WorldWideScience

Sample records for caes

  1. CAES Annual Report FY 2011

    Energy Technology Data Exchange (ETDEWEB)

    Kortny Rolston

    2011-10-01

    The Center for Advanced Energy Studies was created to lead research programs important to the nation, attract students and faculty to the Idaho universities and act as a catalyst for technology-based economic development. CAES is striving to meet those goals by continuing to develop its infrastructure and equipment capabilities, expand its research portfolio and bolster Idaho's energy workforce. This Annual Report details the progress CAES made in FY 2011 toward fulfilling its research, education and economic development missions.

  2. Future perspectives on automotive CAE

    NARCIS (Netherlands)

    Bensler, Henry; Eller, Tom; Kabat vel Job, Alexander; Magoulas, Nikolaos; Yigit, Emrah; Van Tongeren, A.

    2014-01-01

    Computer Aided Engineering (CAE) is an integral part of today’s automotive design process. Very often OEM’s rely solely on software vendors to provide appropriate solutions. On the other hand, some companies still use in-house developed software for specific applications. It is, however, a

  3. Seneca Compressed Air Energy Storage (CAES) Project

    Energy Technology Data Exchange (ETDEWEB)

    None

    2012-11-30

    This document provides specifications for the process air compressor for a compressed air storage project, requests a budgetary quote, and provides supporting information, including compressor data, site specific data, water analysis, and Seneca CAES value drivers.

  4. Seneca Compressed Air Energy Storage (CAES) Project

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2012-11-30

    Compressed Air Energy Storage (CAES) is a hybrid energy storage and generation concept that has many potential benefits especially in a location with increasing percentages of intermittent wind energy generation. The objectives of the NYSEG Seneca CAES Project included: for Phase 1, development of a Front End Engineering Design for a 130MW to 210 MW utility-owned facility including capital costs; project financials based on the engineering design and forecasts of energy market revenues; design of the salt cavern to be used for air storage; draft environmental permit filings; and draft NYISO interconnection filing; for Phase 2, objectives included plant construction with a target in-service date of mid-2016; and for Phase 3, objectives included commercial demonstration, testing, and two-years of performance reporting. This Final Report is presented now at the end of Phase 1 because NYSEG has concluded that the economics of the project are not favorable for development in the current economic environment in New York State. The proposed site is located in NYSEG’s service territory in the Town of Reading, New York, at the southern end of Seneca Lake, in New York State’s Finger Lakes region. The landowner of the proposed site is Inergy, a company that owns the salt solution mining facility at this property. Inergy would have developed a new air storage cavern facility to be designed for NYSEG specifically for the Seneca CAES project. A large volume, natural gas storage facility owned and operated by Inergy is also located near this site and would have provided a source of high pressure pipeline quality natural gas for use in the CAES plant. The site has an electrical take-away capability of 210 MW via two NYSEG 115 kV circuits located approximately one half mile from the plant site. Cooling tower make-up water would have been supplied from Seneca Lake. NYSEG’s engineering consultant WorleyParsons Group thoroughly evaluated three CAES designs and concluded that any

  5. Seneca Compressed Air Energy Storage (CAES) Project

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2012-11-30

    This report provides a review and an analysis of potential environmental justice areas that could be affected by the New York State Electric & Gas (NYSEG) compress air energy storage (CAES) project and identifies existing environmental burden conditions on the area and evaluates additional burden of any significant adverse environmental impact. The review assesses the socioeconomic and demographic conditions of the area surrounding the proposed CAES facility in Schuyler County, New York. Schuyler County is one of 62 counties in New York. Schuyler County’s 2010 population of 18,343 makes it one of the least populated counties in the State (U.S. Census Bureau, 2010). This report was prepared for WorleyParsons by ERM and describes the study area investigated, methods and criteria used to evaluate this area, and the findings and conclusions from the evaluation.

  6. Investigation of IGES for CAD/CAE data transfer

    Science.gov (United States)

    Zobrist, George W.

    1989-01-01

    In a CAD/CAE facility there is always the possibility that one may want to transfer the design graphics database from the native system to a non-native system. This may occur because of dissimilar systems within an organization or a new CAD/CAE system is to be purchased. The Initial Graphics Exchange Specification (IGES) was developed in an attempt to solve this scenario. IGES is a neutral database format into which the CAD/CAE native database format can be translated to and from. Translating the native design database format to IGES requires a pre-processor and transling from IGES to the native database format requires a post-processor. IGES is an artifice to represent CAD/CAE product data in a neutral environment to allow interfacing applications, archive the database, interchange of product data between dissimilar CAD/CAE systems, and other applications. The intent here is to present test data on translating design product data from a CAD/CAE system to itself and to translate data initially prepared in IGES format to various native design formats. This information can be utilized in planning potential procurement and developing a design discipline within the CAD/CAE community.

  7. Solid modeling and applications rapid prototyping, CAD and CAE theory

    CERN Document Server

    Um, Dugan

    2016-01-01

    The lessons in this fundamental text equip students with the theory of Computer Assisted Design (CAD), Computer Assisted Engineering (CAE), the essentials of Rapid Prototyping, as well as practical skills needed to apply this understanding in real world design and manufacturing settings. The book includes three main areas: CAD, CAE, and Rapid Prototyping, each enriched with numerous examples and exercises. In the CAD section, Professor Um outlines the basic concept of geometric modeling, Hermite and Bezier Spline curves theory, and 3-dimensional surface theories as well as rendering theory. The CAE section explores mesh generation theory, matrix notion for FEM, the stiffness method, and truss Equations. And in Rapid Prototyping, the author illustrates stereo lithographic theory and introduces popular modern RP technologies. Solid Modeling and Applications: Rapid Prototyping, CAD and CAE Theory is ideal for university students in various engineering disciplines as well as design engineers involved in product...

  8. Center for Advanced Energy Studies (CAES) Strategic Plan

    Energy Technology Data Exchange (ETDEWEB)

    Kevin Kostelnik; Keith Perry

    2007-07-01

    Twenty-first century energy challenges include demand growth, national energy security, and global climate protection. The Center for Advanced Energy Studies (CAES) is a public/private partnership between the State of Idaho and its academic research institutions, the federal government through the U.S. Department of Energy (DOE) and the Idaho National Laboratory (INL) managed by the Battelle Energy Alliance (BEA). CAES serves to advance energy security for our nation by expanding the educational opportunities at the Idaho universities in energy-related areas, creating new capabilities within its member institutions, and delivering technological innovations leading to technology-based economic development for the intermountain region. CAES has developed this strategic plan based on the Balanced Scorecard approach. A Strategy Map (Section 7) summarizes the CAES vision, mission, customers, and strategic objectives. Identified strategic objectives encompass specific outcomes related to three main areas: Research, Education, and Policy. Technical capabilities and critical enablers needed to support these objectives are also identified. This CAES strategic plan aligns with and supports the strategic objectives of the four CAES institutions. Implementation actions are also presented which will be used to monitor progress towards fulfilling these objectives.

  9. Acoustic performance of industrial mufflers with CAE modeling and simulation

    Directory of Open Access Journals (Sweden)

    Jeon Soohong

    2014-12-01

    Full Text Available This paper investigates the noise transmission performance of industrial mufflers widely used in ships based on the CAE modeling and simulation. Since the industrial mufflers have very complicated internal structures, the conventional Transfer Matrix Method (TMM is of limited use. The CAE modeling and simulation is therefore required to incorporate commercial softwares: CATIA for geometry modeling, MSC/PATRAN for FE meshing and LMS/ SYSNOISE for analysis. Main sources of difficulties in this study are led by complicated arrangement of reactive elements, perforated walls and absorption materials. The reactive elements and absorbent materials are modeled by applying boundary conditions given by impedance. The perforated walls are modeled by applying the transfer impedance on the duplicated node mesh. The CAE approach presented in this paper is verified by comparing with the theoretical solution of a concentric-tube resonator and is applied for industrial mufflers.

  10. Acoustic performance of industrial mufflers with CAE modeling and simulation

    Science.gov (United States)

    Jeon, Soohong; Kim, Daehwan; Hong, Chinsuk; Jeong, Weuibong

    2014-12-01

    This paper investigates the noise transmission performance of industrial mufflers widely used in ships based on the CAE modeling and simulation. Since the industrial mufflers have very complicated internal structures, the conventional Transfer Matrix Method (TMM) is of limited use. The CAE modeling and simulation is therefore required to incorporate commercial softwares: CATIA for geometry modeling, MSC/PATRAN for FE meshing and LMS/ SYSNOISE for analysis. Main sources of difficulties in this study are led by complicated arrangement of reactive elements, perforated walls and absorption materials. The reactive elements and absorbent materials are modeled by applying boundary conditions given by impedance. The perforated walls are modeled by applying the transfer impedance on the duplicated node mesh. The CAE approach presented in this paper is verified by comparing with the theoretical solution of a concentric-tube resonator and is applied for industrial mufflers.

  11. Acoustic performance of industrial mufflers with CAE modeling and simulation

    Directory of Open Access Journals (Sweden)

    Soohong Jeon

    2014-12-01

    Full Text Available This paper investigates the noise transmission performance of industrial mufflers widely used in ships based on the CAE modeling and simulation. Since the industrial mufflers have very complicated internal structures, the conventional Transfer Matrix Method (TMM is of limited use. The CAE modeling and simulation is therefore required to incorporate commercial softwares: CATIA for geometry modeling, MSC/PATRAN for FE meshing and LMS/SYSNOISE for analysis. Main sources of difficulties in this study are led by complicated arrangement of reactive ele- ments, perforated walls and absorption materials. The reactive elements and absorbent materials are modeled by applying boundary conditions given by impedance. The perforated walls are modeled by applying the transfer impedance on the duplicated node mesh. The CAE approach presented in this paper is verified by comparing with the theoretical solution of a concentric-tube resonator and is applied for industrial mufflers.

  12. Design and operation of the emergency support center, CAE; Diseno y explotacion del centro de apoyo en emergencias, CAE

    Energy Technology Data Exchange (ETDEWEB)

    Caro, R. J.; Lopez Trillo, E.

    2016-08-01

    The enhancements developed in Spain in the area of Emergency Management, as consequence of the accident at the Fukushima Dai-Ichi NPP in 2011, included the definition of new emergency response centers; Alternative Center for Emergency Management (CAGE) on each NPP and the Emergency Support Center (CAE), shared by all NPPs. This article summarizes the main features and operation activities undertaken since the establishment of the new CAE, centralized, external to the NPPs shared by all Spanish plants and managed by Tecnatom. (Author)

  13. Compressed air energy storage (CAES) - possibilities in Denmark

    DEFF Research Database (Denmark)

    Elmegaard, Brian; Szameitat, Nicklas; Brix, Wiebke

    2005-01-01

    Through a systematic development of the Danish electrical supply system with wind power and CHP, problems with stability and electricity surplus have appeared. Therefore, the possibilities for profitably implementing a CAES plant for energy storage, peak shaving and electricity surplus reduction ...

  14. Producao de pneumotorax em caes e manejo por toracoscopia paraxifoide transdiafragmatica

    National Research Council Canada - National Science Library

    Pigatto, Juliana; Veloso Brun, Mauricio; Gil Bracellos, Leonardo Jose; Falkenberg Rausch, Stella; Heinze Phol, Virginia; Scussel Feranti, Joao Pedro; Luizari Guedes, Rogerio

    2008-01-01

    O presente estudo foi desenvolvido com o objetivo de avaliar a tecnica de toracoscopia paraxifoide transdiafragmatica no diagnostico e no tratamento do pneumotorax produzido experimentalmente em caes...

  15. Automated knowledge base development from CAD/CAE databases

    Science.gov (United States)

    Wright, R. Glenn; Blanchard, Mary

    1988-01-01

    Knowledge base development requires a substantial investment in time, money, and resources in order to capture the knowledge and information necessary for anything other than trivial applications. This paper addresses a means to integrate the design and knowledge base development process through automated knowledge base development from CAD/CAE databases and files. Benefits of this approach include the development of a more efficient means of knowledge engineering, resulting in the timely creation of large knowledge based systems that are inherently free of error.

  16. Optimal operation strategies of compressed air energy storage (CAES) on electricity spot markets with fluctuating prices

    DEFF Research Database (Denmark)

    Lund, Henrik; Salgi, Georges; Elmegaard, Brian

    2009-01-01

    Compressed air energy storage (CAES) technologies can be used for load levelling in the electricity supply and are therefore often considered for future energy systems with a high share of fluctuating renewable energy sources, such as e.g. wind power. In such systems, CAES plants will often operate...

  17. Characteristics study of the gears by the CAD/CAE

    Science.gov (United States)

    Wang, P. Y.; Chang, S. L.; Lee, B. Y.; Nguyen, D. H.; Cao, C. W.

    2017-09-01

    Gears are the most important transmission component in machines. The rapid development of the machines in industry requires a shorter time of the analysis process. In traditional, the gears are analyzed by setting up the complete mathematical model firstly, considering the profile of cutter and coordinate systems relationship between the machine and the cutter. It is a really complex and time-consuming process. Recently, the CAD/CAE software is well developed and useful in the mechanical design. In this paper, the Autodesk Inventor® software is introduced to model the spherical gears firstly, and then the models can also be transferred into ANSYS Workbench for the finite element analysis. The proposed process in this paper is helpful to the engineers to speed up the analyzing process of gears in the design stage.

