description of 1D quasicrystals has recently been linked to that of 2D quantum Hall states. The topological classification of 1D quasicrystals and the corresponding interpretation of their observed charge transport have been widely discussed. We demonstrate the equivalence of both 1

  7. Data of evolutionary structure change: 1D7EA-1OTAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D7EA-1OTAA 1D7E 1OTA A A ---VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNI...ne>VAL CA 559 PHE CA 524 1OTA A 1OTAA KKALSGDSYWVF E EE...9981689453 7.820000171661377 tion> 0.8790000081062...1399 0.36500000953674316 -0.3330000042915344 -0.25200000405311584 -0.9089999794960022

  8. Molecular cloning, sequence analysis and pharmacological properties of the porcine 5-HT(1D) receptor.

    NARCIS (Netherlands)

    P.L. Bhalla (Pankaj); H.S. Sharma (Hari); T. Wurch (Thierry); P.J. Pauwels (Petrus); P.R. Saxena (Pramod Ranjan)

    2000-01-01

    textabstractA cDNA encoding the full-length 5-HT(1D) receptor derived from porcine cerebral cortex was amplified, cloned and sequenced, using guinea-pig 5-HT(1D) receptor coding sequence oligonucleotide primers in reverse transcription-polymerase chain reaction (RT - PC

  9. Data of evolutionary structure change: 1D5IL-2GJJA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D5IL-2GJJA 1D5I 2GJJ L A -DIKMTQSPSSMYASLGERVTITCKASQDIN------SY... 219 ALA CA 310 SER CA 336 2GJJ A 2GJJA PEVVKTGASVK 5.283660888671875 1 2GJJ... A 2GJJA RLEIK----RGEVQ

  10. Data of evolutionary structure change: 1D5NC-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available msd> 1.0891029834747314 EVID> 1 1UNF...1D5NC-1UNFX 1D5N 1UNF C X ----SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYV...NNANAALESL----PEFANLPVEELITKLDQLPADKKTVL---------RNNAGGHANHSLFWKGLKKGT--TLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGW...HH EVID> 0 TRP CA 380 1UNF X 1UNF

  11. Data of evolutionary structure change: 1D5ND-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1.0915240049362183 EVID> 1 1UNF...1D5ND-1UNFX 1D5N 1UNF D X ----SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYV...NNANAALESL----PEFANLPVEELITKLDQLPADKKTVL---------RNNAGGHANHSLFWKGLKKGTT--LQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGW...H EVID> 0 TRP CA 379 1UNF X 1UNF

  12. Analysis of the interaction proteins of PIH1D1%与PIH1D1相互作用的蛋白分析

    Institute of Scientific and Technical Information of China (English)

    章元; 张业

    2016-01-01

    目的 分析细胞中与PIH1D1相互作用的蛋白.方法 构建稳定表达FLAG-HA双标签标记的PIH1D1蛋白的HEK293T细胞株,利用FLAG-HA串联亲和纯化(TAP)双标签纯化实验,对目的条带进行质谱分析.结果 成功构建稳定表达FLAG-HA双标签标记的PIH1D1细胞株.通过质谱分析得到了PIH1D1相互作用的蛋白数据,包括细胞质内RNA PolⅡ组装复合物成员RPAP3、UXT、PFD2和PFD6等,凋亡复合物成员MONAD/WDR92等,钙调蛋白信号通路中的PIP和CALM1以及代谢通路中的PKM和LCN1等.结论 PIH1D1与细胞中RPAP3、UXT、PFD2、PFD6、MONAD/WDR92、PIP、CALM1、PKM和LCN1等相互作用,提示PIH1D1可能参与细胞中RNApol Ⅱ组装、细胞凋亡、钙调蛋白通路等多种生理过程.

  13. Alternative spliced CD1d transcripts in human bronchial epithelial cells.

    Directory of Open Access Journals (Sweden)

    Kambez Hajipouran Benam

    Full Text Available CD1d is a MHC I like molecule which presents glycolipid to natural killer T (NKT cells, a group of cells with diverse but critical immune regulatory functions in the immune system. These cells are required for optimal defence against bacterial, viral, protozoan, and fungal infections, and control of immune-pathology and autoimmune diseases. CD1d is expressed on antigen presenting cells but also found on some non-haematopoietic cells. However, it has not been observed on bronchial epithelium, a site of active host defence in the lungs. Here, we identify for the first time, CD1D mRNA variants and CD1d protein expression on human bronchial epithelial cells, describe six alternatively spliced transcripts of this gene in these cells; and show that these variants are specific to epithelial cells. These findings provide the basis for investigations into a role for CD1d in lung mucosal immunity.

  14. Influence of lipid rafts on CD1d presentation by dendritic cells

    DEFF Research Database (Denmark)

    Peng, Wei; Martaresche, Cecile; Escande-Beillard, Nathalie

    2011-01-01

    corresponding to lipid rafts and we describe that alpha-GalCer enhanced CD1d amount in the low density detergent insoluble fraction. We conclude that the membrane environment of CD1d can influence antigen presentation mainly when the endocytic pathway is required. Flow cytometry analysis can provide additional...... information on lipid rafts in plasma membranes and allows a dynamics follow-up of lipid rafts partitioning. Using this method, we showed that CD1d plasma membrane expression was sensitive to low concentrations of detergent. This may suggest either that CD1d is associated with lipid rafts mainly......Our main objective was to analyze the role of lipid rafts in the activation of Valpha-14(-) and Valpha-14(+) T hybridomas by dendritic cells. We showed that activation of Valpha-14(+) hybridomas by dendritic cells or other CD1d-expressing cells was altered by disruption of lipid rafts...

  15. Tctex1d2 Is a Negative Regulator of GLUT4 Translocation and Glucose Uptake.

    Science.gov (United States)

    Shimoda, Yoko; Okada, Shuichi; Yamada, Eijiro; Pessin, Jeffrey E; Yamada, Masanobu

    2015-10-01

    Tctex1d2 (Tctex1 domain containing 2) is an open reading frame that encodes for a functionally unknown protein that contains a Tctex1 domain found in dynein light chain family members. Examination of gene expression during adipogenesis demonstrated a marked increase in Tctex1d2 protein expression that was essentially undetectable in preadipocytes and markedly induced during 3T3-L1 adipocyte differentiation. Tctex1d2 overexpression significantly inhibited insulin-stimulated glucose transporter 4 (GLUT4) translocation and 2-deoxyglucose uptake. In contrast, Tctex1d2 knockdown significantly increased insulin-stimulated GLUT4 translocation and 2-deoxyglucose uptake. However, acute insulin stimulation (up to 30 min) in 3T3-L1 adipocytes with overexpression or knockdown of Tctex1d2 had no effect on Akt phosphorylation, a critical signal transduction target required for GLUT4 translocation. Although overexpression of Tctex1d2 had no significant effect on GLUT4 internalization, Tctex1d2 was found to associate with syntaxin 4 in an insulin-dependent manner and inhibit Doc2b binding to syntaxin 4. In addition, glucose-dependent insulinotropic polypeptide rescued the Tctex1d2 inhibition of insulin-stimulated GLUT4 translocation by suppressing the Tctex1d2-syntaxin 4 interaction and increasing Doc2b-Synatxin4 interactions. Taking these results together, we hypothesized that Tctex1d2 is a novel syntaxin 4 binding protein that functions as a negative regulator of GLUT4 plasma membrane translocation through inhibition of the Doc2b-syntaxin 4 interaction.

  16. Towards the development of a fully coupled arterial-venous 1D model: suitability of using a 1D finite volume method with staggered spatial discretization

    CSIR Research Space (South Africa)

    Bogaers, Alfred EJ

    2012-07-01

    Full Text Available In this paper we outline the development of a 1D finite volume model to solve for blood flow through the arterial system. The model is based on a staggered spatial discretization which leads to a stable solution scheme. This scheme can accurately...

  17. Structure and Catalytic Mechanism of Human Steroid 5-Reductase (AKR1D1)

    Energy Technology Data Exchange (ETDEWEB)

    Costanzo, L.; Drury, J; Christianson, D; Penning, T

    2009-01-01

    Human steroid 5{beta}-reductase (aldo-keto reductase (AKR) 1D1) catalyzes reduction of {Delta}{sup 4}-ene double bonds in steroid hormones and bile acid precursors. We have reported the structures of an AKR1D1-NADP{sup +} binary complex, and AKR1D1-NADP{sup +}-cortisone, AKR1D1-NADP{sup +}-progesterone and AKR1D1-NADP{sup +}-testosterone ternary complexes at high resolutions. Recently, structures of AKR1D1-NADP{sup +}-5{beta}-dihydroprogesterone complexes showed that the product is bound unproductively. Two quite different mechanisms of steroid double bond reduction have since been proposed. However, site-directed mutagenesis supports only one mechanism. In this mechanism, the 4-pro-R hydride is transferred from the re-face of the nicotinamide ring to C5 of the steroid substrate. E120, a unique substitution in the AKR catalytic tetrad, permits a deeper penetration of the steroid substrate into the active site to promote optimal reactant positioning. It participates with Y58 to create a 'superacidic' oxyanion hole for polarization of the C3 ketone. A role for K87 in the proton relay proposed using the AKR1D1-NADP{sup +}-5{beta}-dihydroprogesterone structure is not supported.

  18. Use of optimized 1D TOCSY NMR for improved quantitation and metabolomic analysis of biofluids

    Energy Technology Data Exchange (ETDEWEB)

    Sandusky, Peter [Eckerd College, Department of Chemistry (United States); Appiah-Amponsah, Emmanuel; Raftery, Daniel, E-mail: raftery@purdue.edu [Purdue University, Department of Chemistry (United States)

    2011-04-15

    One dimensional selective TOCSY experiments have been shown to be advantageous in providing improved data inputs for principle component analysis (PCA) (Sandusky and Raftery 2005a, b). Better subpopulation cluster resolution in the observed scores plots results from the ability to isolate metabolite signals of interest via the TOCSY based filtering approach. This report reexamines the quantitative aspects of this approach, first by optimizing the 1D TOCSY experiment as it relates to the measurement of biofluid constituent concentrations, and second by comparing the integration of 1D TOCSY read peaks to the bucket integration of 1D proton NMR spectra in terms of precision and accuracy. This comparison indicates that, because of the extensive peak overlap that occurs in the 1D proton NMR spectra of biofluid samples, bucket integrals are often far less accurate as measures of individual constituent concentrations than 1D TOCSY read peaks. Even spectral fitting approaches have proven difficult in the analysis of significantly overlapped spectral regions. Measurements of endogenous taurine made over a sample population of human urine demonstrates that, due to background signals from other constituents, bucket integrals of 1D proton spectra routinely overestimate the taurine concentrations and distort its variation over the sample population. As a result, PCA calculations performed using data matrices incorporating 1D TOCSY determined taurine concentrations produce better scores plot subpopulation cluster resolution.

  19. Growth and Magnetic Characterization of 1D Permalloy Nanowires Using Self Developed Anodic Aluminium Oxide Templates.

    Science.gov (United States)

    Singh, Ashutosh K; Mandal, Kalyan

    2016-01-01

    1D Permalloy refers to arrays of nanowires (NWs) made of an alloy of Ni and Fe with 80 and 20 at% composition respectively. In the present work 1 D Permalloy NWs arrays were fabricated into the pores of self engineered Anodic Aluminium Oxide (AAO) templates by a simple electrodeposition technique (EDT). By varying the anodization voltage and parameters of the electrolyte solutions we developed AAO templates with different average pore diameters (40 nm to 70 nm) and developed 1D Permalloy NWs within them. Structural characterization of AAO templates and 1D Permalloy NWs were performed by Transmission and Scanning Electron Microscopy (TEM and SEM respectively). X-ray diffraction (XRD) studies of 1D Permalloy NWs showed their fcc crystalline structure and the AAO template was found to be amorphous in nature. Magnetic studies showed the 1D Permalloy NWs arrays to have strong shape anisotropy, and the easy axis was found to be parallel to the NWs axis. We studied the angular dependence of magnetic properties of the NWs. Coercivity (Hc) and remanence (Mr/Ms) measured along the NWs axis were found to be higher than those measured in a direction perpendicular to the NWs axis. 1D Permalloy NWs developed in this work have the potential to be used in magnetic recording devices.

  20. On the Current Drive Capability of Low Dimensional Semiconductors: 1D versus 2D

    Science.gov (United States)

    Zhu, Y.; Appenzeller, J.

    2015-10-01

    Low-dimensional electronic systems are at the heart of many scaling approaches currently pursuit for electronic applications. Here, we present a comparative study between an array of one-dimensional (1D) channels and its two-dimensional (2D) counterpart in terms of current drive capability. Our findings from analytical expressions derived in this article reveal that under certain conditions an array of 1D channels can outperform a 2D field-effect transistor because of the added degree of freedom to adjust the threshold voltage in an array of 1D devices.

  1. TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport

    Science.gov (United States)

    Schmidts, Miriam; Hou, Yuqing; Cortés, Claudio R.; Mans, Dorus A.; Huber, Celine; Boldt, Karsten; Patel, Mitali; van Reeuwijk, Jeroen; Plaza, Jean-Marc; van Beersum, Sylvia E. C.; Yap, Zhi Min; Letteboer, Stef J. F.; Taylor, S. Paige; Herridge, Warren; Johnson, Colin A.; Scambler, Peter J.; Ueffing, Marius; Kayserili, Hulya; Krakow, Deborah; King, Stephen M.; Beales, Philip L.; Al-Gazali, Lihadh; Wicking, Carol; Cormier-Daire, Valerie; Roepman, Ronald; Mitchison, Hannah M.; Witman, George B.; Al-Turki, Saeed; Anderson, Carl; Anney, Richard; Antony, Dinu; Asimit, Jennifer; Ayub, Mohammad; Barrett, Jeff; Barroso, Inês; Bentham, Jamie; Bhattacharya, Shoumo; Blackwood, Douglas; Bobrow, Martin; Bochukova, Elena; Bolton, Patrick; Boustred, Chris; Breen, Gerome; Brion, Marie-Jo; Brown, Andrew; Calissano, Mattia; Carss, Keren; Chatterjee, Krishna; Chen, Lu; Cirak, Sebhattin; Clapham, Peter; Clement, Gail; Coates, Guy; Collier, David; Cosgrove, Catherine; Cox, Tony; Craddock, Nick; Crooks, Lucy; Curran, Sarah; Daly, Allan; Danecek, Petr; Smith, George Davey; Day-Williams, Aaron; Day, Ian; Durbin, Richard; Edkins, Sarah; Ellis, Peter; Evans, David; Farooqi, I. Sadaf; Fatemifar, Ghazaleh; Fitzpatrick, David; Flicek, Paul; Floyd, Jamie; Foley, A. Reghan; Franklin, Chris; Futema, Marta; Gallagher, Louise; Gaunt, Tom; Geschwind, Daniel; Greenwood, Celia; Grozeva, Detelina; Guo, Xiaosen; Gurling, Hugh; Hart, Deborah; Hendricks, Audrey; Holmans, Peter; Huang, Jie; Humphries, Steve E.; Hurles, Matt; Hysi, Pirro; Jackson, David; Jamshidi, Yalda; Jewell, David; Chris, Joyce; Kaye, Jane; Keane, Thomas; Kemp, John; Kennedy, Karen; Kent, Alastair; Kolb-Kokocinski, Anja; Lachance, Genevieve; Langford, Cordelia; Lee, Irene; Li, Rui; Li, Yingrui; Ryan, Liu; Lönnqvist, Jouko; Lopes, Margarida; MacArthur, Daniel G.; Massimo, Mangino; Marchini, Jonathan; Maslen, John; McCarthy, Shane; McGuffin, Peter; McIntosh, Andrew; McKechanie, Andrew; McQuillin, Andrew; Memari, Yasin; Metrustry, Sarah; Min, Josine; Moayyeri, Alireza; Morris, James; Muddyman, Dawn; Muntoni, Francesco; Northstone, Kate; O'Donovan, Michael; O'Rahilly, Stephen; Onoufriadis, Alexandros; Oualkacha, Karim; Owen, Michael; Palotie, Aarno; Panoutsopoulou, Kalliope; Parker, Victoria; Parr, Jeremy; Paternoster, Lavinia; Paunio, Tiina; Payne, Felicity; Perry, John; Pietilainen, Olli; Plagnol, Vincent; Quail, Michael A.; Quaye, Lydia; Raymond, Lucy; Rehnström, Karola; Brent Richards, J.; Ring, Sue; Ritchie, Graham R S; Savage, David B.; Schoenmakers, Nadia; Semple, Robert K.; Serra, Eva; Shihab, Hashem; Shin, So-Youn; Skuse, David; Small, Kerrin; Smee, Carol; Soler, Artigas María; Soranzo, Nicole; Southam, Lorraine; Spector, Tim; St Pourcain, Beate; St. Clair, David; Stalker, Jim; Surdulescu, Gabriela; Suvisaari, Jaana; Tachmazidou, Ioanna; Tian, Jing; Timpson, Nic; Tobin, Martin; Valdes, Ana; van Kogelenberg, Margriet; Vijayarangakannan, Parthiban; Wain, Louise; Walter, Klaudia; Wang, Jun; Ward, Kirsten; Wheeler, Ellie; Whittall, Ros; Williams, Hywel; Williamson, Kathy; Wilson, Scott G.; Wong, Kim; Whyte, Tamieka; ChangJiang, Xu; Zeggini, Eleftheria; Zhang, Feng; Zheng, Hou-Feng

    2015-01-01

    The analysis of individuals with ciliary chondrodysplasias can shed light on sensitive mechanisms controlling ciliogenesis and cell signalling that are essential to embryonic development and survival. Here we identify TCTEX1D2 mutations causing Jeune asphyxiating thoracic dystrophy with partially penetrant inheritance. Loss of TCTEX1D2 impairs retrograde intraflagellar transport (IFT) in humans and the protist Chlamydomonas, accompanied by destabilization of the retrograde IFT dynein motor. We thus define TCTEX1D2 as an integral component of the evolutionarily conserved retrograde IFT machinery. In complex with several IFT dynein light chains, it is required for correct vertebrate skeletal formation but may be functionally redundant under certain conditions. PMID:26044572

  2. Spatial and frequency domain effects of defects in 1D photonic crystal

    CERN Document Server

    Rudziński, A; Szczepański, P; 10.1007/s11082-007-9095-3

    2009-01-01

    The aim of this paper is to present the analysis of influence of defects in 1D photonic crystal (PC) on the density of states and simultaneously spontaneous emission, in both spatial and frequency domains. In our investigations we use an analytic model of 1D PC with defects. Our analysis reveals how presence of a defect causes a defect mode to appear. We show that a defect in 1D PC has local character, being negligible in regions of PC situated far from the defected elementary cell. We also analyze the effect of multiple defects, which lead to photonic band gap splitting.

  3. On the Current Drive Capability of Low Dimensional Semiconductors: 1D versus 2D.

    Science.gov (United States)

    Zhu, Y; Appenzeller, J

    2015-12-01

    Low-dimensional electronic systems are at the heart of many scaling approaches currently pursuit for electronic applications. Here, we present a comparative study between an array of one-dimensional (1D) channels and its two-dimensional (2D) counterpart in terms of current drive capability. Our findings from analytical expressions derived in this article reveal that under certain conditions an array of 1D channels can outperform a 2D field-effect transistor because of the added degree of freedom to adjust the threshold voltage in an array of 1D devices.

  4. Ruthenium and osmium complexes of hemilabile chiral monophosphinite ligands derived from 1D-pinitol or 1D-chiro-inositol as catalysts for asymmetric hydrogenation reactions.

    Science.gov (United States)

    Slade, Angela T; Lensink, Cornelis; Falshaw, Andrew; Clark, George R; Wright, L James

    2014-12-07

    The monophosphinite ligands, 1D-1,2;5,6-di-O-cyclopentylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P1), 1D-1,2;5,6-di-O-isopropylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P2), 1D-1,2;5,6-di-O-cyclohexylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P3), and 1D-1,2;5,6-di-O-cyclopentylidene-3-O-ethyl-4-O-diphenylphosphino-chiro-inositol (D-P4), can be conveniently prepared from the chiral natural products 1D-pinitol or 1D-chiro-inositol. On treatment of toluene solutions of RuCl2(PPh3)3 with two mole equivalents of the ligands D-PY (Y = 1-4) the complexes RuCl2(D-P1)2 (1), RuCl2(D-P2)2 (4), RuCl2(D-P3)2 (5), or RuCl2(D-P4)2 (6), respectively, are formed. Similarly, treatment of OsCl2(PPh3)3 with D-P1 gives OsCl2(D-P1)2 (7). The single crystal X-ray structure determination of 1 reveals that each D-P1 ligand coordinates to ruthenium through phosphorus and the oxygen atom of the methoxyl group. Treatment of 1 with excess LiBr or LiI results in metathesis of the chloride ligands and RuBr2(D-P1)2 (2) or RuI2(D-P1)2 (3), respectively, are formed. Exposure of a solution of 1 to carbon monoxide results in the very rapid formation of RuCl2(CO)2(D-P1)2 (8), thereby demonstrating the ease with which the oxygen donors are displaced from the metal and hence the hemilabile nature of the two bidentate D-P1 ligands in 1. Preliminary studies indicate that 1-7 act as catalysts for the asymmetric hydrogenation reactions of acetophenone and 3-quinuclidinone to give the corresponding alcohols in generally high conversions but low enantiomeric excesses.

  5. Derivative expansion and the induced Chern-Simons term in N=1, d=3 superspace

    CERN Document Server

    Gama, F S; Petrov, A Yu

    2015-01-01

    In this paper we apply a supersymmetric generalization of the method of derivative expansion to compute the induced non-Abelian Chern-Simons term in $\\mathcal{N}=1$, $d=3$ superspace, for an arbitrary gauge group.

  6. Experimental Conditions: SE24_S1_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available rometry with 13C‑Labeling for Chemical Assignment of Sulfur-Containing Metabolites ...SE24_S1_M1_D1 SE24 Combination of Liquid Chromatography-Fourier Transform Ion Cyclotron Resonance-Mass Spect

  7. Vorticity and Λ polarization in event-by-event (3+1)D viscous hydrodynamics

    Science.gov (United States)

    Pang, Long-Gang; Fang, Ren-Hong; Petersen, Hannah; Wang, Qun; Wang, Xin-Nian

    2017-01-01

    We visualized the vortical fluid in fluctuating QGP using (3+1)D viscous hydrodynamics, computed the spin distribution and correlation of hyperons and estimated the polarization splitting between Λ and .

  8. Quasi-one dimensional (Q1D) nanostructures: Synthesis, integration and device application

    Science.gov (United States)

    Chien, Chung-Jen

    Quasi-one-dimensional (Q1D) nanostructures such as nanotubes and nanowires have been widely regarded as the potential building blocks for nanoscale electronic, optoelectronic and sensing devices. In this work, the content can be divided into three categories: Nano-material synthesis and characterizations, alignment and integration, physical properties and application. The dissertation consists of seven chapters as following. Chapter 1 will give an introduction to low dimensional nano-materials. Chapter 2 explains the mechanism how Q1D nanostructure grows. Chapter 3 describes the methods how we horizontally and vertically align the Q1D nanostructure. Chapter 4 and 5 are the electrical and optical device characterization respectively. Chapter 6 demonstrates the integration of Q1D nanostructures and the device application. The last chapter will discuss the future work and conclusion of the thesis.

  9. Multigroup confirmatory factor analysis of U.S. and Italian children's performance on the PASS theory of intelligence as measured by the Cognitive Assessment System.

    Science.gov (United States)

    Naglieri, Jack A; Taddei, Stefano; Williams, Kevin M

    2013-03-01

    This study examined Italian and U.S. children's performance on the English and Italian versions, respectively, of the Cognitive Assessment System (CAS; Naglieri & Conway, 2009; Naglieri & Das, 1997), a test based on a neurocognitive theory of intelligence entitled PASS (Planning, Attention, Simultaneous, and Successive; Naglieri & Das, 1997; Naglieri & Otero, 2011). CAS subtest, PASS scales, and Full Scale scores for Italian (N=809) and U.S. (N=1,174) samples, matched by age and gender, were examined. Multigroup confirmatory factor analysis results supported the configural invariance of the CAS factor structure between Italians and Americans for the 5- to 7-year-old (root-mean-square error of approximation [RMSEA]=.038; 90% confidence interval [CI]=.033, .043; comparative fit index [CFI]=.96) and 8- to 18-year-old (RMSEA=.036; 90% CI=.028, .043; CFI=.97) age groups. The Full Scale standard scores (using the U.S. norms) for the Italian (100.9) and U.S. (100.5) samples were nearly identical. The scores between the samples for the PASS scales were very similar, except for the Attention Scale (d=0.26), where the Italian sample's mean score was slightly higher. Negligible mean differences were found for 9 of the 13 subtest scores, 3 showed small d-ratios (2 in favor of the Italian sample), and 1 was large (in favor of the U.S. sample), but some differences in subtest variances were found. These findings suggest that the PASS theory, as measured by CAS, yields similar mean scores and showed factorial invariance for these samples of Italian and American children, who differ on cultural and linguistic characteristics. PsycINFO Database Record (c) 2013 APA, all rights reserved.

  10. Testing the measurement invariance of the EORTC QLQ-C30 across primary cancer sites using multi-group confirmatory factor analysis.

    Science.gov (United States)

    Costa, D S J; Aaronson, N K; Fayers, P M; Pallant, J F; Velikova, G; King, M T

    2015-01-01

    The EORTC Quality of Life Questionnaire is a widely used cancer-specific quality of life instrument comprising a core set of 30 items (QLQ-C30) supplemented by cancer site-specific modules. The purpose of this paper was to examine the extent to which the conventional multi-item domain structure of the QLQ-C30 holds across patients with seven different primary cancer sites. Multi-group confirmatory factor analysis was used to test whether a measurement model of the QLQ-C30 was invariant across cancer sites. Configural (same patterns of factor loadings), metric (equivalence of factor loadings) and scalar (equivalence of thresholds) invariance amongst the cancer site groups were assessed (N = 1,906) by comparing the fit of a model with these parameters freely estimated to a model where estimates were constrained to be equal for the corresponding items in each group. All groups exhibited good model fit except for the prostate group, which was excluded. Only 1 of 576 parameters was found to differ between primary sites: specifically, the first threshold of Item 1 in the breast cancer group exhibited non-invariance. In a post hoc analysis, several instances of non-invariance by treatment status (baseline, on-treatment, off-treatment) were observed. Given only one instance of non-invariance between cancer sites, there is a reason to be confident in the validity of conclusions drawn when comparing QLQ-C30 domain scores between different sites and when interpreting the scores of heterogeneous samples, although future research should assess the potential impact of confounding variables such as treatment and gender.

  11. Structural resistance of chemically modified 1-D nanostructured titanates in inorganic acid environment

    Energy Technology Data Exchange (ETDEWEB)

    Marinkovic, Bojan A., E-mail: bojan@puc-rio.br [Departamento de Engenharia de Materiais, Pontificia Universidade Catolica de Rio de Janeiro-PUC-Rio, Rua Marques de Sao Vicente 225, Gavea, RJ (Brazil); Fredholm, Yann C. [Nanogavea-Nanotecnologia Sustentavel Ltda, Av. Padre Leonel Franca 150, Gavea, RJ (Brazil); Morgado, Edisson [PETROBRAS S.A./CENPES, Research and Development Centre, Av. Horacio Macedo, 950, Cidade Universitaria, 21941-915, Rio de Janeiro, RJ (Brazil); Jardim, Paula M.; Rizzo, Fernando [Departamento de Engenharia de Materiais, Pontificia Universidade Catolica de Rio de Janeiro-PUC-Rio, Rua Marques de Sao Vicente 225, Gavea, RJ (Brazil)

    2010-10-15

    Sodium containing one-dimensional nanostructured layered titanates (1-D NSLT) were produced both from commercial anatase powder and Brazilian natural rutile mineral sands by alkali hydrothermal process. The 1-D NSLT were chemically modified with proton, cobalt or iron via ionic exchange and all products were additionally submitted to intensive inorganic acid aging (pH = 0.5) for 28 days. The morphology and crystal structure transformations of chemically modified 1-D NSLT were followed by transmission electron microscopy, powder X-ray diffraction, selected area electron diffraction and energy dispersive spectroscopy. It was found that the original sodium rich 1-D NSLT and cobalt substituted 1-D NSLT were completely converted to rutile nanoparticles, while the protonated form was transformed in a 70%-30% (by weight) anatase-rutile nanoparticles mixture, very similar to that of the well-known TiO{sub 2}-photocatalyst P25 (Degussa). The iron substituted 1-D NSLT presented better acid resistance as 13% of the original structure and morphology remained, the rest being converted in rutile. A significant amount of remaining 1-D NSLT was also observed after the acid treatment of the product obtained from rutile sand. The results showed that phase transformation of NSLT into titanium dioxide polymorph in inorganic acid conditions were controllable by varying the exchanged cations. Finally, the possibility to transform, through acid aging, 1-D NSLT obtained from Brazilian natural rutile sand into TiO{sub 2}-polymorphs was demonstrated for the first time to the best of authors' knowledge, opening path for producing TiO{sub 2}-nanoproducts with different morphologies through a simple process and from a low cost precursor.

  12. One-Dimensional (1D) ZnS Nanomaterials and Nanostructures

    Institute of Scientific and Technical Information of China (English)

    Xiaosheng FANG; Lide ZHANG

    2006-01-01

    One-dimensional (1D) nanomaterials and nanostructures have received much attention due to their potential interest for understanding fundamental physical concepts and for applications in constructing nanoscale electric and optoelectronic devices. Zinc sulfide (ZnS) is an important semiconductor compound of Ⅱ-Ⅵ group,and the synthesis of 1D ZnS nanomaterials and nanostructures has been of growing interest owing to their promising application in nanoscale optoelectronic devices. This paper reviews the recent progress on 1D ZnS nanomaterials and nanostructures, including nanowires, nanowire arrays, nanorods, nanobelts or nanoribbons,nanocables, and hierarchical nanostructures etc. This article begins with a survey of various methods that have been developed for generating 1D nanomaterials and nanostructures, and then mainly focuses on structures,synthesis, characterization, formation mechanisms and optical property tuning, and luminescence mechanisms of 1D ZnS nanomaterials and nanostructures. Finally, this review concludes with personal views towards future research on 1D ZnS nanomaterials and nanostructures.

  13. The structure of nanocomposite 1D cationic conductor crystal@SWNT.

    Science.gov (United States)

    Kiselev, N A; Kumskov, A S; Zakalyukin, R M; Vasiliev, A L; Chernisheva, M V; Eliseev, A A; Krestinin, A V; Freitag, B; Hutchison, J L

    2012-06-01

    Nanocomposites consisting of one-dimensional (1D) crystals of the cationic conductors CuI, CuBr and AgBr inside single-walled carbon nanotubes, mainly (n, 0), were obtained using the capillary technique. 1D crystal structure models were proposed based on the high resolution transmission electron microscopy performed on a FEI Titan 80-300 at 80 kV with aberration correction. According to the models and image simulations there are two modifications of 1D crystal: hexagonal close-packed bromine (iodine) anion sublattice (growth direction ) and 1D crystal cubic structure (growth direction ) compressed transversely to the nanotube (D(m) ∼1.33 nm) axis. Tentatively this kind of 1D crystal can be considered as monoclinic. One modification of the anion sublattice reversibly transforms into the other inside the nanotube, probably initiated by electron beam heating. As demonstrated by micrographs, copper or silver cations can occupy octahedral positions or are statistically distributed across two tetrahedral positions. A 1DAgBr@SWNT (18, 0; 19, 0) pseudoperiodic 'lattice distortion' is revealed resulting from convolution of the nanotube wall function image with 1D cubic crystal function image.

  14. HERMES Precision Results on g1p, g1d and g1n and the First Measurement of the Tensor Structure Function b1d

    CERN Document Server

    Riedl, C; Akopov, Z; Amarian, M; Ammosov, V V; Andrus, A; Aschenauer, E C; Augustyniak, W; Avakian, R; Avetisian, A; Avetissian, E; Bailey, P; Baturin, V; Baumgarten, C; Beckmann, M; Belostotskii, S; Bernreuther, S; Bianchi, N; Blok, H P; Böttcher, Helmut B; Borisov, A; Bouwhuis, M; Brack, J; Brüll, A; Bryzgalov, V V; Capitani, G P; Chiang, H C; Ciullo, G; Contalbrigo, M; Dalpiaz, P F; De Leo, R; De Nardo, L; De Sanctis, E; Devitsin, E G; Di Nezza, P; Düren, M; Ehrenfried, M; Elalaoui-Moulay, A; Elbakian, G M; Ellinghaus, F; Elschenbroich, U; Ely, J; Fabbri, R; Fantoni, A; Feshchenko, A; Felawka, L; Fox, B; Franz, J; Frullani, S; Gärber, Y; Gapienko, G; Gapienko, V; Garibaldi, F; Garrow, K; Garutti, E; Gaskell, D; Gavrilov, G E; Karibian, V; Graw, G; Grebenyuk, O; Greeniaus, L G; Hafidi, K; Hartig, M; Hasch, D; Heesbeen, D; Henoch, M; Hertenberger, R; Hesselink, W H A; Hillenbrand, A; Hoek, M; Holler, Y; Hommez, B; Iarygin, G; Ivanilov, A; Izotov, A; Jackson, H E; Jgoun, A; Kaiser, R; Kinney, E; Kiselev, A; Königsmann, K C; Kopytin, M; Korotkov, V A; Kozlov, V; Krauss, B; Krivokhizhin, V G; Lagamba, L; Lapikas, L; Laziev, A; Lenisa, P; Liebing, P; Lindemann, T; Lipka, K; Lorenzon, W; Lü, J; Maiheu, B; Makins, N C R; Marianski, B; Marukyan, H O; Masoli, F; Mexner, V; Meyners, N; Miklukho, O; Miller, C A; Miyachi, Y; Muccifora, V; Nagaitsev, A; Nappi, E; Naryshkin, Yu; Nass, A; Negodaev, M A; Nowak, Wolf-Dieter; Oganessyan, K; Ohsuga, H; Orlandi, G; Pickert, N; Potashov, S Yu; Potterveld, D H; Raithel, M; Reggiani, D; Reimer, P E; Reischl, A; Reolon, A R; Rith, K; Airapetian, A; Rosner, G; Rostomyan, A; Rubacek, L; Ryckbosch, D; Salomatin, Yu I; Sanjiev, I; Savin, I; Scarlett, C; Schäfer, A; Schill, C; Schnell, G; Schüler, K P; Schwind, A; Seele, J; Seidl, R; Seitz, B; Shanidze, R G; Shearer, C; Shibata, T A; Shutov, V B; Simani, M C; Sinram, K; Stancari, M D; Statera, M; Steffens, E; Steijger, J J M; Stewart, J; Stösslein, U; Tait, P; Tanaka, H; Taroian, S P; Tchuiko, B; Terkulov, A R; Tkabladze, A V; Trzcinski, A; Tytgat, M; Vandenbroucke, A; Van der Nat, P B; van der Steenhoven, G; Vetterli, Martin C; Vikhrov, V; Vincter, M G; Visser, J; Vogel, C; Vogt, M; Volmer, J; Weiskopf, C; Wendland, J; Wilbert, J; Ybeles-Smit, G V; Yen, S; Zihlmann, B; Zohrabyan, H G; Zupranski, P; Riedl, Caroline

    2005-01-01

    Final HERMES results on the proton, deuteron and neutron structure function g1 are presented in the kinematic range 0.00211d are presented.

  15. Stable Interacting $(2 + 1)d$ Conformal Field Theories at the Boundary of a class of $(3 + 1)d$ Symmetry Protected Topological Phases

    CERN Document Server

    Bi, Zhen; BenTov, Yoni; Xu, Cenke

    2016-01-01

    Motivated by recent studies of symmetry protected topological (SPT) phases, we explore the possible gapless quantum disordered phases in the $(2+1)d$ nonlinear sigma model defined on the Grassmannian manifold $\\frac{U(N)}{U(n)\\times U(N - n)}$ with a Wess-Zumino-Witten (WZW) term at level $k$, which is the effective low energy field theory of the boundary of certain $(3+1)d$ SPT states. With $k = 0$, this model has a well-controlled large-$N$ limit, $i.e.$ its renormalization group equations can be computed exactly with large-$N$. However, with the WZW term, the large-$N$ and large-$k$ limit alone is not sufficient for a reliable study of the nature of the quantum disordered phase. We demonstrate that at least for $n = 1$, through a combined large-$N$, large-$k$ and $3-\\epsilon$ generalization, a stable fixed point in the quantum disordered phase can be reliably located, which corresponds to a $(2+1)d$ strongly interacting conformal field theory. Extension of our method to $n > 1$ will also be discussed.

  16. Benchmarks and models for 1-D radiation transport in stochastic participating media

    Energy Technology Data Exchange (ETDEWEB)

    Miller, D S

    2000-08-21

    Benchmark calculations for radiation transport coupled to a material temperature equation in a 1-D slab and 1-D spherical geometry binary random media are presented. The mixing statistics are taken to be homogeneous Markov statistics in the 1-D slab but only approximately Markov statistics in the 1-D sphere. The material chunk sizes are described by Poisson distribution functions. The material opacities are first taken to be constant and then allowed to vary as a strong function of material temperature. Benchmark values and variances for time evolution of the ensemble average of material temperature energy density and radiation transmission are computed via a Monte Carlo type method. These benchmarks are used as a basis for comparison with three other approximate methods of solution. One of these approximate methods is simple atomic mix. The second approximate model is an adaptation of what is commonly called the Levermore-Pomraning model and which is referred to here as the standard model. It is shown that recasting the temperature coupling as a type of effective scattering can be useful in formulating the third approximate model, an adaptation of a model due to Su and Pomraning which attempts to account for the effects of scattering in a stochastic context. This last adaptation shows consistent improvement over both the atomic mix and standard models when used in the 1-D slab geometry but shows limited improvement in the 1-D spherical geometry. Benchmark values are also computed for radiation transmission from the 1-D sphere without material heating present. This is to evaluate the performance of the standard model on this geometry--something which has never been done before. All of the various tests demonstrate the importance of stochastic structure on the solution. Also demonstrated are the range of usefulness and limitations of a simple atomic mix formulation.