  18. CAD and CAE Analysis for Siphon Jet Toilet

    Science.gov (United States)

    Wang, Yuhua; Xiu, Guoji; Tan, Haishu

    The high precision 3D laser scanner with the dual CCD technology was used to measure the original design sample of a siphon jet toilet. The digital toilet model was constructed from the cloud data measured with the curve and surface fitting technology and the CAD/CAE systems. The Realizable k - ɛ double equation model of the turbulence viscosity coefficient method and the VOF multiphase flow model were used to simulate the flushing flow in the toilet digital model. Through simulating and analyzing the distribution of the flushing flow's total pressure, the flow speed at the toilet-basin surface and the siphoning bent tube, the toilet performance can be evaluated efficiently and conveniently. The method of "establishing digital model, flushing flow simulating, performances evaluating, function shape modifying" would provide a high efficiency approach to develop new water-saving toilets.

  19. CAE Based Die Face Engineering Development to Contribute to the Revitalization of the Tool & Die Industry

    Science.gov (United States)

    Tang, Arthur; Lee, Wing C.; St. Pierre, Shawn; He, Jeanne; Liu, Kesu; Chen, Chin C.

    2005-08-01

    Over the past two decades, the Computer Aided Engineering (CAE) tools have emerged as one of the most important engineering tools in various industries, due to its flexibility and accuracy in prediction. Nowadays, CAE tools are widely used in the sheet metal forming industry to predict the forming feasibility of a wide variety of complex components, ranging from aerospace and automotive components to household products. As the demand of CAE based formability accelerates, the need for a robust and streamlined die face engineering tool becomes more crucial, especially in the early stage when the tooling layout is not available, but a product design decision must be made. Ability to generate blank, binder and addendum surfaces with an appropriate layout of Drawbead, Punch Opening Line, Trim Line are the primary features and functions of a CAE based die face engineering tool. Once the die face layout is ready, a formability study should be followed to verify the die face layout is adequate to produce a formable part. If successful, the established die face surface should be exported back to the CAD/CAM environment to speed up the tooling and manufacturing design process with confidence that this particular part is formable with this given die face. With a CAE tool as described above, the tool & die industry will be greatly impacted as the processes will enable the bypass of hardware try-out and shorten the overall vehicle production timing. The trend has shown that OEMs and first tiers will source to low cost producers in the world which will have a negative impact to the traditional tool & die makers in the developed countries. CAE based tool as described should be adopted, along with many other solutions, in order to maintain efficiency of producing high quality product and meeting time-to-market requirements. This paper will describe how a CAE based die face engineering (DFE) tool could be further developed to enable the traditional tool & die makers to meet the

  20. Radionuclide Emission Estimation for the Center for Advanced Energy Studies (CAES)

    Energy Technology Data Exchange (ETDEWEB)

    Bradley J Schrader

    2010-02-01

    An Radiological Safety Analysis Computer Program (RSAC)-7 model dose assessment was performed to evaluate maximum Center for Advanced Energy Studies (CAES) boundary effective dose equivalent (EDE, in mrem/yr) for potential individual releases of radionuclides from the facility. The CAES is a public/private partnership between the State of Idaho and its academic research institutions, the federal government through the U.S. Department of Energy (DOE), and the Idaho National Laboratory (INL) managed by the Battelle Energy Alliance (BEA). CAES serves to advance energy security for our nation by expanding educational opportunities at Idaho universities in energy-related areas, creating new capabilities within its member institutions, and delivering technological innovations leading to technology-based economic development for the intermountain region. CAES has developed a strategic plan (INL/EXT-07-12950) based on the balanced scorecard approach. At the present time it is unknown exactly what processes will be used in the facility in support of this strategic plan. What is known is that the Idaho State University (ISU) Radioactive Materials License (Nuclear Regulatory Commission [NRC] license 11-27380-01) is the basis for handling radioactive material in the facility. The material in this license is shared between the ISU campus and the CAES facility. There currently are no agreements in place to limit the amount of radioactive material at the CAES facility or what is done to the material in the facility. The scope of this analysis is a summary look at the basis dose for each radionuclide included under the license at a distance of 100, 500, and 1,000 m. Inhalation, ingestion and ground surface dose was evaluated using the NRC design basis guidelines. The results can be used to determine a sum of the fractions approach to facility safety. This sum of the fractions allows a facility threshold value (TV) to be established and potential activities to be evaluated against

  1. APLICACIÓN DEL C.A.E. EN INGENIERÍA ESTRUCTURAL

    OpenAIRE

    Lima Calvo, Eduardo

    2011-01-01

    En este artículo se define el CAE (Computer Aided Engineering) o ingeniería asistida por computadora, y se exploran susdiferencias con el CAD y CAM. Se hace un recorrido desde los primeros intentos de las aplicaciones del CAE, hasta elmomento en que tanto las metodologías y algoritmos de cálculo, como el software y hardware disponibles se compaginaronpara ofrecer programas de cómputo verdaderamente amigables y funcionales. De entre estos programas se elige y revisauna marca específica de gran...

  2. Genetic programming and cae neural networks approach for prediction of the bending capability of ZnTiCu sheets

    OpenAIRE

    Turk, R.; Peruš, I.; Kovačič, M.; Kugler, G.; Terčelj, M.

    2008-01-01

    Genetic programming (GP) and CAE NN analysis have been applied for the prediction of bending capability of rolled ZnTiCu alloy sheet. Investigation revealed that an analysis with CAE NN is faster than GP but less accurate for lower amount of data. Both methods enable good assessment of separate influencing parameters in the complex system.

  3. Cuestionario de afrontamiento del estrés (CAE) : desarrollo y validación preliminar

    OpenAIRE

    Sandín, Bonifacio; Chorot, Paloma

    2003-01-01

    El Cuestionario de Afrontamiento del Estrés (CAE) es una medida de autoinforme diseñada para evaluar siete estilos básicos de afrontamiento: (1) focalizado en la solución del problema, (2) autofocalización negativa, (3) reevaluación positiva, (4) ex

  4. A Proposal of the Topology CAD and CAE Integrated System for the Next Generation

    Science.gov (United States)

    Yoshida, Yasuhiko; Shiiba, Eiji; Yamaguchi, Hiroshi

    3D-CAD system is needed for the Designing of plastic processing products that are required art-design. But the current use Boolean 3D-CAD system takes too match man-power of the operation, and design engineers can not use it directly. And this situation have made the degeneration of the design technology. We have developed the new topology-CAD system as next generation-CAD. Also the current CAE system has the same problems as CAD. And so, the design engineers depend on the out-source-technology. We have also developed the new genera- use-CAE system integrated in the Topology-CAD using particle analysis.

  5. Thermal System Analysis and Optimization of Large-Scale Compressed Air Energy Storage (CAES

    Directory of Open Access Journals (Sweden)

    Zhongguang Fu

    2015-08-01

    Full Text Available As an important solution to issues regarding peak load and renewable energy resources on grids, large-scale compressed air energy storage (CAES power generation technology has recently become a popular research topic in the area of large-scale industrial energy storage. At present, the combination of high-expansion ratio turbines with advanced gas turbine technology is an important breakthrough in energy storage technology. In this study, a new gas turbine power generation system is coupled with current CAES technology. Moreover, a thermodynamic cycle system is optimized by calculating for the parameters of a thermodynamic system. Results show that the thermal efficiency of the new system increases by at least 5% over that of the existing system.

  6. DESIGN OF A SUPERBIKE PADDOCK STAND USING CAD AND CAE TOOLS

    Directory of Open Access Journals (Sweden)

    M.H. Mohd Noh

    2012-06-01

    Full Text Available Two people are required to operate current superbike paddock stands in order to elevate the superbike. Lifting the superbike alone using the current design of paddock stand may be impractical and inconvenient for users. To overcome this limitation, a new design of a superbike paddock stand was conceived that could be operated by a single user. CAD and CAE tools using CATIA V5R18 software were utilised in designing this new stand. A 3D CAD model was developed and analysed through finite element analysis (FEA and a prototype fabricated for verification testing of the design. The use of CAD and CAE tools saved much time in the design work and gave the researchers and designers freedom in producing their own design. However, the most important aspect of this design study was to design a superbike paddock stand that is more practical and convenient for operation by a single user.

  7. Thermo-economic evaluation of novel flexible caes/ccpp concept

    OpenAIRE

    Herrmann, S.; Kahlert, S.; Wuerth, M.; Spliethoff, H.

    2016-01-01

    This paper presents the results of a thermodynamic and economic evaluation of a novel hybrid combination of a compressed air energy storage (CAES) and a combined cycle power plant (CCPP). The new cycle is modeled on the basis of a GE LM6000 gas turbine model, an adiabatic compressor model, an air expander, and a conventional dual-pressure heat recovery steam generator (HRSG) configuration. Furthermore, a detailed design of the recuperator is presented. With the simulated components, a storage...

  8. Siting-selection study for the Soyland Power Cooperative, Inc. , compressed-air energy-storage system (CAES)

    Energy Technology Data Exchange (ETDEWEB)

    1982-01-01

    A method used for siting a compressed air energy storage (CAES) system using geotechnical and environmental criteria is explained using the siting of a proposed 220 MW water-compensated CAES plant in Illinois as an example. Information is included on the identification and comparative ranking of 28 geotechnically and environmental sites in Illinois, the examination of fatal flaws, e.g., mitigation, intensive studies, costly studies, permit denials, at 7 sites; and the selection of 3 sites for further geological surveying. (LCL)

  9. Micromechanics-Based Structural Analysis (FEAMAC) and Multiscale Visualization within Abaqus/CAE Environment

    Science.gov (United States)

    Arnold, Steven M.; Bednarcyk, Brett A.; Hussain, Aquila; Katiyar, Vivek

    2010-01-01

    A unified framework is presented that enables coupled multiscale analysis of composite structures and associated graphical pre- and postprocessing within the Abaqus/CAE environment. The recently developed, free, Finite Element Analysis--Micromechanics Analysis Code (FEAMAC) software couples NASA's Micromechanics Analysis Code with Generalized Method of Cells (MAC/GMC) with Abaqus/Standard and Abaqus/Explicit to perform micromechanics based FEA such that the nonlinear composite material response at each integration point is modeled at each increment by MAC/GMC. The Graphical User Interfaces (FEAMAC-Pre and FEAMAC-Post), developed through collaboration between SIMULIA Erie and the NASA Glenn Research Center, enable users to employ a new FEAMAC module within Abaqus/CAE that provides access to the composite microscale. FEA IAC-Pre is used to define and store constituent material properties, set-up and store composite repeating unit cells, and assign composite materials as sections with all data being stored within the CAE database. Likewise FEAMAC-Post enables multiscale field quantity visualization (contour plots, X-Y plots), with point and click access to the microscale i.e., fiber and matrix fields).

  10. Use of phase change materials during compressed air expansion for isothermal CAES plants

    Science.gov (United States)

    Castellani, B.; Presciutti, A.; Morini, E.; Filipponi, M.; Nicolini, A.; Rossi, F.

    2017-11-01

    Compressed air energy storage (CAES) plants are designed to store compressed air into a vessel or in an underground cavern and to expand it in an expansion turbine when energy demand is high. An innovative CAES configuration recently proposed is the isothermal process. Several methods to implement isothermal CAES configuration are under investigation. In this framework, the present paper deals with the experimental testing of phase change materials (PCM) during compressed air expansion phase. The experimental investigation was carried out by means of an apparatus constituted by a compression section, a steel pressure vessel, to which an expansion valve is connected. The initial internal absolute pressure was equal to 5 bar to avoid moisture condensation and the experimental tests were carried out with two paraffin-based PCM amounts (0.05 kg and 0.1 kg). Results show that the temperature change during air expansion decreases with increasing the PCM amount inside the vessel. With the use of PCM during expansions an increase of the expansion work occurs. The increase is included in the range from 9.3% to 18.2%. In every test there is an approach to the isothermal values, which represent the maximum theoretical value of the obtainable expansion work.

  11. Chinese Acupuncture Expert System (CAES)-a useful tool to practice and learn medical acupuncture.

    Science.gov (United States)

    Lam, Chi Fai David; Leung, Kwong Sak; Heng, Pheng Ann; Lim, Chi Eung Danforn; Wong, Felix Wu Shun

    2012-06-01

    This paper describes the development of a Chinese Acupuncture Expert System (CAES) that will assist the learning and practice of medical acupuncture. This was the development of a Chinese Acupuncture Expert System which incorporated eight functional modules. These modules were 1) Add Patient Record subsystem; 2) Diagnosis subsystem ; 3) Acupuncture Prescription subsystem ; 4) Needle Insertion Position Animation subsystem ; 5) Acupuncture Points Usage Statistic subsystem ; 6) History Query subsystem; 7) Acupuncture Points Query subsystem and 8) Diagnosis Remarks and Diagnosis Record Save subsystem. Two databases were built-Patient Record database and Diagnosis (Acupuncture) Knowledge database. All the Traditional Chinese Medicine (TCM) knowledge and acupuncture treatment prescriptions were extracted from officially used TCM textbooks and received guidance and expert advice from two acupuncturists working in this project. A Chinese Acupuncture Expert System (CAES) was built, which after the input from users of any Chinese disease symptoms and signs, it can provide a list of related TCM syndrome diagnoses based on the patients' disease symptoms and signs, and at the same time it can offer advice of the appropriate Chinese acupuncture treatment to the users. CAES also provided text descriptions and acupuncture animations showing the acupoint locations and the direction and depth of the needle insertion technique. Therefore users can easily learn acupuncture and practice it. This new acupuncture expert system will hopefully provide an easy way for users to learn and practice Chinese Acupuncture and establish its usefulness after it was fully evaluated.

  12. The inhibition of the apoptosis pathway by the Coxiella burnetii effector protein CaeA requires the EK repetition motif, but is independent of survivin.

    Science.gov (United States)

    Bisle, Stephanie; Klingenbeck, Leonie; Borges, Vítor; Sobotta, Katharina; Schulze-Luehrmann, Jan; Menge, Christian; Heydel, Carsten; Gomes, João Paulo; Lührmann, Anja

    2016-05-18

    ABSRTACT Coxiella burnetii is an obligate intracellular bacterium that causes Query (Q) fever, a zoonotic disease. It requires a functional type IV secretion system (T4SS) which translocate bacterial effector proteins into the host cell cytoplasm and thereby facilitates bacterial replication. To date, more than 130 effector proteins have been identified, but their functions remain largely unknown. Recently, we demonstrated that one of these proteins, CaeA (CBU1524) localized to the host cell nucleus and inhibited intrinsic apoptosis of HEK293 or CHO cells. In the present study we addressed the question whether CaeA also affects the extrinsic apoptosis pathway. Ectopic expression of CaeA reduced extrinsic apoptosis and prevented the cleavage of the executioner caspase 7, but did not impair the activation of initiator caspase 9. CaeA expression resulted in an up-regulation of survivin (an inhibitor of activated caspases), which, however, was not causal for the anti-apoptotic effect of CaeA. Comparing the sequence of CaeA from 25 different C. burnetii isolates we identified an EK (glutamic acid/ lysine) repetition motif as a site of high genetic variability. The EK motif of CaeA was essential for the anti-apoptotic activity of CaeA. From these data, we conclude that the C. burnetii effector protein CaeA interferes with the intrinsic and extrinsic apoptosis pathway. The process requires the EK repetition motif of CaeA, but is independent of the upregulated expression of survivin.

  13. A Comparison of the Single-sided (Gen II) and Double-sided (Gen I) Combat Arms Earplugs (CAE): Acoustic Properties, Human Performance, and User Acceptance

    Science.gov (United States)

    2012-12-01

    A Comparison of the Single-sided (Gen II) and Double-sided (Gen I) Combat Arms Earplugs (CAE): Acoustic Properties, Human Performance, and...and Double-sided (Gen I) Combat Arms Earplugs (CAE): Acoustic Properties, Human Performance, and User Acceptance Mary Binseel, Kara Cave, Joel...Double-sided (Gen I) Combat Arms Earplugs (CAE): Acoustic Properties, Human Performance, and User Acceptance 5a. CONTRACT NUMBER 5b. GRANT

  14. RESEARCH USING CAE ON PERFORMANCES EVALUATION FOR MACHINE TOOL ORIENTATION AND CLAMPING DEVICES

    Directory of Open Access Journals (Sweden)

    Raluca Magdalena NIŢĂ

    2014-11-01

    Full Text Available The paper presents the stages of CAE, which is composed by CAD-FEM for determining optimal construction and loads for a modular fixture device for prismatic and circular work-pieces. Such devices are used for processing on CNC performance machine tools, like machining centres including 5-axis CNC milling machines. It is presented the methodology of analysis and results of its application. Are established numerical analyses ways, in the conditions defined by the loadings and identified the most solicited area of the device structure. It is recommended in that the area be placed a strain sensor. This is an important step needed transformation into a mechatronic device.

  15. Sizing of Compression Coil Springs Gas Regulators Using Modern Methods CAD and CAE

    Directory of Open Access Journals (Sweden)

    Adelin Ionel Tuţă

    2010-10-01

    Full Text Available This paper presents a method for compression coil springs sizing by gas regulators composition, using CAD techniques (Computer Aided Design and CAE (Computer Aided Engineering. Sizing is to optimize the functioning of the regulators under dynamic industrial and house-hold. Gas regulator is a device that automatically and continuously adjusted to maintain pre-set limits on output gas pressure at varying flow and input pressure. The performances of the pressure regulators like automatic systems depend on their behaviour under dynamic opera-tion. Time constant optimization of pneumatic actuators, which drives gas regulators, leads to a better functioning under their dynamic.

  16. The application of CAD, CAE & CAM in development of butterfly valve’s disc

    Science.gov (United States)

    Asiff Razif Shah Ranjit, Muhammad; Hanie Abdullah, Nazlin

    2017-06-01

    The improved design of a butterfly valve disc is based on the concept of sandwich theory. Butterfly valves are mostly used in various industries such as oil and gas plant. The primary failure modes for valves are indented disc, keyways and shaft failure and the cavitation damage. Emphasis on the application of CAD, a new model of the butterfly valve’s disc structure was designed. The structure analysis was analysed using the finite element analysis. Butterfly valve performance factors can be obtained is by using Computational Fluid Dynamics (CFD) software to simulate the physics of fluid flow in a piping system around a butterfly valve. A comparison analysis was done using the finite element to justify the performance of the structure. The second application of CAE is the computational fluid flow analysis. The upstream pressure and the downstream pressure was analysed to calculate the cavitation index and determine the performance throughout each opening position of the valve. The CAM process was done using 3D printer to produce a prototype and analysed the structure in form of prototype. The structure was downscale fabricated based on the model designed initially through the application of CAD. This study is utilized the application of CAD, CAE and CAM for a better improvement of the butterfly valve’s disc components.

  17. FAST Modular Wind Turbine CAE Tool: Nonmatching Spatial and Temporal Meshes: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Sprague, M. A.; Jonkman, J. M.; Jonkman, B. J.

    2014-01-01

    In this paper we propose and examine numerical algorithms for coupling time-dependent multi-physics modules relevant to computer-aided engineering (CAE) of wind turbines. In particular, we examine algorithms for coupling modules where spatial grids are non- matching at interfaces and module solutions are time advanced with different time increments and different time integrators. Sharing of data between modules is accomplished with a predictor-corrector approach, which allows for either implicit or explicit time integration within each module. Algorithms are presented in a general framework, but are applied to simple problems that are representative of the systems found in a whole-turbine analysis. Numerical experiments are used to explore the stability, accuracy, and efficiency of the proposed algorithms. This work is motivated by an in-progress major revision of FAST, the National Renewable Energy Laboratory's (NREL's) premier aero-elastic CAE simulation tool. The algorithms described here will greatly increase the flexibility and efficiency of FAST.

  18. Energy system analysis of CAES technologies in the Danish energy system with high penetration of fluctuating renewable energy sources

    DEFF Research Database (Denmark)

    Salgi, Georges Garabeth; Lund, Henrik

    2006-01-01

    countries. However, plans to expand wind power locally and in the neighbouring countries could restrain the export option and create transmission congestion challenges. This results in a need to increase the flexibility of the local electricity system. Compressed Air Energy Storage (CAES) has been proposed...

  19. Cuestionario de afrontamiento del estrés (CAE) : validación en una muestra mexicana

    OpenAIRE

    González Ramírez, Mónica Teresa; Landero Hernández, René

    2007-01-01

    El artículo describe los resultados de la aplicación del Cuestionario de Afrontamiento del Estrés (San-dín, B. y Chorot, P. (2003). Cuestionario de Afrontamiento del Estrés (CAE): Desarrollo y validación preliminar. Revista de Psicopatología y Psic

  20. The effect of key parameters on the design of an optimized caes power plant

    Directory of Open Access Journals (Sweden)

    Assadi M. Khalaji

    2016-01-01

    Full Text Available Due to the significant variations in electricity generation and its demand, the power plant owners are encountered with challenges of economic operation. Among all, Compressed air energy storage (CAES technology has proposed itself as a reliable and efficient solution to match the two sides. This paper deals with a modeled compressed air energy storage power plant which has been optimized thermodynamically through an efficient genetic algorithm code. The results of this optimized model, considered as the base case, show that the power plant is technically and financially justifiable. In order to obtain a more tangible realization, it is necessary to verify the results against the variation of key parameters. In this study, the sensitivity analysis is performed based on main parameters including plant loading and ambient condition and the resultant trends of each case are presented. This approach will help the designers to analyze the quality of their designs in different situations.

  1. Studies Regarding Design and Optimization of Mechanisms Using Modern Techniques of CAD and CAE

    Directory of Open Access Journals (Sweden)

    Marius Tufoi

    2010-01-01

    Full Text Available The paper presents applications of modern techniques of CAD (Computer Aided Design and CAE (Computer Aided Engineering to design and optimize the mechanisms used in mechanical engineering. The use exemplification of these techniques was achieved by designing and optimizing parts of a drawing installation for horizontal continuous casting of metals. By applying these design methods and using finite element method at simulations on designed mechanisms results a number of advantages over traditional methods of drawing and design: speed in drawing, design and optimization of parts and mechanisms, kinematic analysis option, kinetostatic and dynamic through simulation, without requiring physical realization of the part or mechanism, the determination by finite element method of tension, elongations, travel and safety factor and the possibility of optimization for these sizes to ensure the mechanical strength of each piece separately. Achieving these studies was possible using SolidWorks 2009 software suite.

  2. Huida de una voz en Cae la noche tropical, de Manuel Puig

    Directory of Open Access Journals (Sweden)

    Lucas Gagliardi

    2015-01-01

    Full Text Available El análisis literario permite distinguir la presencia de una voz femenina por toda la obra de Manuel Puig. El personaje que la expresa en Cae la noche tropical es Nidia. Desde el enfoque de la crítica genética fue posible observar en los materiales escriturales la configuración de esa voz y su relación con los lugares comunes —rasgo ya señalado como recurrente en la poética de este novelista por la crítica literaria—, así como el proceso por el cual logra fugarse del rol esperado y el cliché.

  3. CAD AND CAE METHODS IN COMPUTER ASSISTED DESIGN OF WORM MESHES

    Directory of Open Access Journals (Sweden)

    Henryk SABINIAK

    2014-03-01

    Full Text Available One important feature of worm gear meshes is their complex geometry and now the application of computer aided design allows for mapping their real construction patterns with great affinity. Modelling of worm meshes with the use of CAD (Computer Aided Design and CAE (Computer Aided Engineering methods enables tracking the design process from the very beginning, i.e. from the concept or specific assumptions, until the final stage only by using appropriate software, thereby lowering the costs and eliminating common errors. Owing to this, just before the manufacturing process of the first meshing elements begins, one can conduct geometric analysis and correct or modify working profiles of the teeth in order to improve the operation properties of future gear. Visualizing such a geometric modelling process can also serve didactic purposes when used in education of future engineers, technologists and operators of this type of gears.

  4. Improvements in emergency management in nuclear power plants after the Fukushima accident: ORE, CAE and CAGE; Mejoras en la gestion de emergencias en centrales nucleares tras el accidente de Fukushima: ORE, CAE y CAGE

    Energy Technology Data Exchange (ETDEWEB)

    Gimenez Gonzalez, S.; Sanchez Lombardia, A.; Martin Calvarro, J. M.; Calvin Cuartero, M.

    2016-08-01

    After Fukushima accident European NPP safety was checked by means of homogenous stress test promoted by European council. At Spain CSN issued Technical instructions to confirm safety NPP margins were appropriate . As a result of this assessment licensees promoted improving NPP safety by strengthen ERO; a new Support Emergency center (CAE) and construction of a new alternative management centre (CAGE) at each site. European countries have been improving and reinforced NPP safety in a similar way to Spain. (Author)

  5. Emerging CAE technologies and their role in Future Ambient Intelligence Environments

    Science.gov (United States)

    Noor, Ahmed

    2011-03-01

    Dramatic improvements are on the horizon in Computer Aided Engineering (CAE) and various simulation technologies. The improvements are due, in part, to the developments in a number of leading-edge technologies and their synergistic combinations/convergence. The technologies include ubiquitous, cloud, and petascale computing; ultra high-bandwidth networks, pervasive wireless communication; knowledge based engineering; networked immersive virtual environments and virtual worlds; novel human-computer interfaces; and powerful game engines and facilities. This paper describes the frontiers and emerging simulation technologies, and their role in the future virtual product creation and learning/training environments. The environments will be ambient intelligence environments, incorporating a synergistic combination of novel agent-supported visual simulations (with cognitive learning and understanding abilities); immersive 3D virtual world facilities; development chain management systems and facilities (incorporating a synergistic combination of intelligent engineering and management tools); nontraditional methods; intelligent, multimodal and human-like interfaces; and mobile wireless devices. The Virtual product creation environment will significantly enhance the productivity and will stimulate creativity and innovation in future global virtual collaborative enterprises. The facilities in the learning/training environment will provide timely, engaging, personalized/collaborative and tailored visual learning.

  6. Application of CAD/CAE class systems to aerodynamic analysis of electric race cars

    Science.gov (United States)

    Grabowski, L.; Baier, A.; Buchacz, A.; Majzner, M.; Sobek, M.