  17. VES/TEM 1D joint inversion by using Controlled Random Search (CRS) algorithm

    Science.gov (United States)

    Bortolozo, Cassiano Antonio; Porsani, Jorge Luís; Santos, Fernando Acácio Monteiro dos; Almeida, Emerson Rodrigo

    2015-01-01

    Electrical (DC) and Transient Electromagnetic (TEM) soundings are used in a great number of environmental, hydrological, and mining exploration studies. Usually, data interpretation is accomplished by individual 1D models resulting often in ambiguous models. This fact can be explained by the way as the two different methodologies sample the medium beneath surface. Vertical Electrical Sounding (VES) is good in marking resistive structures, while Transient Electromagnetic sounding (TEM) is very sensitive to conductive structures. Another difference is VES is better to detect shallow structures, while TEM soundings can reach deeper layers. A Matlab program for 1D joint inversion of VES and TEM soundings was developed aiming at exploring the best of both methods. The program uses CRS - Controlled Random Search - algorithm for both single and 1D joint inversions. Usually inversion programs use Marquadt type algorithms but for electrical and electromagnetic methods, these algorithms may find a local minimum or not converge. Initially, the algorithm was tested with synthetic data, and then it was used to invert experimental data from two places in Paraná sedimentary basin (Bebedouro and Pirassununga cities), both located in São Paulo State, Brazil. Geoelectric model obtained from VES and TEM data 1D joint inversion is similar to the real geological condition, and ambiguities were minimized. Results with synthetic and real data show that 1D VES/TEM joint inversion better recovers simulated models and shows a great potential in geological studies, especially in hydrogeological studies.

  18. 1D pixelated MV portal imager with structured privacy film: a feasibility study

    Science.gov (United States)

    Baturin, Pavlo; Shedlock, Daniel; Myronakis, Marios; Berbeco, Ross; Star-Lack, Josh

    2017-03-01

    Modern amorphous silicon flat panel-based electronic portal imaging devices that utilize thin gadolinium oxysulfide scintillators suffer from low quantum efficiencies (QEs). Thick two dimensionally (2D) pixelated scintillator arrays offer an effective but expensive option for increasing QE. To reduce costs, we have investigated the possibility of combining a thick one dimensional (1D) pixelated scintillator (PS) with an orthogonally placed 1D structured optical filter to provide for overall good 2D spatial resolution. In this work, we studied the potential for using a 1D video screen privacy film (PF) to serve as a directional optical attenuator and filter. A Geant4 model of the PF was built based on reflection and transmission measurements taken with a laser-based optical reflectometer. This information was incorporated into a Geant4-based x-ray detector simulator to generate modulation transfer functions (MTFs), noise power spectra (NPS), and detective quantum efficiencies (DQEs) for various 1D and 2D configurations. It was found that the 1D array with PF can provide the MTFs and DQEs of 2D arrays. Although the PF significantly reduced the amount of optical photons detected by the flat panel, we anticipate using a scintillator with an inherently high optical yield (e.g. cesium iodide) for MV imaging, where fluence rates are inherently high, will still provide adequate signal intensities for the imaging tasks associated with radiotherapy.

  19. Theory of a 3+1D fractional chiral metal: Interacting variant of the Weyl semimetal

    Science.gov (United States)

    Meng, Tobias; Grushin, Adolfo G.; Shtengel, Kirill; Bardarson, Jens H.

    2016-10-01

    Formulating consistent theories describing strongly correlated metallic topological phases is an outstanding problem in condensed-matter physics. In this work, we derive a theory defining a fractionalized analog of the Weyl semimetal state: the fractional chiral metal. Our approach is to construct a 4+1D quantum Hall insulator by stacking 3+1D Weyl semimetals in a magnetic field. In a strong enough field, the low-energy physics is determined by the lowest Landau level of each Weyl semimetal, which is highly degenerate and chiral, motivating us to use a coupled-wire approach. The one-dimensional dispersion of the lowest Landau level allows us to model the system as a set of degenerate 1+1D quantum wires that can be bosonized in the presence of electron-electron interactions and coupled such that a gapped phase is obtained whose response to an electromagnetic field is given in terms of a Chern-Simons field theory. At the boundary of this phase, we obtain the field theory of a 3+1D gapless fractional chiral state, which we show is consistent with a previous theory for the surface of a 4+1D Chern-Simons theory. The boundary's response to an external electromagnetic field is determined by a chiral anomaly with a fractionalized coefficient. We suggest that such an anomalous response can be taken as a working definition of a fractionalized strongly correlated analog of the Weyl semimetal state.

  20. Deconvolution of Complex 1D NMR Spectra Using Objective Model Selection.

    Directory of Open Access Journals (Sweden)

    Travis S Hughes

    Full Text Available Fluorine (19F NMR has emerged as a useful tool for characterization of slow dynamics in 19F-labeled proteins. One-dimensional (1D 19F NMR spectra of proteins can be broad, irregular and complex, due to exchange of probe nuclei between distinct electrostatic environments; and therefore cannot be deconvoluted and analyzed in an objective way using currently available software. We have developed a Python-based deconvolution program, decon1d, which uses Bayesian information criteria (BIC to objectively determine which model (number of peaks would most likely produce the experimentally obtained data. The method also allows for fitting of intermediate exchange spectra, which is not supported by current software in the absence of a specific kinetic model. In current methods, determination of the deconvolution model best supported by the data is done manually through comparison of residual error values, which can be time consuming and requires model selection by the user. In contrast, the BIC method used by decond1d provides a quantitative method for model comparison that penalizes for model complexity helping to prevent over-fitting of the data and allows identification of the most parsimonious model. The decon1d program is freely available as a downloadable Python script at the project website (https://github.com/hughests/decon1d/.

  1. Noncoherent Spectral Optical CDMA System Using 1D Active Weight Two-Code Keying Codes

    Directory of Open Access Journals (Sweden)

    Bih-Chyun Yeh

    2016-01-01

    Full Text Available We propose a new family of one-dimensional (1D active weight two-code keying (TCK in spectral amplitude coding (SAC optical code division multiple access (OCDMA networks. We use encoding and decoding transfer functions to operate the 1D active weight TCK. The proposed structure includes an optical line terminal (OLT and optical network units (ONUs to produce the encoding and decoding codes of the proposed OLT and ONUs, respectively. The proposed ONU uses the modified cross-correlation to remove interferences from other simultaneous users, that is, the multiuser interference (MUI. When the phase-induced intensity noise (PIIN is the most important noise, the modified cross-correlation suppresses the PIIN. In the numerical results, we find that the bit error rate (BER for the proposed system using the 1D active weight TCK codes outperforms that for two other systems using the 1D M-Seq codes and 1D balanced incomplete block design (BIBD codes. The effective source power for the proposed system can achieve −10 dBm, which has less power than that for the other systems.

  2. Transparent Conducting Electrodes based on 1D and 2D Ag Nanogratings for Organic Photovoltaics

    CERN Document Server

    Zeng, Beibei; Bartoli, Filbert J

    2014-01-01

    The optical and electrical properties of optically-thin one-dimensional (1D) Ag nanogratings and two-dimensional (2D) Ag nanogrids are studied, and their use as transparent electrodes in organic photovoltaics are explored. A large broadband and polarization-insensitive optical absorption enhancement in the organic light-harvesting layers is theoretically and numerically demonstrated using either single-layer 2D Ag nanogrids or two perpendicular 1D Ag nanogratings, and is attributed to the excitation of surface plasmon resonances and plasmonic cavity modes. Total photon absorption enhancements of 150% and 200% are achieved for the optimized single-layer 2D Ag nanogrids and double (top and bottom) perpendicular 1D Ag nanogratings, respectively.

  3. Solution to 1-D consolidation of non-homogeneous soft clay

    Institute of Scientific and Technical Information of China (English)

    XIE Kang-he; WEN Jie-bang; XIA Jian-zhong

    2005-01-01

    In this work, semi-analytical methods were used to solve the problem of 1-D consolidation of non-homogeneous soft clay with spatially varying coefficients of permeability and compressibility. The semi-analytical solution was programmed and then verified by comparison with the obtained analytical solution of a special case. Based on the results of some computations and comparisons with the 1-D homogeneous consolidation (by Terzaghi) and the 1-D non-linear consolidation theory (by Davis et al.)of soft clay, some diagrams were prepared and the relevant consolidation behavior of non-homogeneous soils is discussed. It was shown that the result obtained differs greatly from Terzaghi's theory and that of the non-linear consolidation theory when the coefficients of permeability and compressibility vary greatly.

  4. REAL-TIME FLOOD FORECASTING METHOD WITH 1-D UNSTEADY FLOW MODEL

    Institute of Scientific and Technical Information of China (English)

    MU Jin-bin; ZHANG Xiao-feng

    2007-01-01

    A real-time forecasting method coupled with the 1-D unsteady flow model with the recursive least-square method was developed. The 1-D unsteady flow model was modified by using the time-variant parameter and revising it dynamically through introducing a variable weighted forgetting factor, such that the output of the model could be adjusted for the real time forecasting of floods. The application of the new real time forecasting model in the reach from Yichang to Luoshan of the Yangtze River was demonstrated. Computational result shows that the forecasting accuracy of the new model is much higher than that of the original 1-D unsteady flow model. The method developed is effective for flood forecasting, and can be used for practical operation in the flood forecasting.

  5. PC-1D installation manual and user's guide

    Energy Technology Data Exchange (ETDEWEB)

    Basore, P.A.

    1991-05-01

    PC-1D is a software package for personal computers that uses finite-element analysis to solve the fully-coupled two-carrier semiconductor transport equations in one dimension. This program is particularly useful for analyzing the performance of optoelectronic devices such as solar cells, but can be applied to any bipolar device whose carrier flows are primarily one-dimensional. This User's Guide provides the information necessary to install PC-1D, define a problem for solution, solve the problem, and examine the results. Example problems are presented which illustrate these steps. The physical models and numerical methods utilized are presented in detail. This document supports version 3.1 of PC-1D, which incorporates faster numerical algorithms with better convergence properties than previous versions of the program. 51 refs., 17 figs., 5 tabs.

  6. New multi-camera calibration algorithm based on 1D objects

    Institute of Scientific and Technical Information of China (English)

    Zi-jian ZHAO; Yun-cai LIU

    2008-01-01

    A new calibration algorithm for multi-camera systems using 1D calibration objects is proposed. The algorithm integrates the rank-4 factorization with Zhang (2004)'s method. The intrinsic parameters as well as the extrinsic parameters are recovered by capturing with cameras the 1D object's rotations around a fixed point. The algorithm is based on factorization of the scaled measurement matrix, the projective depth of which is estimated in an analytical equation instead of a recursive form. For more than three points on a 1D object, the approach of our algorithm is to extend the scaled measurement matrix. The obtained parameters are finally refined through the maximum likelihood inference. Simulations and experiments with real images verify that the proposed technique achieves a good trade-off between the intrinsic and extrinsic camera parameters.

  7. Recent advances in bioactive 1D and 2D carbon nanomaterials for biomedical applications.

    Science.gov (United States)

    Erol, Ozlem; Uyan, Idil; Hatip, Meryem; Yilmaz, Canelif; Tekinay, Ayse B; Guler, Mustafa O

    2017-05-26

    One-dimensional (1D) carbon nanotubes (CNTs) and the two-dimensional (2D) graphene represent the most widely studied allotropes of carbon. Due to their unique structural, electrical, mechanical and optical properties, 1D and 2D carbon nanostructures are considered to be leading candidates for numerous applications in biomedical fields, including tissue engineering, drug delivery, bioimaging and biosensors. The biocompatibility and toxicity issues associated with these nanostructures have been a critical impediment for their use in biomedical applications. In this review, we present an overview of the various materials types, properties, functionalization strategies and characterization methods of 1D and 2D carbon nanomaterials and their derivatives in terms of their biomedical applications. In addition, we discuss various factors and mechanisms affecting their toxicity and biocompatibility. Copyright © 2017 Elsevier Inc. All rights reserved.

  8. Microstates of D1-D5(-P) black holes as interacting D-branes

    CERN Document Server

    Morita, Takeshi

    2014-01-01

    In our previous study [1] (1311.6540), we figured out that the thermodynamics of the near extremal black $p$-branes can be explained as the collective motions of gravitationally interacting elementary $p$-branes (the $p$-soup proposal). We test this proposal in the near-extremal D1-D5 and D1-D5-P black holes and show that their thermodynamics also can be explained in a similar fashion, i.e. via the collective motions of the interacting elementary D1-branes and D5-branes (and waves). It may imply that the microscopic origins of these intersecting black branes and the black $p$-brane are explained in the unified picture. We also argue the relation between the $p$-soup proposal and the conformal field theory calculations of the D1-D5(-P) black holes in superstring theory.

  9. Microstates of D1-D5(-P) black holes, as interacting D-branes

    Science.gov (United States)

    Morita, Takeshi; Shiba, Shotaro

    2015-07-01

    In our previous study (Morita et al., 2014 [1]), we figured out that the thermodynamics of the near extremal black p-branes can be explained as the collective motions of gravitationally interacting elementary p-branes (the p-soup proposal). We test this proposal in the near-extremal D1-D5 and D1-D5-P black holes and show that their thermodynamics also can be explained in a similar fashion, i.e. via the collective motions of the interacting elementary D1-branes and D5-branes (and waves). It may imply that the microscopic origins of these intersecting black branes and the black p-brane are explained in the unified picture. We also argue the relation between the p-soup proposal and the conformal field theory calculations of the D1-D5(-P) black holes in superstring theory.

  10. 3+1D Massless Weyl Spinors from Bosonic Scalar-Tensor Duality

    Directory of Open Access Journals (Sweden)

    Andrea Amoretti

    2014-01-01

    Full Text Available We consider the fermionization of a bosonic-free theory characterized by the 3+1D scalar-tensor duality. This duality can be interpreted as the dimensional reduction, via a planar boundary, of the 4+1D topological BF theory. In this model, adopting the Sommerfield tomographic representation of quantized bosonic fields, we explicitly build a fermionic operator and its associated Klein factor such that it satisfies the correct anticommutation relations. Interestingly, we demonstrate that this operator satisfies the massless Dirac equation and that it can be identified with a 3+1D Weyl spinor. Finally, as an explicit example, we write the integrated charge density in terms of the tomographic transformed bosonic degrees of freedom.

  11. DEVELOPMENT OF COUPLED 1D-2D MATHEMATICAL MODELS FOR TIDAL RIVERS

    Institute of Scientific and Technical Information of China (English)

    XU Zu-xin; YIN Hai-long

    2004-01-01

    Some coupled 1D-2D hydrodynamic and water quality models depicting tidal water bodies with complex topography were presented. For the coupled models, finite element method was used to solve the governing equations so as to study tidal rivers with complex topography. Since the 1D and 2D models were coupled, the principle of model coupling was proposed to account appropriately for the factors of water level, flow and pollutant flux and the related dynamical behavior was simulated. Specifically the models were used to probe quantitative pollution contribution of receiving water from neighboring Jiangsu and Zhejiang Provinces to the pollution in the Huangpu River passing through Shanghai City. Numerical examples indicated that the developed coupled 1D-2D models are applicable in tidal river network region of Shanghai.

  12. 3+1D Massless Weyl spinors from bosonic scalar-tensor duality

    CERN Document Server

    Amoretti, Andrea; Caruso, Giacomo; Maggiore, Nicola; Magnoli, Nicodemo

    2013-01-01

    We consider the fermionization of a bosonic free theory characterized by the 3+1D scalar - tensor duality. This duality can be interpreted as the dimensional reduction, via a planar boundary, of the 4+1D topological BF theory. In this model, adopting the Sommerfield tomographic representation of quantized bosonic fields, we explicitly build a fermionic operator and its associated Klein factor such that it satisfies the correct anticommutation relations. Interestingly, we demonstrate that this operator satisfies the massless Dirac equation and that it can be identified with a 3+1D Weyl spinor. Finally, as an explicit example, we write the integrated charge density in terms of the tomographic transformed bosonic degrees of freedom.

  13. A comparison of 1D and 2D LSTM architectures for the recognition of handwritten Arabic

    Science.gov (United States)

    Yousefi, Mohammad Reza; Soheili, Mohammad Reza; Breuel, Thomas M.; Stricker, Didier

    2015-01-01

    In this paper, we present an Arabic handwriting recognition method based on recurrent neural network. We use the Long Short Term Memory (LSTM) architecture, that have proven successful in different printed and handwritten OCR tasks. Applications of LSTM for handwriting recognition employ the two-dimensional architecture to deal with the variations in both vertical and horizontal axis. However, we show that using a simple pre-processing step that normalizes the position and baseline of letters, we can make use of 1D LSTM, which is faster in learning and convergence, and yet achieve superior performance. In a series of experiments on IFN/ENIT database for Arabic handwriting recognition, we demonstrate that our proposed pipeline can outperform 2D LSTM networks. Furthermore, we provide comparisons with 1D LSTM networks trained with manually crafted features to show that the automatically learned features in a globally trained 1D LSTM network with our normalization step can even outperform such systems.

  14. An improved 1D area law for frustration-free systems

    CERN Document Server

    Arad, Itai; Vazirani, Umesh

    2011-01-01

    We present a new proof for the 1D area law for frustration-free systems with a constant gap, which exponentially improves the entropy bound in Hastings' 1D area law, and which is tight to within a polynomial factor. For particles of dimension $d$, spectral gap $\\epsilon>0$ and interaction strength of at most $J$, our entropy bound is $S_{1D}\\le \\orderof{1}X^3\\log^8 X$ where $X\\EqDef(J\\log d)/\\epsilon$. Our proof is completely combinatorial, combining the detectability lemma with basic tools from approximation theory. Incorporating locality into the proof when applied to the 2D case gives an entanglement bound that is at the cusp of being non-trivial in the sense that any further improvement would yield a sub-volume law.

  15. Periodic Properties of 1D FE Discrete Models in High Frequency Dynamics

    Directory of Open Access Journals (Sweden)

    A. Żak

    2016-01-01

    Full Text Available Finite element discrete models of various engineering 1D structures may be considered as structures of certain periodic characteristics. The source of this periodicity comes from the discontinuity of stress/strain field between the elements. This behaviour remains unnoticeable, when low frequency dynamics of these structures is investigated. At high frequency regimes, however, its influence may be strong enough to dominate calculated structural responses distorting or even falsifying them completely. In this paper, certain computational aspects of structural periodicity of 1D FE discrete models are discussed by the authors. In this discussion, the authors focus their attention on an exemplary problem of 1D rod modelled according to the elementary theory.

  16. Regulation of DNA methylation on EEF1D and RPL8 expression in cattle.

    Science.gov (United States)

    Liu, Xuan; Yang, Jie; Zhang, Qin; Jiang, Li

    2017-06-30

    Dynamic changes to the epigenome play a critical role in a variety of biology processes and complex traits. Many important candidate genes have been identified through our previous genome wide association study (GWAS) on milk production traits in dairy cattle. However, the underlying mechanism of candidate genes have not yet been clearly understood. In this study, we analyzed the methylation variation of the candidate genes, EEF1D and RPL8, which were identified to be strongly associated with milk production traits in dairy cattle in our previous studies, and its effect on protein and mRNA expression. We compared DNA methylation profiles and gene expression levels of EEF1D and RPL8 in five different tissues (heart, liver, mammary gland, ovary and muscle) of three cows. Both genes showed the highest expression level in mammary gland. For RPL8, there was no difference in the DNA methylation pattern in the five tissues, suggesting no effect of DNA methylation on gene expression. For EEF1D, the DNA methylation levels of its first CpG island differed in the five tissues and were negatively correlated with the gene expression levels. To further investigate the function of DNA methylation on the expression of EEF1D, we collected blood samples of three cows at early stage of lactation and in dry period and analyzed its expression and the methylation status of the first CpG island in blood. As a result, the mRNA expression of EEF1D in the dry period was higher than that at the early stage of lactation, while the DNA methylation level in the dry period was lower than that at the early stage of lactation. Our result suggests that the DNA methylation of EEF1D plays an important role in the spatial and temporal regulation of its expression and possibly have an effect on the milk production traits.

  17. Modelling turbulent vertical mixing sensitivity using a 1-D version of NEMO

    Directory of Open Access Journals (Sweden)

    G. Reffray

    2014-08-01

    Full Text Available Through two numerical experiments, a 1-D vertical model called NEMO1D was used to investigate physical and numerical turbulent-mixing behaviour. The results show that all the turbulent closures tested (k + l from Blanke and Delecluse, 1993 and two equation models: Generic Lengh Scale closures from Umlauf and Burchard, 2003 are able to correctly reproduce the classical test of Kato and Phillips (1969 under favourable numerical conditions while some solutions may diverge depending on the degradation of the spatial and time discretization. The performances of turbulence models were then compared with data measured over a one-year period (mid-2010 to mid-2011 at the PAPA station, located in the North Pacific Ocean. The modelled temperature and salinity were in good agreement with the observations, with a maximum temperature error between −2 and 2 °C during the stratified period (June to October. However the results also depend on the numerical conditions. The vertical RMSE varied, for different turbulent closures, from 0.1 to 0.3 °C during the stratified period and from 0.03 to 0.15 °C during the homogeneous period. This 1-D configuration at the PAPA station (called PAPA1D is now available in NEMO as a reference configuration including the input files and atmospheric forcing set described in this paper. Thus, all the results described can be recovered by downloading and launching PAPA1D. The configuration is described on the NEMO site (http://www.nemo-ocean.eu/Using-NEMO/Configurations/C1D_PAPA. This package is a good starting point for further investigation of vertical processes.

  18. Characterisation and improvement of j(O1D) filter radiometers

    Science.gov (United States)

    Bohn, Birger; Heard, Dwayne E.; Mihalopoulos, Nikolaos; Plass-Dülmer, Christian; Schmitt, Rainer; Whalley, Lisa K.

    2016-07-01

    Atmospheric O3 → O(1D) photolysis frequencies j(O1D) are crucial parameters for atmospheric photochemistry because of their importance for primary OH formation. Filter radiometers have been used for many years for in situ field measurements of j(O1D). Typically the relationship between the output of the instruments and j(O1D) is non-linear because of changes in the shape of the solar spectrum dependent on solar zenith angles and total ozone columns. These non-linearities can be compensated for by a correction method based on laboratory measurements of the spectral sensitivity of the filter radiometer and simulated solar actinic flux density spectra. Although this correction is routinely applied, the results of a previous field comparison study of several filter radiometers revealed that some corrections were inadequate. In this work the spectral characterisations of seven instruments were revised, and the correction procedures were updated and harmonised considering recent recommendations of absorption cross sections and quantum yields of the photolysis process O3 → O(1D). Previous inconsistencies were largely removed using these procedures. In addition, optical interference filters were replaced to improve the spectral properties of the instruments. Successive determinations of spectral sensitivities and field comparisons of the modified instruments with a spectroradiometer reference confirmed the improved performance. Overall, filter radiometers remain a low-maintenance alternative of spectroradiometers for accurate measurements of j(O1D) provided their spectral properties are known and potential drifts in sensitivities are monitored by regular calibrations with standard lamps or reference instruments.

  19. Using the D1D5 CFT to Understand Black Holes

    OpenAIRE

    Avery, Steven

    2010-01-01

    In this dissertation, we review work presented in arXiv:0906.2015, arXiv:0907.1663, arXiv:1002.3132, arXiv:1003.2746, and arXiv:1007.2202 on the D1D5 system. We begin with some motivational material for black holes in string theory. In Chapter 2, we review the D1D5 system, including the gravity and CFT descriptions. In Chapter 3, we show how to perturbatively relax the decoupling limit in a general AdS-CFT setting. This allows one to compute the emission out of the AdS/CFT into the asymptotic...

  20. Column Testing and 1D Reactive Transport Modeling to Evaluate Uranium Plume Persistence Processes

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Raymond H. [Navarro Research and Engineering, Inc.; Morrison, Stan [Navarro Research and Engineering, Inc.; Morris, Sarah [Navarro Research and Engineering, Inc.; Tigar, Aaron [Navarro Research and Engineering, Inc.; Dam, William [U.S. Department of Energy, Office of Legacy Management; Dayvault, Jalena [U.S. Department of Energy, Office of Legacy Management

    2016-04-26

    Motivation for Study: Natural flushing of contaminants at various U.S. Department of Energy Office of Legacy Management sites is not proceeding as quickly as predicted (plume persistence) Objectives: Help determine natural flushing rates using column tests. Use 1D reactive transport modeling to better understand the major processes that are creating plume persistence Approach: Core samples from under a former mill tailings area Tailings have been removed. Column leaching using lab-prepared water similar to nearby Gunnison River water. 1D reactive transport modeling to evaluate processes

  1. Dopamine D1-D2 receptor heteromer signaling pathway in the brain: emerging physiological relevance

    Directory of Open Access Journals (Sweden)

    Hasbi Ahmed

    2011-06-01

    Full Text Available Abstract Dopamine is an important catecholamine neurotransmitter modulating many physiological functions, and is linked to psychopathology of many diseases such as schizophrenia and drug addiction. Dopamine D1 and D2 receptors are the most abundant dopaminergic receptors in the striatum, and although a clear segregation between the pathways expressing these two receptors has been reported in certain subregions, the presence of D1-D2 receptor heteromers within a unique subset of neurons, forming a novel signaling transducing functional entity has been shown. Recently, significant progress has been made in elucidating the signaling pathways activated by the D1-D2 receptor heteromer and their potential physiological relevance.

  2. Statistics of Eigenfunctions in 1D Tight Binding Model: Distribution of Riccati Variable

    Institute of Scientific and Technical Information of China (English)

    WANG Wen-Ge

    2001-01-01

    For energy eigenfunctions in 1D tight binding model, the distribution of ratios of the nearest components (Riccati variable), denoted by f(p), gives information on their fluctuation properties. The shape of f(p) is studied numerically for three versions of the 1D tight binding model. It is shown that when perturbation is strong the shape of f(p) is usually quite close to that of the Lorentzian distribution and in the case of weak perturbation the shape of the central part of f(p) is model-dependent while the shape of tails are still close to the Lorentzian form.``

  3. Synthesis and characterization of 1D iron(II) spin crossover coordination polymers with hysteresis.

    Science.gov (United States)

    Bauer, Wolfgang; Lochenie, Charles; Weber, Birgit

    2014-02-07

    Purposeful ligand design was used for the synthesis of eight new 1D iron(II) spin crossover coordination polymers aiming for cooperative spin transitions with hysteresis. The results from magnetic measurements and X-ray structure analysis show that the combination of rigid linkers and a hydrogen bond network between the 1D chains is a promising tool to reach this goal. Five of the eight new samples show a cooperative spin transition with hysteresis with up to 43 K wide hysteresis loops.

  4. Opto-digital image encryption by using Baker mapping and 1-D fractional Fourier transform

    Science.gov (United States)

    Liu, Zhengjun; Li, She; Liu, Wei; Liu, Shutian

    2013-03-01

    We present an optical encryption method based on the Baker mapping in one-dimensional fractional Fourier transform (1D FrFT) domains. A thin cylinder lens is controlled by computer for implementing 1D FrFT at horizontal direction or vertical direction. The Baker mapping is introduced to scramble the amplitude distribution of complex function. The amplitude and phase of the output of encryption system are regarded as encrypted image and key. Numerical simulation has been performed for testing the validity of this encryption scheme.

  5. Estimation of multi-group cross section covariances for {sup 235,238}U, {sup 239}Pu, {sup 241}Am, {sup 56}Fe, {sup 23}Na and {sup 27}Al

    Energy Technology Data Exchange (ETDEWEB)

    De Saint Jean, C.; Archier, P.; Noguere, G.; Litaize, O.; Vaglio-Gaudard, C.; Bernard, D.; Leray, O. [CEA, DEN, DER, Cadarache, F-13108 Saint-Paul-lez-Durance (France)

    2012-07-01

    This paper presents the methodology used to estimate multi-group covariances for some major isotopes used in reactor physics. The starting point of this evaluation is the modelling of the neutron induced reactions based on nuclear reaction models with parameters. These latest are the vectors of uncertainties as they are absorbing uncertainties and correlation arising from the confrontation of nuclear reaction model to microscopic experiment. These uncertainties are then propagated towards multi-group cross sections. As major breakthroughs were then asked by nuclear reactor physicists to assess proper uncertainties to be used in applications, a solution is proposed by the use of integral experiment information at two different stages in the covariance estimation. In this paper, we will explain briefly the treatment of all type of uncertainties, including experimental ones (statistical and systematic) as well as those coming from validation of nuclear data on dedicated integral experiment (nuclear data oriented). We will illustrate the use of this methodology with various isotopes such as {sup 235,238}U, {sup 239}Pu, {sup 241}Am, {sup 56}Fe, {sup 23}Na and {sup 27}Al. (authors)

  6. File list: Oth.ALL.10.Nr1d2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.10.Nr1d2.AllCell mm9 TFs and others Nr1d2 All cell types SRX109462,SRX12817...4,SRX128175 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.10.Nr1d2.AllCell.bed ...

  7. File list: Oth.ALL.05.Nr1d1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.05.Nr1d1.AllCell mm9 TFs and others Nr1d1 All cell types SRX997755,SRX12817...758,SRX994726,SRX100297,SRX1304810,SRX1304809 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.05.Nr1d1.AllCell.bed ...

  8. File list: Oth.ALL.20.Nr1d1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.Nr1d1.AllCell mm9 TFs and others Nr1d1 All cell types SRX997762,SRX10946...4810,SRX997755,SRX994726,SRX1304809,SRX997756 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.20.Nr1d1.AllCell.bed ...

  9. File list: Oth.ALL.50.Nr1d2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.50.Nr1d2.AllCell mm9 TFs and others Nr1d2 All cell types SRX109462,SRX12817...4,SRX128175 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.50.Nr1d2.AllCell.bed ...

  10. File list: Oth.ALL.20.Nr1d2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.Nr1d2.AllCell mm9 TFs and others Nr1d2 All cell types SRX109462,SRX12817...4,SRX128175 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.20.Nr1d2.AllCell.bed ...

  11. Simulation of engine cooling with coupled 1D and 3D flow computation; Simulation der Motorkuehlung mit Hilfe gekoppelter 1D- und 3D-Stroemungsberechnung

    Energy Technology Data Exchange (ETDEWEB)

    Grafenberger, P.; Klinner, P.; Nefischer, P. [BMW Motoren GmbH, Steyr (Austria); Klingebiel, F. [AMSTRAL Engineering fuer Stroemungsmechanik GmbH, Idstein (Germany)

    2000-04-01

    Shorting the development time for new engines and vehicles is leading to the increasing use of computational design and simulation methods in the automotive industry. For several years now, both one-dimensional and three-dimensional flow computation have been used successfully in the development of cooling systems. However, the fact that less hardware is used in the early development stages makes new demands on the quality and quantity of these simulation results. BMW's diesel development division has been able to improve the quality of the results and to reduce the processing time by improving the model quality and by coupling existing 1D and 3D computational fluid dynamic programmes. (orig.) [German] Die Verkuerzung der Entwicklungszeit neuer Motoren und Automobile fuehrt zu einem verstaerkten Einsatz von rechnergestuetzten Konstruktions- und Simulationsmethoden in der Fahrzeugindustrie. Sowohl eindimensionale als auch dreidimensionale Stroemungsberechnungen werden seit Jahren erfolgreich bei der Entwicklung von Kuehlsystemen eingesetzt. Der Entfall von Hardware-Baugruppen in der fruehen Entwicklungsphase stellt jedoch neue Anforderungen an die Qualitaet und Quantitaet dieser Simulationsergebnisse. Durch Verbesserung der Modellqualitaet und durch Kopplung vorhandener 1D- und 3D-Stroemungsberechnungsprogramme konnten in der Dieselmotorenentwicklung von BMW die Qualitaet der Ergebnisse und die Bearbeitungsgeschwindigkeit deutlich gesteigert werden. (orig.)

  12. Correlation versus surface effects in photoemission of quasi-1D organic conductors

    DEFF Research Database (Denmark)

    Claessen, R.; Schwingenschlogl, U.; Sing, M.;

    2002-01-01

    The absence of spectral weight at the Fermi level in photoemission spectra of quasi-1D organic conductors has been interpreted as possible evidence for an unusual many-body state. We demonstrate that great care must be exercised to draw this conclusion exclusively on the basis of a pseudogap...

  13. Deletion of CD1d in Adipocytes Aggravates Adipose Tissue Inflammation and Insulin Resistance in Obesity.

    Science.gov (United States)

    Huh, Jin Young; Park, Jeu; Kim, Jong In; Park, Yoon Jeong; Lee, Yun Kyung; Kim, Jae Bum

    2017-04-01

    Adipose tissue inflammation is an important factor in obesity that promotes insulin resistance. Among various cell types in adipose tissue, immune cells actively regulate inflammatory responses and affect whole-body energy metabolism. In particular, invariant natural killer T (iNKT) cells contribute to mitigating dysregulation of systemic energy homeostasis by counteracting obesity-induced inflammation in adipose tissue. However, the molecular mechanisms by which adipose iNKT cells become activated and mediate anti-inflammatory roles in obese adipose tissue have not been thoroughly understood yet. In the current study, we demonstrate that adipocyte CD1d plays a key role in the stimulation of adipose iNKT cells, leading to anti-inflammatory responses in high-fat diet (HFD)-fed mice. Accordingly, adipocyte-specific CD1d-knockout (CD1d(ADKO)) mice showed reduced numbers of iNKT cells in adipose tissues and decreased responses to α-galactosylceramide-induced iNKT cell activation. Additionally, HFD-fed CD1d(ADKO) mice revealed reduced interleukin-4 expression in adipose iNKT cells and aggravated adipose tissue inflammation and insulin resistance. Collectively, these data suggest that adipocytes could selectively stimulate adipose iNKT cells to mediate anti-inflammatory responses and attenuate excess proinflammatory responses in obese adipose tissue. © 2017 by the American Diabetes Association.

  14. Focusing the wavefield inside an unknown 1D medium: Beyond seismic interferometry

    NARCIS (Netherlands)

    Broggini, F.; Snieder, R.; Wapenaar, C.P.A.

    2012-01-01

    With seismic interferometry one can retrieve the response to a virtual source inside an unknown medium, if there is a receiver at the position of the virtual source. Using inverse scattering theory, we demonstrate that, for a 1D medium, the requirement of having an actual receiver inside the medium

  15. Toward Structural Correctness: Aquatolide and the Importance of 1D Proton NMR FID Archiving.

    Science.gov (United States)

    Pauli, Guido F; Niemitz, Matthias; Bisson, Jonathan; Lodewyk, Michael W; Soldi, Cristian; Shaw, Jared T; Tantillo, Dean J; Saya, Jordy M; Vos, Klaas; Kleinnijenhuis, Roel A; Hiemstra, Henk; Chen, Shao-Nong; McAlpine, James B; Lankin, David C; Friesen, J Brent

    2016-02-05

    The revision of the structure of the sesquiterpene aquatolide from a bicyclo[2.2.0]hexane to a bicyclo[2.1.1]hexane structure using compelling NMR data, X-ray crystallography, and the recent confirmation via full synthesis exemplify that the achievement of "structural correctness" depends on the completeness of the experimental evidence. Archived FIDs and newly acquired aquatolide spectra demonstrate that archiving and rigorous interpretation of 1D (1)H NMR data may enhance the reproducibility of (bio)chemical research and curb the growing trend of structural misassignments. Despite being the most accessible NMR experiment, 1D (1)H spectra encode a wealth of information about bonds and molecular geometry that may be fully mined by (1)H iterative full spin analysis (HiFSA). Fully characterized 1D (1)H spectra are unideterminant for a given structure. The corresponding FIDs may be readily submitted with publications and collected in databases. Proton NMR spectra are indispensable for structural characterization even in conjunction with 2D data. Quantum interaction and linkage tables (QuILTs) are introduced for a more intuitive visualization of 1D J-coupling relationships, NOESY correlations, and heteronuclear experiments. Overall, this study represents a significant contribution to best practices in NMR-based structural analysis and dereplication.

  16. Refractive index sensor based on a 1D photonic crystal in a microfluidic channel

    DEFF Research Database (Denmark)

    Rodrigues de Sousa Nunes, Pedro André; Mortensen, Asger; Kutter, Jörg Peter

    2010-01-01

    A refractive index sensor has been fabricated in silicon oxynitride by standard UV lithography and dry etching processes. The refractive index sensor consists of a 1D photonic crystal (PhC) embedded in a microfluidic channel addressed by fiber-terminated planar waveguides. Experimental...