    2015-11-01

    Aerodynamics is one of the most important factors which influence on every aspect of a design of a car and car driving parameters. The biggest influence aerodynamics has on design of a shape of a race car body, especially when the main objective of the race is the longest distance driven in period of time, which can not be achieved without low energy consumption and low drag of a car. Designing shape of the vehicle body that must generate the lowest possible drag force, without compromising the other parameters of the drive. In the article entitled „Application of CAD/CAE class systems to aerodynamic analysis of electric race cars” are being presented problems solved by computer analysis of cars aerodynamics and free form modelling. Analysis have been subjected to existing race car of a Silesian Greenpower Race Team. On a basis of results of analysis of existence of Kammback aerodynamic effect innovative car body were modeled. Afterwards aerodynamic analysis were performed to verify existence of aerodynamic effect for innovative shape and to recognize aerodynamics parameters of the shape. Analysis results in the values of coefficients and aerodynamic drag forces. The resulting drag forces Fx, drag coefficients Cx(Cd) and aerodynamic factors Cx*A allowed to compare all of the shapes to each other. Pressure distribution, air velocities and streams courses were useful in determining aerodynamic features of analyzed shape. For aerodynamic tests was used Ansys Fluent CFD software. In a paper the ways of surface modeling with usage of Realize Shape module and classic surface modeling were presented. For shapes modeling Siemens NX 9.0 software was used. Obtained results were used to estimation of existing shapes and to make appropriate conclusions.

  7. THE METHOD OF FORMING CAE MODELS ON THE EXAMPLE OF DESIGN AND TECHNOLOGICAL ELABORATION OF THE PLUNGER OF FORCED HYDROMACHINE

    Directory of Open Access Journals (Sweden)

    A. V. Puzanov

    2017-01-01

    Full Text Available Testing on the manufacturability with ensuring the functionality requirements of the product determines the analysis of a large number of designs. The paper proposed a method of forming CAE models from CAD models, taking into account simplification models (with the exception of nonfunctional elements, the use of symmetry, etc., add the missing data (including the use of the properties of materials differ from the CAD model, the possibility of a multidisciplinary analysis in one or more software systems. An example of design and technological elaboration of the plunger of forced hydraulic machine is shown.

  8. Assessing the Importance of Nonlinearities in the Development of a Substructure Model for the Wind Turbine CAE Tool FAST: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Damiani, R.; Jonkman, J.; Robertson, A.; Song, H.

    2013-03-01

    Design and analysis of wind turbines are performed using aero-servo-elastic tools that account for the nonlinear coupling between aerodynamics, controls, and structural response. The NREL-developed computer-aided engineering (CAE) tool FAST also resolves the hydrodynamics of fixed-bottom structures and floating platforms for offshore wind applications. This paper outlines the implementation of a structural-dynamics module (SubDyn) for offshore wind turbines with space-frame substructures into the current FAST framework, and focuses on the initial assessment of the importance of structural nonlinearities. Nonlinear effects include: large displacements, axial shortening due to bending, cross-sectional transverse shear effects, etc.

  9. CAE Application and Certification for Industrial and Educational Customers: The Case of University-Industry Cooperation between EPLAN and RFH

    Directory of Open Access Journals (Sweden)

    Duško Lukač

    2010-12-01

    Full Text Available The paper presents examples of the application of the currently most used CAE software for electrical engineering and project planning EPLAN Electric P8 as well as novel international certification model, of the so called Eplan Certified Engineer (ECE and EPLAN Certified Student, based on cooperation between Rheinische Fachhochschule Köln gGmbH – University of Applied Sciences in cooperation with EPLANSoftware and Service company, a market leader in development and training in electro CAE. It argues that the successful interface management, communication plan and the costumer oriented technical-didactical model of the concept has been essential for the viability and success of the courses. It concludes that cooperation between the industry and university enhances the university’s and firm’s reputation with consumers and environmental competitors and has had positive financial effects for the both parties. It concludes that on the whole, these joint certification programs have a convenient side effect, like to be the successful way for the development of high-quality training opportunities for the students.

  10. Numerical Stability and Accuracy of Temporally Coupled Multi-Physics Modules in Wind-Turbine CAE Tools

    Energy Technology Data Exchange (ETDEWEB)

    Gasmi, A.; Sprague, M. A.; Jonkman, J. M.; Jones, W. B.

    2013-02-01

    In this paper we examine the stability and accuracy of numerical algorithms for coupling time-dependent multi-physics modules relevant to computer-aided engineering (CAE) of wind turbines. This work is motivated by an in-progress major revision of FAST, the National Renewable Energy Laboratory's (NREL's) premier aero-elastic CAE simulation tool. We employ two simple examples as test systems, while algorithm descriptions are kept general. Coupled-system governing equations are framed in monolithic and partitioned representations as differential-algebraic equations. Explicit and implicit loose partition coupling is examined. In explicit coupling, partitions are advanced in time from known information. In implicit coupling, there is dependence on other-partition data at the next time step; coupling is accomplished through a predictor-corrector (PC) approach. Numerical time integration of coupled ordinary-differential equations (ODEs) is accomplished with one of three, fourth-order fixed-time-increment methods: Runge-Kutta (RK), Adams-Bashforth (AB), and Adams-Bashforth-Moulton (ABM). Through numerical experiments it is shown that explicit coupling can be dramatically less stable and less accurate than simulations performed with the monolithic system. However, PC implicit coupling restored stability and fourth-order accuracy for ABM; only second-order accuracy was achieved with RK integration. For systems without constraints, explicit time integration with AB and explicit loose coupling exhibited desired accuracy and stability.

  11. 2403 自動車開発のための統合化 CAE への 1 考察

    OpenAIRE

    長松, 昭男; 角田, 鎭男; Nagamatsu, Akio; Sumida, Shizuo

    2002-01-01

    Concept and use of virtual product are studied in order to realize fully integrated next age CAE for development of automobile. A concept of virtual product is introduced using a new modeling approach proposed by the authors. Structural content and construction method of virtual product is presented. It is mentioned how to use virtual product for successful automobile development.

  12. Wind Load Design of Hangar-Type Closed Steel Structures with Different Roof Pitches Using Abaqus CAE Software

    Directory of Open Access Journals (Sweden)

    Aybike Özyüksel Çiftçioğlu

    2017-05-01

    Full Text Available Structures convert the kinetic energy available in the air into potential energy which is in the form of pressure and suction forces reducing or fully stopping its motion. The potential impact of the wind depends on the geometric properties and pertinacity of a building, the angle of the wind flow, its strength and velocity. Design gains importance for tall buildings against the impact of the resonance along with the force based on pressure. Relevant calculations are made in Turkey based on the TS 498 Wind Load Velocity Criterion and this standard is currently being updated. This study develops the wind load design of hangar-type closed steel structures with different roof pitches using Abaqus CAE software.

  13. Geotechnical Feasibility Analysis of Compressed Air Energy Storage (CAES) in Bedded Salt Formations: a Case Study in Huai'an City, China

    Science.gov (United States)

    Zhang, Guimin; Li, Yinping; Daemen, Jaak J. K.; Yang, Chunhe; Wu, Yu; Zhang, Kai; Chen, Yanlong

    2015-09-01

    The lower reaches of the Yangtze River is one of the most developed regions in China. It is desirable to build compressed air energy storage (CAES) power plants in this area to ensure the safety, stability, and economic operation of the power network. Geotechnical feasibility analysis was carried out for CAES in impure bedded salt formations in Huai'an City, China, located in this region. First, geological investigation revealed that the salt groups in the Zhangxing Block meet the basic geological conditions for CAES storage, even though the possible unfavorable characteristics of the salt formations include bedding and different percentages of impurities. Second, mechanical tests were carried out to determine the mechanical characteristics of the bedded salt formations. It is encouraging that the samples did not fail even when they had undergone large creep deformation. Finally, numerical simulation was performed to evaluate the stability and volume shrinkage of the CAES under the following conditions: the shape of a single cavern is that of a pear; the width of the pillar is adopted as two times the largest diameter; three regular operating patterns were adopted for two operating caverns (internal pressure 9-10.5 MPa, 10-11.5 MPa, and 11-12.5 MPa), while the other two were kept at high pressure (internal pressure 10.5, 11.5, and 12.5 MPa) as backups; an emergency operating pattern in which two operating caverns were kept at atmospheric pressure (0.1 MPa) for emergency while the backups were under operation (9-10.5 MPa), simulated for 12 months at the beginning of the 5th year. The results of the analysis for the plastic zone, displacement, and volume shrinkage support the feasibility of the construction of an underground CAES power station.

  14. A Model for Bidirectional Community-Academic Engagement (CAE): Overview of Partnered Research, Capacity Enhancement, Systems Transformation, and Public Trust in Research

    OpenAIRE

    Baquet, Claudia R.

    2012-01-01

    The University of Maryland?s Office of Policy and Planning in collaboration with urban and rural community partners, planned and implemented a model for community-academic engagement (CAE) in partnered research and programs. The model addressed health disparities, cancer and tobacco-related diseases, and public trust in research. Environments have flourished that resulted in bidirectional community-academic interactions, and led to transformation of the academic environment and community capa...

  15. Setting the CAE system CR: Relationship between dose in the image receptor, the estimated dose through exposure indicator system and the RSR; Ajuste del CAE de un sistema de CR: Relacion entre la dosis en el receptor de imagen, la dosis estimada a traves del indicador de exposicion del sistema y la RSR

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Manzano, P.; Rivas Ballarin, M. A.; Jimenez Alberico, F. J.; Cortes Rodicio, J.; Canellas Anoz, M.; Hernandez Vitoria, A.

    2011-07-01

    This paper seeks to verify that the criterion of 116, AAPM report can also be applied to Computed Radiography (CR), to relate the dose at the image receptor, the DE and the RSR and verify whether the proposed methodology and tolerance in the PECCR are suitable for verifying the correct operation of CAE in CR.

  16. Cr and Zr/Cr nitride CAE-PVD coated aluminum bipolar plates for polymer electrolyte membrane fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Barranco, Jose; Maza, Mario [University of Zaragoza, Department of Mechanical Engineering, Maria de Luna 3, ES-50018 Zaragoza (Spain); Barreras, Felix; Lozano, Antonio; Lopez, Ana M.; Roda, Vicente; Martin, Jesus [LITEC-CSIC, Univ. Zaragoza, Maria de Luna 10, ES-50018 Zaragoza (Spain); Fuentes, Gonzalo G.; Almandoz, Eluxka [AIN, Centro de Ingenieria Avanzada de Superficies, Cordovilla, ES-31191 Pamplona (Spain)

    2010-10-15

    In this work, two nitride coatings deposited on aluminum-based bipolar plates via cathodic arc evaporation physical vapor deposition (CAE-PVD) have been evaluated using two different techniques. The coating materials, a multi-layer chromium-zirconium nitride (ZrN-CrN) and a monolayer chromium nitride (CrN) have been exposed to electrochemical polarization tests for corrosion resistance simulating the typical environment in the anode and cathode sides in polymer electrolyte membrane fuel cells (PEMFC). Besides, two 3-cell PEMFC stacks, one per each coating material, have been formed. The migration of metal cations toward both the gas diffusion layers (GDL) and catalyst layers have been analyzed by scanning electron microscopy (SEM) and energy dispersive X-ray spectroscopy (EDX), after 100 h of continuous operation of the stacks. Results have shown that the two coatings applied over the Al-plates satisfy the corrosion resistance requirements in the short-term tests performed at the two stacks. Moreover, results obtained from electrochemical polarization tests have revealed that the CrN-coating confers a good corrosion resistance to the Al-based metal plate, achieving values of corrosion potential and corrosion current two orders of magnitude lower than the ones obtained for the Al alloy as-received. (author)

  17. Diseño de un conjunto de altavoces inalámbricos por inyección de plasticos mediante CAD-CAE

    OpenAIRE

    ORTEGA ALBERO, PEDRO JOSÉ

    2016-01-01

    [ES] Se realiza una definición del producto de acuerdo a la solicitud del promotor, normativa y posibilidades que ofrece el estado del arte del sector. Se elaboran bocetos de los posibles candidatos y se procede al diseño CAD del diseño definitivo elegido mediante metodología de diseño. Se confecciona un estudio CAE de simulación de esfuerzos y simulación de inyección para adaptar el producto a un material polimérico y se completan las simulaciones que definan el sistema de ...

  18. Dados sorológicos sobre a presença e distribuição da artrite-encefalite caprina (CAE no Estado da Bahia , Brasil.

    Directory of Open Access Journals (Sweden)

    A. Figueredo

    2005-03-01

    Full Text Available RESUMO: Para verificar a soroprevalência da artrite-encefalite caprina (Cae foram analisadas 1605 amostras de hemo-soros de caprinos pertencentes a rebanhos localizados em nove microrregiões geográficas e distribuídos em 24 municípios do Estado da Bahia, os quais nos foram enviados para exame no Laboratório de Viroses da Escola de Medicina Veterinária. A população estudada compreendeu animais de criatórios de leite e corte, de manejo intensivo, semi-intensivo e extensivo, das raças: alpina, anglo-nubiana, boer, mambrina, saanen, toggenburg e sem raça definida(SRD. Foram positivos ao teste de imunodifusão em ágar gel (IDAG 215 (13,4% hemo-soros de caprinos. Nas raças sanen, alpina e anglo-nubiana foram encontradas um maior número de animais positivos, respectivamente 77 (18,92%, 80 (16,06% e 49 (15,76%. Entre as amostras positivas a maior frequência foi de fêmeas 194 (90,23% e adultos 193 (89,77%. Os resultados obtidos comprovam a existência da CAE na região e a necessidade de novas pesquisas que avaliem o índice de infecção dos animais e as formas de prevenção e controle da doença, PALAVRAS CHAVE: Artrite – encefalite caprina, teste da imunidade, fusão em agar gel, doenças em caprinos SUMMARY: To verify the soroprevalency of the caprine arthritis-encephalitis (CAE 1605 samples of goats hemo-serums belonging to flocks located in nine geographical microrregiões were analyzed and distributed in 24 municipal districts of the State of Bahia. This samples were sent to Laboratory of Viruses of the Veterinary Medicine School to analysis. The studied population understood animals of herd of milk and court, of intensive, semi-intensive and extensive handling, of the races: alpine, anglo-nubiana, boer, mambrina, saanen, toggenburg and without race defined(SRD. They were positive to the agar gel imunodifusion test (IDAG 215 (13,4% goats hemo-serums. In the races

  19. UTILIZAÇÃO DE SOFTWARE CAD E CAE NO DESENVOLVIMENTO DE PRODUTO SUSTENTÁVEL PARA AQUECIMENTO DE ÁGUA

    Directory of Open Access Journals (Sweden)

    Jorge Henrique Sales

    2014-07-01

    Full Text Available Atualmente a engenharia tem preocupação em desenvolvimento de projetos que atendam as necessidades socioambientais. Neste trabalho, apresenta-se um produto que usa o conceito de sustentabilidade visando auxiliar na ação contra alguns dos problemas ambientais que afetam o planeta, sendo grande parte destes associados ao uso irracional de recursos, como energia e a água.  O produto utiliza materiais recicláveis para obter um painel solar, denominado de ASAR (Aquecedor Solar Alternativo por Reflexão com a função de aquecer água para uso residencial. Com base do método do modelo de referência, foi feita a modelagem e simulação com ferramentas como o CAD e CAE.

  20. Contribuição CAD/CAE em análise da confiabilidade do processo de desenvolvimento de produto

    OpenAIRE

    Oliveira, José Ricardo Menezes

    2012-01-01

    Este estudo apresenta a utilização de recursos CAD e CAE como ferramentas de desenvolvimento de novos produtos com proposição ao aumento dos índices de confiabilidade. Para atingir esta meta buscou-se a implementação de um componente do sistema de conformação mecânica por injeção em uma indústria fabricante de chuveiros elétricos. A aplicação de ferramentas qualitativas detectou as falhas críticas do referido sistema e delimitou uma especificação de projeto para concepção de al...

  1. A Model for Bidirectional Community-Academic Engagement (CAE): Overview of Partnered Research, Capacity Enhancement, Systems Transformation, and Public Trust in Research

    Science.gov (United States)

    Baquet, Claudia R.

    2017-01-01

    The University of Maryland’s Office of Policy and Planning in collaboration with urban and rural community partners, planned and implemented a model for community-academic engagement (CAE) in partnered research and programs. The model addressed health disparities, cancer and tobacco-related diseases, and public trust in research. Environments have flourished that resulted in bidirectional community-academic interactions, and led to transformation of the academic environment and community capacity to identify and address health issues. This collaborative model produced: enhanced public trust in research; andenhanced community and Academic Health center (AHC) capacity to address community health needs as partners. A unique feature of this model is AHC’s shared grant funding with community partners serving diverse and medically underserved communities for predetermined roles in research, policy and educational programs. Over $18 million in grant funding was provided to community organizations. This paper presents an overview of this model as a case study. PMID:23698691

  2. The Center for Astronomy Education (CAE) and Our NSF Funded CCLI Phase III Collaboration of Astronomy Teaching Scholars (CATS) Program: Updates to Our New Community-Based Model for Astronomy Education Research

    Science.gov (United States)

    Brissenden, Gina; Impey, C.; Prather, E. E.; Lee, K. M.; CATS

    2010-01-01

    The Center for Astronomy Education (CAE) has been devoted to improving teaching & learning in Astro 101 by creating research-validated curriculum & assessment instruments for use in Astro 101 & by providing Astro 101 instructors professional development opportunities to increase their pedagogical content knowledge & instructional skills at implementing these curricula & assessment materials. To create sustainability and further expand this work, CAE, in collaboration with other national leaders in astronomy education & research, developed the Collaboration of Astronomy Teaching Scholars (CATS) Program. The primary goals of CATS are to: 1) increase the number of Astro 101 instructors conducting fundamental research in astronomy education 2) increase the amount of research-validated curriculum & assessment instruments available for use in Astro 101 3) increase the number of people prepared to develop & conduct their own CAE Teaching Excellence Workshops In our second year we have concluded a national study assessing the contribution students’ personal characteristics make to student learning gains and the effectiveness of interactive learning strategies. We have results from our classroom research validation study on the use of the "ClassAction” electronic learning system. We have begun creation of an assessment instrument designed specifically for Astro 101 to evaluate the effectiveness of our instruction in improving students’ attitudes & beliefs about science, and which is being informed by several of our studies and community input. We have also begun field-testing of our Solar System Concept Inventory. Additionally research into students’ beliefs and reasoning difficulties on topics in Cosmology is underway. We acknowledge the NSF for funding under Award No. 0715517, a CCLI Phase III Grant for the Collaboration of Astronomy Teaching Scholars (CATS) Program.

  3. The Center for Astronomy Education (CAE) Ushers in a New Community-Based Model for Astronomy Education Research with the NSF Funded CCLI Phase III Collaboration of Astronomy Teaching Scholars (CATS) Program

    Science.gov (United States)

    Brissenden, Gina; Impey, C.; Prather, E.; Lee, K.; Duncan, D.

    2009-01-01

    The Center for Astronomy Education (CAE) has been devoted to improving teaching & learning in Astro 101 by creating research-validated curriculum & assessment instruments for use in Astro 101 & by providing Astro 101 instructors professional development opportunities to increase their pedagogical content knowledge & instructional skills at implementing these curricula & assessment materials. To create sustainability and further expand this work, CAE, in collaboration with other national leaders in astronomy education & research, developed the Collaboration of Astronomy Teaching Scholars (CATS) Program. The primary goals of CATS are to: 1) increase the number of Astro 101 instructors conducting fundamental research in astronomy education 2) increase the amount of research-validated curriculum & assessment instruments available for use in Astro 101 3) increase the number of people prepared to develop & conduct their own CAE Teaching Excellence Workshops In our first year we have concluded a national study assessing the teaching & learning of Astro 101 & the effect of interactive instruction. We have begun the initial analysis of the demographics data of this study. We have begun a classroom research validation study on the use of the "ClassAction” electronic learning system. We have begun to analyze data from two different studies on students’ attitudes & understanding of science to inform the creation of an assessment instrument designed specifically for Astro 101 to evaluate the effectiveness of our instruction in improving students’ attitudes & beliefs about science. We have also begun the development of a Solar System Concept Inventory. Additionally the development of the Solar System Concept Inventory and research into students’ beliefs and reasoning difficulties on topics in Cosmology are well underway. We acknowledge the NSF for funding under Award No. 0715517, a CCLI Phase III Grant for the Collaboration of Astronomy Teaching Scholars (CATS) Program.

  4. Diseño de un sistema de gestión de procesos operativos para el desarrollo virtual de un producto industrial como herramienta para obtener mayor eficacia de los sitemas cad & cae

    OpenAIRE

    Vega Chica, Victor Alejandro; Quincha, Marcos Tapia

    2009-01-01

    En la presente tesis se pondrán en manifiesto todas las herramientas necesarias para llevar a cabo un desarrollo virtual de un producto industrial, como los sistemas de diseño (CAD) y de simulación avanzada (CAE), se explicarán además en qué consisten y cuales son las ventajas de los prototipos y ensayos virtuales. Como parte fundamental se diseñará un sistema de gestión de procesos en los que se consideraran todos los servicios ofrecidos en el desarrollo virtual de productos, los cuales depe...

  5. Integração de tecnologias CAD/CAE/CAM no ateliê de arquitetura: Uma aplicação no projeto de edifícios altos

    Directory of Open Access Journals (Sweden)

    Gabriela Celani

    2017-02-01

    Full Text Available This paper describes a 5th year design studio in an Architecture and Urban Design undergraduate program which adopted a parametric and performance-based design strategy for the design of high-rise buildings. The studio included the use of environmental and structural analyses, as well as parametric and algorithmic modeling for incorporating the results of these analyses to the generation of form based on performance.  Besides, the studio included an intensive use of digital fabrication equipment for the production of scale models. The results show the importance of having an interdisciplinary team of instructors in the design studio, and the feasibility of reproducing, even if in a simplified manner, the integrated design process, with the use of CAD/CAE/CAM technologies, which is ever more present in architectural offices.

  6. Corrosion resistance appraisal of TiN, TiCN and TiAlN coatings deposited by CAE-PVD method on WC–Co cutting tools exposed to artificial sea water

    Energy Technology Data Exchange (ETDEWEB)

    Matei, A.A. [Center for Microscopy-Microanalysis and Information Processing, University POLITEHNICA of Bucharest, Splaiul Independentei 313, Sector 6, Bucharest (Romania); Pencea, I., E-mail: ion.pencea@upb.ro [Materials Science and Engineering Faculty, University POLITEHNICA of Bucharest, Splaiul Independentei 313, Sector 6, Bucharest (Romania); Branzei, M. [Materials Science and Engineering Faculty, University POLITEHNICA of Bucharest, Splaiul Independentei 313, Sector 6, Bucharest (Romania); Trancă, D.E. [Center for Microscopy-Microanalysis and Information Processing, University POLITEHNICA of Bucharest, Splaiul Independentei 313, Sector 6, Bucharest (Romania); Ţepeş, G.; Sfăt, C.E. [Materials Science and Engineering Faculty, University POLITEHNICA of Bucharest, Splaiul Independentei 313, Sector 6, Bucharest (Romania); Ciovica, E. [Materials Engineering, University Valahia Targoviste, Calea Calarasilor 189, Sector 3, Bucharest (Romania); Gherghilescu, A.I. [Materials Science and Engineering Faculty, University POLITEHNICA of Bucharest, Splaiul Independentei 313, Sector 6, Bucharest (Romania); Stanciu, G.A. [Center for Microscopy-Microanalysis and Information Processing, University POLITEHNICA of Bucharest, Splaiul Independentei 313, Sector 6, Bucharest (Romania)

    2015-12-15

    Highlights: • A new composite WC–Co cutting tool was coated with TiN, TiCN, TiAlN by CAE-PVD. • Corrosion resistance in 3.5% NaCl solution of TiN, TiCN, TiAlN coatings were measured. • Structural changes induced by corrosion test upon TiN, TiCN, TiAlN were investigated. • Corrosion resistance of TiN, TiCN, TiAlN was ranked based on E{sub oc}, i{sub corr}, P parameters. • TiN coating is the best solution for new tool designed to work in marine environment. - Abstract: A new advanced sintered composite cutting tool has been developed based on tungsten carbide matrix ligated with cobalt (WC–Co) additivated with tantalum carbide (TaC), titanium carbide (TiC) and niobium carbide (NbC) as grain growth inhibitors. Titanium nitride (TiN), titanium carbonitride (TiCN) and titanium aluminium nitride (TiAlN) coatings were deposited on these tools by CAE-PVD technique to find out the best solution to improve the corrosion resistance of this tool in marine environment. The electrochemical behaviours of the specimens in 3.5% NaCl water solution were estimated by potentiodynamic polarization measurements i.e. the open circuit potential (E{sub oc}), corrosion potential (E{sub corr}) and corrosion current density (i{sub corr}). Wide angle X-ray diffraction (WAXD), optical microscopy (OM) and atomic force microscopy (AFM) investigations have been carried on tested and untested specimens to substantiate the corrosion resistance of the tested specimens. Based on the open circuit potential (E{sub oc}) and corrosion potential (E{sub corr}) results, the tested specimens were ranked as TiN, TiAlN, TiCN and WC–Co while on corrosion current density (i{sub corr}) and protective efficiency (P) values they have been ranked as TiN, TiAlN, WC–Co and TiCN. The WAXD, MO and AFM results unambiguously show that the corrosion resistance depends on the nature and morphology of the coating.

  7. Dataudveksling mellem CAD og CAE programmer

    DEFF Research Database (Denmark)

    Sørensen, Torben; Conrad, Finn

    2001-01-01

    Når mange forskelligartede programmer benyttes til beregninger og anden databehandling på samme modeller er det nødvendig at udveksle modellerne mellem disse forskellige programmer. Biler og skibe bliver f.eks. typisk designet i 3D CAD systemer, mens CAD modellerne herefter anvendes i andre...... dedikerede IT-systemer i forbindelse montageplanlægningen, svejseplanlægningen, robotprogrammeringen mm. der således her et behov for at udveksle CAD modellen mellem de forskellige programmer. Udveksling af information mellem forskellige programmer og systemer kræver såvel en fælles specifikation af det...

  8. Development, Exploitation, and Transition of Computer Aided Engineering (CAE) Tools

    National Research Council Canada - National Science Library

    Carter, Harold W

    2003-01-01

    .... Tasks include CMOS-based microwave component design and fabrication, parallel and mixed-signal VHDL and VBHDL-AMS simulator algorithms, conversion tools for VHDL-AMS models, System-on-a-Chip methods...

  9. CAD-CAE in Electrical Machines and Drives Teaching.

    Science.gov (United States)

    Belmans, R.; Geysen, W.

    1988-01-01

    Describes the use of computer-aided design (CAD) techniques in teaching the design of electrical motors. Approaches described include three technical viewpoints, such as electromagnetics, thermal, and mechanical aspects. Provides three diagrams, a table, and conclusions. (YP)

  10. Data management for Computer-Aided Engineering (CAE)

    Science.gov (United States)

    Bryant, W. A.; Smith, M. R.

    1984-01-01

    Analysis of data flow through the design and manufacturing processes has established specific information management requirements and identified unique problems. The application of data management technology to the engineering/manufacturing environment addresses these problems. An overview of the IPAD prototype data base management system, representing a partial solution to these problems, is presented here.