  17. CD1d-restricted peripheral T cell lymphoma in mice and humans

    Science.gov (United States)

    Bachy, Emmanuel; Urb, Mirjam; Chandra, Shilpi; Robinot, Rémy; Bricard, Gabriel; de Bernard, Simon; Traverse-Glehen, Alexandra; Gazzo, Sophie; Blond, Olivier; Khurana, Archana; Baseggio, Lucile; Heavican, Tayla; Ffrench, Martine; Crispatzu, Giuliano; Mondière, Paul; Schrader, Alexandra; Taillardet, Morgan; Thaunat, Olivier; Martin, Nadine; Dalle, Stéphane; Le Garff-Tavernier, Magali; Salles, Gilles; Lachuer, Joel; Hermine, Olivier; Asnafi, Vahid; Roussel, Mikael; Lamy, Thierry; Herling, Marco; Iqbal, Javeed; Buffat, Laurent; Marche, Patrice N.; Gaulard, Philippe; Kronenberg, Mitchell; Defrance, Thierry

    2016-01-01

    Peripheral T cell lymphomas (PTCLs) are a heterogeneous entity of neoplasms with poor prognosis, lack of effective therapies, and a largely unknown pathophysiology. Identifying the mechanism of lymphomagenesis and cell-of-origin from which PTCLs arise is crucial for the development of efficient treatment strategies. In addition to the well-described thymic lymphomas, we found that p53-deficient mice also developed mature PTCLs that did not originate from conventional T cells but from CD1d-restricted NKT cells. PTCLs showed phenotypic features of activated NKT cells, such as PD-1 up-regulation and loss of NK1.1 expression. Injections of heat-killed Streptococcus pneumonia, known to express glycolipid antigens activating NKT cells, increased the incidence of these PTCLs, whereas Escherichia coli injection did not. Gene expression profile analyses indicated a significant down-regulation of genes in the TCR signaling pathway in PTCL, a common feature of chronically activated T cells. Targeting TCR signaling pathway in lymphoma cells, either with cyclosporine A or anti-CD1d blocking antibody, prolonged mice survival. Importantly, we identified human CD1d-restricted lymphoma cells within Vδ1 TCR-expressing PTCL. These results define a new subtype of PTCL and pave the way for the development of blocking anti-CD1d antibody for therapeutic purposes in humans. PMID:27069116

  18. Models of Late-Type Disk Galaxies: 1-D Versus 2-D

    CERN Document Server

    Mineikis, Tadas

    2015-01-01

    We investigate the effects of stochasticity on the observed galaxy parameters by comparing our stochastic star formation two-dimensional (2-D) galaxy evolution models with the commonly used one-dimensional (1-D) models with smooth star formation. The 2-D stochastic models predict high variability of the star formation rate and the surface photometric parameters across the galactic disks and in time.

  19. Dynamics of the 1D Heisenberg model and optical absorption of spinons in cuprate antiferromagnetic chains

    NARCIS (Netherlands)

    Lorenzana, J.; Eder, R.

    1996-01-01

    Published in: Phys. Rev. B 55 (1997) 3358-3361 Citing articles (CrossRef) citations recorded in [Science Citation Index] Abstract: We use numerical and analytical results to construct a simple ansatz for the energy dynamical correlation function of the 1D antiferromagnetic Heisenberg model. This is

  20. On time-reversal anomaly of 2+1d topological phases

    CERN Document Server

    Tachikawa, Yuji

    2016-01-01

    We describe a method to find the anomaly of the time-reversal symmetry of 2+1d topological quantum field theories, by computing the fractional anomalous momentum on the cross-cap background. This allows us, for example, to identify the parameter $\

  1. GLOBAL EXISTENCE AND ASYMPTOTIC BEHAVIOR OF THE SOLUTION TO 1-D ENERGY TRANSPORT MODEL FOR SEMICONDUCTORS

    Institute of Scientific and Technical Information of China (English)

    黎勇; 陈丽

    2002-01-01

    In this paper, we study the asymptotic behavior of global smooth solution to the initial boundary problem for the 1-D energy transport model in semiconductor science. We prove that the smooth solution of the problem converges to a stationary solution exponentially fast as t - ∞ when the initial data is a small perturbation of the stationary solution.

  2. CAMK1D amplification implicated in epithelial-mesenchymal transition in basal-like breast cancer.

    Science.gov (United States)

    Bergamaschi, Anna; Kim, Young H; Kwei, Kevin A; La Choi, Yoon; Bocanegra, Melanie; Langerød, Anita; Han, Wonshik; Noh, Dong-Young; Huntsman, David G; Jeffrey, Stefanie S; Børresen-Dale, Anne-Lise; Pollack, Jonathan R

    2008-12-01

    Breast cancer exhibits clinical and molecular heterogeneity, where expression profiling studies have identified five major molecular subtypes. The basal-like subtype, expressing basal epithelial markers and negative for estrogen receptor (ER), progesterone receptor (PR) and HER2, is associated with higher overall levels of DNA copy number alteration (CNA), specific CNAs (like gain on chromosome 10p), and poor prognosis. Discovering the molecular genetic basis of tumor subtypes may provide new opportunities for therapy. To identify the driver oncogene on 10p associated with basal-like tumors, we analyzed genomic profiles of 172 breast carcinomas. The smallest shared region of gain spanned just seven genes at 10p13, including calcium/calmodulin-dependent protein kinase ID (CAMK1D), functioning in intracellular signaling but not previously linked to cancer. By microarray, CAMK1D was overexpressed when amplified, and by immunohistochemistry exhibited elevated expression in invasive carcinomas compared to carcinoma in situ. Engineered overexpression of CAMK1D in non-tumorigenic breast epithelial cells led to increased cell proliferation, and molecular and phenotypic alterations indicative of epithelial-mesenchymal transition (EMT), including loss of cell-cell adhesions and increased cell migration and invasion. Our findings identify CAMK1D as a novel amplified oncogene linked to EMT in breast cancer, and as a potential therapeutic target with particular relevance to clinically unfavorable basal-like tumors.

  3. 1D and 2D economical FIR filters generated by Chebyshev polynomials of the first kind

    Science.gov (United States)

    Dragoljub Pavlović, Vlastimir; Stanojko Dončov, Nebojša; Gradimir Ćirić, Dejan

    2013-11-01

    Christoffel-Darboux formula for Chebyshev continual orthogonal polynomials of the first kind is proposed to find a mathematical solution of approximation problem of a one-dimensional (1D) filter function in the z domain. Such an approach allows for the generation of a linear phase selective 1D low-pass digital finite impulse response (FIR) filter function in compact explicit form by using an analytical method. A new difference equation and structure of corresponding linear phase 1D low-pass digital FIR filter are given here. As an example, one extremely economic 1D FIR filter (with four adders and without multipliers) is designed by the proposed technique and its characteristics are presented. Global Christoffel-Darboux formula for orthonormal Chebyshev polynomials of the first kind and for two independent variables for generating linear phase symmetric two-dimensional (2D) FIR digital filter functions in a compact explicit representative form, by using an analytical method, is proposed in this paper. The formula can be most directly applied for mathematically solving the approximation problem of a filter function of even and odd order. Examples of a new class of extremely economic linear phase symmetric selective 2D FIR digital filters obtained by the proposed approximation technique are presented.

  4. Build up An Operational Flood Simulation from Existing 1D Channel Flow Works

    Science.gov (United States)

    Chang, Che-Hao; Hsu, Chih-Tsung; Wu, Shiang-Jen; Lien, Ho-Cheng; Shen, Jhih-Cyuan; Chung, Ming-Ko

    2016-04-01

    Several 2D flood simulations will be developed for urban area in recent years in Taiwan. Original ideas focus on the static flood maps produced by the 2D flood simulation with respect to design events, which could be useful no matter for planning or disaster awareness. However, an extra bonus is expected to see if we can reuse the 2D flood simulation framework for operational use or not. Such a project goal inspire us to setup a standard operation procedure before any progress from existing 1D channel flow works. 3 key issues are taken into account in the SOP: 1. High Resolution Terrain: A 1m resolution digital terrain model (DTM) is considered as a reference. The Channels and structures should be setup in 1D channel flow works if we can identify under such high resolution. One should examine the existing 1D channel flow works consistent with the DTM or not. 2. Meteo Stations Referenced: Real time precipitation would be send to referenced location in RR models during an operational forecast. Existing 1D channels flow works are usually specifically for design events which are not necessarily equipped with such references. 3. Time Consuming: A full scale 2D flood simulation needs a lot of computation resources. A solution should be derived within practical time limits. Under the above consideration, some impacts and procedures will be analyzed and developed to setup the SOP for further model modification.

  5. Data of evolutionary structure change: 1D3AA-2PWZC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available RDIAD-EVVFV > -EEEE > ATOM 141 C...ain> 2PWZC QLPSGSELSLY >H EEEEEE...ucture> ---EEEEE> ATOM 4093 CA ASP C 2...in>A 1D3AA EGEFGHEDTAFGV ...> GGG EEEEEcture> ATOM 1885 CA GLU A 276 63

  6. Solvent-free porous framework resulted from 3D entanglement of 1D zigzag coordination polymer

    KAUST Repository

    Kole, Goutam Kumar Umar

    2010-01-01

    A solvent-free porous metal organic framework is constructed by the 3D entanglement of 1D zigzag coordination polymeric chains. The role of solvents and the effect of reaction conditions on such unique entanglement are addressed. © 2010 The Royal Society of Chemistry and the Centre National de la Recherche Scientifique.

  7. Characterizing diabetes burnout in parents of youth with type 1 diabetes (T1D)

    Science.gov (United States)

    Managing type 1 diabetes (T1D) is complex and requires round-the-clock attention, much of which falls to parents. Parental stress and family conflict about diabetes are associated with suboptimal youth self-management and glycemic outcomes, yet little research has described parents' experiences with...

  8. Nonlinear Control of Absorption in Graphene-based 1D Photonic Crystal

    CERN Document Server

    Vincenti, M A; Grande, M; D'Orazio, A; Scalora, M

    2013-01-01

    Perfect, narrow-band absorption is achieved in an asymmetric 1D photonic crystal with a monolayer graphene defect. Thanks to the large third order nonlinearity of graphene and field localization in the defect layer we demonstrate the possibility to achieve controllable, saturable absorption for the pump frequency.

  9. A South American Prehistoric Mitogenome: Context, Continuity, and the Origin of Haplogroup C1d

    Science.gov (United States)

    Sans, Mónica; Figueiro, Gonzalo; Hughes, Cris E.; Lindo, John; Hidalgo, Pedro C.; Malhi, Ripan S.

    2015-01-01

    Based on mitochondrial DNA (mtDNA), it has been estimated that at least 15 founder haplogroups peopled the Americas. Subhaplogroup C1d3 was defined based on the mitogenome of a living individual from Uruguay that carried a lineage previously identified in hypervariable region I sequences from ancient and modern Uruguayan individuals. When complete mitogenomes were studied, additional substitutions were found in the coding region of the mitochondrial genome. Using a complete ancient mitogenome and three modern mitogenomes, we aim to clarify the ancestral state of subhaplogroup C1d3 and to better understand the peopling of the region of the Río de la Plata basin, as well as of the builders of the mounds from which the ancient individuals were recovered. The ancient mitogenome, belonging to a female dated to 1,610±46 years before present, was identical to the mitogenome of one of the modern individuals. All individuals share the mutations defining subhaplogroup C1d3. We estimated an age of 8,974 (5,748–12,261) years for the most recent common ancestor of C1d3, in agreement with the initial peopling of the geographic region. No individuals belonging to the defined lineage were found outside of Uruguay, which raises questions regarding the mobility of the prehistoric inhabitants of the country. Moreover, the present study shows the continuity of Native lineages over at least 6,000 years. PMID:26509686

  10. Plasma as a tool for growth of 1D and 2D nanomaterials and their conversions

    Science.gov (United States)

    Cvelbar, Uros

    2015-09-01

    The growth of 1D and 2D nanostructures in low pressure oxygen plasma is presented with the special stress on metal-oxide nanowires and their deterministic growth mechanisms. Since the resulting nanostructures not always have required properties for applications their modifications are required. Therefore their conversions into different oxides or sulphites/nitrides are required with either molecules, atoms, electrons or photons.

  11. (3+1)D Anomalous Twisted Gauge Theories with Global Symmetry

    CERN Document Server

    Ye, Peng

    2016-01-01

    In (3+1)D twisted gauge theories, global symmetry may be imposed on topological currents $\\star\\frac{1}{2\\pi}db^I$ in a hydrodynamical way ($I=1,2,\\cdots$, $\\{b^I\\}$ is a set of Kalb-Ramond gauge fields). This methodology has been applied before in the Chern-Simons theory of fractional quantum Hall liquids. We find that, in some twisted gauge theories (with discrete Abelian gauge group $G_g$), implementing a global symmetry (denoted by $G_s$) is always inconsistent. There are two consequences. First, the symmetry-enriched topological order (SET) of the ground state is anomalous, which cannot exist in (3+1)D system alone. It can exist as a boundary of 4+1D topological phases. Second, if $G_s$ is fully gauged, the resulting new gauge theory has gauge anomaly. A (4+1)D topological phase is required to cancel this anomaly. We elaborate this phenomenon via a concrete example.

  12. Data of evolutionary structure change: 1BU1D-1OOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BU1D-1OOTA 1BU1 1OOT D A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE---WW...14> 1OOT A 1OOTA...tryChain> -21.645000457763672 -6.38100004196167 51.89799880981445 ...76022339 -0.7429999709129333 -0.09000000357627869 tion> 1.78559505939483641OOT A 1OOTA WTGRV--NGREG

  13. Field representations for optical defect microcavities in 1D grating structures using quasi-normal modes

    NARCIS (Netherlands)

    Maksimovic, Milan; Lohmeyer, Manfred; van Groesen, Embrecht W.C.

    Quasi-Normal Modes are used to characterize transmission resonances in 1D optical defect cavities and the related field approximations. Using a mirror field and the relevant QNM, a variational principle permits to represent the field and the spectral transmission close to resonances.

  14. Data of evolutionary structure change: 1D5IH-3FZUH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ntryIDChain> CKATG--YTFSS >EEEE -- GGG> 3FZU H 3FZUH CAASGFRFTFNN ...>EEEE GGGure> ATOM 1790 CA CYS H 22 34.95...SW >EEEE ---- > ATOM 2413 CA ALA...pdbChain> 1D5IH ARGHSYYFYDGDYW >EE

  15. 1D Seismic reflection technique to increase depth information in surface seismic investigations

    Science.gov (United States)

    Camilletti, Stefano; Fiera, Francesco; Umberto Pacini, Lando; Perini, Massimiliano; Prosperi, Andrea

    2017-04-01

    1D seismic methods, such as MASW Re.Mi. and HVSR, have been extensively used in engineering investigations, bedrock research, Vs profile and to some extent for hydrologic applications, during the past 20 years. Recent advances in equipment, sound sources and computer interpretation techniques, make 1D seismic methods highly effective in shallow subsoil modeling. Classical 1D seismic surveys allows economical collection of subsurface data however they fail to return accurate information for depths greater than 50 meters. Using a particular acquisition technique it is possible to collect data that can be quickly processed through reflection technique in order to obtain more accurate velocity information in depth. Furthermore, data processing returns a narrow stratigraphic section, alongside the 1D velocity model, where lithological boundaries are represented. This work will show how collect a single-CMP to determine: (1) depth of bedrock; (2) gravel layers in clayey domains; (3) accurate Vs profile. Seismic traces was processed by means a new software developed in collaboration with SARA electronics instruments S.r.l company, Perugia - ITALY. This software has the great advantage of being able to be used directly in the field in order to reduce the times elapsing between acquisition and processing.

  16. Experimental Conditions: SE19_S2_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE19_S2_M1_D1 SE19 Grobal triacylglycerol analysis in mouse liver and white adipose... tissue (WAT) by high resolution LC/ESI-QTOF MS/MS SE19_S2 Mouse white adipose tissue (WAT) SE19_S2_M1 20 ug

  17. Classical solution to 1D viscous polytropic perfect fluids with constant diffusion coefficients and vacuum

    Science.gov (United States)

    Liang, Zhilei; Wu, Shanqiu

    2017-02-01

    This paper deals with the initial boundary value problem for one-dimensional (1D) viscous, compressible and heat conducting fluids. We establish the global existence and uniqueness of classical solutions, with large data and possible vacuum at initial time. Our approach is based on the Calderón-Zygmund decomposition technique and allows that the viscosity and heat conductivity are both constant.

  18. Fresnel Lenses fabricated by femtosecond laser micromachining on Polymer 1D Photonic Crystal

    Directory of Open Access Journals (Sweden)

    Guduru Surya S.K.

    2013-11-01

    Full Text Available We report the fabrication of micro Fresnel lenses by femtosecond laser surface ablation on polymer 1D photonic crystals. This device is designed to focus the transmitted wavelength of the photonic crystal and filter the wavelengths corresponding to the photonic band gap region. Integration of such devices in a wavelength selective light harvesting and filtering microchip can be achieved.

  19. Probing the dispersion properties of 1D nanophotonic waveguides with far-field Fourier optics

    DEFF Research Database (Denmark)

    Le Thomas, N.; Jágerská, J.; Houdré, R.

    2008-01-01

    We present an advanced Fourier space imaging technique to probe guided light in nanophotonic structures with an effective numerical aperture of 2.5. This superresolution technique allows us to successfully investigate the dispersive properties of 1D nanowaveguides such as photonic crystal W1...

  20. Phase structure of (2+1)d strongly coupled lattice gauge theories

    CERN Document Server

    Strouthos, C G

    2003-01-01

    We study the chiral phase transition in (2+1)d strongly coupled U(N) lattice gauge theories with staggered fermions. We show with high precision simulations performed directly in the chiral limit that these models undergo a Berezinski-Kosterlitz-Thouless (BKT) transition. We also show that this universality class is unaffected even in the large N limit.

  1. Stabilization and shape control of a 1D piezoelectric Timoshenko beam

    NARCIS (Netherlands)

    Voss, T.; Scherpen, J. M. A.

    2011-01-01

    In this paper we show how to perform stabilization and shape control for a finite dimensional model that recasts the dynamics of an inflatable space reflector in port-Hamiltonian (pH) form. We show how to derive a decentralized passivity-based controller which can be used to stabilize a 1D piezoelec

  2. A new EEG measure using the 1D cluster variation method

    Science.gov (United States)

    Maren, Alianna J.; Szu, Harold H.

    2015-05-01

    A new information measure, drawing on the 1-D Cluster Variation Method (CVM), describes local pattern distributions (nearest-neighbor and next-nearest neighbor) in a binary 1-D vector in terms of a single interaction enthalpy parameter h for the specific case where the fractions of elements in each of two states are the same (x1=x2=0.5). An example application of this method would be for EEG interpretation in Brain-Computer Interfaces (BCIs), especially in the frontier of invariant biometrics based on distinctive and invariant individual responses to stimuli containing an image of a person with whom there is a strong affiliative response (e.g., to a person's grandmother). This measure is obtained by mapping EEG observed configuration variables (z1, z2, z3 for next-nearest neighbor triplets) to h using the analytic function giving h in terms of these variables at equilibrium. This mapping results in a small phase space region of resulting h values, which characterizes local pattern distributions in the source data. The 1-D vector with equal fractions of units in each of the two states can be obtained using the method for transforming natural images into a binarized equi-probability ensemble (Saremi & Sejnowski, 2014; Stephens et al., 2013). An intrinsically 2-D data configuration can be mapped to 1-D using the 1-D Peano-Hilbert space-filling curve, which has demonstrated a 20 dB lower baseline using the method compared with other approaches (cf. SPIE ICA etc. by Hsu & Szu, 2014). This CVM-based method has multiple potential applications; one near-term one is optimizing classification of the EEG signals from a COTS 1-D BCI baseball hat. This can result in a convenient 3-D lab-tethered EEG, configured in a 1-D CVM equiprobable binary vector, and potentially useful for Smartphone wireless display. Longer-range applications include interpreting neural assembly activations via high-density implanted soft, cellular-scale electrodes.

  3. Role of α1D -adrenoceptors in vascular wall hypertrophy during angiotensin II-induced hypertension.

    Science.gov (United States)

    Gallardo-Ortíz, I A; Rodríguez-Hernández, S N; López-Guerrero, J J; Del Valle-Mondragón, L; López-Sánchez, P; Touyz, R M; Villalobos-Molina, R

    2015-09-01

    The in vivo effect of continuous angiotensin II (Ang II) infusion on arterial blood pressure, vascular hypertrophy and α1 -adrenoceptors (α1 -ARs) expression was explored. Alzet(®) minipumps filled with Ang II (200 ng kg(-1)  min(-1) ) were subcutaneously implanted in male Wistar rats (3 months-old). Groups of rats were also treated with losartan, an AT1 R antagonist, or with BMY 7378, a selective α1D -AR antagonist. Blood pressure was measured by tail-cuff; after 2 or 4 weeks of treatment, vessels were isolated for functional and structural analyses. Angiotensin II increased systolic blood pressure. Phenylephrine-induced contraction in aorta was greater (40% higher) in Ang II-treated rats than in the controls, and similar effect occurred with KCl 80 mm. Responses in tail arteries were not significantly different among the different groups. Angiotensin II decreased α1D -ARs without modifying the other α1 -ARs and induced an increase in media thickness (hypertrophy) in aorta, while no structural change occurred in tail artery. Losartan prevented and reversed hypertension and hypertrophy, while BMY 7378 prevented and reversed the aorta's hypertrophic response, without preventing or reversing hypertension. Findings indicate that Ang II-induced aortic hypertrophic response involves Ang II-AT1 Rs and α1D -ARs. Angiotensin II-induced α1D -AR-mediated vascular remodeling occurs independently of hypertension. Findings identify a α1D -AR-mediated process whereby Ang II influences aortic hypertrophy independently of blood pressure elevation. © 2016 John Wiley & Sons Ltd.

  4. Improvement of the 2D/1D Method in MPACT Using the Sub-Plane Scheme

    Energy Technology Data Exchange (ETDEWEB)

    Graham, Aaron M [ORNL; Collins, Benjamin S [ORNL; Downar, Thomas [University of Michigan

    2017-01-01

    Oak Ridge National Laboratory and the University of Michigan are jointly developing the MPACTcode to be the primary neutron transport code for the Virtual Environment for Reactor Applications (VERA). To solve the transport equation, MPACT uses the 2D/1D method, which decomposes the problem into a stack of 2D planes that are then coupled with a 1D axial calculation. MPACT uses the Method of Characteristics for the 2D transport calculations and P3 for the 1D axial calculations, then accelerates the solution using the 3D Coarse mesh Finite Dierence (CMFD) method. Increasing the number of 2D MOC planes will increase the accuracy of the alculation, but will increase the computational burden of the calculations and can cause slow convergence or instability. To prevent these problems while maintaining accuracy, the sub-plane scheme has been implemented in MPACT. This method sub-divides the MOC planes into sub-planes, refining the 1D P3 and 3D CMFD calculations without increasing the number of 2D MOC planes. To test the sub-plane scheme, three of the VERA Progression Problems were selected: Problem 3, a single assembly problem; Problem 4, a 3x3 assembly problem with control rods and pyrex burnable poisons; and Problem 5, a quarter core problem. These three problems demonstrated that the sub-plane scheme can accurately produce intra-plane axial flux profiles that preserve the accuracy of the fine mesh solution. The eigenvalue dierences are negligibly small, and dierences in 3D power distributions are less than 0.1% for realistic axial meshes. Furthermore, the convergence behavior with the sub-plane scheme compares favorably with the conventional 2D/1D method, and the computational expense is decreased for all calculations due to the reduction in expensive MOC calculations.

  5. 1D Ladder-like Chain and 1D Channeled 3D Supramolecular Architectures Based on Benzophenone-2,4'-dicarboxylic Acid

    Institute of Scientific and Technical Information of China (English)

    YANG Xiao-Gang; LI Dong-Sheng; FU Feng; WU Ya-Pan; WANG Ji-Jiang; WANG Yao-Yu

    2008-01-01

    The hydrothermal reactions of AgNO3, 2,2'-bipyridyl, and benzophenone-2,4'-dicarboxylic acid gave rise to two benzophenone-2,4'-dicarboxylic acid). The two compounds are extended by hydrogen bonds in two different apbonding between H2L ligands and water molecules, then extended to a 3D supramolecular architecture. Compound 2 possesses 3D supramolecular architecture containing 1D open channels, which are driven due to the strong H-bonding interactions occurring between the HL anions and water molecules; interestingly, [Ag(bpy)2]+ cations vestigated, the emission maxima for 2 exhibits red-shift compared with that of free ligand and 1 due to chelating effect of the 2,2'-bipyridine ligand to the silver ion and the presence of aromatic π-packing.

  6. Engineered Solution-Liquid-Solid Growth of a "Treelike" 1D/1D TiO2 Nanotube-CdSe Nanowire Heterostructure: Photoelectrochemical Conversion of Broad Spectrum of Solar Energy.

    Science.gov (United States)

    Mukherjee, Bratindranath; Sarker, Swagotom; Crone, Eric; Pathak, Pawan; Subramanian, Vaidyanathan R

    2016-12-07

    This work presents a hitherto unreported approach to assemble a 1D oxide-1D chalcogenide heterostructured photoactive film. As a representative system, bismuth (Bi) catalyzed 1D CdSe nanowires are directly grown on anodized 1D TiO2 nanotube (T_NT). A combination of the reductive successive-ionic-layer-adsorption-reaction (R-SILAR) and the solution-liquid-solid (S-L-S) approach is implemented to fabricate this heterostructured assembly, reported in this 1D/1D form for the first time. XRD, SEM, HRTEM, and elemental mapping are performed to systematically characterize the deposition of bismuth on T_NT and the growth of CdSe nanowires leading to the evolution of the 1D/1D heterostructure. The resulting "treelike" photoactive architecture demonstrates UV-visible light-driven electron-hole pair generation. The photoelectrochemical results highlight: (i) the formation of a stable n-n heterojunction between TiO2 nanotube and CdSe nanowire, (ii) an excellent correlation between the absorbance vis-à-vis light conversion efficiency (IPCE), and (iii) a photocurrent density of 3.84 mA/cm(2). This proof-of-concept features the viability of the approach for designing such complex 1D/1D oxide-chalcogenide heterostructures that can be of interest to photovoltaics, photocatalysis, environmental remediation, and sensing.

  7. 基于WIMS格式多群核数据制作过程的优化分析%Optimization analysis of the production process based on WIMS format multigroup nuclear data

    Institute of Scientific and Technical Information of China (English)

    谢明亮; 陈玉清; 于雷; 时浩

    2015-01-01

    Background:NJOY is used widely nuclear data processing program that can convert the data format of ENDF/B nuclear database into WIMS format of the multi-group cross section database.Purpose: This study aims to produce a multi-group database of WIMS-D format on the basis of the latest release of nuclear evaluation library ENDF/B-VII.1 by using nuclear data processing program NJOY-99.Methods: In allusion to basic fuel cell homogenization calculation benchmark problem of the light water reactor (LWR), taking the 235U and 238U nuclide as the main objects of analysis, the effect on processing time of making cross section library, as well as integral parametersΔKef and data sensitivity of selecting input parameters of the NJOY program were compared and analyzed, which optimized the option of input parameter. Results and Conclusion:The results of validating on benchmark problems showed that the production of the multi-group database was correct, which embodied the high accuracy of calculation and provided the basis data of fuel assembly homogenization calculation for pressurized water reactor.%基于最新释放的ENDF/B-VII.1核评价库,采用核数据加工处理程序NJOY-99制作基于WIMS格式的多群数据库,针对轻水堆(Light Water Reactor, LWR)基本燃料栅元均匀化计算基准题,以235U、238U核素为主要分析对象,对比研究了NJOY程序输入模块参数的选择对截面库制作加工时间、积分量ΔKef 及灵敏度的影响,得到优化的输入参数选择方案。基准例题验证结果表明:所制作的多群数据库是正确的,Kef 计算精度较高,可为压水堆燃料组件均匀化计算提供数据基础。

  8. Targeting PPM1D by lentivirus-mediated RNA interference inhibits the tumorigenicity of bladder cancer cells

    Directory of Open Access Journals (Sweden)

    W. Wang

    2014-12-01

    Full Text Available Protein phosphatase magnesium/manganese-dependent 1D (PPM1D is a p53-induced phosphatase that functions as a negative regulator of stress response pathways and has oncogenic properties. However, the functional role of PPM1D in bladder cancer (BC remains largely unknown. In the present study, lentivirus vectors carrying small hairpin RNA (shRNA targeting PPM1D were used to explore the effects of PPM1D knockdown on BC cell proliferation and tumorigenesis. shRNA-mediated knockdown of PPM1D significantly inhibited cell growth and colony forming ability in the BC cell lines 5637 and T24. Flow cytometric analysis showed that PPM1D silencing increased the proportion of cells in the G0/G1 phase. Downregulation of PPM1D also inhibited 5637 cell tumorigenicity in nude mice. The results of the present study suggest that PPM1D plays a potentially important role in BC tumorigenicity, and lentivirus-mediated delivery of shRNA against PPM1D might be a promising therapeutic strategy for the treatment of BC.

  9. Targeting PPM1D by lentivirus-mediated RNA interference inhibits the tumorigenicity of bladder cancer cells

    Energy Technology Data Exchange (ETDEWEB)

    Wang, W. [Institute of Urology, Huashan Hospital, Fudan University, Shanghai (China); Department of the Intensive Care Unit, Huashan Hospital, Fudan University, Shanghai (China); Zhu, H. [Department of the Intensive Care Unit, Huashan Hospital, Fudan University, Shanghai (China); Zhang, H.; Zhang, L. [Department of Urology, Huashan Hospital, Fudan University, Shanghai (China); Ding, Q.; Jiang, H. [Institute of Urology, Huashan Hospital, Fudan University, Shanghai (China); Department of Urology, Huashan Hospital, Fudan University, Shanghai (China)

    2014-09-23

    Protein phosphatase magnesium/manganese-dependent 1D (PPM1D) is a p53-induced phosphatase that functions as a negative regulator of stress response pathways and has oncogenic properties. However, the functional role of PPM1D in bladder cancer (BC) remains largely unknown. In the present study, lentivirus vectors carrying small hairpin RNA (shRNA) targeting PPM1D were used to explore the effects of PPM1D knockdown on BC cell proliferation and tumorigenesis. shRNA-mediated knockdown of PPM1D significantly inhibited cell growth and colony forming ability in the BC cell lines 5637 and T24. Flow cytometric analysis showed that PPM1D silencing increased the proportion of cells in the G0/G1 phase. Downregulation of PPM1D also inhibited 5637 cell tumorigenicity in nude mice. The results of the present study suggest that PPM1D plays a potentially important role in BC tumorigenicity, and lentivirus-mediated delivery of shRNA against PPM1D might be a promising therapeutic strategy for the treatment of BC.

  10. Cytoplasmic retention of a nucleocytoplasmic protein TBC1D3 by microtubule network is required for enhanced EGFR signaling.

    Directory of Open Access Journals (Sweden)

    Ze He

    Full Text Available The hominoid oncogene TBC1D3 enhances epidermal growth factor receptor (EGFR signaling and induces cell transformation. However, little is known regarding its spatio-temporal regulation and mechanism of tumorigenesis. In the current study, we identified the microtubule subunit β-tubulin as a potential interaction partner for TBC1D3 using affinity purification combined with mass spectrometry analysis. The interaction between TBC1D3 and β-tubulin was confirmed by co-immunoprecipitation. Using the same method, we also revealed that TBC1D3 co-precipitated with endogenous α-tubulin, another subunit of the microtubule. In agreement with these results, microtubule cosedimentation assays showed that TBC1D3 associated with the microtubule network. The β-tubulin-interacting site of TBC1D3 was mapped to amino acids 286∼353 near the C-terminus of the TBC domain. Deletion mutation within these amino acids was shown to abolish the interaction of TBC1D3 with β-tubulin. Interestingly, the deletion mutation caused a complete loss of TBC1D3 from the cytoplasmic filamentous and punctate structures, and TBC1D3 instead appeared in the nucleus. Consistent with this, wild-type TBC1D3 exhibited the same nucleocytoplasmic distribution in cells treated with the microtubule depolymerizing agent nocodazole, suggesting that the microtubule network associates with and retains TBC1D3 in the cytoplasm. We further found that deficiency in β-tubulin-interacting resulted in TBC1D3's inability to inhibit c-Cbl recruitment and EGFR ubiquitination, ultimately leading to dysregulation of EGFR degradation and signaling. Taken together, these studies indicate a novel model by which the microtubule network regulates EGFR stability and signaling through tubulin dimer/oligomer interaction with the nucleocytoplasmic protein TBC1D3.

  11. Revisiting the D1/D5 system or bubbling in AdS{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Boni, Matteo [Dipartimento di Fisica dell' Universita di Milano (Italy); INFN, Sezione di Milano, Via Celoria 16, I-20133 Milan (Italy); Silva, Pedro J. [INFN, Sezione di Milano, Via Celoria 16, I-20133 Milan (Italy); Institut de Fisica d' Altes Energies (IFAE), Edf. Cn, Universitat Autonoma de Barcelona (UAB), E-08193 Bellaterra, Barcelona (Spain)

    2005-10-15

    In this article we study the relation between the bubbling construction and the Mathur's microscopic solutions for the D1/D5 system. We have found that the regular near horizon D1/D5 system (after appropriated constraints are imposed) contains all the bubbling regular solutions. Then, we show that the features of this system are rather different from the bubbling in AdS{sub 5} x S{sup 5}, since the perimeter and not the area plays a key role. After setting the main dictionary between the two approaches, we investigate on extensions to non-regular solutions like conical defects and/or naked singular solutions. In particular, among the latter metrics, closed time-like curves are found together with a chronology protection mechanism enforced by the AdS/CFT duality.

  12. Riemann-Hadamard method for solving a (2+1)-D problem for degenerate hyperbolic equation

    Science.gov (United States)

    Nikolov, Aleksey; Popivanov, Nedyu

    2015-11-01

    We consider a (2+1)-D boundary value problem for degenerate hyperbolic equation, which is closely connected with transonic fluid dynamics. This problem was introduced by Protter in 1954 as a multi-dimensional analogue of the Darboux problem in the plain, which is known to be well-posed. However the (2+1)-D problem is overdetermined with infinitely many conditions necessary for its classical solvability and there exist generalized solutions of this problem with strong singularities. Last years we study the exact asymptotic behavior of such singular solutions. We offer a Riemann-Hadamard method for solving the problem instead of the used until now method of successive approximations for solving an equivalent integral equation. As result, we obtain a more convenient representation of the singular solutions giving more precise results in our investigation.

  13. TBC1D24 Mutations in a Sibship with Multifocal Polymyoclonus

    Science.gov (United States)

    Ngoh, Adeline; Bras, Jose; Guerreiro, Rita; McTague, Amy; Ng, Joanne; Meyer, Esther; Chong, W. Kling; Boyd, Stewart; MacLellan, Linda; Kirkpatrick, Martin; Kurian, Manju A.

    2017-01-01

    Background Advances in molecular genetic technologies have improved our understanding of genetic causes of rare neurological disorders with features of myoclonus. Case Report A family with two affected siblings, presenting with multifocal polymyoclonus and neurodevelopmental delay, was recruited for whole-exome sequencing following unyielding diagnostic neurometabolic investigations. Compound heterozygous mutations in TBC1D24, a gene previously associated with various epilepsy phenotypes and hearing loss, were identified in both siblings. The mutations included a missense change c.457G>A (p.Glu157Lys), and a novel frameshift mutation c.545del (p.Thr182Serfs*6). Discussion We propose that TBC1D24-related diseases should be in the differential diagnosis for children with polymyoclonus. PMID:28428906

  14. Numerical Methods and Comparisons for 1D and Quasi 2D Streamer Propagation Models

    CERN Document Server

    Huang, Mengmin; Guan, Huizhe; Zeng, Rong

    2016-01-01

    In this work, we propose four different strategies to simulate the one-dimensional (1D) and quasi two-dimensional (2D) model for streamer propagation. Each strategy involves of one numerical method for solving Poisson's equation and another method for solving continuity equations in the models, and a total variation diminishing three-stage Runge-Kutta method in temporal discretization. The numerical methods for Poisson's equation include finite volume method, discontinuous Galerkin methods, mixed finite element method and least-squared finite element method. The numerical method for continuity equations is chosen from the family of discontinuous Galerkin methods. The accuracy tests and comparisons show that all of these four strategies are suitable and competitive in streamer simulations from the aspects of accuracy and efficiency. By applying any strategy in real simulations, we can study the dynamics of streamer propagations and influences due to the change of parameters in both of 1D and quasi 2D models. T...

  15. Design, implementation and analysis of fully digital 1-D controllable multiscroll chaos

    KAUST Repository

    Mansingka, Abhinav S.

    2011-12-01

    This paper introduces the fully digital implementation of a 1-D multiscroll chaos generator based on a staircase nonlinearity in the 3rd-order jerk system using the Euler approximation. For the first time, digital design is exploited to provide real-time controllability of (i) number of scrolls, (ii) position in 1-D space, (iii) Euler step size and (iv) system parameter. The effect of variations in these fields on the maximum Lyapunov exponent (MLE) is analyzed. The system is implemented using Verilog HDL and synthesized on an Xilinx Virtex 4 FPGA, exhibiting area utilization less than 3.5% and high performance with experimentally verified throughput up to 3.33 Gbits/s. This fully digital system enables applications in modulation schemes and chaos-based cryptosystems without analog to digital conversion. © 2011 IEEE.

  16. 1-D seismic velocity model and hypocenter relocation using double difference method around West Papua region

    Science.gov (United States)

    Sabtaji, Agung; Nugraha, Andri Dian

    2015-04-01

    West Papua region has fairly high of seismicity activities due to tectonic setting and many inland faults. In addition, the region has a unique and complex tectonic conditions and this situation lead to high potency of seismic hazard in the region. The precise earthquake hypocenter location is very important, which could provide high quality of earthquake parameter information and the subsurface structure in this region to the society. We conducted 1-D P-wave velocity using earthquake data catalog from BMKG for April, 2009 up to March, 2014 around West Papua region. The obtained 1-D seismic velocity then was used as input for improving hypocenter location using double-difference method. The relocated hypocenter location shows fairly clearly the pattern of intraslab earthquake beneath New Guinea Trench (NGT). The relocated hypocenters related to the inland fault are also observed more focus in location around the fault.

  17. Verification and comparison of four numerical schemes for a 1D viscoelastic blood flow model.

    Science.gov (United States)

    Wang, Xiaofei; Fullana, Jose-Maria; Lagrée, Pierre-Yves

    2015-01-01

    A reliable and fast numerical scheme is crucial for the 1D simulation of blood flow in compliant vessels. In this paper, a 1D blood flow model is incorporated with a Kelvin-Voigt viscoelastic arterial wall. This leads to a nonlinear hyperbolic-parabolic system, which is then solved with four numerical schemes, namely: MacCormack, Taylor-Galerkin, monotonic upwind scheme for conservation law and local discontinuous Galerkin. The numerical schemes are tested on a single vessel, a simple bifurcation and a network with 55 arteries. The numerical solutions are checked favorably against analytical, semi-analytical solutions or clinical observations. Among the numerical schemes, comparisons are made in four important aspects: accuracy, ability to capture shock-like phenomena, computational speed and implementation complexity. The suitable conditions for the application of each scheme are discussed.

  18. Analytical investigations of the magnetotelluric directionality estimation in 1-D anisotropic layered media

    Science.gov (United States)

    Okazaki, T.; Oshiman, N.; Yoshimura, R.

    2016-11-01

    Inferring geoelectric dimensionality (1D, 2D or 3D) and directionality (strike directions) from the impedance tensor is a basic procedure in magnetotelluric data processing. Given that electrical anisotropy is increasingly recognized in observations, it is valuable to understand the imprint of anisotropy in these analyses. In this paper, we analytically investigate the estimation of strike directions based on rotational invariants in 1D anisotropic layered media. We first show that if anisotropy axes are identical in all anisotropic layers, the estimated strike coincides with that direction. We then derive an analytical formula of the strike angle at long periods for general anisotropic layers with an isotropic basement. This formula shows a clear physical interpretation that the strike angle points where the conductance integrated along depth takes a maximum value.

  19. Effect of the deformation operator in the D1D5 CFT

    CERN Document Server

    Carson, Zaq; Mathur, Samir D; Turton, David

    2014-01-01

    The D1D5 CFT gives a holographic dual description of a near-extremal black hole in string theory. The interaction in this theory is given by a marginal deformation operator, which is composed of supercharges acting on a twist operator. The twist operator links together different copies of a free CFT. We study the effect of this deformation operator when it links together CFT copies with winding numbers M and N to produce a copy with winding M+N, populated with excitations of a particular form. We compute the effect of the deformation operator in the full supersymmetric theory, firstly on a Ramond-Ramond ground state and secondly on states with an initial bosonic or fermionic excitation. Our results generalize recent work which studied only the bosonic sector of the CFT. Our findings are a step towards understanding thermalization in the D1D5 CFT, which is related to black hole formation and evaporation in the bulk.

  20. Effect of the twist operator in the D1D5 CFT

    CERN Document Server

    Carson, Zaq; Mathur, Samir D; Turton, David

    2014-01-01

    The D1D5 CFT has been very useful in the study of black holes. The interaction in this theory involves a twist operator, which links together different copies of a free CFT. For the bosonic fields, we examine the action of this twist when it links together CFT copies with winding numbers M and N to produce a copy with winding M+N. Starting with the vacuum state generates a squeezed state, which we compute. Starting with an initial excitation on one of the copies gives a linear combination of excitations on the final state, which we also compute. These results generalize earlier computations where these quantities were computed for the special case M=N=1. Our results should help in understanding the thermalization process in the D1D5 CFT, which gives the dual of black hole formation in the bulk.

  1. Polarons in endohedral Li+@C60- dimers and in 1D and 2D crystals

    Science.gov (United States)

    Kawazoe, Yoshiyuki; Belosludov, Vladimir R.; Zhdanov, Ravil K.; Belosludov, Rodion V.

    2017-10-01

    The electron charge distribution and polaron formation on the carbon sites of dimer clusters Li+@C60- and of 1D or 2D Li+@C60- periodic systems are studied with the use of the generalized Su-Schrieffer-Heeger model with respect to the intermolecular and intramolecular degrees of freedom. The charge distributions over the molecular surface and Jahn-Teller bond distortions of carbon atoms are calculated using the self-consistent iterative methods. Polarons formed in periodic 1D and 2D systems (chains and planar layers) as well as in dimer cluster system are examined. In the periodic systems polaron formation may be described by the cooperative Jahn-Teller effect. Orientation of the polarons on the molecule surface depends on the doping of the system, moreover, electron doping changes the energy levels in the system.

  2. ZnO 1-D nanostructures: Low temperature synthesis and characterizations

    Indian Academy of Sciences (India)

    Apurba Dev; S Chaudhuri; B N Dev

    2008-06-01

    ZnO is one of the most important semiconductors having a wide variety of applications in photonic, field emission and sensing devices. In addition, it exhibits a wide variety of morphologies in the nano regime that can be grown by tuning the growth habit of the ZnO crystal. Among various nanostructures, oriented 1-D nanoforms are particularly important for applications such as UV laser, sensors, UV LED, field emission displays, piezoelectric nanogenerator etc. We have developed a soft chemical approach to fabricate well-aligned arrays of various 1-D nanoforms like nanonails, nanowires and nanorods. The microstructural and photoluminescence properties of all the structures were investigated and tuned by varying the synthesis parameters. Field emission study from the aligned nanorod arrays exhibited high current density and a low turn-on field. These arrays also exhibited very strong UV emission and week defect emission. These structures can be utilized to fabricate efficient UV LEDs.

  3. Static sign language recognition using 1D descriptors and neural networks

    Science.gov (United States)

    Solís, José F.; Toxqui, Carina; Padilla, Alfonso; Santiago, César

    2012-10-01

    A frame work for static sign language recognition using descriptors which represents 2D images in 1D data and artificial neural networks is presented in this work. The 1D descriptors were computed by two methods, first one consists in a correlation rotational operator.1 and second is based on contour analysis of hand shape. One of the main problems in sign language recognition is segmentation; most of papers report a special color in gloves or background for hand shape analysis. In order to avoid the use of gloves or special clothing, a thermal imaging camera was used to capture images. Static signs were picked up from 1 to 9 digits of American Sign Language, a multilayer perceptron reached 100% recognition with cross-validation.

  4. Quantitative Multiscale Analysis using Different Wavelets in 1D Voice Signal and 2D Image

    CERN Document Server

    Shakhakarmi, Niraj

    2012-01-01

    Mutiscale analysis represents multiresolution scrutiny of a signal to improve its signal quality. Multiresolution analysis of 1D voice signal and 2D image is conducted using DCT, FFT and different wavelets such as Haar, Deubachies, Morlet, Cauchy, Shannon, Biorthogonal, Symmlet and Coiflet deploying the cascaded filter banks based decomposition and reconstruction. The outstanding quantitative analysis of the specified wavelets is done to investigate the signal quality, mean square error, entropy and peak-to-peak SNR at multiscale stage-4 for both 1D voice signal and 2D image. In addition, the 2D image compression performance is significantly found 93.00% in DB-4, 93.68% in bior-4.4, 93.18% in Sym-4 and 92.20% in Coif-2 during the multiscale analysis.

  5. Self-assembly of magnetic Ni nanoparticles into 1D arrays with antiferromagnetic order.

    Science.gov (United States)

    Bliznyuk, V; Singamaneni, S; Sahoo, S; Polisetty, S; He, Xi; Binek, Ch

    2009-03-11

    In this paper, we report on the magnetic properties of isolated nanoparticles and interacting nanochains formed by the self-assembly of Ni nanoparticles. The magnetic properties were studied using superconducting quantum interference device (SQUID) magnetometry and magnetic force microscopy (MFM). We demonstrate that single-domain Ni nanoparticles spontaneously form one-dimensional (1D) chains under the influence of an external magnetic field. Furthermore, such magnetic field-driven self-assembly in conjunction with surface templating produces regular arrays of 1D nanochains with antiferromagnetic intra-chain order. The antiferromagnetic order, which is in striking contrast to what is found for non-interacting nanoparticle assemblies within the chains, can be evidenced from MFM and SQUID measurements.

  6. Self-assembly of magnetic Ni nanoparticles into 1D arrays with antiferromagnetic order

    Science.gov (United States)

    Bliznyuk, V.; Singamaneni, S.; Sahoo, S.; Polisetty, S.; He, Xi; Binek, Ch

    2009-03-01

    In this paper, we report on the magnetic properties of isolated nanoparticles and interacting nanochains formed by the self-assembly of Ni nanoparticles. The magnetic properties were studied using superconducting quantum interference device (SQUID) magnetometry and magnetic force microscopy (MFM). We demonstrate that single-domain Ni nanoparticles spontaneously form one-dimensional (1D) chains under the influence of an external magnetic field. Furthermore, such magnetic field-driven self-assembly in conjunction with surface templating produces regular arrays of 1D nanochains with antiferromagnetic intra-chain order. The antiferromagnetic order, which is in striking contrast to what is found for non-interacting nanoparticle assemblies within the chains, can be evidenced from MFM and SQUID measurements.

  7. (3 +1 )D Quasiparticle Anisotropic Hydrodynamics for Ultrarelativistic Heavy-Ion Collisions

    Science.gov (United States)

    Alqahtani, Mubarak; Nopoush, Mohammad; Ryblewski, Radoslaw; Strickland, Michael

    2017-07-01

    We present the first comparisons of experimental data with phenomenological results from (3 +1 )D quasiparticle anisotropic hydrodynamics (aHydroQP). We compare particle spectra, average transverse momentum, and elliptic flow. The dynamical equations used for the hydrodynamic stage utilize aHydroQP, which naturally includes both shear and bulk viscous effects. The (3 +1 )D aHydroQP evolution obtained is self-consistently converted to hadrons using anisotropic Cooper-Frye freeze-out. Hadron production and decays are modeled using a customized version of therminator 2. In this first study, we utilized smooth Glauber-type initial conditions and a single effective freeze-out temperature TFO=130 MeV with all hadronic species in full chemical equilibrium. With this rather simple setup, we find a very good description of many heavy-ion observables.

  8. Bifurcations of families of 1D-tori in 4D symplectic maps.

    Science.gov (United States)

    Onken, Franziska; Lange, Steffen; Ketzmerick, Roland; Bäcker, Arnd

    2016-06-01

    The regular structures of a generic 4d symplectic map with a mixed phase space are organized by one-parameter families of elliptic 1d-tori. Such families show prominent bends, gaps, and new branches. We explain these features in terms of bifurcations of the families when crossing a resonance. For these bifurcations, no external parameter has to be varied. Instead, the longitudinal frequency, which varies along the family, plays the role of the bifurcation parameter. As an example, we study two coupled standard maps by visualizing the elliptic and hyperbolic 1d-tori in a 3d phase-space slice, local 2d projections, and frequency space. The observed bifurcations are consistent with the analytical predictions previously obtained for quasi-periodically forced oscillators. Moreover, the new families emerging from such a bifurcation form the skeleton of the corresponding resonance channel.

  9. Localized self-heating in large arrays of 1D nanostructures

    Science.gov (United States)

    Monereo, O.; Illera, S.; Varea, A.; Schmidt, M.; Sauerwald, T.; Schütze, A.; Cirera, A.; Prades, J. D.

    2016-02-01

    One dimensional (1D) nanostructures offer a promising path towards highly efficient heating and temperature control in integrated microsystems. The so called self-heating effect can be used to modulate the response of solid state gas sensor devices. In this work, efficient self-heating was found to occur at random networks of nanostructured systems with similar power requirements to highly ordered systems (e.g. individual nanowires, where their thermal efficiency was attributed to the small dimensions of the objects). Infrared thermography and Raman spectroscopy were used to map the temperature profiles of films based on random arrangements of carbon nanofibers during self-heating. Both the techniques demonstrate consistently that heating concentrates in small regions, the here-called ``hot-spots''. On correlating dynamic temperature mapping with electrical measurements, we also observed that these minute hot-spots rule the resistance values observed macroscopically. A physical model of a random network of 1D resistors helped us to explain this observation. The model shows that, for a given random arrangement of 1D nanowires, current spreading through the network ends up defining a set of spots that dominate both the electrical resistance and power dissipation. Such highly localized heating explains the high power savings observed in larger nanostructured systems. This understanding opens a path to design highly efficient self-heating systems, based on random or pseudo-random distributions of 1D nanostructures.One dimensional (1D) nanostructures offer a promising path towards highly efficient heating and temperature control in integrated microsystems. The so called self-heating effect can be used to modulate the response of solid state gas sensor devices. In this work, efficient self-heating was found to occur at random networks of nanostructured systems with similar power requirements to highly ordered systems (e.g. individual nanowires, where their thermal

  10. Formation of Water Chains on CaO(001): What Drives the 1D Growth?

    Science.gov (United States)

    Zhao, Xunhua; Shao, Xiang; Fujimori, Yuichi; Bhattacharya, Saswata; Ghiringhelli, Luca M; Freund, Hans-Joachim; Sterrer, Martin; Nilius, Niklas; Levchenko, Sergey V

    2015-04-02

    Formation of partly dissociated water chains is observed on CaO(001) films upon water exposure at 300 K. While morphology and orientation of the 1D assemblies are revealed from scanning tunneling microscopy, their atomic structure is identified with infrared absorption spectroscopy combined with density functional theory calculations. The latter exploit an ab initio genetic algorithm linked to atomistic thermodynamics to determine low-energy H2O configurations on the oxide surface. The development of 1D structures on the C4v symmetric CaO(001) is triggered by symmetry-broken water tetramers and a favorable balance between adsorbate-adsorbate versus adsorbate-surface interactions at the constraint of the CaO lattice parameter.

  11. Controlling Interface States in 1D Photonic Crystals by tuning Bulk Geometric Phases

    CERN Document Server

    Gao, Wensheng; Chen, Baojie; Pun, Edwin Y B; Chan, C T; Tam, Wing Yim

    2016-01-01

    Interface states in photonic crystals usually require defects or surface/interface decorations. We show here that one can control interface states in 1D photonic crystals through the engineering of geometrical phase such that interface states can be guaranteed in even or odd, or in all photonic bandgaps. We verify experimentally the designed interface states in 1D multilayered photonic crystals fabricated by electron beam vapor deposition. We also obtain the geometrical phases by measuring the reflection phases at the bandgaps of the PCs and achieve good agreement with the theory. Our approach could provide a platform for the design of using interface states in photonic crystals for nonlinear optic, sensing, and lasing applications

  12. Rogue-wave bullets in a composite (2+1)D nonlinear medium.

    Science.gov (United States)

    Chen, Shihua; Soto-Crespo, Jose M; Baronio, Fabio; Grelu, Philippe; Mihalache, Dumitru

    2016-07-11

    We show that nonlinear wave packets localized in two dimensions with characteristic rogue wave profiles can propagate in a third dimension with significant stability. This unique behavior makes these waves analogous to light bullets, with the additional feature that they propagate on a finite background. Bulletlike rogue-wave singlet and triplet are derived analytically from a composite (2+1)D nonlinear wave equation. The latter can be interpreted as the combination of two integrable (1+1)D models expressed in different dimensions, namely, the Hirota equation and the complex modified Korteweg-de Vries equation. Numerical simulations confirm that the generation of rogue-wave bullets can be observed in the presence of spontaneous modulation instability activated by quantum noise.

  13. Magnetic Anticrossing of 1D Subbands in Coupled Ballistic Double Quantum Wires

    Energy Technology Data Exchange (ETDEWEB)

    BLOUNT,MARK A.; MOON,JEONG-SUN; SIMMONS,JERRY A.; LYO,SUNGKWUN K.; WENDT,JOEL R.; RENO,JOHN L.

    2000-07-13

    We study the low-temperature in-plane magnetoconductance of vertically coupled double quantum wires. Using a novel flip-chip technique, the wires are defined by two pairs of mutually aligned split gates on opposite sides of a s 1 micron thick AlGaAs/GaAs double quantum well heterostructure. We observe quantized conductance steps due to each quantum well and demonstrate independent control of each ID wire. A broad dip in the magnetoconductance at -6 T is observed when a magnetic field is applied perpendicular to both the current and growth directions. This conductance dip is observed only when 1D subbands are populated in both the top and bottom constrictions. This data is consistent with a counting model whereby the number of subbands crossing the Fermi level changes with field due to the formation of an anticrossing in each pair of 1D subbands.

  14. A 1D (radial) Plasma Jet Propagation Study for the Plasma Liner Experiment (PLX)

    Science.gov (United States)

    Thompson, J. R.; Bogatu, I. N.; Galkin, S. A.; Kim, J. S.; Welch, D. R.; Thoma, C.; Golovkin, I.; Macfarlane, J. J.; Case, A.; Messer, S. J.; Witherspoon, F. D.; Cassibry, J. T.; Awe, T. J.; Hsu, S. C.

    2011-10-01

    The Plasma Liner Experiment will explore the formation of imploding spherical ``plasma liners'' that reach peak pressures of 0.1 Mbar upon stagnation. The liners will be formed through the merging of dense, high velocity plasma jets (n ~1017 cm-3, T ~3 eV, v ~50 km/s) in a spherically convergent geometry. The focus of this 1D (radial) study is argon plasma jet evolution during propagation from the rail gun source to the jet merging radius. The study utilizes the Large Scale Plasma (LSP) PIC code with atomic physics included through the use of a non-Local Thermal Equilibrium (NLTE) Equation of State (EOS) table. We will present scenarios for expected 1D (radial) plasma jet evolution, from upon exiting the PLX rail gun to reaching the jet merging radius. The importance of radiation cooling early in the simulation is highlighted. Work supported by US DOE grant DE-FG02-05ER54835.

  15. Bifurcations of families of 1D-tori in 4D symplectic maps

    Science.gov (United States)

    Onken, Franziska; Lange, Steffen; Ketzmerick, Roland; Bäcker, Arnd

    2016-06-01

    The regular structures of a generic 4d symplectic map with a mixed phase space are organized by one-parameter families of elliptic 1d-tori. Such families show prominent bends, gaps, and new branches. We explain these features in terms of bifurcations of the families when crossing a resonance. For these bifurcations, no external parameter has to be varied. Instead, the longitudinal frequency, which varies along the family, plays the role of the bifurcation parameter. As an example, we study two coupled standard maps by visualizing the elliptic and hyperbolic 1d-tori in a 3d phase-space slice, local 2d projections, and frequency space. The observed bifurcations are consistent with the analytical predictions previously obtained for quasi-periodically forced oscillators. Moreover, the new families emerging from such a bifurcation form the skeleton of the corresponding resonance channel.

  16. Membranes having aligned 1-D nanoparticles in a matrix layer for improved fluid separation

    Energy Technology Data Exchange (ETDEWEB)

    Revanur, Ravindra; Lulevich, Valentin; Roh, Il Juhn; Klare, Jennifer E.; Kim, Sangil; Noy, Aleksandr; Bakajin, Olgica

    2015-12-22

    Membranes for fluid separation are disclosed. These membranes have a matrix layer sandwiched between an active layer and a porous support layer. The matrix layer includes 1-D nanoparticles that are vertically aligned in a porous polymer matrix, and which substantially extend through the matrix layer. The active layer provides species-specific transport, while the support layer provides mechanical support. A matrix layer of this type has favorable surface morphology for forming the active layer. Furthermore, the pores that form in the matrix layer tend to be smaller and more evenly distributed as a result of the presence of aligned 1-D nanoparticles. Improved performance of separation membranes of this type is attributed to these effects.

  17. 1-D seismic velocity model and hypocenter relocation using double difference method around West Papua region

    Energy Technology Data Exchange (ETDEWEB)

    Sabtaji, Agung, E-mail: sabtaji.agung@gmail.com, E-mail: agung.sabtaji@bmkg.go.id [Study Program of Earth Sciences, Faculty of Earth Sciencies and Technology, Institute of Technology Bandung, Bandung 40132 (Indonesia); Indonesia’s Agency for Meteorological, Climatological and Geophysics Region V, Jayapura 1572 (Indonesia); Nugraha, Andri Dian, E-mail: nugraha@gf.itb.ac.id [Global Geophysics Research Group, Faculty of Mining and Petroleum Engineering, Institute of Technology Bandung, Bandung 40132 (Indonesia)

    2015-04-24

    West Papua region has fairly high of seismicity activities due to tectonic setting and many inland faults. In addition, the region has a unique and complex tectonic conditions and this situation lead to high potency of seismic hazard in the region. The precise earthquake hypocenter location is very important, which could provide high quality of earthquake parameter information and the subsurface structure in this region to the society. We conducted 1-D P-wave velocity using earthquake data catalog from BMKG for April, 2009 up to March, 2014 around West Papua region. The obtained 1-D seismic velocity then was used as input for improving hypocenter location using double-difference method. The relocated hypocenter location shows fairly clearly the pattern of intraslab earthquake beneath New Guinea Trench (NGT). The relocated hypocenters related to the inland fault are also observed more focus in location around the fault.

  18. Lacunarity analysis of raster datasets and 1D, 2D, and 3D point patterns

    Science.gov (United States)

    Dong, Pinliang

    2009-10-01

    Spatial scale plays an important role in many fields. As a scale-dependent measure for spatial heterogeneity, lacunarity describes the distribution of gaps within a set at multiple scales. In Earth science, environmental science, and ecology, lacunarity has been increasingly used for multiscale modeling of spatial patterns. This paper presents the development and implementation of a geographic information system (GIS) software extension for lacunarity analysis of raster datasets and 1D, 2D, and 3D point patterns. Depending on the application requirement, lacunarity analysis can be performed in two modes: global mode or local mode. The extension works for: (1) binary (1-bit) and grey-scale datasets in any raster format supported by ArcGIS and (2) 1D, 2D, and 3D point datasets as shapefiles or geodatabase feature classes. For more effective measurement of lacunarity for different patterns or processes in raster datasets, the extension allows users to define an area of interest (AOI) in four different ways, including using a polygon in an existing feature layer. Additionally, directionality can be taken into account when grey-scale datasets are used for local lacunarity analysis. The methodology and graphical user interface (GUI) are described. The application of the extension is demonstrated using both simulated and real datasets, including Brodatz texture images, a Spaceborne Imaging Radar (SIR-C) image, simulated 1D points on a drainage network, and 3D random and clustered point patterns. The options of lacunarity analysis and the effects of polyline arrangement on lacunarity of 1D points are also discussed. Results from sample data suggest that the lacunarity analysis extension can be used for efficient modeling of spatial patterns at multiple scales.

  19. Development of a hybrid deterministic/stochastic method for 1D nuclear reactor kinetics

    Science.gov (United States)

    Terlizzi, Stefano; Rahnema, Farzad; Zhang, Dingkang; Dulla, Sandra; Ravetto, Piero

    2015-12-01

    A new method has been implemented for solving the time-dependent neutron transport equation efficiently and accurately. This is accomplished by coupling the hybrid stochastic-deterministic steady-state coarse-mesh radiation transport (COMET) method [1,2] with the new predictor-corrector quasi-static method (PCQM) developed at Politecnico di Torino [3]. In this paper, the coupled method is implemented and tested in 1D slab geometry.

  20. Controlled Growth and Field-emission Application of 1D ZnS Nanostructures

    Institute of Scientific and Technical Information of China (English)

    X.S.Fang; Y.Bando; D.Golberg

    2007-01-01

    1 Results One-dimensional (1D) nanostructures have recently stimulated great interest due to their potential value for understanding fundamental physical concepts and for applications in constructing nanoscale electric and optoelectronic devices since the discovery of carbon nanotubes[1]. ZnS is one of the first semiconductors discovered and probably one of the most important materials in the electronics industry with a wide range of applications[2]. Controllable growth of nanostructures is a crucial is...

  1. Finite difference approximation of control via the potential in a 1-D Schrodinger equation

    Directory of Open Access Journals (Sweden)

    K. Kime

    2000-04-01

    Full Text Available We consider the problem of steering given initial data to given terminal data via a time-dependent potential, the control, in a 1-D Schrodinger equation. We determine a condition for existence of a transferring potential within our approximation. Using Maple, we give equations for the control and also examples in which the potential is restricted to be centralized and to be a step potential.

  2. Development of a hybrid deterministic/stochastic method for 1D nuclear reactor kinetics

    Energy Technology Data Exchange (ETDEWEB)

    Terlizzi, Stefano; Dulla, Sandra; Ravetto, Piero [Politecnico di Torino, Corso Duca degli Abruzzi, 24 10129, Torino (Italy); Rahnema, Farzad, E-mail: farzad@gatech.edu [Nuclear & Radiological Engineering and Medical Physics Programs, Georgia Institute of Technology, 770 State Street NW, Atlanta, Ga, 30332-0745 (United States); Nuclear & Radiological Engineering and Medical Physics Programs, Georgia Institute of Technology, 770 State Street NW, Atlanta, Ga, 30332-0745 (United States); Zhang, Dingkang [Nuclear & Radiological Engineering and Medical Physics Programs, Georgia Institute of Technology, 770 State Street NW, Atlanta, Ga, 30332-0745 (United States)

    2015-12-31

    A new method has been implemented for solving the time-dependent neutron transport equation efficiently and accurately. This is accomplished by coupling the hybrid stochastic-deterministic steady-state coarse-mesh radiation transport (COMET) method [1,2] with the new predictor-corrector quasi-static method (PCQM) developed at Politecnico di Torino [3]. In this paper, the coupled method is implemented and tested in 1D slab geometry.

  3. Modelling Hydrology of a Single Bioretention System with HYDRUS-1D

    OpenAIRE

    Yingying Meng; Huixiao Wang; Jiangang Chen; Shuhan Zhang

    2014-01-01

    A study was carried out on the effectiveness of bioretention systems to abate stormwater using computer simulation. The hydrologic performance was simulated for two bioretention cells using HYDRUS-1D, and the simulation results were verified by field data of nearly four years. Using the validated model, the optimization of design parameters of rainfall return period, filter media depth and type, and surface area was discussed. And the annual hydrologic performance of bioretention systems was ...

  4. Quasi-1D van der Waals materials as high current-density local interconnects (Conference Presentation)

    Science.gov (United States)

    Stolyarov, Maxim; Aytan, Ece; Bloodgood, Matthew; Salguero, Tina T.; Balandin, Alexander A.

    2016-09-01

    The continuous downscaling of interconnect dimensions in combination with the introduction of low-k dielectrics has increased the number of heat dissipation, integration and reliability challenges in modern electronics. As a result, there is a strong need for new materials that have high current-carrying capacity for applications as nanoscale interconnects. In this presentation, we show that quasi-one-dimensional (1D) van der Waals metals such as TaSe3 have excellent breakdown current density exceeding that of 5 MA/cm2. This value is above that currently achievable in conventional copper or aluminum wires. The quasi-1D van der Waals materials are characterized by strong bonds along one dimension and weak van der Waals bonds along two other dimensions. The material for this study was grown by the chemical vapor transport (CVT) method. Both mechanical and chemical exfoliation methods were used to fabricate nanowires with lateral dimensions below 100 nm. The dimensions of the quasi-1D nanowires were verified with scanning electron microscopy (SEM) and atomic force microscopy (AFM). The metal (Ti/Au) contacts for the electrical characterization were deposited using electron beam evaporation (EBE). The measurements were conducted on a number of prototype interconnects with multiple electric contacts to ensure reproducibility. The obtained results suggest that quasi-1D van der Waals metals present a feasible alternative to conventional copper interconnects in terms of the current-carrying capacity and the breakdown current-density. This work was supported, in part, by the SRC and DARPA through STARnet Center for Function Accelerated nanoMaterial Engineering (FAME).

  5. Transfer Matrix Approach to 1d Random Band Matrices: Density of States

    Science.gov (United States)

    Shcherbina, Mariya; Shcherbina, Tatyana

    2016-09-01

    We study the special case of n× n 1D Gaussian Hermitian random band matrices, when the covariance of the elements is determined by the matrix J=(-W^2triangle +1)^{-1}. Assuming that n≥ CW log W≫ 1, we prove that the averaged density of states coincides with the Wigner semicircle law up to the correction of order W^{-1}.

  6. Scotogenic $Z_2$ or $U(1)_D$ Model of Neutrino Mass with $\\Delta(27)$ Symmetry

    CERN Document Server

    Ma, Ernest

    2014-01-01

    The scotogenic model of radiative neutrino mass with $Z_2$ or $U(1)_D$ dark matter is shown to accommodate $\\Delta(27)$ symmetry naturally. The resulting neutrino mass matrix is identical to either of two forms, one proposed in 2006, the other in 2008. These two structures are studied in the context of present neutrino data, with predictions of $CP$ violation and neutrinoless double beta decay.

  7. A Fulling-Kuchment theorem for the 1D harmonic oscillator

    CERN Document Server

    Guillemin, Victor

    2011-01-01

    We prove that there exists a pair of "non-isospectral" 1D semiclassical Schr\\"odinger operators whose spectra agree modulo h^\\infty. In particular, all their semiclassical trace invariants are the same. Our proof is based on an idea of Fulling-Kuchment and Hadamard's variational formula applied to suitable perturbations of the harmonic oscillator. Keywords: Inverse spectral problems, semiclassical Schr\\"odinger operators, trace invariants, Hadamard's variational formula, harmonic oscillator, Penrose mushroom, Sturm-Liouville theory.

  8. Mentor Graphics在京发布1D-3D CFD解决方案

    Institute of Scientific and Technical Information of China (English)

    杜莹

    2012-01-01

    7月10日,Mentor Graphics1D-3D CFD解决方案战略发布会在北京举行。作为领先的电子设计自动化技术和MCAE技术的领导厂商,Mentor Graphics Mechanical Analysis部门总经理Erich Buergel分享了最新的产品解决方案。

  9. Complex Langevin Dynamics in 1+1d QCD at Non-Zero Densities

    CERN Document Server

    Schmalzbauer, Sebastian

    2016-01-01

    We present our results obtained from gauge cooled complex Langevin simulations in 1+1d QCD at non-zero densities in the strong coupling regime with unrooted staggered fermions. For small quark masses there are regions of the chemical potential where this method fails to reproduce correct results. In these parameter ranges we studied the effect of different gauge cooling schemes on the distributions of the fermion determinant as well as of observables.

  10. Time-dependent delta-interactions for 1D Schr\\"odinger Hamiltonians

    CERN Document Server

    Hmidi, Taoufik; Nier, Francis

    2009-01-01

    The non autonomous Cauchy problem for time dependent 1D point interactions is considered. The regularity assumptions for the coupling parameter are accurately analyzed and show that the general results for non autonomous linear evolution equations in Banach spaces are far from being optimal. In the mean time, this article shows an unexpected application of paraproduct techniques, initiated by J.M. Bony for nonlinear partial differential equations, to a classical linear problem.

  11. Towards an Automatic Parking System using Bio-Inspired 1-D Optical Flow Sensors

    OpenAIRE

    2015-01-01

    International audience; Although several (semi-) automatic parking systems have been presented throughout the years [1]–[12], car manufacturers are still looking for low-cost sensors providing redundant information about the obstacles around the vehicle, as well as efficient methods of processing this information, in the hope of achieving a very high level of robustness. We therefore investigated how Local Motion Sensors (LMSs) [13], [14], comprising only of a few pixels giving 1-D optical fl...

  12. New Scotogenic Model of Neutrino Mass with $U(1)_D$ Gauge Interaction

    CERN Document Server

    Ma, Ernest; Radovcic, Branimir

    2013-01-01

    We propose a new realization of the one-loop radiative model of neutrino mass generated by dark matter (scotogenic), where the particles in the loop have an additional $U(1)_D$ gauge symmetry, which may be exact or broken to $Z_2$. This model is relevant to a number of astrophysical observations, including AMS-02 and the dark matter distribution in dwarf galactic halos.

  13. Uranium(VI) coordination polymers with pyromellitate ligand: Unique 1D channel structures and diverse fluorescence

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yingjie, E-mail: yzx@ansto.gov.au [Australian Nuclear Science and Technology Organization, Locked Bag 2001, Kirrawee DC, NSW 2232 (Australia); Bhadbhade, Mohan [Mark Wainwright Analytical Centre, University of New South Wales, Kensington, NSW 2052 (Australia); Karatchevtseva, Inna [Australian Nuclear Science and Technology Organization, Locked Bag 2001, Kirrawee DC, NSW 2232 (Australia); Price, Jason R. [Australian Synchrotron, 800 Blackburn Road, Clayton, VIC 3168 (Australia); Liu, Hao [Centre for Clean Energy Technology, School of Chemistry and Forensic Science, University of Technology Sydney, PO Box 123, Broadway, Sydney, NSW 2007 (Australia); Zhang, Zhaoming; Kong, Linggen [Australian Nuclear Science and Technology Organization, Locked Bag 2001, Kirrawee DC, NSW 2232 (Australia); Čejka, Jiří [Department of Mineralogy, National Museum, Václavské náměstí, 68, Prague 1, 115 79-CZ (Czech Republic); Lu, Kim; Lumpkin, Gregory R. [Australian Nuclear Science and Technology Organization, Locked Bag 2001, Kirrawee DC, NSW 2232 (Australia)

    2015-03-15

    Three new coordination polymers of uranium(VI) with pyromellitic acid (H{sub 4}btca) have been synthesized and structurally characterized. (ED)[(UO{sub 2})(btca)]·(DMSO)·3H{sub 2}O (1) (ED=ethylenediammonium; DMSO=dimethylsulfoxide) has a lamellar structure with intercalation of ED and DMSO. (NH{sub 4}){sub 2}[(UO{sub 2}){sub 6}O{sub 2}(OH){sub 6}(btca)]·~6H{sub 2}O (2) has a 3D framework built from 7-fold coordinated uranyl trinuclear units and btca ligands with 1D diamond-shaped channels (~8.5 Å×~8.6 Å). [(UO{sub 2}){sub 2}(H{sub 2}O)(btca)]·4H{sub 2}O (3) has a 3D network constructed by two types of 7-fold coordinated uranium polyhedron. The unique μ{sub 5}-coordination mode of btca in 3 enables the formation of 1D olive-shaped large channels (~4.5 Å×~19 Å). Vibrational modes, thermal stabilities and fluorescence properties have been investigated. - Graphical abstract: Table of content: three new uranium(VI) coordination polymers with pyromellitic acid (H{sub 4}btca) have been synthesized via room temperature and hydrothermal synthesis methods, and structurally characterized. Two to three dimensional (3D) frameworks are revealed. All 3D frameworks have unique 1D large channels. Their vibrational modes, thermal stabilities and photoluminescence properties have been investigated. - Highlights: • Three new coordination polymers of U(VI) with pyromellitic acid (H{sub 4}btca). • Structures from a 2D layer to 3D frameworks with unique 1D channels. • Unusual µ{sub 5}-(η{sub 1}:η{sub 2}:η{sub 1}:η{sub 2:}η{sub 1}) coordination mode of btca ligand. • Vibrational modes, thermal stabilities and luminescent properties reported.

  14. Two Qubits Entanglement Dynamics in 1D Heisenberg Chain with Intrinsic Decoherence

    Institute of Scientific and Technical Information of China (English)

    SHAO Bin; ZHANG Li-li; ZOU Jian

    2006-01-01

    To reveal how the decoherence modifies the time evolution of the entanglement of quantum system,the intrinsic decoherence approach and the entanglement of formation are used, and the time evolution of entanglement for two-qubit 1D quantum Heisenberg model in an external uniform magnetic field is derived. It is shown that the external magnetic field can strengthen the effects of the intrinsic decoherence on the entanglement of the system.

  15. 1D-Var temperature retrievals from microwave radiometer and convective scale model

    Directory of Open Access Journals (Sweden)

    Pauline Martinet

    2015-12-01

    Full Text Available This paper studies the potential of ground-based microwave radiometers (MWR for providing accurate temperature retrievals by combining convective scale numerical models and brightness temperatures (BTs. A one-dimensional variational (1D-Var retrieval technique has been tested to optimally combine MWR and 3-h forecasts from the French convective scale model AROME. A microwave profiler HATPRO (Humidity and Temperature PROfiler was operated during 6 months at the meteorological station of Bordeaux (Météo France. MWR BTs were monitored against simulations from the Atmospheric Radiative Transfer Simulator 2 radiative transfer model. An overall good agreement was found between observations and simulations for opaque V-band channels but large errors were observed for channels the most affected by liquid water and water vapour emissions (51.26 and 52.28 GHz. 1D-Var temperature retrievals are performed in clear-sky and cloudy conditions using a screening procedure based on cloud base height retrieval from ceilometer observations, infrared radiometer temperature and liquid water path derived from the MWR observations. The 1D-Var retrievals were found to improve the AROME forecasts up to 2 km with a maximum gain of approximately 50 % in root-mean-square-errors (RMSE below 500 m. They were also found to outperform neural network retrievals. A static bias correction was proposed to account for systematic instrumental errors. This correction was found to have a negligible impact on the 1D-Var retrievals. The use of low elevation angles improves the retrievals up to 12 % in RMSE in cloudy-sky in the first layers. The present implementation achieved a RMSE with respect to radiosondes within 1 K in clear-sky and 1.3 K in cloudy-sky conditions for temperature.