  11. Shell stability analysis in a computer aided engineering (CAE) environment

    Science.gov (United States)

    Arbocz, J.; Hol, J. M. A. M.

    1993-01-01

    The development of 'DISDECO', the Delft Interactive Shell DEsign COde is described. The purpose of this project is to make the accumulated theoretical, numerical and practical knowledge of the last 25 years or so readily accessible to users interested in the analysis of buckling sensitive structures. With this open ended, hierarchical, interactive computer code the user can access from his workstation successively programs of increasing complexity. The computational modules currently operational in DISDECO provide the prospective user with facilities to calculate the critical buckling loads of stiffened anisotropic shells under combined loading, to investigate the effects the various types of boundary conditions will have on the critical load, and to get a complete picture of the degrading effects the different shapes of possible initial imperfections might cause, all in one interactive session. Once a design is finalized, its collapse load can be verified by running a large refined model remotely from behind the workstation with one of the current generation 2-dimensional codes, with advanced capabilities to handle both geometric and material nonlinearities.

  12. Estudo de caso de peça moldada pelo processo de injeção-compressão para termoplásticos utilizando análise computacional Study of injection-compression molded part using CAE analysis

    Directory of Open Access Journals (Sweden)

    Thyago M. Kiam

    2007-03-01

    Full Text Available O processamento de termoplásticos através do processo de injeção representa o principal método de fabricação de peças plásticas. Limitações do processo de injeção convencional, principalmente quanto à matéria-prima e configuração e funcionamento das máquinas disponíveis, tornam inviável a produção de produtos com grande área projetada e pequena espessura, como janelas automotivas e alguns tipos de lentes. Paralelamente, o processo de injeção evolui continuamente e há uma série de novas tecnologias geradas a partir do processo original, dentre elas o processo de injeção-compressão. No presente trabalho, utilizando análise computacional, estudou-se a produção de lentes de policarbonato através de dois processos distintos: injeção convencional e processo de injeção-compressão. A seqüência de estudos envolveu basicamente os seguintes pontos: estudo do padrão de preenchimento com conseqüente otimização do processo de injeção-compressão quanto à formação de linha de emenda; estudo da janela de processo para ambos os casos e comparação de alguns parâmetros principalmente tensão de cisalhamento e força de fechamento, por se tratarem de fatores limitantes na produção de peças com grande área projetada. Os resultados para o caso estudado comprovam grande vantagem na utilização do processo de injeção-compressão.The injection-molding of thermoplastics is the main process used in the production of plastics parts. There are some limitations in the conventional injection process, specially related to raw materials, machines configuration and operation, which hamper fabrication of thin parts with large areas such as car windows and lenses. On the other hand, the process has been improved continuously with several new technologies, going beyond the conventional injection molding process, including the "injection-compression" process. In this paper, using CAE (computer aided engineering technology

  13. Experiencia de aplicación de sistemas CAE en estudios de pregrado // Experience of application of CAE systems in undergraduate studies.

    Directory of Open Access Journals (Sweden)

    R. Armas Cardona

    2000-07-01

    Full Text Available Los estudiantes de pregrado reciben entrenamiento y experiencia en el análisis de diseño del mundo real que encontrarán.La motivación que se despierta en los estudiantes de pregrado al enfrentarse a la solución de problemas de resistencia yrigidez reales o a la solución de sistemas mecánicos de formas complejas, es elevada. La diferenciación entre lasposibilidades de cálculo de modelos hechos a mano con los modelos desarrollados en computadora es grande y esto loentiende perfectamente el estudiante de pregrado quien reconoce la poderosa herramienta de trabajo y diseño. Aún más, elestudiante se siente competente y a la vanguardia de la técnica.Este trabajo consiste en mostrar los resultados obtenidos durante el proceso de ensañanza al aplicar un software deelementos finitos. Uno de los objetivos es alcanzar cierta estimación sobre el aprendizaje en las tareas de preprocesamiento,análisis y postprocesamiento ofrecidos por un sistema computacional de elementos finitos poco interactivo. En el curso deun semestre los estudiantes generan entidades paramétricas y no paramétricas, generan mallas de elementos finitos, ploteanresultados, animan el cuerpo modelado y otras tareas características.Palabras claves: Elementos Finitos, aprendizaje, enseñanza, estudio._____________________________________________________________________AbstractThe undergraduate students receive training and experience in the analysis of design of the real world. The motivation inthese students when they are facing the solution of real resistance and rigidity problems or the solution of mechanicalsystems of complex shape is very high. The difference between the calculation possibilities of hand made models with themodels developed in a computer is great and this is perfectly understood by the undergraduate students who recognizes thispowerful mean for work and design. Even more, the student feels competent and using advanced technique. This workshows the results achieve in the teaching of a FEM software. One of the objectives is to reach certain estimate on thelearning in the preprocessing tasks, analysis and postprocessing offered by a not very interactive computational system offinite elements. In the semester, the students be able to generate parametric and not parametric entities, they generatemeshes of finite elements, plot the results, animate the modeling body and other typical tasks.Key words: Finite elements, undergraduate studies, modelation, learning, teaching.

  14. Design Analysis and Optimization of Internal Combustion Engine Piston using CAE tool ANSYS

    OpenAIRE

    Aditya Kumar Gupta; Vinay Kumar Tripathi

    2014-01-01

    In the internal combustion engine there are many reciprocating parts which are responsible for giving the motion to the engine. from them the piston is very important part of the internal combustion engine.. The working condition of the piston is so worst in comparison of other parts of the internal combustion engine. There is very high probability to failure of the piston due to high wear and tear. So there is necessary to inspection the working condition of piston. In before the...

  15. Decentralized (bio)gas storage design with small scale MTT/CAES/TES

    NARCIS (Netherlands)

    C. Pelletier; R. de Boer; H. van Weerden; F. Koopman; M. de Rooij

    2014-01-01

    The increase in renewable energy sources will require an increase in the operational flexibility of the grid, due to the intermittent nature of these sources. This can be achieved for the gas and the electricity grid, which are integrated by means of power-to-gas and vice versa, by applying gas and

  16. New Modularization Framework for the FAST Wind Turbine CAE Tool: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Jonkman, J.

    2013-01-01

    NREL has recently put considerable effort into improving the overall modularity of its FAST wind turbine aero-hydro-servo-elastic tool to (1) improve the ability to read, implement, and maintain source code; (2) increase module sharing and shared code development across the wind community; (3) improve numerical performance and robustness; and (4) greatly enhance flexibility and expandability to enable further developments of functionality without the need to recode established modules. The new FAST modularization framework supports module-independent inputs, outputs, states, and parameters; states in continuous-time, discrete-time, and in constraint form; loose and tight coupling; independent time and spatial discretizations; time marching, operating-point determination, and linearization; data encapsulation; dynamic allocation; and save/retrieve capability. This paper explains the features of the new FAST modularization framework, as well as the concepts and mathematical background needed to understand and apply it correctly. It is envisioned that the new modularization framework will transform FAST into a powerful, robust, and flexible wind turbine modeling tool with a large number of developers and a range of modeling fidelities across the aerodynamic, hydrodynamic, servo-dynamic, and structural-dynamic components.

  17. Parametric Modeling in the CAE Process: Creating a Family of Models

    Science.gov (United States)

    Brown, Christopher J.

    2011-01-01

    This Presentation meant as an example - Give ideas of approaches to use - The significant benefit of PARAMETRIC geometry based modeling The importance of planning before you build Showcase some NX capabilities - Mesh Controls - Associativity - Divide Face - Offset Surface Reminder - This only had to be done once! - Can be used for any cabinet in that "family" Saves a lot of time if pre-planned Allows re-use in the future

  18. Retos de la Cooperación Internacional para el desarrollo: El caso de la CAE

    OpenAIRE

    Mujika Barcena, Arrate

    2018-01-01

    En este TFG se estudia la Cooperación al Desarrollo de la Comunidad Autónoma de Euskadi, así como los retos a los que podría tener que hacer frente, en el marco del Sistema Internacional de Cooperación al Desarrollo. El contenido íntegro está redactado en Castellano.

  19. Air pollution effects on food quality. Final progress report. CAES No. 555-80

    Energy Technology Data Exchange (ETDEWEB)

    Pell, E.J.

    1980-01-01

    The impact of ozone on the qualitative characteristics of potatoes, alfalfa and soybeans is discussed. The impact on yield, total solids, sugar status and tuber glycoalkaloid (TGA) content was measured. The effects of ozone on the leaves were also noted. Field trials were conducted as well as laboratory experiments. (DC)

  20. Modeling and Simulation of Wave Gait of a Hexapod Walking Robot: A CAD/CAE Approach

    Directory of Open Access Journals (Sweden)

    Abhijit Mahapatra

    2013-03-01

    Full Text Available In the present paper, an attempt has been made to carry out dynamic analysis of a hexapod robot using the concept of multibody dynamics. A CAD (Computer Aided Design model of a realistic hexapod robot has been made for dynamic simulation of its locomotion using ADAMS (Automatic Dynamic Analysis of Mechanical Systems multibody dynamics solver. The kinematic model of each leg of three degrees of freedom has been designed using CATIA (Computer Aided Three Dimensional Interactive Application and SimDesigner package in order to develop an overall kinematic model of the robot, when it follows a straight path. Joint Torque variation as well as the variation of the aggregate center of mass of the robot was analyzed for the wave tetrapod gait. The simulation results provide the basis for developing the control algorithm as well as an intelligent decision making for the robot while in motion.

  1. INJECTION MOLDING AND STRUCTURAL ANALYSIS IN METAL TO PLASTIC CONVERSION OF BOLTED FLANGE JOINT BY CAE

    Directory of Open Access Journals (Sweden)

    Marian Blaško

    2014-12-01

    Full Text Available Many metal parts in various applications are being replaced by plastic parts. There are several reasons for that depending on actual application - minimize part cost, enhance corrosion resistance, integrating more components into one part etc. Most important steps of metal to plastic conversion are material selection and design of plastic part. Plastic part has to withstand the same load as metal part. To fulfill this requirement fiber reinforced engineering plastics are often used. Also it is convenient to substitute heavy wall sections with ribbed structure to increase load-carrying ability of part and decrease cycle time, eliminate voids, sink marks etc. Mechanical properties of such part could be highly affected by fiber orientation. Results of fiber orientation from injection molding filling analysis can be used in stress analysis for better prediction of part response to mechanical load. Such coupled analysis is performed here in this case study on bolted flange joint.

  2. Amish Schooling: A Study in Alternatives. CAE Newsletter, Volume 3, Number 2.

    Science.gov (United States)

    Hostetler, John A.

    This paper summarizes the issues underlying the Amish conflicts with public school consolidation and the enforcement of extended compulsory school-age limits. It calls attention to a long-standing strategy for community control of schools contributing to the maintenance of a culturally divergent minority group tradition. None of the traditional…

  3. CRANK-PISTON MODEL OF INTERNAL COMBUSTION ENGINE USING CAD/CAM/CAE IN THE MSC ADAMS

    Directory of Open Access Journals (Sweden)

    Michał BIAŁY

    2017-03-01

    Full Text Available The article presents the modeling and simulation of the crank-piston model of internal combustion engine. The object of the research was the engine of the vehicle from the B segment. The individual elements of the gasoline engine were digitizing using the process of reverse engineering. After converting the geometry, assembling was imported to MSC Adams software. The crank-piston system was specified by boundary conditions of piston forces applied on the pistons crowns. This force was obtain from the cylinder pressure recorded during the tests, that were carried out on a chassis dynamometer. The simulation studies allowed t determine the load distribution in a dynamic state for the selected kinematic pairs.

  4. Estudo, ao microscópio óptico e eletrônico, do rim de caes natural e experimentalmente infectados com Leishmania (Leishmania chagasi

    Directory of Open Access Journals (Sweden)

    Washington Luiz Tafuri

    1989-06-01

    Full Text Available Os autores estudam os rins de 4 cães infectados com Leishmania (Leishmania chagasi. Dois animais (um macho e uma fêmea naturalmente infectados foram sacrificados 18 meses após sua permanência no laboratório. Dois machos foram inoculados por via endovenosa, com lxlO6 promastigotas da cepa MHO/BR/70/BH46 e sacrificados após 18 meses e 2 anos, respectivamente. Em todos os animais os rins estavam lesados. As alterações encontradas foram: (1 glomerulonefrite mesangioproliferativa focal ou difusa, com pronunciada hipertrofia e hiperplasia das células mesangiais e com alargamento da matriz; (2 espessamento da membrana basal com depósitos eletrondensos; (3 nefrite intersticial intertubular crônica com exsudação plasmocitária intensa. (4 degeneração albuminosa dos túbulos renais. Baseados nos achados os autores discutem os prováveis mecanismos patogenéticos.

  5. CAE 2000 Presidential Address: The Council on Anthropology and Education as a Crossroad Community: Reflections on Theory-Oriented and Practice-Oriented Research.

    Science.gov (United States)

    Jacob, Evelyn

    2001-01-01

    Examines the relationship between anthropology and educational research, characterizing the Council on Anthropology and Education as a "crossroad community" and discussing conversations in this crossroad community (e.g., studies oriented toward contributing to anthropological theory or to educational practice). Calls for a horizontal…

  6. Application of CAE-modeling for the study of the influence of the sensor location on the flow-through water heater operation

    Science.gov (United States)

    Yakunin, A. G.