  16. E1DS: catalytic site prediction based on 1D signatures of concurrent conservation

    OpenAIRE

    2008-01-01

    Large-scale automatic annotation of protein sequences remains challenging in postgenomics era. E1DS is designed for annotating enzyme sequences based on a repository of 1D signatures. The employed sequence signatures are derived using a novel pattern mining approach that discovers long motifs consisted of several sequential blocks (conserved segments). Each of the sequential blocks is considerably conserved among the protein members of an EC group. Moreover, a signature includes at least thre...

  17. Insulin stimulation regulates AS160 and TBC1D1 phosphorylation sites in human skeletal muscle

    DEFF Research Database (Denmark)

    Middelbeek, R J W; Chambers, M A; Tantiwong, P

    2013-01-01

    Individuals with obesity and type 2 diabetes (T2D) are typically insulin resistant, exhibiting impaired skeletal muscle glucose uptake. Animal and cell culture experiments have shown that site-specific phosphorylation of the Rab-GTPase-activating proteins AS160 and TBC1D1 is critical for GLUT4 tr...... translocation facilitating glucose uptake, but their regulation in human skeletal muscle is not well understood....

  18. Piezo-semiconductive quasi-1D nanodevices with or without anti-symmetry.

    Science.gov (United States)

    Araneo, Rodolfo; Lovat, Giampiero; Burghignoli, Paolo; Falconi, Christian

    2012-09-04

    The piezopotential in floating, homogeneous, quasi-1D piezo-semiconductive nanostructures under axial stress is an anti-symmetric (i.e., odd) function of force. Here, after introducing piezo-nano-devices with floating electrodes for maximum piezo-potential, we show that breaking the anti-symmetric nature of the piezopotential-force relation, for instance by using conical nanowires, can lead to better nanogenerators, piezotronic and piezophototronic devices.

  19. Implementation and validation of a 1D fluid model for collapsible channels.

    Science.gov (United States)

    Anderson, Peter; Fels, Sidney; Green, Sheldon

    2013-11-01

    A 1D fluid model is implemented for the purpose of fluid-structure interaction (FSI) simulations in complex and completely collapsible geometries, particularly targeting the case of obstructive sleep apnea (OSA). The fluid mechanics are solved separately from any solid mechanics, making possible the use of a highly complex and/or black-box solver for the solid mechanics. The fluid model is temporally discretized with a second-order scheme and spatially discretized with an asymmetrical fourth-order scheme that is robust in highly uneven geometries. A completely collapsing and reopening geometry is handled smoothly using a modified area function. The numerical implementation is tested with two driven-geometry cases: (1) an inviscid analytical solution and (2) a completely closing geometry with viscous flow. Three-dimensional fluid simulations in static geometries are performed to examine the assumptions of the 1D model, and with a well-defined pressure-recovery constant the 1D model agrees well with 3D models. The model is very fast computationally, is robust, and is recommended for OSA simulations where the bulk flow pressure is primarily of interest.

  20. Resonance Raman Spectroscopy of Extreme Nanowires and Other 1D Systems

    Science.gov (United States)

    Smith, David C.; Spencer, Joseph H.; Sloan, Jeremy; McDonnell, Liam P.; Trewhitt, Harrison; Kashtiban, Reza J.; Faulques, Eric

    2016-01-01

    This paper briefly describes how nanowires with diameters corresponding to 1 to 5 atoms can be produced by melting a range of inorganic solids in the presence of carbon nanotubes. These nanowires are extreme in the sense that they are the limit of miniaturization of nanowires and their behavior is not always a simple extrapolation of the behavior of larger nanowires as their diameter decreases. The paper then describes the methods required to obtain Raman spectra from extreme nanowires and the fact that due to the van Hove singularities that 1D systems exhibit in their optical density of states, that determining the correct choice of photon excitation energy is critical. It describes the techniques required to determine the photon energy dependence of the resonances observed in Raman spectroscopy of 1D systems and in particular how to obtain measurements of Raman cross-sections with better than 8% noise and measure the variation in the resonance as a function of sample temperature. The paper describes the importance of ensuring that the Raman scattering is linearly proportional to the intensity of the laser excitation intensity. It also describes how to use the polarization dependence of the Raman scattering to separate Raman scattering of the encapsulated 1D systems from those of other extraneous components in any sample. PMID:27168195

  1. Soil salt leaching under different irrigation regimes:HYDRUS-1D modelling and analysis

    Institute of Scientific and Technical Information of China (English)

    WenZhi ZENG; Chi XU; JingWei WU; JieSheng HUANG

    2014-01-01

    Field irrigation experiments were conducted in the Hetao Irrigation District of Inner Mongolia, China, to study the effects of irrigation regimes on salt leaching in the soil profile. The data were used to calibrate and validate the HYDRUS-1D model. The results demonstrated that the model can accurately simulate the water and salt dy-namics in the soil profile. The HYDRUS-1D model was then used to simulate 15 distinct irrigation scenarios. The results of the simulation indicated that irrigation amount did not have a significant effect on soil water storage but that increases in irrigation amount could accelerate salt leaching. However, when the irrigation amount was larger than 20 cm, the acceleration was not obvious. Compared with irrigating only once, intermittent irrigation had a better effect on increasing soil water storage and salt leaching, but excessive irrigation times and intervals did not improve salt leaching. In addition, we found that the irrigation regime of 20 cm, irrigated twice at 1-d intervals, might signifi-cantly increase salt leaching in the plough layer and decrease the risks of deep seepage and groundwater con-tamination.

  2. An experimental and theoretical investigation of the C(1D) + D2 reaction

    CERN Document Server

    Hickson, Kevin M

    2016-01-01

    In a previous joint experimental and theoretical study of the barrierless chemical reaction C(1D) + H2 at low temperatures (300-50 K) [K. M. Hickson, J.-C. Loison, H. Guo, Y. V. Suleimanov, J. Phys. Chem. Lett., 2015, 6, 4194.], excellent agreement was found between experimental thermal rate constants and theoretical estimates based on ring polymer molecular dynamics (RPMD) over the two lowest singlet potential energy surfaces (PESs). Here, we extend this work to one of its deuterated counterparts, C(1D) + D2, over the same temperature range. Experimental and RPMD results are in very good agreement when contributions from both PESs to this chemical reaction are included in the RPMD simulations. The deviation between experiment and the RPMD calculations does not exceed 25 % and both results exhibit a slight negative temperature dependence. The first excited 1A" PES plays a more important role than the ground 1A' PES as the temperature is decreased, similar to our previous studies of the C(1D) + H2 reaction but...

  3. Neutronic analysis of the 1D and 1E banks reflux detection system

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.

    1999-12-21

    Two H Canyon neutron monitoring systems for early detection of postulated abnormal reflux conditions in the Second Uranium Cycle 1E and 1D Mixer-Settle Banks have been designed and built. Monte Carlo neutron transport simulations using the general purpose, general geometry, n-particle MCNP code have been performed to model expected response of the monitoring systems to varying conditions.The confirmatory studies documented herein conclude that the 1E and 1D neutron monitoring systems are able to achieve adequate neutron count rates for various neutron source and detector configurations, thereby eliminating excessive integration count time. Neutron count rate sensitivity studies are also performed. Conversely, the transport studies concluded that the neutron count rates are statistically insensitive to nitric acid content in the aqueous region and to the transition region length. These studies conclude that the 1E and 1D neutron monitoring systems are able to predict the postulated reflux conditions for all examined perturbations in the neutron source and detector configurations. In the cases examined, the relative change in the neutron count rates due to postulated transitions from normal {sup 235}U concentration levels to reflux levels remain satisfactory detectable.

  4. Measuring the Speed of Sound in a 1D Fermi Gas

    Science.gov (United States)

    Fry, Jacob; Revelle, Melissa; Hulet, Randall

    2016-05-01

    We report measurements of the speed of sound in a two-spin component, 1D gas of fermionic lithium. The 1D system is an array of one-dimensional tubes created by a 2D optical lattice. By increasing the lattice depth, the tunneling between tubes is sufficiently small to make each an independent 1D system. To measure the speed of sound, we create a density notch at the center of the atom cloud using a sheet of light tuned far from resonance. The dipole force felt by both spin states will be equivalent, so this notch can be thought of as a charge excitation. Once this beam is turned off, the notch propagates to the edge of the atomic cloud with a velocity that depends on the strength of interatomic interactions. We control interactions using a magnetically tuned Feshbach resonance, allowing us to measure the speed of sound over a wide range of interaction. This method may be used to extract the Luttinger parameter vs. interaction strength. Supported by an ARO MURI Grant, NSF, and The Welch Foundation.

  5. Surface defect inspection of TFT-LCD panels based on 1D Fourier method

    Science.gov (United States)

    Zhang, Teng-da; Lu, Rong-sheng

    2016-01-01

    Flat panel displays have been used in a wide range of electronic devices. The defects on their surfaces are an important factor affecting the product quality. Automated optical inspection (AOI) method is an important and effective means to perform the surface defection inspection. In this paper, a kind of defect extraction algorithm based on one dimensional (1D) Fourier theory for the surface defect extraction with periodic texture background is introduced. In the algorithm, the scanned surface images are firstly transformed from time domain to frequency domain by 1D Fourier transform. The periodic texture background on the surface is then removed by using filtering methods in the frequency domain. Then, a dual-threshold statistical control method is applied to separate the defects from the surface background. Traditional 1D Fourier transform scheme for detecting ordinary defects is very effective; however, the method is not where the defect direction is close to horizontal in periodic texture background. In order to tackle the problem, a mean threshold method based on faultless image is put forward. It firstly calculates the upper and lower control limits of the every reconstructed line scanned image with faultless and then computes the averages of the upper and lower limits. The averages then act as the constant double thresholds to extract the defects. The experimental results of different defects show that the method developed in the paper is very effective for TFT-LCD panel surface defect inspection even in the circumstance that the defect directions are close to horizontal.

  6. Study of 1D stranged-charm meson family using HQET

    CERN Document Server

    Gupta, Pallavi

    2015-01-01

    Recently LHCb predicted spin 1 and spin 3 states D* s1(2860) and D* s3(2860) which are studied through their strong decays, and are assigned to fit the 13D1and 13D3 states in the charm spectroscopy. In this paper,using the heavy quark effective theory, we state that assigning D*s1(2860) as the mixing of 13D1 - 23S1 states, is rather a better justification to its observed experimental values than a pure state. We study its decay modes variation with hadronic coupling constant gxh and the mixing angle . We appoint spin 3 state D* s3(2860) as the missing 1D 3- JP state, and also study its decay channel behavior with coupling constant gyh. To appreciate the above results, we check the variation of decay modes for their spin partners states i.e. 1D2 and 1D'2 with their masses and strong coupling constant i.e. gxh and gyh. Our calculation using HQET approach give mixing angle between the 13D1 - 23S1 state for D* s1(2860) to lie in the range (-1.6 radians < theta < -1.2 radians). Our calculation for coupling c...

  7. Determination of cellular lipids bound to human CD1d molecules.

    Directory of Open Access Journals (Sweden)

    Daryl Cox

    Full Text Available CD1 molecules are glycoproteins that present lipid antigens at the cell surface for immunological recognition by specialized populations of T lymphocytes. Prior experimental data suggest a wide variety of lipid species can bind to CD1 molecules, but little is known about the characteristics of cellular ligands that are selected for presentation. Here we have molecularly characterized lipids bound to the human CD1d isoform. Ligands were eluted from secreted CD1d molecules and separated by normal phase HPLC, then characterized by mass spectroscopy. A total of 177 lipid species were molecularly identified, comprising glycerophospholipids and sphingolipids. The glycerophospholipids included common diacylglycerol species, reduced forms known as plasmalogens, lyso-phospholipids (monoacyl species, and cardiolipins (tetraacyl species. The sphingolipids included sphingomyelins and glycosylated forms, such as the ganglioside GM3. These results demonstrate that human CD1d molecules bind a surprising diversity of lipid structures within the secretory pathway, including compounds that have been reported to play roles in cancer, autoimmune diseases, lipid signaling, and cell death.

  8. Numerical Modeling of Imploding Plasma liners Using the 1D Radiation-Hydrodynamics Code HELIOS

    Science.gov (United States)

    Davis, J. S.; Hanna, D. S.; Awe, T. J.; Hsu, S. C.; Stanic, M.; Cassibry, J. T.; Macfarlane, J. J.

    2010-11-01

    The Plasma Liner Experiment (PLX) is attempting to form imploding plasma liners to reach 0.1 Mbar upon stagnation, via 30--60 spherically convergent plasma jets. PLX is partly motivated by the desire to develop a standoff driver for magneto-inertial fusion. The liner density, atomic makeup, and implosion velocity will help determine the maximum pressure that can be achieved. This work focuses on exploring the effects of atomic physics and radiation on the 1D liner implosion and stagnation dynamics. For this reason, we are using Prism Computational Science's 1D Lagrangian rad-hydro code HELIOS, which has both equation of state (EOS) table-lookup and detailed configuration accounting (DCA) atomic physics modeling. By comparing a series of PLX-relevant cases proceeding from ideal gas, to EOS tables, to DCA treatments, we aim to identify how and when atomic physics effects are important for determining the peak achievable stagnation pressures. In addition, we present verification test results as well as brief comparisons to results obtained with RAVEN (1D radiation-MHD) and SPHC (smoothed particle hydrodynamics).

  9. A two-layer $\\alpha\\omega$ dynamo model, and its implications for 1-D dynamos

    CERN Document Server

    Roald, C B

    1999-01-01

    I will discuss an attempt at representing an interface dynamo in a simplified, essentially 1D framework. The operation of the dynamo is broken up into two 1D layers, one containing the $\\alpha$ effect and the other containing the $\\omega$ effect, and these two layers are allowed to communicate with each other by the simplest possible representation of diffusion, an analogue of Newton's law of cooling. Dynamical back-reaction of the magnetic field on them with diagrams I computed for a comparable purely 1D model. The bifurcation structure shows remarkable similarity, but a couple of subtle changes imply dramatically different physical behaviour for the model. In particular, the solar-like dynamo mode found in the 1-layer model is not stable in the 2-layer version; instead there is an (apparent) homoclinic bifurcation and a sequence of periodic, quasiperiodic, and chaotic modes. I argue that the fragility of these models makes them effectively useless as predictors or interpreters of more complex dynamos.

  10. A SPLIT-CHARACTERISTIC FINITE ELEMENT MODEL FOR 1-D UNSTEADY FLOWS

    Institute of Scientific and Technical Information of China (English)

    ZHOU Yi-lin; TANG Hong-wu; LIU Xiao-hua

    2007-01-01

    An efficient and accurate solution algorithm was proposed for 1-D unsteady flow problems widely existing in hydraulic engineering. Based on the split-characteristic finite element method, the numerical model with the Saint-Venant equations of 1-D unsteady flows was established. The assembled finite element equations were solved with the tri-diagonal matrix algorithm. In the semi-implicit and explicit scheme, the critical time step of the method was dependent on the space step and flow velocity, not on the wave celerity. The method was used to eliminate the restriction due to the wave celerity for the computational analysis of unsteady open-channel flows. The model was verified by the experimental data and theoretical solution and also applied to the simulation of the flow in practical river networks. It shows that the numerical method has high efficiency and accuracy and can be used to simulate 1-D steady flows, and unsteady flows with shock waves or flood waves. Compared with other numerical methods, the algorithm of this method is simpler with higher accuracy, less dissipation, higher computation efficiency and less computer storage.

  11. Low band gap frequencies and multiplexing properties in 1D and 2D mass spring structures

    Science.gov (United States)

    Aly, Arafa H.; Mehaney, Ahmed

    2016-11-01

    This study reports on the propagation of elastic waves in 1D and 2D mass spring structures. An analytical and computation model is presented for the 1D and 2D mass spring systems with different examples. An enhancement in the band gap values was obtained by modeling the structures to obtain low frequency band gaps at small dimensions. Additionally, the evolution of the band gap as a function of mass value is discussed. Special attention is devoted to the local resonance property in frequency ranges within the gaps in the band structure for the corresponding infinite periodic lattice in the 1D and 2D mass spring system. A linear defect formed of a row of specific masses produces an elastic waveguide that transmits at the narrow pass band frequency. The frequency of the waveguides can be selected by adjusting the mass and stiffness coefficients of the materials constituting the waveguide. Moreover, we pay more attention to analyze the wave multiplexer and DE-multiplexer in the 2D mass spring system. We show that two of these tunable waveguides with alternating materials can be employed to filter and separate specific frequencies from a broad band input signal. The presented simulation data is validated through comparison with the published research, and can be extended in the development of resonators and MEMS verification.

  12. Renegade homeostatic cytokine responses in T1D: drivers of regulatory/effector T cell imbalance.

    Science.gov (United States)

    Gupta, Shipra; Cerosaletti, Karen; Long, S Alice

    2014-04-01

    Homeostatic cytokines contribute to the balance between regulatory and effector T cells (Tregs and Teffs respectively) and are necessary to maintain peripheral tolerance. These cytokines include IL-2 that supports Treg and IL-7 and IL-15 that drive Teff. In overt settings of lost tolerance (i.e. graft rejection), IL-2 Treg signatures are decreased while IL-7 and IL-15 Teff signatures are often enhanced. Similar cytokine profile imbalances also occur in some autoimmune diseases. In type 1 diabetes (T1D), there are underlying defects in the IL-2 pathway and Teff cytokine blockade can prevent and treat diabetes in NOD mice. In this review, we summarize evidence of IL-2, IL-7 and IL-15 genetic and cellular alterations in T1D patients. We then discuss how the combined effect of these cytokine profiles may together contribute to altered Treg/Teff ratios and functions in T1D. Implications for combination therapies and suggestions for integrated cytokine and Treg/Teff biomarker development are then proposed. Copyright © 2014 Elsevier Inc. All rights reserved.

  13. Quantitative 3D electromagnetic field determination of 1D nanostructures from single projection

    Energy Technology Data Exchange (ETDEWEB)

    Phatak, C.; Knoop, L. de; Houdellier, F.; Gatel, C.; Hÿtch, M. J.; Masseboeuf, A.

    2016-05-01

    One-dimensional (1D) nanostructures have been regarded as the most promising building blocks for nanoelectronics and nanocomposite material systems as well as for alternative energy applications. Although they result in confinement of a material, their properties and interactions with other nanostructures are still very much three-dimensional (3D) in nature. In this work, we present a novel method for quantitative determination of the 3D electromagnetic fields in and around 1D nanostructures using a single electron wave phase image, thereby eliminating the cumbersome acquisition of tomographic data. Using symmetry arguments, we have reconstructed the 3D magnetic field of a nickel nanowire as well as the 3D electric field around a carbon nanotube field emitter, from one single projection. The accuracy of quantitative values determined here is shown to be a better fit to the physics at play than the value obtained by conventional analysis. Moreover the 3D reconstructions can then directly be visualized and used in the design of functional 3D architectures built using 1D nanostructures.

  14. A study on cooling efficiency using 1-d analysis code suitable for cooling system of thermoforming

    Energy Technology Data Exchange (ETDEWEB)

    Li, Zhen Zhe; Heo, Kwang Su; Xuan, Dong Ji; Seol, Seoung Yun [Chonnam National University, Gwangju (Korea, Republic of)

    2009-03-15

    Thermoforming is one of the most versatile and economical processes available for polymer products, but cycle time and production cost must be continuously reduced in order to improve the competitive power of products. In this study, water spray cooling was simulated to apply to a cooling system instead of compressed air cooling in order to shorten the cycle time and reduce the cost of compressed air used in the cooling process. At first, cooling time using compressed air was predicted in order to check the state of mass production. In the following step, the ratio of removed energy by air cooling or water spray cooling among the total removed energy was found by using 1-D analysis code of the cooling system under the condition of checking the possibility of conversion from 2-D to 1-D problem. The analysis results using water spray cooling show that cycle time can be reduced because of high cooling efficiency of water spray, and cost of production caused by using compressed air can be reduced by decreasing the amount of the used compressed air. The 1-D analysis code can be widely used in the design of a thermoforming cooling system, and parameters of the thermoforming process can be modified based on the recommended data suitable for a cooling system of thermoforming

  15. Subplane-based Control Rod Decusping Techniques for the 2D/1D Method in MPACT

    Energy Technology Data Exchange (ETDEWEB)

    Graham, Aaron M [ORNL; Collins, Benjamin S [ORNL; Downar, Thomas [University of Michigan

    2017-01-01

    The MPACT transport code is being jointly developed by Oak Ridge National Laboratory and the University of Michigan to serve as the primary neutron transport code for the Virtual Environment for Reactor Applications Core Simulator. MPACT uses the 2D/1D method to solve the transport equation by decomposing the reactor model into a stack of 2D planes. A fine mesh flux distribution is calculated in each 2D plane using the Method of Characteristics (MOC), then the planes are coupled axially through a 1D NEM-P$_3$ calculation. This iterative calculation is then accelerated using the Coarse Mesh Finite Difference method. One problem that arises frequently when using the 2D/1D method is that of control rod cusping. This occurs when the tip of a control rod falls between the boundaries of an MOC plane, requiring that the rodded and unrodded regions be axially homogenized for the 2D MOC calculations. Performing a volume homogenization does not properly preserve the reaction rates, causing an error known as cusping. The most straightforward way of resolving this problem is by refining the axial mesh, but this can significantly increase the computational expense of the calculation. The other way of resolving the partially inserted rod is through the use of a decusping method. This paper presents new decusping methods implemented in MPACT that can dynamically correct the rod cusping behavior for a variety of problems.

  16. Influence of Underhood Flow on Engine Cooling Using 1-D And 3-D Approach

    Directory of Open Access Journals (Sweden)

    Bolehovský Ondřej

    2015-12-01

    Full Text Available This work deals with numerical simulation of complete cooling system of internal combustion engine (GT-SUITE, which also involves the simulation of flow in underhood using the computationally undemanding simulation. A detailed model of the internal combustion engine is extended to a cooling circuit model which is then coupled to a simplified underhood model which is created with the help of GT-COOL application as a 3-D model and afterwards transferred to a 1-D form. The approaches, one using 1-D solution of arrangement of the heat exchangers and the other 3-D approach using the underhood model, were investigated in two steady states corresponding to various vehicle speeds and engine load. These simulations have shown the inappropriateness of 1-D approach when solving the flow in the heat exchangers in the underhood and helped to explore a relatively undemanding method of flow simulation in the underhood, which enables to detect the interaction between the models of the cooling system and the internal combustion engine and the issue of arrangement of the heat exchangers in the underhood.

  17. Interview: glycolipid antigen presentation by CD1d and the therapeutic potential of NKT cell activation.

    Science.gov (United States)

    Kronenberg, Mitchell

    2007-01-01

    Natural Killer T cells (NKT) are critical determinants of the immune response to cancer, regulation of autioimmune disease, clearance of infectious agents, and the development of artheriosclerotic plaques. In this interview, Mitch Kronenberg discusses his laboratory's efforts to understand the mechanism through which NKT cells are activated by glycolipid antigens. Central to these studies is CD1d--the antigen presenting molecule that presents glycolipids to NKT cells. The advent of CD1d tetramer technology, a technique developed by the Kronenberg lab, is critical for the sorting and identification of subsets of specific glycolipid-reactive T cells. Mitch explains how glycolipid agonists are being used as therapeutic agents to activate NKT cells in cancer patients and how CD1d tetramers can be used to assess the state of the NKT cell population in vivo following glycolipid agonist therapy. Current status of ongoing clinical trials using these agonists are discussed as well as Mitch's prediction for areas in the field of immunology that will have emerging importance in the near future.

  18. Study on Development of 1D-2D Coupled Real-time Urban Inundation Prediction model

    Science.gov (United States)

    Lee, Seungsoo

    2017-04-01

    In recent years, we are suffering abnormal weather condition due to climate change around the world. Therefore, countermeasures for flood defense are urgent task. In this research, study on development of 1D-2D coupled real-time urban inundation prediction model using predicted precipitation data based on remote sensing technology is conducted. 1 dimensional (1D) sewerage system analysis model which was introduced by Lee et al. (2015) is used to simulate inlet and overflow phenomena by interacting with surface flown as well as flows in conduits. 2 dimensional (2D) grid mesh refinement method is applied to depict road networks for effective calculation time. 2D surface model is coupled with 1D sewerage analysis model in order to consider bi-directional flow between both. Also parallel computing method, OpenMP, is applied to reduce calculation time. The model is estimated by applying to 25 August 2014 extreme rainfall event which caused severe inundation damages in Busan, Korea. Oncheoncheon basin is selected for study basin and observed radar data are assumed as predicted rainfall data. The model shows acceptable calculation speed with accuracy. Therefore it is expected that the model can be used for real-time urban inundation forecasting system to minimize damages.

  19. Coupled 1D-2D hydrodynamic inundation model for sewer overflow: Influence of modeling parameters

    Directory of Open Access Journals (Sweden)

    Adeniyi Ganiyu Adeogun

    2015-10-01

    Full Text Available This paper presents outcome of our investigation on the influence of modeling parameters on 1D-2D hydrodynamic inundation model for sewer overflow, developed through coupling of an existing 1D sewer network model (SWMM and 2D inundation model (BREZO. The 1D-2D hydrodynamic model was developed for the purpose of examining flood incidence due to surcharged water on overland surface. The investigation was carried out by performing sensitivity analysis on the developed model. For the sensitivity analysis, modeling parameters, such as mesh resolution Digital Elevation Model (DEM resolution and roughness were considered. The outcome of the study shows the model is sensitive to changes in these parameters. The performance of the model is significantly influenced, by the Manning's friction value, the DEM resolution and the area of the triangular mesh. Also, changes in the aforementioned modeling parameters influence the Flood characteristics, such as the inundation extent, the flow depth and the velocity across the model domain.

  20. Secure information embedding into 1D biomedical signals based on SPIHT.

    Science.gov (United States)

    Rubio, Oscar J; Alesanco, Alvaro; García, José

    2013-08-01

    This paper proposes an encoding system for 1D biomedical signals that allows embedding metadata and provides security and privacy. The design is based on the analysis of requirements for secure and efficient storage, transmission and access to medical tests in e-health environment. This approach uses the 1D SPIHT algorithm to compress 1D biomedical signals with clinical quality, metadata embedding in the compressed domain to avoid extra distortion, digital signature to implement security and attribute-level encryption to support Role-Based Access Control. The implementation has been extensively tested using standard electrocardiogram and electroencephalogram databases (MIT-BIH Arrhythmia, MIT-BIH Compression and SCCN-EEG), demonstrating high embedding capacity (e.g. 3 KB in resting ECGs, 200 KB in stress tests, 30 MB in ambulatory ECGs), short delays (2-3.3s in real-time transmission) and compression of the signal (by ≃3 in real-time transmission, by ≃5 in offline operation) despite of the embedding of security elements and metadata to enable e-health services.

  1. Numerical simulation of Ge solar cells using D-AMPS-1D code

    Energy Technology Data Exchange (ETDEWEB)

    Barrera, Marcela, E-mail: barrera@tandar.cnea.gov.ar [Comision Nacional de Energia Atomica, Avenida General Paz 1499, San Martin 1650, Buenos Aires (Argentina); Consejo Nacional de Investigaciones Cientificas y Tecnicas (CONICET) (Argentina); Rubinelli, Francisco [Instituto de Desarrollo Tecnologico para la Industria Quimica (INTEC)-CONICET, Gueemes 3450, Santa Fe 3000 (Argentina); Rey-Stolle, Ignacio [Instituto de Energia Solar, Universidad Politecnica de Madrid, Avenida Complutense 30, Madrid 28040 (Spain); Pla, Juan [Comision Nacional de Energia Atomica, Avenida General Paz 1499, San Martin 1650, Buenos Aires (Argentina); Consejo Nacional de Investigaciones Cientificas y Tecnicas (CONICET) (Argentina)

    2012-08-15

    A solar cell is a solid state device that converts the energy of sunlight directly into electricity by the photovoltaic effect. When light with photon energies greater than the band gap is absorbed by a semiconductor material, free electrons and free holes are generated by optical excitation in the material. The main characteristic of a photovoltaic device is the presence of internal electric field able to separate the free electrons and holes so they can pass out of the material to the external circuit before they recombine. Numerical simulation of photovoltaic devices plays a crucial role in their design, performance prediction, and comprehension of the fundamental phenomena ruling their operation. The electrical transport and the optical behavior of the solar cells discussed in this work were studied with the simulation code D-AMPS-1D. This software is an updated version of the one-dimensional (1D) simulation program Analysis of Microelectronic and Photonic Devices (AMPS) that was initially developed at The Penn State University, USA. Structures such as homojunctions, heterojunctions, multijunctions, etc., resulting from stacking layers of different materials can be studied by appropriately selecting characteristic parameters. In this work, examples of cells simulation made with D-AMPS-1D are shown. Particularly, results of Ge photovoltaic devices are presented. The role of the InGaP buffer on the device was studied. Moreover, a comparison of the simulated electrical parameters with experimental results was performed.

  2. Enzyme-catalysed synthesis of galactosylated 1D- and 1L-chiro-inositol, 1D-pinitol, myo-inositol and selected derivatives using the beta-galactosidase from the thermophile Thermoanaerobacter sp. strain TP6-B1.

    Science.gov (United States)

    Hart, Joanne B; Kröger, Lars; Falshaw, Andrew; Falshaw, Ruth; Farkas, Erzsébet; Thiem, Joachim; Win, Anna L

    2004-08-02

    The products from the enzymatic beta-D-galactopyranosylation of 1D-chiro-inositol, 1D-pinitol, 1D-3-O-allyl-4-O-methyl-chiro-inositol, 1D-3,4-di-O-methyl-chiro-inositol, 1L-chiro-inositol and myo-inositol in combined yields ranging from 46% to 64% have been obtained using the beta-galactosidase isolated from an anaerobic extreme thermophile, Thermoanaerobacter sp. strain TP6-B1 and p-nitrophenyl beta-D-galactopyranoside as the donor. Analysis of the products from these reactions reveals information about the acceptor preferences of the enzyme.

  3. MAST-1D, a Model to Route Sediment and Tracers in Channel-Floodplain Complexes

    Science.gov (United States)

    Viparelli, E.; Lauer, J. W.; Belmont, P.

    2014-12-01

    Sediment exchange between the channel and floodplain can occur via meander migration, overbank deposition or erosion, and channel widening or narrowing. Depending on channel and floodplain history, floodplains can act either as sources or sinks of bed material and/or wash load. The Morphodynamics And Sediment Tracers in 1D program (MAST-1D) is a numerical model built to describe grain size specific transport of sediment and tracers and the long-term - i.e. decadal and longer - evolution of channel floodplain complexes. MAST-1D differs from other 1D numerical models because it allows for 1) uneven exchange of sediment and tracers between the river channel and the floodplain, 2) temporal changes in channel geometry, bed elevation and floodplain thickness, which result in changes in the channel hydraulic capacity, and 3) temporal changes of size distribution and tracer content in the floodplain, in the load and in the underlying substrate. Under conditions of constant base level, water and sediment supply, the main assumptions in the model result in the system evolving asymptotically toward a steady state wherein channel bed erosion is balanced by channel bed deposition. When at this condition, the amount of sediment deposited on the floodplain through point bar deposition and overbank sedimentation is balanced by the erosion of sediment from the floodplain through lateral migration. However, imbalances in floodplain storage can persist for many years even when the channel bed elevation and size distribution are near steady state. The MAST-1D program is applied to study the long term response of a sand bed river, an 80 km long reach of the Minnesota River between Mankato and Jordan, Minnesota, to changes in flow regime and the sediment load due to the development of intensive agriculture in the watershed. The simulations are performed in successive phases, the model is first set up so that under the best estimates available for pre-agriculture conditions, channel

  4. Hydrothermally processed 1D hydroxyapatite: Mechanism of formation and biocompatibility studies.

    Science.gov (United States)

    Stojanović, Zoran S; Ignjatović, Nenad; Wu, Victoria; Žunič, Vojka; Veselinović, Ljiljana; Škapin, Srečo; Miljković, Miroslav; Uskoković, Vuk; Uskoković, Dragan

    2016-11-01

    Recent developments in bone tissue engineering have led to an increased interest in one-dimensional (1D) hydroxyapatite (HA) nano- and micro-structures such as wires, ribbons and tubes. They have been proposed for use as cell substrates, reinforcing phases in composites and carriers for biologically active substances. Here we demonstrate the synthesis of 1D HA structures using an optimized, urea-assisted, high-yield hydrothermal batch process. The one-pot process, yielding HA structures composed of bundles of ribbons and wires, was typified by the simultaneous occurrence of a multitude of intermediate reactions, failing to meet the uniformity criteria over particle morphology and size. To overcome these issues, the preparation procedure was divided to two stages: dicalcium phosphate platelets synthesized in the first step were used as a precursor for the synthesis of 1D HA in the second stage. Despite the elongated particle morphologies, both the precursor and the final product exhibited excellent biocompatibility and caused no reduction of viability when tested against osteoblastic MC3T3-E1 cells in 2D culture up to the concentration of 2.6mg/cm(2). X-ray powder diffraction combined with a range of electron microscopies and laser diffraction analyses was used to elucidate the formation mechanism and the microstructure of the final particles. The two-step synthesis involved a more direct transformation of DCP to 1D HA with the average diameter of 37nm and the aspect ratio exceeding 100:1. The comparison of crystalline domain sizes along different crystallographic directions showed no signs of significant anisotropy, while indicating that individual nanowires are ordered in bundles in the b crystallographic direction of the P63/m space group of HA. Intermediate processes, e.g., dehydration of dicalcium phosphate, are critical for the formation of 1D HA alongside other key aspects of this phase transformation, it must be investigated in more detail in the continuous

  5. Position error in profiles retrieved from MIPAS observations with a 1-D algorithm

    Directory of Open Access Journals (Sweden)

    M. Carlotti

    2012-09-01

    Full Text Available The information load (IL analysis, first introduced for the two-dimensional approach (Carlotti and Magnani, 2009, is applied to the inversion of MIPAS observations operated with a 1-dimensional (1-D retrieval algorithm. The IL distribution of MIPAS spectra is shown to be often asymmetrical with respect to the tangent points of the observations and permits to identify the preferential latitude where the profiles retrieved with a 1-D algorithm should be geo-located. Therefore a position error is made when the tangent points of the observations are used to assign the geo-location of the retrieved profile. We assess the amplitude of the position error for some of the MIPAS main targets and we show that the IL analysis can also be used as a tool for the selection of observations that, when analyzed, minimize the position error of the retrieved profile. When the temperature (T profiles are used for the retrieval of volume mixing ratio (VMR of atmospheric constituents, the T position error (of the order of 1.5 degrees of latitude induces a VMR error that is directly connected with the horizontal T gradients. Temperature profiles can be externally-provided or determined in a previous step of the retrieval process. In the first case, the IL analysis shows that a meaningful fraction (often exceeding 50% of the VMR error deriving from the 1-D approximation is to be attributed to the mismatch between the position assigned to the external T profile and the positions where T is required by the analyzed observations. In the second case the retrieved T values suffer by an error of 1.5–2 K due to neglecting the horizontal variability of T; however the error induced on VMRs is of minor entity because of the generally small mismatch between the IL distribution of the observations analyzed to retrieve T and those analyzed to retrieve the VMR target. An estimate of the contribution of the

  6. HLA class II susceptibility pattern for type 1 diabetes (T1D) in an Iranian population.

    Science.gov (United States)

    Kiani, J; Hajilooi, M; Furst, D; Rezaei, H; Shahryari-Hesami, S; Kowsarifard, S; Zamani, A; Solgi, G

    2015-08-01

    This study aimed to determine the HLA-DRB1/HLA-DQB1 susceptibility and protection pattern for type 1 diabetes (T1D) in a population from Hamadan, north-west of Iran. A total of 133 patients with T1D were tested for HLA-DRB1 and HLA-DQB1 alleles using PCR-SSP compared to 100 ethnic-matched healthy controls. Alleles and haplotypes frequencies were compared between both groups. The most susceptible alleles for disease were HLA-DRB1*03:01, DRB1*04:02, DQB1*02:01 and DQB1*03:02, and protective alleles were HLA-DRB1*07:01, *11:01, *13:01, *14:01 and DRB1*15 and HLA-DQB1*06:01, *06:02 and *06:03. Haplotype analysis revealed that patients with T1D had higher frequencies of DRB1*03:01-DQB1*02:01 (OR = 4.86, P < 10(-7) ) and DRB1*04:02-DQB1*03:02 (OR = 9.93, P < 10(-7) ) and lower frequencies of DRB1*07:01-DQB1*02:01 (P = 0.0005), DRB1*11:01-DQB1*03:01 (P = 0.001), DRB1*13:01-DQB1*06:03 (P = 0.002) and DRB1*15-DQB1*06:01 (P = 0.001) haplotypes compared to healthy controls. Heterozygote combination of both susceptible haplotypes (DR3/DR4) confers the highest risk for T1D (RR = 18.80, P = 4 × 10(-5) ). Additionally, patients with homozygote diplotype, DR3/DR3 and DR4/DR4, showed a similar risk with less extent to heterozygote combination (P = 0.0004 and P = 0.01, respectively). Our findings not only confirm earlier reports from Iranians but also are in line with Caucasians and partly with Asians and some African patients with T1D. Remarkable differences were the identification of DRB1*04:01-DQB1*03:02, DRB1*07:01-DQB1*03:03 and DRB1*16-DQB1*05:02 as neutral and DRB1*13:01-DQB1*06:03 as the most protective haplotypes in this study.

  7. Analytical synthetic methods of solution of neutron transport equation with diffusion theory approaches energy multigroup; Metodos sinteticos analiticos de solucao da equacao de transporte de neutrons com aproximacoes da teoria da difusao multigrupo de energia

    Energy Technology Data Exchange (ETDEWEB)

    Moraes, Pedro Gabriel B.; Leite, Michel C.A.; Barros, Ricardo C., E-mail: pgbmoraes@gmail.com, E-mail: chell_leite@hotmail.com, E-mail: rcbarros@pq.cnpq.br [Universidade do Estado do Rio de Janeiro (UERJ), Nova Friburgo, RJ (Brazil). Instituto Politecnico. Departamento de Modelagem Computacional

    2013-07-01

    In this work we developed a software to model and generate results in tables and graphs of one-dimensional neutron transport problems in multi-group formulation of energy. The numerical method we use to solve the problem of neutron diffusion is analytic, thus eliminating the truncation errors that appear in classical numerical methods, e.g., the method of finite differences. This numerical analytical method increases the computational efficiency, since they are not refined spatial discretization necessary because for any spatial discretization grids used, the numerical result generated for the same point of the domain remains unchanged unless the rounding errors of computational finite arithmetic. We chose to develop a computational application in MatLab platform for numerical computation and program interface is simple and easy with knobs. We consider important to model this neutron transport problem with a fixed source in the context of shielding calculations of radiation that protects the biosphere, and could be sensitive to ionizing radiation.

  8. Empirical evidence for a four factor framework of personality disorder organization: multigroup confirmatory factor analysis of the Millon Clinical Multiaxial Inventory-III personality disorder scales across Belgian and Danish data samples.

    Science.gov (United States)

    Rossi, Gina; Elklit, Ask; Simonsen, Erik

    2010-02-01

    The factor structure of the Millon Clinical Multiaxial Inventory-III (Millon, Millon, Davis, & Grossman, 2006) personality disorder scales was analyzed using multigroup confirmatory factor analysis on data obtained from a Danish (N = 2030) and a Belgian (N = 1210) sample. Two-, three-, and four factor models, a priori specified using structures found by Dyce, O'Connor, Parkins, and Janzen (1997), were fitted to the data. The best fitting model was a four factor structure (RMSEA = .066, GFI = .98, CFI = .93) with partially invariant factor loadings. The robustness of this four-factor model clearly supports the efforts to organize future personality disorder description in a four-factor framework by corroborating four domains that were predominant in dimensional models (Widiger & Simonsen, 2005): Factor 1, 2, 3, and 4 respectively corresponded to emotional dysregulation versus stability, antagonism versus compliance, extraversion versus introversion, and constraint versus impulsivity.

  9. AMPX-77: A modular code system for generating coupled multigroup neutron-gamma cross-section libraries from ENDF/B-IV and/or ENDF/B-V

    Energy Technology Data Exchange (ETDEWEB)

    Greene, N.M.; Ford, W.E. III; Petrie, L.M.; Arwood, J.W.

    1992-10-01

    AMPX-77 is a modular system of computer programs that pertain to nuclear analyses, with a primary emphasis on tasks associated with the production and use of multigroup cross sections. AH basic cross-section data are to be input in the formats used by the Evaluated Nuclear Data Files (ENDF/B), and output can be obtained in a variety of formats, including its own internal and very general formats, along with a variety of other useful formats used by major transport, diffusion theory, and Monte Carlo codes. Processing is provided for both neutron and gamma-my data. The present release contains codes all written in the FORTRAN-77 dialect of FORTRAN and wig process ENDF/B-V and earlier evaluations, though major modules are being upgraded in order to process ENDF/B-VI and will be released when a complete collection of usable routines is available.

  10. Programming for seismogram 1-D generation, considering the attenuation and dispersing effects; Programa para gerar sismograma 1-D, considerando os efeitos da atenuacao e dispersao

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Bruno de O.; Oliveira, Sergio A.M. de [Universidade Estadual do Norte Fluminense (UENF), Macae, RJ (Brazil). Lab. de Engenharia e Exploracao do Petroleo (LENEP)

    2004-07-01

    For a processing and an interpretation of correct seismic data, it is necessary to recognize and to know as the factors act that influence in the propagation of the seismic waves, as the attenuation and the dispersion, constituting in the biggest practical impediment for the use of seismic for targets the big depths, limiting the resolution of the method. However these phenomena little are taken in consideration in the analysis of the data, thus the necessity of its bigger agreement, because if attenuation and dispersion they confuse the application of the seismic, if convenient understood and measures, can be valuable sources of information about the constitution of the rocks. Therefore, in this work the effect of the attenuation and dispersion in the data of reflection seismic had been simulated on a program, in Mat-Lab. Being able to generate 1-D seismograms, in the domain of the time, considering the normal incidence of plain wave in a package of plain, horizontal and isotropic layers, taking in account the physical attributes of the way, being able to simulate the effects of ghost and of multiples of free surface, if considering the source in the water. (author)

  11. What causes the large extensions of red-supergiant atmospheres? Comparisons of interferometric observations with 1-D hydrostatic, 3-D convection, and 1-D pulsating model atmospheres

    CERN Document Server

    Arroyo-Torres, B; Chiavassa, A; Scholz, M; Freytag, B; Marcaide, J M; Hauschildt, P H; Wood, P R; Abellan, F J

    2015-01-01

    We present the atmospheric structure and the fundamental parameters of three red supergiants, increasing the sample of RSGs observed by near-infrared spectro-interferometry. Additionally, we test possible mechanisms that may explain the large observed atmospheric extensions of RSGs. We carried out spectro-interferometric observations of 3 RSGs in the near-infrared K-band with the VLTI/AMBER instrument at medium spectral resolution. To comprehend the extended atmospheres, we compared our observational results to predictions by available hydrostatic PHOENIX, available 3-D convection, and new 1-D self-excited pulsation models of RSGs. Our near-infrared flux spectra are well reproduced by the PHOENIX model atmospheres. The continuum visibility values are consistent with a limb-darkened disk as predicted by the PHOENIX models, allowing us to determine the angular diameter and the fundamental parameters of our sources. Nonetheless, in the case of V602 Car and HD 95686, the PHOENIX model visibilities do not predict ...

  12. File list: Oth.Liv.05.Nr1d1.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Liv.05.Nr1d1.AllCell mm9 TFs and others Nr1d1 Liver SRX128176,SRX997762,SRX9977...63,SRX997761,SRX997760,SRX997765,SRX997764,SRX109461,SRX100296,SRX994725,SRX994726,SRX100297 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.Liv.05.Nr1d1.AllCell.bed ...

  13. Altered Expression Profile of Renal α1D-Adrenergic Receptor in Diabetes and Its Modulation by PPAR Agonists

    Directory of Open Access Journals (Sweden)

    Xueying Zhao

    2014-01-01

    Full Text Available Alpha1D-adrenergic receptor (α1D-AR plays important roles in regulating physiological and pathological responses mediated by catecholamines, particularly in the cardiovascular and urinary systems. The present study was designed to investigate the expression profile of α1D-AR in the diabetic kidneys and its modulation by activation of peroxisome proliferator-activated receptors (PPARs. 12-week-old Zucker lean (ZL and Zucker diabetic fatty (ZD rats were treated with fenofibrate or rosiglitazone for 8–10 weeks. Gene microarray, real-time PCR, and confocal immunofluorescence microscopy were performed to assess mRNA and protein expression of α1D-AR in rat kidney tissue. Using microarray, we found that α1D-AR gene was dramatically upregulated in 22-week-old ZD rats compared to ZL controls. Quantitative PCR analysis verified a 16-fold increase in α1D-AR mRNA in renal cortex from ZD animals compared to normal controls. Chronic treatment with fenofibrate or rosiglitazone reduced renal cortical α1D-AR gene. Immunofluorescence staining confirmed that α1D-AR protein was induced in the glomeruli and tubules of diabetic rats. Moreover, dual immunostaining for α1D-AR and kidney injury molecule-1 indicated that α1D-AR was expressed in dedifferentiated proximal tubules of diabetic Zucker rats. Taken together, our results show that α1D-AR expression is upregulated in the diabetic kidneys. PPAR activation suppressed renal expression of α1D-AR in diabetic nephropathy.

  14. Computational Study and Analysis of Structural Imperfections in 1D and 2D Photonic Crystals

    Energy Technology Data Exchange (ETDEWEB)

    Maskaly, Karlene Rosera [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States)

    2005-06-01

    Dielectric reflectors that are periodic in one or two dimensions, also known as 1D and 2D photonic crystals, have been widely studied for many potential applications due to the presence of wavelength-tunable photonic bandgaps. However, the unique optical behavior of photonic crystals is based on theoretical models of perfect analogues. Little is known about the practical effects of dielectric imperfections on their technologically useful optical properties. In order to address this issue, a finite-difference time-domain (FDTD) code is employed to study the effect of three specific dielectric imperfections in 1D and 2D photonic crystals. The first imperfection investigated is dielectric interfacial roughness in quarter-wave tuned 1D photonic crystals at normal incidence. This study reveals that the reflectivity of some roughened photonic crystal configurations can change up to 50% at the center of the bandgap for RMS roughness values around 20% of the characteristic periodicity of the crystal. However, this reflectivity change can be mitigated by increasing the index contrast and/or the number of bilayers in the crystal. In order to explain these results, the homogenization approximation, which is usually applied to single rough surfaces, is applied to the quarter-wave stacks. The results of the homogenization approximation match the FDTD results extremely well, suggesting that the main role of the roughness features is to grade the refractive index profile of the interfaces in the photonic crystal rather than diffusely scatter the incoming light. This result also implies that the amount of incoherent reflection from the roughened quarterwave stacks is extremely small. This is confirmed through direct extraction of the amount of incoherent power from the FDTD calculations. Further FDTD studies are done on the entire normal incidence bandgap of roughened 1D photonic crystals. These results reveal a narrowing and red-shifting of the normal incidence bandgap with

  15. Development of the V4.2m5 and V5.0m0 Multigroup Cross Section Libraries for MPACT for PWR and BWR

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kang Seog [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Clarno, Kevin T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gentry, Cole [Univ. of Tennessee, Knoxville, TN (United States); Wiarda, Dorothea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Williams, Mark L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Kochunas, Brendan [Univ. of Michigan, Ann Arbor, MI (United States); Liu, Yuxuan [Univ. of Michigan, Ann Arbor, MI (United States); Palmtag, Scott [Core Physics, Inc., Wilmington, NC (United States); Godfrey, Andrew T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-03-01

    The MPACT neutronics module of the Consortium for Advanced Simulation of Light Water Reactors (CASL) core simulator is a 3-D whole core transport code being developed for the CASL toolset, Virtual Environment for Reactor Analysis (VERA). Key characteristics of the MPACT code include (1) a subgroup method for resonance selfshielding and (2) a whole-core transport solver with a 2-D/1-D synthesis method. The MPACT code requires a cross section library to support all the MPACT core simulation capabilities which would be the most influencing component for simulation accuracy.

  16. Natural Outbreak of BVDV-1d-Induced Mucosal Disease Lacking Intestinal Lesions.

    Science.gov (United States)

    Bianchi, M V; Konradt, G; de Souza, S O; Bassuino, D M; Silveira, S; Mósena, A C S; Canal, C W; Pavarini, S P; Driemeier, D

    2017-03-01

    Bovine viral diarrhea virus (BVDV) belongs to the Pestivirus genus, which is further divided into subgenotypes (1a-1u and 2a-c). When persistent infection occurs, the calf will be immunotolerant to BVDV and possibly develop mucosal disease. This study describes an outbreak of BVDV-1d-induced mucosal disease lacking intestinal lesions. Eleven calves presented with anorexia, sialorrhea, lameness, recumbency, and death. Three calves were necropsied, showing ulceration of the interdigital skin and the oral and nasal mucosa; linear ulcers in the tongue, esophagus, and rumen; and rounded ulcers in the abomasum. Microscopically, mucosa and skin had superficial necrosis, with single-cell necrosis and vacuolation in epithelial cells, and severe parakeratosis. Immunohistochemistry (IHC) showed BVDV antigen in the cytoplasm of epithelial cells in skin and mucosa. All 11 dead calves were positive upon reverse transcription-polymerase chain reaction (RT-PCR) for the detection of Pestivirus along with another 11 live calves from the herd, which were positive again by RT-PCR and IHC after a 4-week interval. Sequencing of the 5' untranslated region and N-terminal protease showed that viruses from these 22 calves were homologous and of subgenotype BVDV-1d. Cytopathic BVDV was isolated from 8 of 11 dead calves, but only noncytopathic BVDV was isolated from the 11 live animals. The findings indicate that this was an outbreak of mucosal disease caused by BVDV-1d, with high morbidity, and lesions restricted to the upper alimentary system and skin and absent from intestine. Thus, the epidemiological and pathological features in this form of mucosal disease may be similar to vesicular diseases, including foot and mouth disease.

  17. Electrochemical cortisol immunosensors based on sonochemically synthesized zinc oxide 1D nanorods and 2D nanoflakes.

    Science.gov (United States)

    Vabbina, Phani Kiran; Kaushik, Ajeet; Pokhrel, Nimesh; Bhansali, Shekhar; Pala, Nezih

    2015-01-15

    We report on label free, highly sensitive and selective electrochemical immunosensors based on one-dimensional 1D ZnO nanorods (ZnO-NRs) and two-dimensional 2D ZnO nanoflakes (ZnO-NFs) which were synthesized on Au-coated substrates using simple one step sonochemical approach. Selective detection of cortisol using cyclic voltammetry (CV) is achieved by immobilizing anti-cortisol antibody (Anti-C(ab)) on the ZnO nanostructures (NSs). 1D ZnO-NRs and 2D ZnO-NFs provide unique sensing advantages over bulk materials. While 1D-NSs boast a high surface area to volume ratio, 2D-NSs with large area in polarized (0001) plane and high surface charge density could promote higher Anti-C(ab) loading and thus better sensing performance. Beside large surface area, ZnO-NSs also exhibit higher chemical stability, high catalytic activity, and biocompatibility. TEM studies showed that both ZnO-NSs are single crystalline oriented in (0001) plane. The measured sensing parameters are in the physiological range with a sensitivity of 11.86 µA/M exhibited by ZnO-NRs and 7.74 µA/M by ZnO-NFs with the lowest detection limit of 1 pM which is 100 times better than conventional enzyme-linked immunosorbant immunoassay (ELISA). ZnO-NSs based cortisol immunosensors were tested on human saliva samples and the performance were validated with conventional (ELISA) method which exhibits a remarkable correlation. The developed sensors can be integrated with microfluidic system and miniaturized potentiostat for point-of-care cortisol detection and such developed protocol can be used in personalized health monitoring/diagnostic.

  18. HLA and autoimmune diseases: Type 1 diabetes (T1D) as an example.

    Science.gov (United States)

    Gorodezky, Clara; Alaez, Carmen; Murguía, Andrea; Rodríguez, Araceli; Balladares, Sandra; Vazquez, Miriam; Flores, Hilario; Robles, Carlos

    2006-03-01

    Autoimmune diseases need to be considered at a genetic and mechanistic level. T1D is an autoimmune, chronic, multifactorial and polygenic disease characterized by the destruction of the pancreatic beta-cells associated with long term dysfunction of several organs and tissues. Mechanisms of susceptibility include epi-genetic and post-transcriptional effects that regulate transmission and expression of the inherited genes. The HLA complex, constitutes the most relevant region contributing 50% of the inherited risk for T1D. An additional 17 genes with variable but small effects have been described. In non-Caucasians, the presence of E-DRbeta1-74 and/or D-DRbeta1-57 are relevant in predisposition. The "Diabetogenic haplotypes" in Mexicans were DRB1*0301-DQA1*0501-DQB1*0201 (OR = 21.4); DRB1*0405-DQA1-*0301-DQB1*0302 (OR = 44.5) and the same DQA1/DQB1 with DRB1*0404/*0401 conferring lower risk, increasing (OR = 61.3) with an early age at onset and a heterozygote DR3/DR4 genotype. In most populations, the absence of D-57 and the presence of R-52 are important to the susceptibility, but in Hispanics, all DR4s (including the protective DRB1*0403/*0407/*0411) are in linkage disequilibrium with DQA1/DQB1 susceptibility alleles. Thus, susceptibility alleles in Latin American Mestizos are of Mediterranean ancestry whereas protective alleles are of Amerindian origin. In this review, we discuss the complexity of T1D and some aspects of prevention/intervention based on immunogenetics.

  19. Nanoelectronic Modeling (NEMO): Moving from commercial grade 1-D simulation to prototype 3-D simulation

    Science.gov (United States)

    Klimeck, Gerhard

    2001-03-01

    The quantum mechanical functionality of commercially pursued heterostructure devices such as resonant tunneling diodes (RTDs), quantum well infrared photodetectors, and quantum well lasers are enabled by material variations on an atomic scale. The creation of these heterostructure devices is realized in a vast design space of material compositions, layer thicknesses and doping profiles. The full experimental exploration of this design space is unfeasible and a reliable design tool is needed. The Nanoelectronic Modeling tool (NEMO) is one of the first commercial grade attempts for such a modeling tool. NEMO was developed as a general-purpose quantum mechanics-based 1-D device design and analysis tool from 1993-97 by the Central Research Laboratory of Texas Instruments (later Raytheon Systems). NEMO enables(R. Lake, G. Klimeck, R. C. Bowen, and D. Jovanovic, J. Appl. Phys. 81), 7845 (1997). the fundamentally sound inclusion of the required(G. Klimeck et al.), in the 1997 55th Annual Device Research Conference Digest, (IEEE, NJ, 1997), p. 92^,(R. C. Bowen et al.), J. Appl. Phys 81, 3207 (1997). physics: bandstructure, scattering, and charge self-consistency based on the non-equilibrium Green function approach. A new class of devices which require full 3-D quantum mechanics based models is starting to emerge: quantum dots, or in general semiconductor based deca-nano devices. We are currently building a 3-D modeling tool based on NEMO to include the important physics to understand electronic stated in such superscaled structures. This presentation will overview various facets of the NEMO 1-D tool such electron transport physics in RTDs, numerical technology, software engineering and graphical user interface. The lessons learned from that work are now entering the NEMO 3-D development and first results using the NEMO 3-D prototype will be shown. More information about the publically available NEMO 1-D executables can be found at http://hpc.jpl.nasa.gov/ PEP/gekco/nemo

  20. Design, synthesis and biological evaluation of bivalent ligands against A1-D1 receptor heteromers

    Institute of Scientific and Technical Information of China (English)

    Jian SHEN; Lei ZHANG; Wan-ling SONG; Tao MENG; Xin WANG; Lin CHEN; Lin-yin FENG

    2013-01-01

    Aim:To design and synthesize bivalent ligands for adenosine A1-dopamine D1 receptor heteromers (A1-D1R),and evaluate their pharmacological activities.Methods:Bivalent ligands and their corresponding A1R monovalent ligands were designed and synthesized.The affinities of the bivalent ligands for A1R and D1R in rat brain membrane preparation were examined using radiolabeled binding assays.To demonstrate the formation of A1-D1R,fluorescence resonance energy transfer (FRET) was conducted in HEK293 cells transfected with D1-CFP and A1-YFP.Molecular modeling was used to analyze the possible mode of protein-protein and protein-ligand interactions.Results:Two bivalent ligands for A1R and D1R (20a,20b),as well as the corresponding A1R monovalent ligands (21a,21b) were synthesized.In radiolabeled binding assays,the bivalent ligands showed affinities for A1R 10-100 times higher than those of the corresponding monovalent ligands.In FRET experiments,the bivalent ligands significantly increased the heterodimerization of A1R and D1R compared with the corresponding monovalent ligands.A heterodimer model with the interface of helixes 3,4,5 of A1R and helixes 1,6,7 from D1R was established with molecular modeling.The distance between the two ligand binding sites in the heterodimer model was approximately 48.4 (A),which was shorter than the length of the bivalent ligands.Conclusion:This study demonstrates the existence of A1-D1R in situ and a simultaneous interaction of bivalent ligands with both the receptors.

  1. 1-D and 2-D electrophoresis protein profiles of the scorpion venom from Brotheas amazonicus

    Energy Technology Data Exchange (ETDEWEB)

    Higa, A.M.; Noronha, M.D.N. [Universidade do Estado do Amazonas (UEA), Manaus, AM (Brazil). Rede Proteomica do Amazonas (Proteam). Lab. de Genomica e Proteomica; Rocha-Oliveira, F.; Lopez-Lozano, J.L.L. [Universidade Federal do Amazonas (UFAM), Manaus, AM (Brazil). Pos-Graduacao em Biotecnologia

    2008-07-01

    Full text: Introduction: Scorpions venoms show specific neurotoxins to insect or mammals. These toxins are very important molecular tools to development of news drugs or bioinsecticides. Brotheas amazonicus scorpion is an endemic specie in Amazonian Rain Forest, but your venom do not show toxicity in humans. Information about biological specific activity on insect of this venom is not known yet. Objectives: Molecular protein toxins profiles of the venom from Brotheas amazonicus scorpion by 1-D and 2-D electrophoresis methods to detected toxins with potential biotech applications. Results: Several spots 'families' with {approx} 60, 70 and 80 kDa were detected in gel acidic region with pI {approx} 4,5 - 6 range, in the same region 1-D zimography showed proteolytic activity on gelatin and fibrinogen and proteolytic activity was inhibited by PMSF, suggesting scorpion serine proteinases. 50 kDa proteins were detected with pI {approx} 6,5 - 7 range. In 23 - 50 kDa gel acid region were observed some proteins. In 23 - 14 kDa gel acidic region were detected proteins with pI 4 - 7 range. 1-D Tris-tricine gel showed proteins with {approx} 7 kDa, suggesting scorpion neurotoxins. In gel basic region only 14 kDa proteins were observed with pI {approx} 9 - 10 range. Conclusion: Molecular profile of the scorpion venom from B. amazonicus showed proteins with high and low molecular masses, mainly with acidic pI. Proteolytic activity suggest serine proteinases with high molecular masses and 7 kDa proteins in B. amazonicus venom suggest scorpion neurotoxins. Purification and molecular characterization of these toxins are in course.

  2. Membranes from nanoporous 1D and 2D materials: A review of opportunities, developments, and challenges

    KAUST Repository

    Kim, Wun-gwi

    2013-12-01

    Membranes utilizing nanoporous one-dimensional (1D) and two-dimensional (2D) materials are emerging as attractive candidates for applications in molecular separations and related areas. Such nanotubular and nanolayered materials include carbon nanotubes, metal oxide nanotubes, layered zeolites, porous layered oxides, layered aluminophosphates, and porous graphenes. By virtue of their unique shape, size, and structure, they possess transport properties that are advantageous for membrane and thin film applications. These materials also have very different chemistry from more conventional porous 3D materials, due to the existence of a large, chemically active, external surface area. This feature also necessitates the development of innovative strategies to process these materials into membranes and thin films with high performance. This work provides the first comprehensive review of this emerging area. We first discuss approaches for the synthesis and structural characterization of nanoporous 1D and 2D materials. Thereafter, we elucidate different approaches for fabrication of membranes and thin films from these materials, either as multiphase (composite/hybrid) or single-phase membranes. The influence of surface chemistry and processing techniques on the membrane morphology is highlighted. We then discuss the applications of such membranes in areas relating to molecular transport and separation, e.g. gas and liquid-phase separations, water purification, and ion-conducting membranes. The review concludes with a discussion of the present outlook and some of the key scientific challenges to be addressed on the path to industrially applicable membranes containing nanoporous 1D and 2D materials. © 2013 Elsevier Ltd.

  3. Test of 1D carbon-carbon composite prototype tiles for the SPIDER diagnostic calorimeter

    Science.gov (United States)

    Serianni, G.; Pimazzoni, A.; Canton, A.; Palma, M. Dalla; Delogu, R.; Fasolo, D.; Franchin, L.; Pasqualotto, R.; Tollin, M.

    2017-08-01

    Additional heating will be provided to the thermonuclear fusion experiment ITER by injection of neutral beams from accelerated negative ions. In the SPIDER test facility, under construction at Consorzio RFX in Padova (Italy), the production of negative ions will be studied and optimised. To this purpose the STRIKE (Short-Time Retractable Instrumented Kalorimeter Experiment) diagnostic will be used to characterise the SPIDER beam during short operation (several seconds) and to verify if the beam meets the ITER requirement regarding the maximum allowed beam non-uniformity (below ±10%). The most important measurements performed by STRIKE are beam uniformity, beamlet divergence and stripping losses. The major components of STRIKE are 16 1D-CFC (Carbon matrix-Carbon Fibre reinforced Composite) tiles, observed at the rear side by a thermal camera. The requirements of the 1D CFC material include a large thermal conductivity along the tile thickness (at least 10 times larger than in the other directions); low specific heat and density; uniform parameters over the tile surface; capability to withstand localised heat loads resulting in steep temperature gradients. So 1D CFC is a very anisotropic and delicate material, not commercially available, and prototypes are being specifically realised. This contribution gives an overview of the tests performed on the CFC prototype tiles, aimed at verifying their thermal behaviour. The spatial uniformity of the parameters and the ratio between the thermal conductivities are assessed by means of a power laser at Consorzio RFX. Dedicated linear and non-linear simulations are carried out to interpret the experiments and to estimate the thermal conductivities; these simulations are described and a comparison of the experimental data with the simulation results is presented.

  4. Thermal impedance at the interface of contacting bodies: 1-D examples solved by semi-derivatives

    Directory of Open Access Journals (Sweden)

    Hristov Jordan

    2012-01-01

    Full Text Available Simple 1-D semi-infinite heat conduction problems enable to demonstrate the potential of the fractional calculus in determination of transient thermal impedances of two bodies with different initial temperatures contacting at the interface ( x = 0 at t = 0 . The approach is purely analytic and uses only semi-derivatives (half-time and semi-integrals in the Riemann-Liouville sense. The example solved clearly reveals that the fractional calculus is more effective in calculation the thermal resistances than the entire domain solutions.

  5. Partial Internal Control Recovery on 1-D Klein-Gordon Systems

    Directory of Open Access Journals (Sweden)

    Iwan Pranoto

    2010-03-01

    Full Text Available In this exposition, a technique to recover internal control on a distributed parameter system is reported. The system is described by 1-D Klein-Gordon partial differential equation with a time-varying parameter. We would like to recover the internal control applied to the system if we know some limited information about the output. We use a method called sentinel method to recover the internal control. It involves some construction of a linear functional, and we show that this construction relates closely to the exact controllability problem.

  6. Pharmacological evidence that 5-HT1D activation induces renal vasodilation by NO pathway in rats.

    Science.gov (United States)

    García-Pedraza, José-Ángel; García, Mónica; Martín, María-Luisa; Morán, Asunción

    2015-06-01

    5-HT is a powerful vasoconstrictor substance in renal vasculature (mainly by 5-HT₂ activation). Nevertheless, 5-HT is notable for its dual cardiovascular effects, producing both vasodilator and vasoconstrictor actions. This study aimed to investigate whether, behind the predominant serotonergic vasoconstrictor action, THE 5-HT system may exert renal vasodilator actions, and, if so, characterize the 5-HT receptors and possible indirect pathways. Renal perfusion pressure (PP), systemic blood pressure (SBP) and heart rate (HR) measurement in in situ autoperfused rat kidney was determined in phenylephrine infused rats. Intra arterial (i.a.) bolus administration of 5-HT (0.00000125-0.1 μg/kg) decreased renal PP in the presence of a phenylephrine continuous infusion (phenylephrine-infusion group), without modifying SBP or HR. These vasodilator responses were potentiated by 5-HT₂ antagonism (ritanserin, 1 mg/kg i.v.), whereas the responses were abolished by 5-HT₁ /₇ antagonist (methiothepin, 100 μg/kg i.v.) or 5-HT1D antagonist (LY310762, 1 mg/kg i.v.). The i.a. administration (0.00000125 to 0.1 μg/kg) of 5-CT or L-694,247 (5-HT1D agonist) mimicked 5-HT vasodilator effect, while other agonists (1-PBG, α-methyl-5-HT, AS-19 (5-HT₇), 8-OH-DPAT (5-HT1A) or CGS-12066B (5-HT1B)) did not alter baseline haemodynamic variables. L-694,247 vasodilation was abolished by i.v. bolus of antagonists LY310762 (5-HT1D, 1 mg/kg) or L-NAME (nitric oxide, 10 mg/kg), but not by i.v. bolus of indomethacin (cyclooxygenase, 2 mg/kg) or glibenclamide (ATP-dependent K(+) channel, 20 mg/kg). These outcomes suggest that 5-HT1D activation produces a vasodilator effect in the in situ autoperfused kidney of phenylephrine-infusion rats mediated by the NO pathway.

  7. Comparison between the 1D deconvolution and the ETM scatter correction techniques in PET

    Energy Technology Data Exchange (ETDEWEB)

    Trebossen, R.; Bendrien, B.; Frouin, V. [CEA-Service Hospitalier F. Joliot, Orsay (France)] [and others

    1994-05-01

    Scatter corrections usually degrade the Signal-to-Noise Ratio (SNR) while they improve image quantification. Dual energy corrections provide scatter corrected images with a poor SNR due to the use of two sinograms having low statistics. We have evaluated the SNR on 20 cm uniform cylinder images, acquired on an ECAT 953B/31 with septa in the field-of-view, corrected for scatter using the 1D deconvolution method and an energy based correction developed at Orsay. The latter, referenced as the Estimation of True Method, uses a High Energy Window (HEW) with 550 and 850 keV settings to estimate the true component registered in the Classical Energy Window (CEW) with 250 and 850 keV settings. A sinogram of scattered events is formed from this noisy estimate of the trues. It is filtered and then subtracted from the CEW sinogram to provide a scatter free sinogram. Nine Regions of Interest (ROI) of 18mm diameter have been drawn on a 110 mm diameter circle and reported on 11 direct slices (96 million events each in the CEW and 8 million in the HEW). The SNR has been defined as the ratio of the mean over the standard deviation of all ROI values. With the 1D deconvolution the SNR is 38.0, close to that obtained without scatter correction (39.1) It is lower with the ETM depending on the filter used: with a rectangular window of 9 bins by 15 angles it is 29;.8 (26.9 with a 5 by 5 window) while with a 2D Gaussian filter (7 bins by 13 angles variances) it is 30.8. This value is higher than 22.1 measured on the HEW image. The ETM with adequate filtering allows scatter correction with a SNR acceptable compared with that measured with the 1D deconvolution. Yet the ETM has a clear advantage over the 1D deconvolution in case of asymetrical source distributions in non homogeneous media and in case of off-plane scattering as has been tested on various phantom measurements.

  8. Excitation of multiple resonances in 1D Anderson localized systems for efficient light amplification.

    Science.gov (United States)

    Choi, Seung Ho; Byun, Kyung Min; Kim, Young L

    2015-03-01

    Excitation of hybridized multiple resonances can be an effective route for coherent light generation in irregular 1D systems larger than the localization length of light. Necklace states are often considered to have nonlocalized states. However, we propose that some hybridized/coupled states can have high-resonant tunneling with spatially extended fields. If strong localization properties are preserved in hybridized resonances, the excitation of such states allows for deposition of the excitation energy deep into the structure and spatial overlap with local gain regions. This result could allow for better utilizing hybridized resonances in biological or natural photonic systems.

  9. Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder.

    Directory of Open Access Journals (Sweden)

    Yin-Chieh Lai

    Full Text Available Several genes that are involved in the regulation of circadian rhythms are implicated in the susceptibility to bipolar disorder (BD. The current study aimed to investigate the relationships between genetic variants in NR1D1 RORA, and RORB genes and BD in the Han Chinese population. We conducted a case-control genetic association study with two samples of BD patients and healthy controls. Sample I consisted of 280 BD patients and 200 controls. Sample II consisted of 448 BD patients and 1770 healthy controls. 27 single nucleotide polymorphisms in the NR1D1, RORA, and RORB genes were genotyped using GoldenGate VeraCode assays in sample I, and 492 markers in the three genes were genotyped using Affymetrix Genome-Wide CHB Array in sample II. Single marker and gene-based association analyses were performed using PLINK. A combined p-value for the joining effects of all markers within a gene was calculated using the rank truncated product method. Multifactor dimensionality reduction (MDR method was also applied to test gene-gene interactions in sample I. All markers were in Hardy-Weinberg equilibrium (P>0.001. In sample I, the associations with BD were observed for rs4774388 in RORA (OR = 1.53, empirical p-value, P = 0.024, and rs1327836 in RORB (OR = 1.75, P = 0.003. In Sample II, there were 45 SNPs showed associations with BD, and the most significant marker in RORA was rs11639084 (OR = 0.69, P = 0.002, and in RORB was rs17611535 (OR = 3.15, P = 0.027. A combined p-value of 1.6×10-6, 0.7, and 1.0 was obtained for RORA, RORB and NR1D1, respectively, indicting a strong association for RORA with the risk of developing BD. A four way interaction was found among markers in NR1D1, RORA, and RORB with the testing accuracy 53.25% and a cross-validation consistency of 8 out of 10. In sample II, 45 markers had empirical p-values less than 0.05. The most significant markers in RORA and RORB genes were rs11639084 (OR = 0.69, P = 0.002, and rs17611535 (OR = 3

  10. Analysis on characteristics of 1-D apodized and chirped photonic crystals containing negative refractive materials

    Institute of Scientific and Technical Information of China (English)

    TONG Kai; CUI Wei-wei; XU Xiao-hui; LI Zhi-quan

    2008-01-01

    Using transfer matrix method, the optical transmission properties of 1-D photonic crystals composed partially of negativerefraction media are analyzed. The transmission spectra of periodic photonic crystal, chirped photonic crystal and apodizedphotonic crystal are numerically simulated respectively. By contrast with optical transmission properties of ordinary photo-nic crystals made of positive refraction media, the transmission spectra of apodized photonic crystal become unregular, theBragg flat-headed area recurs but the peak of transmission does not change significantly. Futhermore, the band gap rangeof chirped photonic crystal diminishes gradually.

  11. Hair on non-extremal D1-D5 bound states

    Science.gov (United States)

    Roy, Pratik; Srivastava, Yogesh K.; Virmani, Amitabh

    2016-09-01

    We consider a truncation of type IIB supergravity on four-torus where in addition to the Ramond-Ramond 2-form field, the Ramond-Ramond axion ( w) and the NS-NS 2-form field ( B) are also retained. In the ( w, B) sector we construct a linearised perturbation carrying only left moving momentum on two-charge non-extremal D1-D5 geometries of Jejjala, Madden, Ross and Titchener. The perturbation is found to be smooth everywhere and normalisable. It is constructed by matching to leading order solutions of the perturbation equations in the inner and outer regions of the geometry.

  12. Cold beam of isotopically pure Yb atoms by deflection using 1D-optical molasses

    Science.gov (United States)

    Rathod, K. D.; Singh, P. K.; Natarajan, Vasant

    2014-09-01

    We demonstrate generation of an isotopically pure beam of laser-cooled Yb atoms by deflection using 1D-optical molasses. Atoms in a collimated thermal beam are first slowed using a Zeeman Slower. They are then subjected to a pair of molasses beams inclined at $45^\\circ$ with respect to the slowed atomic beam. The slowed atoms are deflected and probed at a distance of 160 mm. We demonstrate selective deflection of the bosonic isotope $^{174}$Yb, and the fermionic isotope $^{171}$Yb. Using a transient measurement after the molasses beams are turned on, we find a longitudinal temperature of 41 mK.

  13. Cold beam of isotopically pure Yb atoms by deflection using 1D-optical molasses

    Indian Academy of Sciences (India)

    K D Rathod; P K Singh; Vasant Natarajan

    2014-09-01

    We demonstrate the generation of an isotopically pure beam of laser-cooled Yb atoms by deflection using 1D-optical molasses. Atoms in a collimated thermal beam are first slowed using a Zeeman slower. They are then subjected to a pair of molasses beams inclined at 45° with respect to the slowed atomic beam. The slowed atoms are deflected and probed at a distance of 160 mm. We demonstrate the selective deflection of the bosonic isotope 174Yb and the fermionic isotope 171Yb. Using a transient measurement after the molasses beams are turned on, we find a longitudinal temperature of 41 mK.

  14. Maximizing 1D “like” implosion performance for inertial confinement fusion science

    Energy Technology Data Exchange (ETDEWEB)

    Kline, John L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-07-15

    While the march towards achieving indirectly driven inertial confinement fusion at the NIF has made great progress, the experiments show that multi-dimensional effects still dominate the implosion performance. Low mode implosion symmetry and hydrodynamic instabilities seed by capsule mounting features appear to be two key limiting factors for implosion performance. One reason these factors have a large impact on the performance of ICF implosions is the high convergence required to achieve high fusion gains. To tackle these problems, a predictable implosion platform is needed meaning experiments must trade-off high gain for performance. To this end, LANL has adopted three main approaches to develop a 1D implosion platform where 1D means high yield over 1D clean calculations. Taking advantage of the properties of beryllium capsules, a high adiabat, low convergence platform is being developed. The higher drive efficiency for beryllium enables larger case-to-capsule ratios to improve symmetry at the expense of drive. Smaller capsules with a high adiabat drive are expected to reduce the convergence and thus increase predictability. The second approach is liquid fuel layers using wetted foam targets. With liquid fuel layers, the initial mass in the hot spot can be controlled via the target fielding temperature which changes the liquid vapor pressure. Varying the initial hot spot mass via the vapor pressure controls the implosion convergence and minimizes the need to vaporize the dense fuel layer during the implosion to achieve ignition relevant hot spot densities. The last method is double shell targets. Unlike hot spot ignition, double shells ignite volumetrically. The inner shell houses the DT fuel and the convergence of this cavity is relatively small compared to hot spot ignition. Radiation trapping and the longer confinement times relax the conditions required to ignite the fuel. Key challenges for double shell targets are coupling the momentum of the outer shell to

  15. Momentum-carrying waves on D1-D5 microstate geometries

    CERN Document Server

    Mathur, Samir D

    2012-01-01

    If one attempts to add momentum-carrying waves to a black string then the solution develops a singularity at the horizon; this is a manifestation of the 'no hair theorem' for black objects. However individual microstates of a black string do not have a horizon, and so the above theorem does not apply. We construct a perturbation that adds momentum to a family of microstates of the extremal D1-D5 string. This perturbation is analogous to the 'singleton' mode localized at the boundary of AdS; to leading order it is pure gauge in the AdS interior of the geometry.