    2018-01-01

    The article deals with issues related to increasing the efficiency of the system of automatic maintenance of the temperature of liquid media entering the pipes to the place of consumption. For this purpose, a flowing water heater model is proposed, made in the SolidWorks environment, the construction parameters of which can be changed using the appropriate macro and screen form. It is shown that the choice of the location of the temperature sensor has a significant effect on such parameters of the device as the accuracy of maintaining a given temperature regime and the duration of the transient process caused by a change in the temperature of the liquid entering the heater. On a concrete example, it is shown that by changing the distance between the sensor and the heating module, it is possible to achieve minimum temperature fluctuations of the heat-transfer-agent at the heater outlet.

  7. El agua no cae del cielo: gobernación y gestión del agua en el Pacífico Sur

    OpenAIRE

    Farias Ferreira, Marcos

    2013-01-01

    La seguridad hídrica se está volviendo una preocupación central en el cotidiano de muchas comunidades rurales por todo el mundo y se relaciona con cada una de las siete dimensiones de la seguridad humana, ampliando todo tipo de vulnerabilidades. De acuerdo con el informe del Foro Económico Mundial sobre el nexo agua-alimentos-energía-clima, la gestión del agua se está volviendo una materia política urgente en el debate de la sostenibilidad y de la seguridad humana a escala global. Asimismo, h...

  8. El agua que nos cae. del origen de la electricidad al nacimiento de empresas públicas de medellín.

    OpenAIRE

    López D, Juan Carlos

    2011-01-01

    Este articulo explora un acápite de la historia social de la técnica, el del origen de la energía eléctrica de fuentes híbridas. Tiene como objeto la relación agua - Energía, relación de la que se ha construido la noción de sistemas hídrico - eléctricos, con una perspectiva regional y administrativa que se atraviesa por algunas de las tensiones históricamente presentadas entre lo público y lo privado.

  9. Sustainable Schools, Sustainable Communities: The View from the West. CAE Spring 2001 Conference [Proceedings] (San Diego, California, March 22-24, 2001).

    Science.gov (United States)

    Malone, Sara

    This paper presents summary conclusions reached by discussion panels that participated in the Committee on Architecture for Education's conference. The conference explored the symbiotic relationship between schools and communities and the ways that schools and communities sustain one another. Panel titles were: "City Heights Urban Village"; "High…

  10. Computed tomography of mast cell tumors in dogs: assessment before and after chemotherapy; Tomografia computadorizada de mastocitomas em caes: avaliacao pre e pos-tratamento quimioterapico

    Energy Technology Data Exchange (ETDEWEB)

    Lorigados, Carla A.B.; Matera, Julia Maria; Pinto, Ana Carolina B.C.F.; Macedo, Thais R., E-mail: clorigados@usp.br [Universidade de Sao Paulo (FMVZ/USP), SP (Brazil). Fac. de Medicina Veterinaria e Zootecnia. Dept. de Cirurgia; Coppi, Antonio A.; Ladd, Fernando V.L. [Universidade de Sao Paulo (LSSCA/USP), SP (Brazil). Fac. de Medicina Veterinaria e Zootecnia. Lab. de Estereologia Estocastica e Anatomia Quimica; Souza, Vanessa A.F. de [Faculdades Metropolitanas Unidas (FMU), Sao Paulo, SP (Brazil). Curso de Medicina Veterinaria

    2013-11-15

    Nineteen dogs with mast cell tumors treated with chemotherapy were evaluated by computed tomography (CT). Were evaluated aspects related to contours, attenuation, postcontrast enhancement and presence of cleavage with adjacent structures. The RECIST criteria and volumetric measurement of lesions were performed to assess the response to treatment. The mast cell tumors presented a homogeneous or heterogeneous attenuation, presented more frequently a well delineated and regular contours and moderate enhancement after intravenous administration of the iodinated contrast media. The methods RECIST and volumetric measurements showed an excellent agreement to the classification of therapeutic response, providing a good parameter of the response to treatment. The CT examination proved to be useful in the delimitation of the tumor and an important tool for planning of surgical margins. (author)

  11. Computed tomographic aspects of primary brain tumors in dogs and cats; Aspectos tomograficos de tumores cerebrais primarios em caes e gatos

    Energy Technology Data Exchange (ETDEWEB)

    Babicsak, Viviam Rocco; Zardo, Karen Maciel; Santos, Debora Rodrigues dos; Silva, Luciana Carandina da; Machado, Vania Maria de Vasconcelos; Vulcano, Luiz Carlos, E-mail: viviam.babicsak@gmail.com [Setor de Diagnostico por Imagem - FMVZ - UNESP/Botucatu, SP (Brazil)

    2011-07-01

    Over the years, the Veterinary Medicine has made great advances, enabling thus the diagnosis of many diseases. As a result of this new situation, there was an increased expectation of life of animals resulting in an increase in the number of clinical care of older animals. Thus, diseases considered unusual in the past, begin to be diagnosed more frequently, as is the case of brain damage. Recently, computed tomography has been widely used in Brazil as a tool to aid in the diagnosis of several diseases. This noninvasive imaging technique allows the identification and evaluation of lesions of central nervous tissue such as brain tumors. This provides information about the size, shape and location of the lesion, in addition to the magnitude of compression and invasion of adjacent structures by the tumor and its side effects (such as the peritumoral edema and hydrocephalus). The image obtained from computed tomography may suggest the presence of a certain type brain tumor, data of great importance for the prognosis and treatment of the animal. This review covers the computed tomography aspects of primary brain tumors such as meningiomas, astrocytomas, oligodendrogliomas, choroid plexus tumors and ependymomas. However, despite the computed tomography provide much information about the changes inside the skull; no way replace histopathological examination in determining the definitive diagnosis. (author)

  12. Radiographic and tomographic study of the elbow joint in dogs; Avaliacao morfologica e morfometrica da articulacao umerorradioulnar em caes atraves de exames radiograficos e por tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Sendyk-Grunkraut, Alessandra; Martin, Claudia M.; Souza, Alexandre N.A.; Patricio, Geni Cristina F.; Lorigados, Carla A.B.; Matera, Julia M.; Fonseca-Pinto, Ana C.B.C., E-mail: anacarol@usp.br [Universidade de Sao Paulo (FMVZ/USP), SP (Brazil). Faculdade de Medicina Veterinaria e Zootecnia

    2017-02-15

    Elbow dysplasia disease includes an united anconeal process, fragmented medial coronoid process, osteochondrosis of humeral trochlea, articular incongruity and degenerative joint disease. The aim of this study was to present detailed morphologic and morphometric aspects of the elbow joint in dog in clinical and correlate with radiographic and tomographic (CT) exam. Inter-observer variation for articular incongruity measurements by CT, comparative analysis in the radiographic exam, angle in ulnar notch and its comparative analysis between radiographic and tomographic agreement examination in 44 elbow of dogs with different ages were evaluated. The statistics analyses included the kappa coefficient and interclass correlation and Fischer's test and McNemar's test. It was evidenced that individual performance of each radiographic incidence had poor agreement with the tomographic exam, suggesting that the accomplishment of more than two radiograph views are needed. There was no agreement between the three evaluators in the ulnar notch angle at radiographic and tomographic exams. However, there was good/moderate agreement for articular incongruity measurement in the sagittal plane between evaluators. It was possible to conclude that none of the five radiographic incidences was better than the others for radiographic analysis because each incidence had a better identification of a particular elbow compartment; measurements at the tomographic exam to evaluate radioulnar incongruity had no reproductiveness in the frontal plane, but in sagittal plan had a good/moderate agreement between observers and the angle in ulnar notch presented no repeatability at radiographic exam and no reproductiveness at tomographic exam. (author)

  13. Diagnosis and evaluation of surveying examination by intracranial tumor in dogs CT; Diagnostico e avaliacao topografica de neoplasias intracranianas pelo exame de TC em caes

    Energy Technology Data Exchange (ETDEWEB)

    Romaldini, Andre Fonseca; Santos, Debora Rodrigues dos; Oliveira, Juliana Messias; Abreu, Felipe Andrei Suarez; Wallace, Verena; Pacheco, Eduardo Nelson da Silva, E-mail: andreromaldini@gmail.com [Hospital Santa Ines de Sao Paulo, Santana, SP (Brazil)

    2012-07-01

    The use of computed tomography (CT) revolutionized image diagnostic in veterinary medicine and currently can be considered one of the most useful tools for the imaging evaluation of intracranial tumor in dogs. Computed tomography of the brain in small animals allows visualization of intracranial tumor, compression of adjacent structures such as cerebral parenchyma, falx or lateral ventricles, and evaluate secondary hemorrhages and edema. The CT imaging provides essential information to indicate the surgical approach for a possible tumor resection or biopsy, including the correct location and boundaries structures involved, and also can be used to monitor the clinical treatment. However, only histopathological examination is able to confirm the final diagnosis. (author)

  14. Assessment in dogs tympanic bulla, through virtual tomographic endoscopy; Avaliacao de bulas timpanicas em caes, por meio da endoscopia tomografica virtual

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Luciana Carandina da; Sabino, Emanuelle Guidugli, E-mail: lucianacarandina@uol.com.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Botucatu, SP (Brazil). Faculdade de Medicina Veterinaria. Dept. de Reproducao Animal e Radiologia Veterinaria; Vulcano, Luiz Carlos; Machado, Vania Maria de Vasconcelos [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Botucatu, SP (Brazil). Faculdade de Medicina Veterinaria

    2012-07-01

    Dogs usually have problems related to the auditory canal. For the diagnosis of these pathologies, it is necessary a physical examination and, in some cases radiographic examination and computed tomography. The tympanic bulla is not easily visualized radiographically, since there is many structures of the brain overlaying the image obtained. The computed tomography has been the technique of choice to assess this structure faithfully. A new alternative assessment of the tympanic bulla is tomographic virtual endoscopy, which allows an improvement of the image obtained through the virtual tomographic technique. This paper provides information on the use of computed tomography, and a new technique, tomographic virtual endoscopy, in order to make the improvement of these techniques, and prove the reliability of these changes in the diagnosis of ear canals of dogs. Therefore, we performed the computed tomography of the tympanic bulla on healthy animals, and later performed image reconstruction in three-dimensional (3D) mode for virtual endoscopy. (author)

  15. Radiographic and tomographic evaluation of total hybrid hip replacement in dogs; Avaliacao radiografica e tomografica de caes submetidosa artroplastia coxofemoral total hibrida

    Energy Technology Data Exchange (ETDEWEB)

    Minto, B.W., E-mail: brunowminto@gmail.com [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Jaboticabal, SP (Brazil); Brandao, C.V.S.; Pereira, G.J.C.; Babicsak, V.R.; Vulcano, L.C.; Rossetto, V.J.V. [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Botucatu, SP (Brazil)

    2016-11-15

    The total hip arthroplasty is the most effective surgical technique for the treatment of severe canine hip dysplasia. Currently, the radiographic examination is the most common method used to assess this procedure in dogs, but has some limitations. CT scan by computed tomography instead enables the acquisition of images without overlap, thereby determining the positioning of prosthetic components with greater accuracy. This research aimed to evaluate by radiography and CT scan examinations the use of a hybrid modular total hip prosthesis developed and made in Brazil, applied experimentally in healthy dogs. Six skeletally mature dogs, which previously underwent surgery on the left hip joint were used. The dogs underwent CT scan at 360 days and three years after surgery. All animals showed good positioning of prosthetic components, and proper joint reduction. In the CT scan, however, it was possible to detect irregular fill areas in some animals. In addition, CT scan allowed the detection and monitoring of areas of bone resorption around the acetabular component. Therefore, the CT scan was useful in the evaluation of prosthetic joints, with the advantage of optimum sharpness of the images and allowing for the possibility of quantifying peri-prosthetic changes and measure joint, fundamental relations for late postoperative follow-up. (author)

  16. Automação e integração CAD/CAE no projeto de estruturas metalicas, utilizando perfis tubulares

    OpenAIRE

    Mauricio Guilherme Quilez Souza

    2006-01-01

    Resumo: Este trabalho tem como objetivo o desenvolvimento de códigos de computador que têm a finalidade de automatizar as etapas principais de um projeto de estruturas metálicas através das linguagens AutoLISP e Delphi5. Os projetos de estruturas metálicas em estudo são os de coberturas com treliças planas constituídas de barras com perfis tubulares laminados sem costuras e seus contraventamentos. Estes perfis tubulares, ainda pouco utilizados em estruturas planas no Brasil, vêm sendo dissemi...

  17. CAE of pulmonary cryptococcosis mimicking hematogenous metastases in an immunocompetent patient: Value of absent 1{sup 8F}- fluorodeoxyglucose uptake on position emission tomography/CT scan

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Chiao Hua; Tzao, Ching; Chang, Tsun Hou; Chang, Wei Chou; Huang, Guo Shu; Lin, Chih Kung; Lin, Hsin Chung; Hsu, Hsian He [Tri-Service General Hospital and National Defense Medical Center, Taipei (China)

    2013-06-15

    The radiologic appearance of multiple discrete pulmonary nodules in immunocompetent patients, with cryptococcal infection, has been rarely described. We describe a case of pulmonary cryptococcosis, presenting with bilaterally and randomly distributed nodules on a computed tomography, mimicking hematogeneous metastases. Positron emission tomography does not demonstrate 1{sup 8F}-fluorodeoxyglucose (FDG) uptake, suggesting a low probability for malignancy, which is a crucial piece of information for clinicians when making a management decision. We find the absence of FDG uptake correlates with the pathologic finding of an infectious nodule, composed of fibrosis and necrosis.