  16. Momentum-carrying waves on D1-D5 microstate geometries

    Energy Technology Data Exchange (ETDEWEB)

    Mathur, Samir D., E-mail: mathur@mps.ohio-state.edu [Department of Physics, Ohio State University, Columbus, OH 43210 (United States); Turton, David, E-mail: turton.7@osu.edu [Department of Physics, Ohio State University, Columbus, OH 43210 (United States)

    2012-09-21

    If one attempts to add momentum-carrying waves to a black string then the solution develops a singularity at the horizon; this is a manifestation of the 'no hair theorem' for black objects. However individual microstates of a black string do not have a horizon, and so the above theorem does not apply. We construct a perturbation that adds momentum to a family of microstates of the extremal D1-D5 string. This perturbation is analogous to the 'singleton' mode localized at the boundary of AdS; to leading order it is pure gauge in the AdS interior of the geometry.

  17. Simulations of Edge Effect in 1D Spin Crossover Compounds by Atom-Phonon Coupling Model

    Science.gov (United States)

    Linares, J.; Chiruta, D.; Jureschi, C. M.; Alayli, Y.; Turcu, C. O.; Dahoo, P. R.

    2016-08-01

    We used the atom-phonon coupling model to explain and illustrate the behaviour of a linear nano-chain of molecules. The analysis of the system's behaviour was performed using Free Energy method, and by applying Monte Carlo Metropolis (MCM) method which take into account the phonon contribution. In particular we tested both the MCM algorithm and the dynamic-matrix method and we expose how the thermal behaviour of a 1D spin crossover system varies as a function of different factors. Furthermore we blocked the edge atoms of the chain in its high spin state to study the effect on the system's behaviour.

  18. Phase-sensitive detection of Bragg scattering at 1D optical lattices

    CERN Document Server

    Slama, S; Deh, B; Ludewig, A; Zimmermann, C; Courteille, P W; Courteille, Ph.W.

    2004-01-01

    We report on the observation of Bragg scattering at 1D atomic lattices. Cold atoms are confined by optical dipole forces at the antinodes of a standing wave generated by the two counter-propagating modes of a laser-driven high-finesse ring cavity. By heterodyning the Bragg-scattered light with a reference beam, we obtain detailed information on phase shifts imparted by the Bragg scattering process. Being deep in the Lamb-Dicke regime, the scattered light is not broadened by the motion of individual atoms. In contrast, we have detected signatures of global translatory motion of the atomic grating.

  19. Peculiarities of propagation of acoustic excitations through an imperfect 1D-superlattice

    Energy Technology Data Exchange (ETDEWEB)

    Rumyantsev, V.V.; Fedorov, S.A. [Galkin Institute for Physics and Engineering of National Academy of Sciences of Ukraine, 83114 Donetsk (Ukraine); Gumennyk, K.V., E-mail: gumennyk@depm.fti.ac.donetsk.ua [Galkin Institute for Physics and Engineering of National Academy of Sciences of Ukraine, 83114 Donetsk (Ukraine)

    2012-09-15

    Virtual crystal approximation is adapted to address peculiarities of propagation of acoustic waves through a 1D 'sandwich' superstructure consisting of alternating layers of two types randomly substituted by foreign layers of the third type. Same-parity layers are of the same width and constitute a sublattice. Dependence of the lowest forbidden acoustic zone width of the described structure on concentrations of impurity layers in the two sublattices is numerically evaluated for longitudinal and transverse excitations. Values of substitute concentrations making the structure completely transparent prove to be independent of the relative widths of the 1st and 2nd type layers.

  20. High Sensitivity 1-D and 2-D Microwave Spectroscopy via Cryogenic Buffer Gas Cooling

    Science.gov (United States)

    Patterson, David; Eibenberger, Sandra

    2017-06-01

    All rotationally resolved spectroscopic methods rely on sources of cold molecules. For the last three decades, the workhorse technique for producing highly supersaturated samples of cold molecules has been the pulsed supersonic jet. We present here progress on our alternative method, cryogenic buffer gas cooling. Our high density, continuous source, and low noise temperature allow us to record microwave spectra at unprecedented sensitivity, with a dynamic range in excess of 10^6 achievable in a few minutes of integration time. This high sensitivity enables new protocols in both 1-D and 2-D microwave spectroscopy, including sensitive chiral analysis via nonlinear three wave mixing and applications as an analytical chemistry tool

  1. Hair on non-extremal D1-D5 bound states

    CERN Document Server

    Roy, Pratik; Virmani, Amitabh

    2016-01-01

    We consider a truncation of type IIB supergravity on four-torus where in addition to the Ramond-Ramond 2-form field, the Ramond-Ramond axion (w) and the NS-NS 2-form field (B) are also retained. In the (w, B) sector we construct a linearised perturbation carrying only left moving momentum on two-charge non-extremal D1-D5 geometries of Jejjala, Madden, Ross and Titchener. The perturbation is found to be smooth everywhere and normalizable. It is constructed by matching to leading order solutions of the perturbation equations in the inner and outer regions of the geometry.

  2. TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport

    OpenAIRE

    Schmidts, M.; Hou, Y.; Cortés, CR; Mans, DA; HUBER, C; Boldt, K.; Patel, M.; Van Reeuwijk, J; Plaza, JM; Van Beersum, SEC; Yap, ZM; Letteboer, SJF; Taylor, SP; Herridge, W.; Johnson, CA

    2015-01-01

    ARTICLE Received 1 Oct 2014 | Accepted 31 Mar 2015 | Published 5 June 2015 TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport Miriam Schmidts1,2,3,4,*, Yuqing Hou5,*, Claudio R. Corte´s6, Dorus A. Mans2,3, Celine Huber7, Karsten Boldt8, Mitali Patel1, Jeroen van Reeuwijk2,3, Jean-Marc Plaza9, Sylvia E.C. van Beersum2,3, Zhi Min Yap1, Stef J.F. Letteboer2,3, S Paige Taylor10, Warren Herridge11, Colin A. Johns...

  3. Synthesis, Characterization, and Application of 1-D Cerium Oxide Nanomaterials: A Review

    Directory of Open Access Journals (Sweden)

    Kuen-Song Lin

    2010-09-01

    Full Text Available The present work provides a comprehensive overview of the recent progress of research work toward developing new one dimensional (1-D ceria (CeO2 nanomaterials. The review has been classified into three parts: the preparation procedures with identification of the existing different dimensional ceria nanomaterials, the formation mechanisms, and an analysis of their applications. From literature survey, it is inaugurated that the fundamental structures of the ceria nanomaterials constructively dominate their properties and applications. In addition, this work will also provide a perspective on the future technical trends for the development of different dimensional CeO2 nanomaterials.

  4. Complex-Temperature Phase Diagrams of 1D Spin Models with Next-Nearest-Neighbor Couplings

    OpenAIRE

    1997-01-01

    We study the dependence of complex-temperature phase diagrams on details of the Hamiltonian, focusing on the effect of non-nearest-neighbor spin-spin couplings. For this purpose, we consider a simple exactly solvable model, the 1D Ising model with nearest-neighbor (NN) and next-to-nearest-neighbor (NNN) couplings. We work out the exact phase diagrams for various values of $J_{nnn}/J_{nn}$ and compare these with the case of pure nearest-neighbor (NN) couplings. We also give some similar result...

  5. Analytical solution to the Riemann problem of 1D elastodynamics with general constitutive laws

    CERN Document Server

    Berjamin, H; Chiavassa, G; Favrie, N

    2016-01-01

    Under the hypothesis of small deformations, the equations of 1D elastodynamics write as a 2 x 2 hyperbolic system of conservation laws. Here, we study the Riemann problem for convex and nonconvex constitutive laws. In the convex case, the solution can include shock waves or rarefaction waves. In the nonconvex case, compound waves must also be considered. In both convex and nonconvex cases, a new existence criterion for the initial velocity jump is obtained. Also, admissibility regions are determined. Lastly, analytical solutions are completely detailed for various constitutive laws (hyperbola, tanh and polynomial), and reference test cases are proposed.

  6. Adiabatic evolution of 1D shape resonances: an artificial interface conditions approach

    CERN Document Server

    Faraj, Ali; Nier, Francis

    2010-01-01

    Artificial interface conditions parametrized by a complex number $\\theta_{0}$ are introduced for 1D-Schr{\\"o}dinger operators. When this complex parameter equals the parameter $\\theta\\in i\\R$ of the complex deformation which unveils the shape resonances, the Hamiltonian becomes dissipative. This makes possible an adiabatic theory for the time evolution of resonant states for arbitrarily large time scales. The effect of the artificial interface conditions on the important stationary quantities involved in quantum transport models is also checked to be as small as wanted, in the polynomial scale $(h^N)_{N\\in \\N}$ as $h\\to 0$, according to $\\theta_{0}$.

  7. Simulation of Tunnel Junction in Cascade Solar Cell (GaAs/Ge Using AMPS-1D

    Directory of Open Access Journals (Sweden)

    Benmoussa Dennai

    2014-11-01

    Full Text Available The development of the tunnel junction interconnect was key the first two-terminal monolithic, multi-junction solar cell development. This paper describes simulation for the tunnel junction (GaAs between top cell (GaAs and bottom cell (Ge. This solar cell cascade was simulated when using one dimensional simulation program called analysis of microelectronic and photonic structures (AMPS-1D. In the simulation, the thickness of the tunnel junction layer was varied from 10 to 50 nm. By varying thickness of tunnel junction layer the simulated device performance was demonstrate in the form of current-voltage(I-V characteristics and quantum efficiency (QE.

  8. Numerical Simulation of Carbon Nanotubes/GaAs Hybrid PV Devices with AMPS-1D

    Directory of Open Access Journals (Sweden)

    Georgi Xosrovashvili

    2014-01-01

    Full Text Available The performance and characteristics of a hybrid heterojunction single-walled carbon nanotube and GaAs solar cell are modelled and numerically simulated using AMPS-1D device simulation tool. The device physics and performance with different junction parameters are analysed. The results suggest that the open-circuit voltage changes very slightly by changing the electron affinity, acceptor and donor density while the other electrical parameters reach an optimum value. Increasing the concentration of a discrete defect density in the absorber layer decreases the electrical parameters. The current-voltage characteristics, quantum efficiency, band gap, and thickness variation of the photovoltaic response will be quantitatively considered.

  9. Variational Formulation of 1-D Unsteady Compressible Flow in a Deforming Tube

    Institute of Scientific and Technical Information of China (English)

    Gaolian Liu; Yi Tao; Yingxue Liu

    2003-01-01

    The variational principles for 1-D unsteady compressible flow in a deforming tube derived in a previous paper are improved essentially by reconstructing the initial/final-integral terms according to a new method suggested in a recent paper. As a result, the inherent shortcoming of variational principles of being unable to admit physically rational initial/final-value conditions in initial/boundary-value problems is successfully eliminated. Thus, a new theoretical basis for the time-space finite-element analysis is provided.

  10. Exponentially long Equilibration times in a 1-D Collisional Model of a classical gas

    DEFF Research Database (Denmark)

    Hjorth, Poul; Benettin, G.

    1999-01-01

    separation between the time scale for the vibration and the time scale associated with a typical binary collision in the gas. We consider here a simple 1-D model, and show how, when these time scales are well separated, the collisional dynamics is constrained by a many-particle adiabatic invariant....... The effect is that the collisional energy exchanges between the translational and the vibrational degrees of freedom are slowed down by an exponential factor (as Jeans conjectured). A metastable situation thus occurs, in which the fast vibrational degrees of freedom effectivly do not contribute...

  11. Results and limits in the 1-D analytical modeling for the asymmetric DG SOI MOSFET

    OpenAIRE

    O. Cobianu; M. Glesner

    2008-01-01

    This paper presents the results and the limits of 1-D analytical modeling of electrostatic potential in the low-doped p type silicon body of the asymmetric n-channel DG SOI MOSFET, where the contribution to the asymmetry comes only from p- and n-type doping of polysilicon used as the gate electrodes. Solving Poisson's equation with boundary conditions based on the continuity of normal electrical displacement at interfaces and the presence of a minimum electrostatic potential by using the...

  12. Design for manufacturability from 1D to 4D for 90-22 nm technology nodes

    CERN Document Server

    Balasinski, Artur

    2013-01-01

    This book explains integrated circuit design for manufacturability (DfM) at the product level (packaging, applications) and applies engineering DfM principles to the latest standards of product development at 22 nm technology nodes.  It is a valuable guide for layout designers, packaging engineers and quality engineers, covering DfM development from 1D to 4D, involving IC design flow setup, best practices, links to manufacturing and product definition, for process technologies down to 22 nm node, and product families including memories, logic, system-on-chip and system-in-package.

  13. LPMLE3: A novel 1-D approach to study water flow in streambeds using heat as a tracer

    NARCIS (Netherlands)

    Schneidewind, U.; Berkel, van M.; Anibas, C.; van der Steen, G.; Schmidt, C.; Joris, I.; Seuntjens, P.; Batelaan, O.; Zwart, Heiko J.

    We introduce LPMLE3, a new 1-D approach to quantify vertical water flow components at streambeds using temperature data collected in different depths. LPMLE3 solves the partial differential equation for coupled water flow and heat transport in the frequency domain. Unlike other 1-D approaches it

  14. Potential role of TBC1D4 in enhanced post-exercise insulin action in human skeletal muscle

    DEFF Research Database (Denmark)

    Treebak, Jonas Thue; Frøsig, Christian; Pehmøller, Christian

    2009-01-01

    AIMS/HYPOTHESIS: TBC1 domain family, member 4 (TBC1D4; also known as AS160) is a cellular signalling intermediate to glucose transport regulated by insulin-dependent and -independent mechanisms. Skeletal muscle insulin sensitivity is increased after acute exercise by an unknown mechanism that does.......01). However, TBC1D4 phosphorylation on Ser-318, Ser-341, Ser-588 and Ser-751 was higher in the previously exercised leg, both in the absence and in the presence of insulin (p power = 0.39). 14-3-3 binding capacity for TBC1D4 increased equally (p ... insulin stimulation. CONCLUSION/INTERPRETATION: We provide evidence for site-specific phosphorylation of TBC1D4 in human skeletal muscle in response to physiological hyperinsulinaemia. The data support the idea that TBC1D4 is a nexus for insulin- and exercise-responsive signals that may mediate increased...

  15. Identification of regions critical for the integrity of the TSC1-TSC2-TBC1D7 complex.

    Directory of Open Access Journals (Sweden)

    Arthur Jorge Santiago Lima

    Full Text Available The TSC1-TSC2-TBC1D7 complex is an important negative regulator of the mechanistic target of rapamycin complex 1 that controls cell growth in response to environmental cues. Inactivating TSC1 and TSC2 mutations cause tuberous sclerosis complex (TSC, an autosomal dominant disorder characterised by the occurrence of benign tumours in various organs and tissues, notably the brain, skin and kidneys. TBC1D7 mutations have not been reported in TSC patients but homozygous inactivation of TBC1D7 causes megaencephaly and intellectual disability. Here, using an exon-specific deletion strategy, we demonstrate that some regions of TSC1 are not necessary for the core function of the TSC1-TSC2 complex. Furthermore, we show that the TBC1D7 binding site is encoded by TSC1 exon 22 and identify amino acid residues involved in the TSC1-TBC1D7 interaction.

  16. 488-1D Ash Basin closure cap help modeling- Microdrain® liner option

    Energy Technology Data Exchange (ETDEWEB)

    Dyer, J. A. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-08-03

    At the request of Area Completion Engineering and in support of the 488-1D Ash Basin closure, the Savannah River National Laboratory (SRNL) performed hydrologic simulations of the revised 488-1D Ash Basin closure cap design using the Hydrologic Evaluation of Landfill Performance (HELP) model. The revised design substitutes a MicroDrain Liner®—60-mil low-density polyethylene geomembrane structurally integrated with 130-mil drainage layer—for the previously planned drainage/barrier system—300-mil geosynthetic drainage layer (GDL), 300-mil geosynthetic clay liner (GCL), and 6-inch common fill soil layer. For a 25-year, 24-hour storm event, HELP model v3.07 was employed to (1) predict the peak maximum daily hydraulic head for the geomembrane layer, and (2) ensure that South Carolina Department of Health and Environmental Control (SCDHEC) requirements for the barrier layer (i.e., ≤ 12 inches hydraulic head on top of a barrier having a saturated hydraulic conductivity ≤ 1.0E-05 cm/s) will not be exceeded. A 25-year, 24-hour storm event at the Savannah River Site (SRS) is 6.1 inches rainfall (Weber 1998). HELP model v3.07 results based upon the new planned cap design suggest that the peak maximum daily hydraulic head on the geomembrane barrier layer will be 0.15 inches for a minimum slope equal to 3%, which is two orders of magnitude below the SCDHEC upper limit of 12 inches.

  17. Quasi-1D physics in metal-organic frameworks: MIL-47(V from first principles

    Directory of Open Access Journals (Sweden)

    Danny E. P. Vanpoucke

    2014-10-01

    Full Text Available The geometric and electronic structure of the MIL-47(V metal-organic framework (MOF is investigated by using ab initio density functional theory (DFT calculations. Special focus is placed on the relation between the spin configuration and the properties of the MOF. The ground state is found to be antiferromagnetic, with an equilibrium volume of 1554.70 Å3. The transition pressure of the pressure-induced large-pore-to-narrow-pore phase transition is calculated to be 82 MPa and 124 MPa for systems with ferromagnetic and antiferromagnetic chains, respectively. For a mixed system, the transition pressure is found to be a weighted average of the ferromagnetic and antiferromagnetic transition pressures. Mapping DFT energies onto a simple-spin Hamiltonian shows both the intra- and inter-chain coupling to be antiferromagnetic, with the latter coupling constant being two orders of magnitude smaller than the former, suggesting the MIL-47(V to present quasi-1D behavior. The electronic structure of the different spin configurations is investigated and it shows that the band gap position varies strongly with the spin configuration. The valence and conduction bands show a clear V d-character. In addition, these bands are flat in directions orthogonal to VO6 chains, while showing dispersion along the the direction of the VO6 chains, similar as for other quasi-1D materials.

  18. Effect of copper doping on the crystal structure and morphology of 1D nanostructured manganese oxides.

    Science.gov (United States)

    Lee, Sun Hee; Park, Dae Hoon; Hwang, Seong-Ju; Choy, Jin-Ho

    2007-11-01

    We have tried to control the aspect ratio and physicochemical properties of 1D nanostructured manganese oxides through copper doping. Copper-doped manganese oxide nanostructures have been synthesized by one-pot hydrothermal treatment for the mixed solution of permanganate anions and copper cations. According to powder X-ray diffraction and electron microscopic analyses, all the present materials commonly crystallize with alpha-MnO2-type structure but their aspect ratio decreases significantly with increasing the content of copper. Such a variation of crystallite dimension is attributable to the limitation of crystal growth by the incorporation of copper ions. X-ray absorption spectroscopic studies at Mn K- and Cu K-edges clearly demonstrate that the average oxidation state of manganese ions is increased by the substitution of divalent copper ions. Electrochemical measurements reveal the improvement of the electrode performance of nanostructured manganate upon copper doping, which can be interpreted as a result of the decrease of aspect ratio and the increase of Mn valence state. From the present experimental findings, it becomes certain that the present Cu doping method can provide an effective way of controlling the crystal dimension and electrochemical property of 1D nanostructured manganese oxide.

  19. Statistical investigation and thermal properties for a 1-D impact system with dissipation

    Energy Technology Data Exchange (ETDEWEB)

    Díaz I, Gabriel, E-mail: gabriel.diaz.iturry@gmail.com; Livorati, André L.P., E-mail: livorati@rc.unesp.br; Leonel, Edson D., E-mail: edleonel@rc.unesp.br

    2016-05-06

    Highlights: • The dynamics of a 1-D dissipative impact system is studied. • Statistical properties for the average velocity, root mean square velocity and its deviation are characterized. • A thermodynamics formalism is developed as function of the statistical variable. • The formalism shows itself to be robust, and we can predict numerical values without doing numerical simulations. - Abstract: The behavior of the average velocity, its deviation and average squared velocity are characterized using three techniques for a 1-D dissipative impact system. The system – a particle, or an ensemble of non-interacting particles, moving in a constant gravitation field and colliding with a varying platform – is described by a nonlinear mapping. The average squared velocity allows to describe the temperature for an ensemble of particles as a function of the parameters using: (i) straightforward numerical simulations; (ii) analytically from the dynamical equations; (iii) using the probability distribution function. Comparing analytical and numerical results for the three techniques, one can check the robustness of the developed formalism, where we are able to estimate numerical values for the statistical variables, without doing extensive numerical simulations. Also, extension to other dynamical systems is immediate, including time dependent billiards.

  20. Eighth-Order Compact Finite Difference Scheme for 1D Heat Conduction Equation

    Directory of Open Access Journals (Sweden)

    Asma Yosaf

    2016-01-01

    Full Text Available The purpose of this paper is to develop a high-order compact finite difference method for solving one-dimensional (1D heat conduction equation with Dirichlet and Neumann boundary conditions, respectively. A parameter is used for the direct implementation of Dirichlet and Neumann boundary conditions. The introduced parameter adjusts the position of the neighboring nodes very next to the boundary. In the case of Dirichlet boundary condition, we developed eighth-order compact finite difference method for the entire domain and fourth-order accurate proposal is presented for the Neumann boundary conditions. In the case of Dirichlet boundary conditions, the introduced parameter behaves like a free parameter and could take any value from its defined domain but for the Neumann boundary condition we obtained a particular value of the parameter. In both proposed compact finite difference methods, the order of accuracy is the same for all nodes. The time discretization is performed by using Crank-Nicholson finite difference method. The unconditional convergence of the proposed methods is presented. Finally, a set of 1D heat conduction equations is solved to show the validity and accuracy of our proposed methods.

  1. CD1d expression and invariant NKT cell responses in herpesvirus infections

    Directory of Open Access Journals (Sweden)

    Rusung eTan

    2015-06-01

    Full Text Available Invariant natural killer T (iNKT cells are a highly conserved subset of unconventional T lymphocytes that express a canonical, semi-invariant T cell receptor (TCR and surface markers shared with the natural killer cell lineage. iNKT cells recognize exogenous and endogenous glycolipid antigens restricted by non-polymorphic CD1d molecules, and are highly responsive to the prototypical agonist, α-galactosylceramide. Upon activation, iNKT cells rapidly coordinate signaling between innate and adaptive immune cells through the secretion of proinflammatory cytokines, leading to the maturation of antigen-presenting cells and expansion of antigen-specific CD4+ and CD8+ T cells. Because of their potent immunoregulatory properties, iNKT cells have been extensively studied and are known to play a pivotal role in mediating immune responses against microbial pathogens including viruses. Here, we review evidence that herpesviruses manipulate CD1d expression to escape iNKT cell surveillance and establish lifelong latency in humans. Collectively, published findings suggest that iNKT cells play critical roles in anti-herpesvirus immune responses and could be harnessed therapeutically to limit viral infection and viral-associated disease.

  2. Hypocenter determination using simulated annealing, updated 1D seismic velocity model and focal mechanism analysis

    Science.gov (United States)

    Akbar, Akhmad Fanani; Nugraha, Andri Dian; Sule, Rachmat; Juanda, Aditya Abdurrahman

    2013-09-01

    Hypocenter determination of micro-earthquakes of Mount "X-1" geothermal field has been conducted using simulated annealing and guided error search method using a 1D seismic velocity model. In order to speed up the hypocenter determination process a three-circle intersection method has been used to guide the simulated annealing and guided error search process. We used P and S arrival time's microseismic data. In the simulated annealing and guided error search processes, the minimum travel time from a source to a receiver has been calculated by employing ray tracing with shooting method. The resulting hypocenters from the above process occurred at depths of 3-4 km below mean sea level. These hypocenter distributions are correlated with previous study which was concluded that the most active microseismic area in which the site of many fractures and also vertical circulation place. Later on, resulting hypocenters location was used as input to determine 1-D seismic velocity using joint hypocenter determination method. The results of VELEST indicate show low Vp/Vs ratio value at depths of 3-4 km. Our interpretation is this anomaly may be related to a rock layer which is saturated by vapor (gas or steam). Another feature is high Vp/Vs ratio value at depths of 1-3 km that may related to a rock layer which is saturated by fluid or partial melting. We also analyze the focal mechanism of microseismic using ISOLA method to determine the source characteristic of this event.

  3. Unveiling the Role of CNTs on the Phase Formation of 1D Ferroelectrics

    KAUST Repository

    Mahajan, Amit

    2015-05-21

    Carbon nanotubes (CNTs) have the potential to act as templates or bottom electrodes for three dimension (3D) capacitor arrays, which utilise one dimension (1D) ferroelectric nanostructures to increase memory size and density. However, growing a ferroelectric on the surface of CNTs is non-trivial. Here, we demonstrate that multi-walled (MW) CNTs decrease the time and temperature for formation of lead zirconium titanate Pb(Zr1-xTix)O3 (PZT) by ~100 ºC commensurate with a decrease in activation energy from 68±15 kJ/mol to 27±2 kJ/mol. As a consequence, monophasic PZT was obtained at 575 ºC for MWCNTs/PZT whereas for pure PZT traces of pyrochlore were still present at 650 ºC, where PZT phase formed due to homogeneous nucleation. The piezoelectric nature of MWCNT/PZT synthesised at 500 ºC for 1 h was proved. Although further work is required to prove the concept of 3D capacitor arrays, our result suggests that it is feasible to utilise MWCNTs as templates/electrodes for the formation of 1D PZT nano ferroelectrics.

  4. A world-line framework for 1D Topological Conformal sigma-models

    CERN Document Server

    Baulieu, L; Toppan, F

    2015-01-01

    We use world-line methods for pseudo-supersymmetry to construct $sl(2|1)$-invariant actions for the $(2,2,0)$ chiral and ($1,2,1)$ real supermultiplets of the twisted $D$-module representations of the $sl(2|1)$ superalgebra. The derived one-dimensional topological conformal $\\sigma$-models are invariant under nilpotent operators. The actions are constructed for both parabolic and hyperbolic/trigonometric realizations (with extra potential terms in the latter case). The scaling dimension $\\lambda$ of the supermultiplets defines a coupling constant, $2\\lambda+1$, the free theories being recovered at $\\lambda=-\\frac{1}{2}$. We also present, generalizing previous works, the $D$-module representations of one-dimensional superconformal algebras induced by ${\\cal N}=(p,q)$ pseudo-supersymmetry acting on $(k,n,n-k)$ supermultiplets. Besides $sl(2|1)$, we obtain the superalgebras $A(1,1)$, $D(2,1;\\alpha)$, $D(3,1)$, $D(4,1)$, $A(2,1)$ from $(p,q)= (1,1), (2,2), (3,3), (4,4), (5,1)$, at given $k,n$ and critical values ...

  5. Simulation of hetero-junction silicon solar cells with AMPS-1D

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez-Como, Norberto; Morales-Acevedo, Arturo [Centro de Investigacion y de Estudios Avanzados del IPN, Electrical Engineering Department, Avenida IPN No. 2508, 07360 Mexico, D. F. (Mexico)

    2010-01-15

    Mono- and poly-crystalline silicon solar cell modules currently represent between 80% and 90% of the PV world market. The reasons are the stability, robustness and reliability of this kind of solar cells as compared to those of emerging technologies. Then, in the mid-term, silicon solar cells will continue playing an important role for their massive terrestrial application. One important approach is the development of silicon solar cells processed at low temperatures (less than 300 C) by depositing amorphous silicon layers with the purpose of passivating the silicon surface, and avoiding the degradation suffered by silicon when processed at temperatures above 800 C. This kind of solar cells is known as HIT cells (hetero-junction with an intrinsic thin amorphous layer) and are already produced commercially (Sanyo Ltd.), reaching efficiencies above 20%. In this work, HIT solar cells are simulated by means of AMPS-1D, which is a program developed at Pennsylvania State University. We shall discuss the modifications required by AMPS-1D for simulating this kind of structures since this program explicitly does not take into account interfaces with high interfacial density of states as occurs at amorphous-crystalline silicon hetero-junctions. (author)

  6. Bogoliubov coefficients for the twist operator in the D1D5 CFT

    Energy Technology Data Exchange (ETDEWEB)

    Carson, Zaq, E-mail: carson.231@osu.edu; Mathur, Samir D., E-mail: mathur.16@osu.edu; Turton, David, E-mail: turton.7@osu.edu

    2014-12-15

    The D1D5 CFT is a holographic dual of a near-extremal black hole in string theory. The interaction in this theory involves a twist operator which joins together different copies of a free CFT. Given a large number of D1 and D5 branes, the effective length of the circle on which the CFT lives is very large. We develop a technique to study the effect of the twist operator in the limit where the wavelengths of excitations are short compared to this effective length, which we call the ‘continuum limit’. The method uses Bogoliubov coefficients to compute the effect of the twist operator in this limit. For bosonic fields, we use the method to reproduce recent results describing the effect of the twist operator when it links together CFT copies with windings M and N, producing a copy of winding M+N. We also comment on possible generalizations of our results. The methods developed here may help in understanding the twist interaction at higher orders. This in turn should provide insight into the thermalization process in the D1D5 CFT, which gives a holographic description of black hole formation.

  7. Nanorobotic System iTRo for Controllable 1D Micro/nano Material Twisting Test.

    Science.gov (United States)

    Lu, Haojian; Shang, Wanfeng; Wei, Xueyong; Yang, Zhan; Fukuda, Toshio; Shen, Yajing

    2017-06-08

    In-situ micro/nano characterization is an indispensable methodology for material research. However, the precise in-situ SEM twisting of 1D material with large range is still challenge for current techniques, mainly due to the testing device's large size and the misalignment between specimen and the rotation axis. Herein, we propose an in-situ twist test robot (iTRo) to address the above challenges and realize the precise in-situ SEM twisting test for the first time. Firstly, we developed the iTRo and designed a series of control strategies, including assembly error initialization, triple-image alignment (TIA) method for rotation axis alignment, deformation-based contact detection (DCD) method for sample assembly, and switch control for robots cooperation. After that, we chose three typical 1D material, i.e., magnetic microwire Fe74B13Si11C2, glass fiber, and human hair, for twisting test and characterized their properties. The results showed that our approach is able to align the sample to the twisting axis accurately, and it can provide large twisting range, heavy load and high controllability. This work fills the blank of current in-situ mechanical characterization methodologies, which is expected to give significant impact in the fundamental nanomaterial research and practical micro/nano characterization.

  8. VaMpy: A Python Package to Solve 1D Blood Flow Problems

    Directory of Open Access Journals (Sweden)

    Alexandra K. Diem

    2017-06-01

    Full Text Available Finite-differences methods such as the Lax-Wendroff method (LW are commonly used to solve 1D models of blood flow. These models solve for blood flow and lumen area and are useful in disease research, such as hypertension and atherosclerosis, where flow and pressure are good indicators for the presence of disease. Despite the popularity of the LW method to solve the blood flow equations, no implementation of a LW solver for these equations has been published and made publicly available. This leads to the reimplementation of the same methods within different research groups and makes verification of results more difficult. The Vascular Modelling in Python (VaMpy toolkit is a Python package that aims to fill this gap. It implements Richtmyer’s two-step Lax-Wendroff scheme to solve 1D model equations of blood flow in arterial trees and aims at facilitating the solution of blood flow problems for various medical applications.   Funding statement: The development of this software was supported by an EPSRC Doctoral Training Centre grant (EP/G03690X/1.

  9. Interfaces Supporting Surface Gap Soliton Ground States in the 1D Nonlinear Schroedinger Equation

    CERN Document Server

    Dohnal, Tomas; Plum, Michael; Reichel, Wolfgang

    2012-01-01

    We consider the problem of verifying the existence of $H^1$ ground states of the 1D nonlinear Schr\\"odinger equation for an interface of two periodic structures: $$-u" +V(x)u -\\lambda u = \\Gamma(x) |u|^{p-1}u \\ {on} \\R$$ with $V(x) = V_1(x), \\Gamma(x)=\\Gamma_1(x)$ for $x\\geq 0$ and $V(x) = V_2(x), \\Gamma(x)=\\Gamma_2(x)$ for $x1$. The article [T. Dohnal, M. Plum and W. Reichel, "Surface Gap Soliton Ground States for the Nonlinear Schr\\"odinger Equation," \\textit{Comm. Math. Phys.} \\textbf{308}, 511-542 (2011)] provides in the 1D case an existence criterion in the form of an integral inequality involving the linear potentials $V_{1},V_2$ and the Bloch waves of the operators $-\\tfrac{d^2}{dx^2}+V_{1,2}-\\lambda$. We choose here the classes of piecewise constant and piecewise linear potentials $V_{1,2}$ and check this criterion for a set of parameter values. In the piecewise constant case the Bloch waves are calculated explicitly and in the piecewise linear case verified enclosures of the Bloch waves are computed ...

  10. 1-D Systolic Arrays Design of LMS Adaptive (FIR Digital Filtering

    Directory of Open Access Journals (Sweden)

    Ali H. Mahdi

    2010-01-01

    Full Text Available This paper extends the 1-D systolic array approach with a method of systematic linear design of systolic algorithms. Past methods for mapping the Least-Mean-Square (LMS Adaptive Finite-Impulse-Response (FIR filter onto parallel and pipelined architectures either introduce delays in the coefficients updates or have excessive hardware requirements. In this article, we describe an efficient 1-D systolic array for the LMS adaptive FIR filter that produces the same output and error signals as produced by the standard LMS adaptive filter architecture with single assignment form of processor functions.The proposed systolic architectures that are designed operate on a block-by-block basis and makes use of the flexibility in the design, which takes the inner product step (convolution sum of the tap weight vector and the tap input vector in the design consideration. It enables us to extract more than one algorithm for the same problem. The input and output data flow sequentially and continuously into and out of the systolic arrays at the system clock rates, during each clock period, processing element of the same type operates in parallel. The most computationally demanding among them performs only two consecutive multiplications and two additions/subtractions per clock period, thereby allowing a very high throughput and very fast block signal processing to be achieved at the expense of a delay of L samples between the input and output and 100% utilization, L being the block size.

  11. Superdescendants of the D1D5 CFT and their dual 3-charge geometries

    Energy Technology Data Exchange (ETDEWEB)

    Giusto, Stefano [Dipartimento di Fisica ed Astronomia “Galileo Galilei”, Università di Padova,Via Marzolo 8, 35131 Padova (Italy); I.N.F.N. Sezione di Padova,Via Marzolo 8, 35131 Padova (Italy); Russo, Rodolfo [Centre for Research in String Theory, School of Physics and Astronomy,Queen Mary University of London, Mile End Road, London, E1 4NS (United Kingdom); Laboratoire de Physique Théorique de L’Ecole Normale Supérieure,24 rue Lhomond, 75231 Paris cedex (France)

    2014-03-03

    We describe how to obtain the gravity duals of semiclassical states in the D1-D5 CFT that are superdescendants of a class of RR ground states. On the gravity side, the configurations we construct are regular and asymptotically reproduce the 3-charge D1-D5-P black hole compactified on S{sup 1}×T{sup 4}. The geometries depend trivially on the T{sup 4} directions but non-trivially on the remaining 6D space. In the decoupling limit, they reduce to asymptotically AdS{sub 3}×S{sup 3}×T{sup 4} spaces that are dual to CFT states obtained by acting with (exponentials of) the operators of the superconformal algebra. As explicit examples, we generalise the solution first constructed in arXiv:1306.1745 and discuss another class of states that have a more complicated dual geometry. By using the free orbifold description of the CFT we calculate the average values for momentum and the angular momenta of these configurations. Finally we compare the CFT results with those obtained in the bulk from the asymptotically M{sup 1,4}×S{sup 1}×T{sup 4} region.

  12. 1-D air-snowpack modeling of atmospheric nitrous acid at South Pole during ANTCI 2003

    Directory of Open Access Journals (Sweden)

    Wei Liao

    2008-05-01

    Full Text Available A 1-D air-snowpack model of HONO has been developed and constrained by observed chemistry and meteorology data. The 1-D model includes molecular diffusion and mechanical dispersion, windpumping in snow, gas phase to quasi-liquid layer phase HONO transfer and quasi-liquid layer nitrate and interstitial air HONO photolysis. Photolysis of nitrate is important as a dominant HONO source inside the snowpack, however, the observed HONO emission from the snowpack was triggered mainly by the equilibrium between quasi liquid layer nitrite and firn air HONO deep down the snow surface (i.e. 30 cm below snow surface. The high concentration of HONO in the firn air is subsequently transported above the snowpack by diffusion and windpumping. The model uncertainties come mainly from lack of measurements and the interpretation of the QLL properties based on the bulk snow measurements. One critical factor is the ionic strength of QLL nitrite, which is estimated here by the bulk snow pH, nitrite concentration, and QLL to bulk snow volume ratio.

  13. 1-D Air-snowpack modeling of atmospheric nitrous acid at South Pole during ANTCI 2003

    Directory of Open Access Journals (Sweden)

    W. Liao

    2008-12-01

    Full Text Available A 1-D air-snowpack model of HONO has been developed and constrained by observed chemistry and meteorology data. The 1-D model includes molecular diffusion and mechanical dispersion, windpumping in snow, gas phase to quasi-liquid layer phase HONO transfer and quasi-liquid layer nitrate and interstitial air HONO photolysis. Photolysis of nitrate is important as a dominant HONO source inside the snowpack, however, the observed HONO emission from the snowpack was triggered mainly by the equilibrium between quasi liquid layer nitrite and firn air HONO deep down the snow surface (i.e. 30 cm below snow surface. The high concentration of HONO in the firn air is subsequently transported above the snowpack by diffusion and windpumping. The model uncertainties come mainly from lack of measurements and the interpretation of the QLL properties based on the bulk snow measurements. One critical factor is the ionic strength of QLL nitrite, which is estimated here by the bulk snow pH, nitrite concentration, and QLL to bulk snow volume ratio.

  14. Performance studies on high pressure 1-D position sensitive neutron detectors

    Indian Academy of Sciences (India)

    S S Desai; A M Shaikh

    2008-11-01

    The powder diffractometer and Hi-Q diffractometer at Dhruva reactor make use of five identical 1-D position sensitive detectors (PSDs) to scan scattering angles in the range 3° to 140°. In order to improve the overall throughput of these spectrometers, it is planned to install a bank of 15 high-efficiency and high-resolution PSDs arranged in three layers with five PSDs in each layer. With each high pressure PSD (3He 10 bar + Kr 2 bar) showing the efficiency gain of 1.8 at 1.2 Å, detector bank is expected to show overall gain of 5.5 times the present detection efficiency and reduction in data collection time by equivalent factor. The 1-D PSDs are developed in batches of five, and are characterized so that all PSDs operate at uniform parameters such as position resolution, uniformity of efficiency and linearity of response. Position spectrum indicates the differential position resolution to be ∼ 1 mm and integral position resolution to be 3–4 mm. Broadening of position spectrum at the extreme end of sensitive length of PSD is analysed using fine shift of the beam. Dependence of position resolution and dynamic range of output pulse on the input impedance of pre-amplifier is also presented.

  15. A Review of Swarm-Based 1D/2D Signal Processing

    Directory of Open Access Journals (Sweden)

    Horia Mihail Teodorescu

    2012-10-01

    Full Text Available While swarming behavior, widely encountered in nature, has recently sparked numerous models and interest in domains as optimization, data clustering, and control, their application to signal processing remains sporadic. In this paper I provide a unitary treatment and a review of former results obtained in signal filtering and enhancement using swarms. General equations are presented for these procedures and stability issues are considered, with examples. The paper overviews several swarming model I introduced in previous papers and provides new evidence of the applicability of these models in signal processing. In all the models for 1D signal processing, the key idea is that the swarm hunts a prey that impersonates the filtered signal. In the 2D models, the signal (image represents the “landscape” over which the swarm moves at a distance, while the swarm interacts with the signal (landscape. I provide and discuss details of the underlying theory of the models for processing time-domain signals and images. While this paper partly follows and summarizes previous papers, it nevertheless includes supplementary theoretical and algorithmic considerations and new results for both 1D and 2D signal processing. Although following either biological models or physical models in swarm algorithms is not generally accepted for technical applications, we prefer to emphasize the analogies established by our biomimetic approach with these two groups of models.

  16. Atomic layer deposition of 1D and 2D nickel nanostructures on graphite

    Science.gov (United States)

    Ryu, Seung Wook; Yoon, Jaehong; Moon, Hyoung-Seok; Shong, Bonggeun; Kim, Hyungjun; Lee, Han-Bo-Ram

    2017-03-01

    One-dimensional (1D) nanowires (NWs) and two-dimensional (2D) thin films of Ni were deposited on highly ordered pyrolytic graphite (HOPG) by atomic layer deposition (ALD), using NH3 as a counter reactant. Thermal ALD using NH3 gas forms 1D NWs along step edges, while NH3 plasma enables the deposition of a continuous 2D film over the whole surface. The lateral and vertical growth rates of the Ni NWs are numerically modeled as a function of the number of ALD cycles. Pretreatment with NH3 gas promotes selectivity in deposition by the reduction of oxygenated functionalities on the HOPG surface. On the other hand, NH3 plasma pretreatment generates surface nitrogen species, and results in a morphological change in the basal plane of graphite, leading to active nucleation across the surface during ALD. The effects of surface nitrogen species on the nucleation of ALD Ni were theoretically studied by density functional theory calculations. Our results suggest that the properties of Ni NWs, such as their density and width, and the formation of Ni thin films on carbon surfaces can be controlled by appropriate use of NH3.

  17. Design method for a laser line beam shaper of a general 1D angular power distribution

    Science.gov (United States)

    Oved, E.; Oved, A.

    2016-05-01

    Laser line is a beam of laser, spanned in one direction using a beam shaper to form a fan of light. This illumination tool is important in laser aided machine vision, 3D scanners, and remote sensing. For some applications the laser line should have a specific angular power distribution. If the distribution is nonsymmetrical, the beam shaper is required to be nonsymmetrical freeform, and its design process using optical design software is time consuming due to the long optimization process which usually converges to some local minimum. In this paper we introduce a new design method of a single element refractive beam shaper of any predefined general 1D angular power distribution. The method makes use of a notion of "prism space", a geometrical representation of all double refraction prisms, and any 1D beam shaper can be described by a continuous curve in this space. It is shown that infinitely many different designs are possible for any given power distribution, and it is explained how an optimal design is selected among them, based on criteria such as high transmission, low surface slopes, robustness to manufacturing errors etc. The method is non-parametric and hence does not require initial guess of a functional form, and the resultant optical surfaces are described by a sequence of points, rather than by an analytic function.

  18. Thermodynamics of Large N Gauge Theories with Chemical Potentials in a 1/D Expansion

    CERN Document Server

    Morita, Takeshi

    2010-01-01

    In order to understand thermodynamical properties of N D-branes with chemical potentials associated with R-symmetry charges, we study a one dimensional large N gauge theory (bosonic BFSS type model) as a first step. This model is obtained through a dimensional reduction of a 1+D dimensional SU(N) Yang-Mills theory and we use a 1/D expansion to investigate the phase structure. We find three phases in the \\mu-T plane. We also show that all the adjoint scalars condense at large D and obtain a mass dynamically. This dynamical mass protects our model from the usual perturbative instability of massless scalars in a non-zero chemical potential. We find that the system is at least meta-stable for arbitrary large values of the chemical potentials in D \\to \\infty limit. We also explore the existence of similar condensation in higher dimensional gauge theories in a high temperature limit. In 2 and 3 dimensions, the condensation always happens as in one dimensional case. On the other hand, if the dimension is higher than...

  19. Thermodynamics of large N gauge theories with chemical potentials in a 1/ D expansion

    Science.gov (United States)

    Morita, Takeshi

    2010-08-01

    In order to understand thermodynamical properties of N D-branes with chemical potentials associated with R-symmetry charges, we study a one dimensional large N gauge theory (bosonic BFSS type model) as a first step. This model is obtained through a dimensional reduction of a 1 + D dimensional SU( N) Yang-Mills theory and we use a 1 /D expansion to investigate the phase structure. We find three phases in the μ - T plane. We also show that all the adjoint scalars condense at large D and obtain a mass dynamically. This dynamical mass protects our model from the usual perturbative instability of massless scalars in a non-zero chemical potential. We find that the system is at least meta-stable for arbitrary large values of the chemical potentials in D → ∞ limit. We also explore the existence of similar condensation in higher dimensional gauge theories in a high temperature limit. In 2 and 3 dimensions, the condensation always happens as in one dimensional case. On the other hand, if the dimension is higher than 4, there is a critical chemical potential and the condensation happens only if the chemical potentials are below it.

  20. Operator mixing in deformed D1D5 CFT and the OPE on the cover

    Science.gov (United States)

    Burrington, Benjamin A.; Jardine, Ian T.; Peet, Amanda W.

    2017-06-01

    We consider the D1D5 CFT near the orbifold point and develop methods for computing the mixing of untwisted operators to first order by using the OPE on the covering surface. We argue that the OPE on the cover encodes both the structure constants for the orbifold CFT and the explicit form of the mixing operators. We show this explicitly for some example operators. We start by considering a family of operators dual to supergravity modes, and show that the OPE implies that there is no shift in the anomalous dimension to first order, as expected. We specialize to the operator dual to the dilaton, and show that the leading order singularity in the OPE reproduces the correct structure constant. Finally, we consider an unprotected operator of conformal dimension (2,2), and show that the leading order singularity and one of the subleading singularities both reproduce the correct structure constant. We check that the operator produced at subleading order using the OPE method is correct by calculating a number of three point functions using a Mathematica package we developed. Further development of this OPE technique should lead to more efficient calculations for the D1D5 CFT perturbed away from the orbifold point.

  1. Reciprocating Compressor 1D Thermofluid Dynamic Simulation: Problems and Comparison with Experimental Data

    Directory of Open Access Journals (Sweden)

    A. Gimelli

    2012-01-01

    Full Text Available The authors here extend a 0D-1D thermofluid dynamic simulation approach to describe the phenomena internal to the volumetric machines, reproducing pressure waves’ propagation in the ducts. This paper reports the first analysis of these phenomena in a reciprocating compressor. The first part presents a detailed experimental analysis of an open-type reciprocating compressor equipped with internal sensors. The second part describes a 0D-1D thermofluid dynamic simulation of the compressor. Comparison of computed and measured values of discharge mass flow rate shows a good agreement between results for compression ratio <5. Then, to improve the model fitting at higher pressures, a new scheme has been developed to predict the blow-by through the ring pack volumes. This model is based on a series of volumes and links which simulate the rings’ motions inside the grooves, while the ring dynamics are imposed using data from the literature about blow-by in internal combustion engines. The validation is obtained comparing experimental and computing data of the two cylinder engine blowby. After the validation, a new comparison of mass flow rate on the compressor shows a better fitting of the curves at higher compression ratio.

  2. Frequency graded 1D metamaterials: A study on the attenuation bands

    Science.gov (United States)

    Banerjee, Arnab; Das, Raj; Calius, Emilio P.

    2017-08-01

    Depending on the frequency, waves can either propagate (transmission band) or be attenuated (attenuation band) while travelling through a one-dimensional spring-mass chain with internal resonators. The literature on wave propagation through a 1D mass-in-mass chain is vast and continues to proliferate because of its versatile applicability in condensed matter physics, optics, chemistry, acoustics, and mechanics. However, in all these areas, a uniformly periodic arrangement of identical linear resonating units is normally used which limits the attenuation band to a narrow frequency range. To counter this limitation of linear uniformly periodic metamaterials, the attenuation bandwidth in a one-dimensional finite chain with frequency graded linear internal resonators are investigated in this paper. The result shows that a properly tuned frequency graded arrangement of resonating units can extend the upper part of the attenuation band of 1D metamaterial theoretically up to infinity and also increases the lower part of the attenuation bandwidth by around 40% of an equivalent uniformly periodic metamaterial without increasing the mass. Therefore, the frequency graded metamaterials can be a potential solution towards low frequency and wideband acoustic or vibration insulation. In addition, this paper provides analytical expressions for the attenuation and transmission frequency limits for a periodic mass-in-mass metamaterial and demonstrates the attenuation band is generated by the high absolute value of the effective mass not only due to the negative effective mass.

  3. A world-line framework for 1D topological conformal σ-models

    Science.gov (United States)

    Baulieu, L.; Holanda, N. L.; Toppan, F.

    2015-11-01

    We use world-line methods for pseudo-supersymmetry to construct sl(2|1)-invariant actions for the (2, 2, 0) chiral and (1, 2, 1) real supermultiplets of the twisted D-module representations of the sl(2|1) superalgebra. The derived one-dimensional topological conformal σ-models are invariant under nilpotent operators. The actions are constructed for both parabolic and hyperbolic/trigonometric realizations (with extra potential terms in the latter case). The scaling dimension λ of the supermultiplets defines a coupling constant, 2λ + 1, the free theories being recovered at λ = - /1 2 . We also present, generalizing previous works, the D-module representations of one-dimensional superconformal algebras induced by N = ( p , q ) pseudo-supersymmetry acting on (k, n, n - k) supermultiplets. Besides sl(2|1), we obtain the superalgebras A(1, 1), D(2, 1; α), D(3, 1), D(4, 1), A(2, 1) from (p, q) = (1, 1), (2, 2), (3, 3), (4, 4), (5, 1), at given k, n and critical values of λ.

  4. Modeling of subsurface structures in Telomoyo Volcano geothermal area, Magelang using 1-D magnetotelluric method

    Science.gov (United States)

    Sarjan, Achmad Fajar Narotama; Niasari, Sintia Windhi

    2017-07-01

    There are some of geothermal prospects around Java Island. One of them are located in Telomoyo Volcano area, Magelang, Central Java. The existence of hot spring manifestations in Telomoyo Volcano area shows the presence of geothermal system. The upflow zone of this geothermal system was formed in the caldera of Telomoyo Volcano area, while the outflow zone was formed around Candi Umbul. In addition, from the geological map shows a geological structure assumed as a normal fault with southwest-northeast orientation that was caused by the volcanic activity. The aim of this research is to give a brief introduction about subsurface resistivity beneath Telomoyo Volcano area using 1-D magnetotelluric forward model. Thus, we can determine the possibility of data that will obtained during the acquisition process based on the geological model that was made. The apparent resistivity, phase, and period values were obtained from the forward modeling process. The result from this study is a 1-D resistivity section with synthetics curves of each geothermal model. In each model the presence of clay cap characterized by a low resistivity layer. A layer below the clay cap with a medium resistivity value interpreted as the reservoir of this geothermal system. The heat source of this geothermal area is characterized by a low resistivity that is located at depth 4000-5500m. This study is still in progress to acquire the exact values of resistivity from each layer from the field data acquisition in Telomoyo Volcano area, Magelang.

  5. Developing a 1D ``like'' performance basecamp for beryllium capsule implosions

    Science.gov (United States)

    Kline, John; Yi, Austin; Loomis, Eric; Simakov, Andrei; Kyrala, George; Wilson, Doub; Dewald, Eddie; Ralph, Joe; Strozzi, David

    2016-10-01

    Experiments with Beryllium capsules in high density gas filled targets showed little difference in performance with respect to CH or HDC capsules. The hypothesis for the lack of performance difference is attributed to poor control of symmetry based on work by Clark et al. Going forward, the goal is to develop a target design that enables better comparisons between the performance of Be capsules and other ablators, as well as with simulations. To develop a platform in which Be capsules maximize performance with respect to 1D calculations, we have increased the case-to-capsule ratio and reduced the hohlraum drive. The stability properties of beryllium are expected to be accentuated at lower radiation temperature drives compared with other ablators. Experiments have been carried out with case-to-capasule ratio of 3.1 and 4.3. Results from these experiments are being used to develop an optimized case-to-capsule ratio to achieve controllable symmetric implosions with maximum 1D like performance. This presentation will focus on how results of the experiments are used to design the next series of optimized experiments..

  6. Modelling the water balance of irrigated fields in tropical floodplain soils using Hydrus-1D

    Science.gov (United States)

    Beyene, Abebech; Frankl, Amaury; Verhoest, Niko E. C.; Tilahun, Seifu; Alamirew, Tena; Adgo, Enyew; Nyssen, Jan

    2017-04-01

    Accurate estimation of evaporation, transpiration and deep percolation is crucial in irrigated agriculture and the sustainable management of water resources. Here, the Hydrus-1D process-based numerical model was used to estimate the actual transpiration, soil evaporation and deep percolation from irrigated fields of floodplain soils. Field experiments were conducted from Dec 2015 to May 2016 in a small irrigation scheme (50 ha) called 'Shina' located in the Lake Tana floodplains of Ethiopia. Six experimental plots (three for onion and three for maize) were selected along a topographic transect to account for soil and groundwater variability. Irrigation amount (400 to 550 mm during the growing period) was measured using V-notches installed at each plot boundary and daily groundwater levels were measured manually from piezometers. There was no surface runoff observed in the growing period and rainfall was measured using a manual rain gauge. All daily weather data required for the evapotranspiration calculation using Pen Man Monteith equation were collected from a nearby metrological station. The soil profiles were described for each field to include the vertical soil heterogeneity in the soil water balance simulations. The soil texture, organic matter, bulk density, field capacity, wilting point and saturated moisture content were measured for all the soil horizons. Soil moisture monitoring at 30 and 60 cm depths was performed. The soil hydraulic parameters for each horizon was estimated using KNN pedotransfer functions for tropical soils and were effectively fitted using the RETC program (R2= 0.98±0.011) for initial prediction. A local sensitivity analysis was performed to select and optimize the most important hydraulic parameters for soil water flow in the unsaturated zone. The most sensitive parameters were saturated hydraulic conductivity (Ks), saturated moisture content (θs) and pore size distribution (n). Inverse modelling using Hydrus-1D further optimized

  7. Discovery of TBC1D1 as an insulin-, AICAR-, and contraction-stimulated signaling nexus in mouse skeletal muscle.

    Science.gov (United States)

    Taylor, Eric B; An, Ding; Kramer, Henning F; Yu, Haiyan; Fujii, Nobuharu L; Roeckl, Katja S C; Bowles, Nicole; Hirshman, Michael F; Xie, Jianxin; Feener, Edward P; Goodyear, Laurie J

    2008-04-11

    The Akt substrate of 160 kDa (AS160) is phosphorylated on Akt substrate (PAS) motifs in response to insulin and contraction in skeletal muscle, regulating glucose uptake. Here we discovered a dissociation between AS160 protein expression and apparent AS160 PAS phosphorylation among soleus, tibialis anterior, and extensor digitorum longus muscles. Immunodepletion of AS160 in tibialis anterior muscle lysates resulted in minimal depletion of the PAS band at 160 kDa, suggesting the presence of an additional PAS immunoreactive protein. By immunoprecipitation and mass spectrometry, we identified this protein as the AS160 paralog TBC1D1, an obesity candidate gene regulating GLUT4 translocation in adipocytes. TBC1D1 expression was severalfold higher in skeletal muscles compared with all other tissues and was the dominant protein detected by the anti-PAS antibody at 160 kDa in tibialis anterior and extensor digitorum longus but not soleus muscles. In vivo stimulation by insulin, contraction, and the AMP-activated protein kinase (AMPK) activator AICAR increased TBC1D1 PAS phosphorylation. Using mass spectrometry on TBC1D1 from mouse skeletal muscle, we identified several novel phosphorylation sites on TBC1D1 and found the majority were consensus or near consensus sites for AMPK. Semiquantitative analysis of spectra suggested that AICAR caused greater overall phosphorylation of TBC1D1 sites compared with insulin. Purified Akt and AMPK phosphorylated TBC1D1 in vitro, and AMPK, but not Akt, reduced TBC1D1 electrophoretic mobility. TBC1D1 is a major PAS immunoreactive protein in skeletal muscle that is phosphorylated in vivo by insulin, AICAR, and contraction. Both Akt and AMPK phosphorylate TBC1D1, but AMPK may be the more robust regulator.

  8. Crystal Structures of Human TBC1D1 and TBC1D4 (AS160) RabGTPase-activating Protein (RabGAP) Domains Reveal Critical Elements for GLUT4 Translocation

    Energy Technology Data Exchange (ETDEWEB)

    S Park; W Jin; S Shoelson

    2011-12-31

    We have solved the x-ray crystal structures of the RabGAP domains of human TBC1D1 and human TBC1D4 (AS160), at 2.2 and 3.5 {angstrom} resolution, respectively. Like the yeast Gyp1p RabGAP domain, whose structure was solved previously in complex with mouse Rab33B, the human TBC1D1 and TBC1D4 domains both have 16 {alpha}-helices and no {beta}-sheet elements. We expected the yeast Gyp1p RabGAP/mouse Rab33B structure to predict the corresponding interfaces between cognate mammalian RabGAPs and Rabs, but found that residues were poorly conserved. We further tested the relevance of this model by Ala-scanning mutagenesis, but only one of five substitutions within the inferred binding site of the TBC1D1 RabGAP significantly perturbed catalytic efficiency. In addition, substitution of TBC1D1 residues with corresponding residues from Gyp1p did not enhance catalytic efficiency. We hypothesized that biologically relevant RabGAP/Rab partners utilize additional contacts not described in the yeast Gyp1p/mouse Rab33B structure, which we predicted using our two new human TBC1D1 and TBC1D4 structures. Ala substitution of TBC1D1 Met{sup 930}, corresponding to a residue outside of the Gyp1p/Rab33B contact, substantially reduced catalytic activity. GLUT4 translocation assays confirmed the biological relevance of our findings. Substitutions with lowest RabGAP activity, including catalytically dead RK and Met{sup 930} and Leu{sup 1019} predicted to perturb Rab binding, confirmed that biological activity requires contacts between cognate RabGAPs and Rabs beyond those in the yeast Gyp1p RabGAP/mouse Rab33B structure.

  9. Structural and population-based evaluations of TBC1D1 p.Arg125Trp.

    Directory of Open Access Journals (Sweden)

    Tom G Richardson

    Full Text Available Obesity is now a leading cause of preventable death in the industrialised world. Understanding its genetic influences can enhance insight into molecular pathogenesis and potential therapeutic targets. A non-synonymous polymorphism (rs35859249, p.Arg125Trp in the N-terminal TBC1D1 phosphotyrosine-binding (PTB domain has shown a replicated association with familial obesity in women. We investigated these findings in the Avon Longitudinal Study of Parents and Children (ALSPAC, a large European birth cohort of mothers and offspring, and by generating a predicted model of the structure of this domain. Structural prediction involved the use of three separate algorithms; Robetta, HHpred/MODELLER and I-TASSER. We used the transmission disequilibrium test (TDT to investigate familial association in the ALSPAC study cohort (N = 2,292 mother-offspring pairs. Linear regression models were used to examine the association of genotype with mean measurements of adiposity (Body Mass Index (BMI, waist circumference and Dual-energy X-ray absorptiometry (DXA assessed fat mass, and logistic regression was used to examine the association with odds of obesity. Modelling showed that the R125W mutation occurs in a location of the TBC1D1 PTB domain that is predicted to have a function in a putative protein:protein interaction. We did not detect an association between R125W and BMI (mean per allele difference 0.27 kg/m(2 (95% Confidence Interval: 0.00, 0.53 P = 0.05 or obesity (odds ratio 1.01 (95% Confidence Interval: 0.77, 1.31, P = 0.96 in offspring after adjusting for multiple comparisons. Furthermore, there was no evidence to suggest that there was familial association between R125W and obesity (χ(2 = 0.06, P = 0.80. Our analysis suggests that R125W in TBC1D1 plays a role in the binding of an effector protein, but we find no evidence that the R125W variant is related to mean BMI or odds of obesity in a general population sample.

  10. Dynamics of the gas-liquid interfacial reaction of O(1D) with a liquid hydrocarbon.

    Science.gov (United States)

    Waring, Carla; King, Kerry L; Costen, Matthew L; McKendrick, Kenneth G

    2011-06-30

    The dynamics of the gas-liquid interfacial reaction of the first electronically excited state of the oxygen atom, O((1)D), with the surface of a liquid hydrocarbon, squalane (C(30)H(62); 2,6,10,15,19,23-hexamethyltetracosane) has been studied experimentally. Translationally hot O((1)D) atoms were generated by 193 nm photolysis of a low pressure (nominally 1 mTorr) of N(2)O a short distance (mean = 6 mm) above a continually refreshed liquid squalane surface. Nascent OH (X(2)Π, v' = 0) reaction products were detected by laser-induced fluorescence (LIF) on the OH A(2)Σ(+)-X(2)Π (1,0) band at the same distance above the surface. The speed distribution of the recoiling OH was characterized by measuring the appearance profiles as a function of photolysis-probe delay for selected rotational levels, N'. The rotational (and, partially, fine-structure) state distributions were also measured by recording LIF excitation spectra at selected photolysis-probe delays. The OH v' = 0 rotational distribution is bimodal and can be empirically decomposed into near thermal (~300 K) and much hotter (~6000 K) Boltzmann-temperature components. There is a strong positive correlation between rotational excitation and translation energy. However, the colder rotational component still represents a significant fraction (~30%) of the fastest products, which have substantially superthermal speeds. We estimate an approximate upper limit of 3% for the quantum yield of OH per O((1)D) atom that collides with the surface. By comparison with established mechanisms for the corresponding reactions in the gas phase, we conclude that the rotationally and translationally hot products are formed via a nonstatistical insertion mechanism. The rotationally cold but translationally hot component is most likely produced by direct abstraction. Secondary collisions at the liquid surface of products of either of the previous two mechanisms are most likely responsible for the rotationally and translationally cold

  11. 1D coordination polymers with polychalcogenides as linkers between metal atoms

    Energy Technology Data Exchange (ETDEWEB)

    Kysliak, Oleksandr; Beck, Johannes, E-mail: j.beck@uni-bonn.de

    2013-07-15

    The reactions of zinc metal with elemental selenium and selenium/sulfur mixtures in liquid ammonia or methylamine under solvothermal conditions in closed glass ampoules at 50 °C lead within some days specifically to [Zn(NH{sub 3}){sub 2}Se{sub 4}]{sub n} (1), [Zn(MeNH{sub 2}){sub 2}Se{sub 4}]{sub n} (2), [Zn(NH{sub 3}){sub 2}Se{sub 2.23}S{sub 1.77}]{sub n} (3). From MnCl{sub 2}, Rb{sub 2}Se and excess Se in n-butylamine [Mn({sup n}BuNH{sub 2}){sub 4}Se{sub 6}]{sub n} (4) is obtained after prolonged reaction time at ambient temperature. The compounds are sensitive towards air and loss of NH{sub 3} or the amine ligands. The crystal structures were determined by single crystal diffraction at low temperatures. As a common structural feature, all compounds represent 1D coordination polymers with polychalcogenide chains as linkers between the metal atoms and consist of infinite [M–Ch{sub m}–]{sub n} chains (M=Zn, Mn; Ch{sub m}=Se{sub 4}, (S/Se){sub 4}, Se{sub 6}). The Zn central atoms in 1–3 have tetrahedral coordination with two amine ligands, the Mn atoms in 4 have octahedral coordination with four amine ligands and cis position of the two Se atoms. Raman spectra of 1–3 show the stretching mode vibrations of the Ch{sub 4} groups. The observation of S–S, S–Se, and Se–Se vibration bands in the spectrum of 3 indicates the presence of mixed S/Se polyanions. An optical band gap of 1.86(5) eV was determined for 2 by diffuse reflectance spectroscopy. - Graphical abstract: The reaction of Zn and Se in liquid methylamine yields dark red [Zn(NH{sub 2}CH{sub 3})Se{sub 4}], a 1D coordination polymer consisting of helical Zn–Se{sub 4}–Zn– chains. - Highlights: • A series of 1D coordination polymers consisting of metal amine complexes concatenated by polychalcogenide ions is presented. • Syntheses were performed as solvothermal reactions in liquid ammonia, liquid methylamine and n-butylamine. • Crystal structures are dominated by helices [M–Ch{sub m

  12. Higher-order local and non-local correlations for 1D strongly interacting Bose gas

    Science.gov (United States)

    Nandani, EJKP; Römer, Rudolf A.; Tan, Shina; Guan, Xi-Wen

    2016-05-01

    The correlation function is an important quantity in the physics of ultracold quantum gases because it provides information about the quantum many-body wave function beyond the simple density profile. In this paper we first study the M-body local correlation functions, g M , of the one-dimensional (1D) strongly repulsive Bose gas within the Lieb-Liniger model using the analytical method proposed by Gangardt and Shlyapnikov (2003 Phys. Rev. Lett. 90 010401; 2003 New J. Phys. 5 79). In the strong repulsion regime the 1D Bose gas at low temperatures is equivalent to a gas of ideal particles obeying the non-mutual generalized exclusion statistics with a statistical parameter α =1-2/γ , i.e. the quasimomenta of N strongly interacting bosons map to the momenta of N free fermions via {k}i≈ α {k}iF with i=1,\\ldots ,N. Here γ is the dimensionless interaction strength within the Lieb-Liniger model. We rigorously prove that such a statistical parameter α solely determines the sub-leading order contribution to the M-body local correlation function of the gas at strong but finite interaction strengths. We explicitly calculate the correlation functions g M in terms of γ and α at zero, low, and intermediate temperatures. For M = 2 and 3 our results reproduce the known expressions for g 2 and g 3 with sub-leading terms (see for instance (Vadim et al 2006 Phys. Rev. A 73 051604(R); Kormos et al 2009 Phys. Rev. Lett. 103 210404; Wang et al 2013 Phys. Rev. A 87 043634). We also express the leading order of the short distance non-local correlation functions x}1)\\cdots {{{\\Psi }}}\\dagger ({x}M){{\\Psi }}({y}M)\\cdots {{\\Psi }}({y}1)> of the strongly repulsive Bose gas in terms of the wave function of M bosons at zero collision energy and zero total momentum. Here {{\\Psi }}(x) is the boson annihilation operator. These general formulas of the higher-order local and non-local correlation functions of the 1D Bose gas provide new insights into the many-body physics.

  13. Retinoic acid regulates CD1d gene expression at the transcriptional level in human and rodent monocytic cells.

    Science.gov (United States)

    Chen, Qiuyan; Ross, A Catharine

    2007-04-01

    CD1d belongs to a group of nonclassical antigen-presenting molecules that present glycolipid antigens and thereby activate natural killer T (NKT) cells, a subset of bifunctional T cells. Little is known so far regarding the expression and physiologic regulation of CD1d. Here we show that all-trans-retinoic acid (RA), the active metabolite of vitamin A, rapidly (1 hr after treatment) increases CD1d mRNA in human and rodent monocytic cells at a physiologic dose (10 nM). The induction is RA specific and RA receptor (RAR) dependent-RA and an RARalpha agonist, Am580, both had a pronounced positive effect, whereas the addition of RARalpha antagonist partially blocked the increase in CD1d mRNA induced by RA and Am580. The induction was also completely blocked by the presence of actinomycin D. A putative RA-response element was identified in the distal 5' flanking region of the CD1d gene, which binds nuclear retinoid receptors and was responsive to RA in both gel mobility shift assay and transient transfection assay in THP-1 cells. These results further confirmed the transcriptional regulation of RA in CD1d gene expression. Moreover, RA significantly increased alpha-galactosylceramide-induced spleen cell proliferation. These studies together provide evidence for a previously unknown mechanism of CD1d gene expression regulation by RA and suggest that RA is a significant modulator of NKT cell activation.

  14. Lysophospholipid presentation by CD1d and recognition by a human Natural Killer T-cell receptor

    Energy Technology Data Exchange (ETDEWEB)

    López-Sagaseta, Jacinto; Sibener, Leah V.; Kung, Jennifer E.; Gumperz, Jenny; Adams, Erin J. (UC); (UW-MED)

    2014-10-02

    Invariant Natural Killer T (iNKT) cells use highly restricted {alpha}{beta} T cell receptors (TCRs) to probe the repertoire of lipids presented by CD1d molecules. Here, we describe our studies of lysophosphatidylcholine (LPC) presentation by human CD1d and its recognition by a native, LPC-specific iNKT TCR. Human CD1d presenting LPC adopts an altered conformation from that of CD1d presenting glycolipid antigens, with a shifted {alpha}1 helix resulting in an open A pocket. Binding of the iNKT TCR requires a 7-{angstrom} displacement of the LPC headgroup but stabilizes the CD1d-LPC complex in a closed conformation. The iNKT TCR CDR loop footprint on CD1d-LPC is anchored by the conserved positioning of the CDR3{alpha} loop, whereas the remaining CDR loops are shifted, due in part to amino-acid differences in the CDR3{beta} and J{beta} segment used by this iNKT TCR. These findings provide insight into how lysophospholipids are presented by human CD1d molecules and how this complex is recognized by some, but not all, human iNKT cells.

  15. Application of OpenMP to Wireline Triaxial Induction Logging in 1D Layered Anisotropic Medium

    Directory of Open Access Journals (Sweden)

    Zhijuan Zhang

    2012-01-01

    Full Text Available Efficient and accurate forward modeling of logging tool responses is essential for data inversion in the log data interpretation in both real time and postprocessing. With the aggressive advancement of various high-performance computing techniques and computer hardware technology, it is possible to significantly improve the efficiency of the forward modeling. In this paper, we apply OpenMP to parallelize the simulation of triaxial induction logging tools in 1D multilayered anisotropic formation. The parallel process is explained in detail and numerical examples are presented to demonstrate the effect of the parallel programming. Comparison of the original code and the parallel code shows that the latter is much faster without loss of accuracy, which is very promising for future real-time inversion.

  16. Initial Stage of the Microwave Ionization Wave Within a 1D Model

    Science.gov (United States)

    Semenov, V. E.; Rakova, E. I.; Glyavin, M. Yu.; Nusinovich, G. S.

    2016-05-01

    The dynamics of the microwave breakdown in a gas is simulated numerically within a simple 1D model which takes into account such processes as the impact ionization of gas molecules, the attachment of electrons to neutral molecules, and plasma diffusion. Calculations are carried out for different spatial distributions of seed electrons with account for reflection of the incident electromagnetic wave from the plasma. The results reveal considerable dependence of the ionization wave evolution on the relation between the field frequency and gas pressure, as well as on the existence of extended rarefied halo of seed electrons. At relatively low gas pressures (or high field frequencies), the breakdown process is accompanied by the stationary ionization wave moving towards the incident electromagnetic wave. In the case of a high gas pressure (or a relatively low field frequency), the peculiarities of the breakdown are associated with the formation of repetitive jumps of the ionization front.

  17. Fluid friction and wall viscosity of the 1D blood flow model

    CERN Document Server

    Wang, Xiao-Fei; Matsukawa, Mami; Ghigo, Arthur; Lagrée, Pierre-Yves; Fullana, Jose-Maria

    2015-01-01

    We study the behavior of the pulse waves of water into a flexible tube for application to blood flow simulations. In pulse waves both fluid friction and wall viscosity are damping factors, and difficult to evaluate separately. In this paper, the coefficients of fluid friction and wall viscosity are estimated by fitting a nonlinear 1D flow model to experimental data. In the experimental setup, a distensible tube is connected to a piston pump at one end and closed at another end. The pressure and wall displacements are measured simultaneously. A good agreement between model predictions and experiments was achieved. For amplitude decrease, the effect of wall viscosity on the pulse wave has been shown as important as that of fluid viscosity.

  18. Quantum phase transition of light in a 1-D photon-hopping-controllable resonator array

    CERN Document Server

    Wu, Chun-Wang; Deng, Zhi-Jiao; Dai, Hong-Yi; Chen, Ping-Xing; Li, Cheng-Zu

    2011-01-01

    We give a concrete experimental scheme for engineering the insulator-superfluid transition of light in a one-dimensional (1-D) array of coupled superconducting stripline resonators. In our proposed architecture, the on-site interaction and the photon hopping rate can be tuned independently by adjusting the transition frequencies of the charge qubits inside the resonators and at the resonator junctions, respectively, which permits us to systematically study the quantum phase transition of light in a complete parameter space. By combining the techniques of photon-number-dependent qubit transition and fast read-out of the qubit state using a separate low-Q resonator mode, the statistical property of the excitations in each resonator can be obtained with a high efficiency. An analysis of the various decoherence sources and disorders shows that our scheme can serve as a guide to coming experiments involving a small number of coupled resonators.

  19. Quantum propagation and confinement in 1D systems using the transfer-matrix method

    Science.gov (United States)

    Pujol, Olivier; Carles, Robert; Pérez, José-Philippe

    2014-05-01

    The aim of this article is to provide some Matlab scripts to the teaching community in quantum physics. The scripts are based on the transfer-matrix formalism and offer a very efficient and versatile tool to solve problems of a physical object (electron, proton, neutron, etc) with one-dimensional (1D) stationary potential energy. Resonant tunnelling through a multiple-barrier or confinement in wells of various shapes is particularly analysed. The results are quantitatively discussed with semiconductor heterostructures, harmonic and anharmonic molecular vibrations, or neutrons in a gravity field. Scripts and other examples (hydrogen-like ions and transmission by a smooth variation of potential energy) are available freely at http://www-loa.univ-lille1.fr/˜pujol in three languages: English, French and Spanish.

  20. Efficient transparent thin dye solar cells based on highly porous 1D photonic crystals

    Energy Technology Data Exchange (ETDEWEB)

    Colodrero, Silvia; Lopez-Lopez, Carmen; Miguez, Hernan [Instituto de Ciencia de Materiales de Sevilla (CSIC-US), Centro de Investigaciones Cientificas Isla de la Cartuja, C/Americo Vespucio 49, 41092 Sevilla (Spain); Forneli, Amparo; Pelleja, Laia [Institute of Chemical Research of Catalonia (ICIQ) Avda., Paisos Catalans 16, 43007 Tarragona (Spain); Palomares, Emilio [Institute of Chemical Research of Catalonia (ICIQ) Avda., Paisos Catalans 16, 43007 Tarragona (Spain); Institucio Catalana de Recerca i Estudis Avancats (ICREA), Avda. Lluis Companys 23, 08010 Barcelona (Spain)

    2012-03-21

    A working electrode design based on a highly porous 1D photonic crystal structure that opens the path towards high photocurrents in thin, transparent, dye-sensitized solar cells is presented. By enlarging the average pore size with respect to previous photonic crystal designs, the new working electrode not only increases the device photocurrent, as predicted by theoretical models, but also allows the observation of an unprecedented boost of the cell photovoltage, which can be attributed to structural modifications caused during the integration of the photonic crystal. These synergic effects yield conversion efficiencies of around 3.5% by using just 2 {mu}m thick electrodes, with enhancements between 100% and 150% with respect to reference cells of the same thickness. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)