  18. MODELING OF SPATIAL DISTRIBUTION OF SPEEDS OF METAL IN MOLDS WITH VARIOUS TYPE OF CONNECTION OF GATING CHANNELS IN CAE «PROLIT-І»

    Directory of Open Access Journals (Sweden)

    A. N. Chichko

    2012-01-01

    Full Text Available The mathematical apparatus for the calculation analysis of the metal current process in casting mold cavities is described. Boundary conditions for calculation of highspeed regimes and time of filling with metal of complex in the dimensional respect moulds are developed.

  19. Compressed air energy storage technology program. Annual report for 1979

    Energy Technology Data Exchange (ETDEWEB)

    Loscutoff, W.V.

    1980-06-01

    The objectives of the Compressed Air Energy Storage (CAES) program are to establish stability criteria for large underground reservoirs in salt domes, hard rock, and porous rock used for air storage in utility applications, and to develop second-generation CAES technologies that have minimal or no dependence on petroleum fuels. During the year reported reports have been issued on field studies on CAES on aquifers and in salt, stability, and design criteria for CAES and for pumped hydro-storage caverns, laboratory studies of CAES in porous rock reservoris have continued. Research has continued on combined CAES/Thermal Energy Storage, CAES/Solar systems, coal-fired fluidized bed combustors for CAES, and two-reservoir advanced CAES concepts. (LCL)

  20. Determination of bone mineral density of the distal extremity of the radio in Rottweiller, by radiographic optic densitometry;Determinacao da densidade mineral ossea da extremidade distal do radio de caes da raca Rottweiller, por meio da densitometria optica radiografica

    Energy Technology Data Exchange (ETDEWEB)

    Alves, Jefferson Douglas Soares, E-mail: radiologia@unifeob.edu.b [Fundacao de Ensino Octavio Bastos (UNIFEOB), Sao Joao da Boa Vista, SP (Brazil). Fac. de Medicina e Veterinaria; Sterman, Franklin de Almeida [Universidade de Sao Paulo (USP), Butanta, SP (Brazil). Fac. de Medicina Veterinaria e Zootecnia. Dept. de Cirurgia

    2010-06-15

    This study allowed the standardization of the bone mineral density (BMD) of the distal extremity of the radio of 36 dogs adults in Rottweiler breed by radiographic optic densitometry. The limbs of the animals were radiographed with scale of aluminum that served as a reference. The radiographs images were digitalized and analyzed by a computer program for comparison of gray tones between the standard image and the image of the reference scale radiographed with the bone. Afterwards the values of density were expressed in millimeters of aluminum. Also studied the correlations between BMD and the sex, weight and external measures as the length of spine, height of the animal and circumference the distal extremity of the limb in study. The mean values and standard deviations of the bone mineral density of the distal extremity of the radio were: for the metaphyseal region the average of BMD of 7,88+-0,89 mmAl, the diaphyseal region 1 the average of BMD of 8,58+-0,80 mmAl and for diaphyseal region 2 of BMD of 9,00+-0,74 mmAl. (author)

  1. Retrospective study of ear findings of dogs submitted to cranial tomography in FMVZ - UNESP, Botucatu; Estudo retrospectivo dos achados otologicos de caes submetidos a tomografia craniana na FMVZ - UNESP, Botucatu

    Energy Technology Data Exchange (ETDEWEB)

    Babicsak, Viviam Rocco; Oliveira, Hugo Salvador de; Belotta, Alexandra Frey; Santos, Debora Rodrigues dos; Zardo, Karen Maciel; Mamprim, Maria Jaqueline; Machado, Vania Maria de Vasconcelos; Vulcano, Luiz Carlos, E-mail: viviam.babicsak@gmail.com [Universidade Estadual Paulista Julio de Mesquita Filho (FMVZ/UNESP), Botucatu, SP (Brazil). Faculdade de Medicina Veterinaria e Zootecnia. Dept. de Reproducao Animal e Radiologia Veterinaria

    2012-07-01

    Computed tomography (CT) is an important imaging modality in the diagnosis of ear alterations, especially those affecting the middle ear. In this retrospective study, in which the cranial CT scans of 151 dogs were evaluated, the most common finding was the mineralization of the external auditory cartilage, followed by secretions in external and middle ear and tissue in these two regions. The average age of affected animals ranged from 6-9 years. Mixed breed dogs were the most affected animals, followed by cockers, boxers, poodles, labrador retrievers, german shepherds and pit bulls. (author)

  2. Prevalence of brain atrophy in dogs submitted to cranial tomography in FMVZ - UNESP Botucatu: retrospective study; Prevalencia de atrofia cerebral em caes submetidos a tomografia craniana na FMVZ - UNESP Botucatu: estudo retrospectivo

    Energy Technology Data Exchange (ETDEWEB)

    Babicsak, Viviam Rocco; Belotta, Alexandra Frey; Oliveira, Hugo Salvador de; Zardo, Karen Maciel; Santos, Debora Rodrigues dos; Mamprim, Maria Jaqueline; Machado, Vania Maria de Vasconcelos; Vulcano, Luiz Carlos, E-mail: viviam.babicsak@gmail.com [Universidade Estadual Paulista Julio de Mesquita Filho (FMVZ/UNESP), Botucatu, SP (Brazil). Faculdade de Medicina Veterinaria e Zootecnia . Dept. de Reproducao Animal e Radiologia Veterinaria

    2012-07-01

    Brain atrophy is diagnosed by imaging methods that allow the verification of the widening of cerebral sulci and ventricular dilatation. In this retrospective study, in which the cranial CT scans of 150 dogs were evaluated, brain atrophy was identified in 16 animals. Mixed breed dogs were the most affected, followed by poodles, maltese, dachshunds, yorkshires, pinschers and cockers. Brain atrophy was observed in animals of all age groups, being more prevalent in middle aged dogs followed by elderly animals, in which this alteration can be commonly found. The identification of reduced brain volume, however, may not be the cause of neurological signs expressed by animals since in some dogs of this study it was considered a finding. (author)

  3. Evaluación de la tecnología CAES como sistema de almacenamiento de energía eólica. Caso de estudio en España

    OpenAIRE

    Rodríguez Ávila, Laura

    2014-01-01

    Se presenta a continuación un modelo de una planta del almacenamiento de energía mediante aire comprimido siguiendo un proceso adiabático. En esta planta la energía eólica sobrante se usa para comprimir aire mediante un tren de compresión de 25 MW, el aire comprimido será después almacenado en una caverna de sal a 770 metros de profundidad. La compresión se llevará a cabo por la noche, durante 6 horas, debido a los bajos precios de electricidad. Cuando los precios de la electricidad suben dur...

  4. Clinically and radiological aspects of alterations in humeroradiulnar and hip joints in fila brasileiro dogs.; Aspectos clinicos e radiologicos das alteracoes degenerativas das articulacoes umero-radio-ulnar e coxo-femoral de caes da raca fila brasileiro

    Energy Technology Data Exchange (ETDEWEB)

    Araujo, Roberto B. de

    1995-12-31

    Humeroradiulnar and hip joints of 100 fila brasileiro dogs were clinically and radiological studied. the objective was the demonstration of pathologies and their frequency in the metropolitan area of Belo Horizonte, Minas Gerais. The animals were 47 females and 53 males, aged between 9 and 120 months, although 74% of them had less than 36 months and were investigated according their city region and kind of food. Most of the animals came from region III (37%) and used to eat commercial food (32%) and mixed diet composed by commercial food meat and domestic food (26%). Diets with higher density and protein concentrations were more frequent in regions I and III and domestic food in region V. the alterations frequency in the humeroredioulnar joint was 33%. The most frequent pathologies observed were the fragmentation of the coronoid process (39.4%), osteochondrosis dissecans of the medial humeral condyle (31.8%) and ununited anconeal process (28.8%). It was observed significant difference in the frequency of hip dysplasia between the female group (46.5%) and male group (66.7%). For the entire group this frequency was 58%. No significant difference was found in the average inclination angle for normal dogs (149.73 deg {+-} 1.55 deg) and dysplastic dogs dysplasia. Control measures must be applied aiming the reduction of the joint alterations, as the fila brasileiro is a relative new breed. (author). 68 refs., 10 figs., 12 tabs.

  5. Herramientas CAD/CAE en la caracterización tecnológica del Patrimonio Histórico Industrial: Aplicación a una prensa de aceite de oliva

    Directory of Open Access Journals (Sweden)

    José Ignacio Rojas Sola

    2013-05-01

    Full Text Available The olive tree with its fruit, the olive, has been throughout history a culture whose importance has generated a widespread culture along the Mediterranean Sea. Since the days of ancient Egypt until today, its transformation to the consumption of olives, table olives or vegetable fat, has evolved hand in hand with contemporary techniques known. As for obtaining olive oil, fruit or the pressing of the pulp obtained after milling, is a critical point in its manufacture. This process is the goal of this communication which will present a technical analysis of an oil press. This is expected to achieve greater depth of knowledge of the techniques employed in the sector of olive oil.

  6. Thermodynamic Analysis of Three Compressed Air Energy Storage Systems: Conventional, Adiabatic, and Hydrogen-Fueled

    Directory of Open Access Journals (Sweden)

    Hossein Safaei

    2017-07-01

    Full Text Available We present analyses of three families of compressed air energy storage (CAES systems: conventional CAES, in which the heat released during air compression is not stored and natural gas is combusted to provide heat during discharge; adiabatic CAES, in which the compression heat is stored; and CAES in which the compression heat is used to assist water electrolysis for hydrogen storage. The latter two methods involve no fossil fuel combustion. We modeled both a low-temperature and a high-temperature electrolysis process for hydrogen production. Adiabatic CAES (A-CAES with physical storage of heat is the most efficient option with an exergy efficiency of 69.5% for energy storage. The exergy efficiency of the conventional CAES system is estimated to be 54.3%. Both high-temperature and low-temperature electrolysis CAES systems result in similar exergy efficiencies (35.6% and 34.2%, partly due to low efficiency of the electrolyzer cell. CAES with high-temperature electrolysis has the highest energy storage density (7.9 kWh per m3 of air storage volume, followed by A-CAES (5.2 kWh/m3. Conventional CAES and CAES with low-temperature electrolysis have similar energy densities of 3.1 kWh/m3.

  7. Big endothelin-1 level is a useful marker for predicting the presence of isolated coronary artery ectasia.

    Science.gov (United States)

    Wang, Yao; Zhang, Yan; Zhu, Cheng-Gang; Guo, Yuan-Lin; Huang, Qiao-Juan; Wu, Na-Qiong; Gao, Ying; Qing, Ping; Liu, Geng; Dong, Qian; Li, Jian-Jun

    Endothelin-1(ET-1) has been implicated in coronary artery disease (CAD) and may be associated with coronary artery ectasia (CAE). To clarify the relationship between big ET-1 and isolated CAE. We measured big ET-1 with ELISA in 216 patients (CAE, n = 72; CAD, n = 72; normal, n = 72) and evaluated the link with isolated CAE. The level of plasma big ET-1 was significantly higher in patients with isolated CAE (p Big ET-1 was strongly and independently associated with CAE by multivariate analysis (OR 95%CI: 1.026 (1.018-1.034), p = 0.000). Big ET-1 may be a useful predictor for the presence of isolated CAE.

  8. A Novel Hybrid-Fuel Storage System of Compressed Air Energy for China

    Directory of Open Access Journals (Sweden)

    Wenyi Liu

    2014-08-01

    Full Text Available Compressed air energy storage (CAES is a large-scale technology that provides long-duration energy storage. It is promising for balancing the large-scale penetration of intermittent and dispersed sources of power, such as wind and solar power, into electric grids. The existing CAES plants utilize natural gas (NG as fuel. However, China is rich in coal but is deficient in NG; therefore, a hybrid-fuel CAES is proposed and analyzed in this study. Based on the existing CAES plants, the hybrid-fuel CAES incorporates an external combustion heater into the power generation subsystem to heat the air from the recuperator and the air from the high-pressure air turbine. Coal is the fuel for the external combustion heater. The overall efficiency and exergy efficiency of the hybrid-fuel CAES are 61.18% and 59.84%, respectively. Given the same parameters, the cost of electricity (COE of the hybrid-fuel CAES, which requires less NG, is $5.48/MW∙h less than that of the gas-fuel CAES. Although the proposed CAES requires a relatively high investment in the current electricity system in North China, the proposed CAES will be likely to become competitive in the market, provided that the energy supplies are improved and the large scale grid-connection of wind power is realized.

  9. Thermo-Economic Comparison and Parametric Optimizations among Two Compressed Air Energy Storage System Based on Kalina Cycle and ORC

    Directory of Open Access Journals (Sweden)

    Ruixiong Li

    2016-12-01

    Full Text Available The compressed air energy storage (CAES system, considered as one method for peaking shaving and load-levelling of the electricity system, has excellent characteristics of energy storage and utilization. However, due to the waste heat existing in compressed air during the charge stage and exhaust gas during the discharge stage, the efficient operation of the conventional CAES system has been greatly restricted. The Kalina cycle (KC and organic Rankine cycle (ORC have been proven to be two worthwhile technologies to fulfill the different residual heat recovery for energy systems. To capture and reuse the waste heat from the CAES system, two systems (the CAES system combined with KC and ORC, respectively are proposed in this paper. The sensitivity analysis shows the effect of the compression ratio and the temperature of the exhaust on the system performance: the KC-CAES system can achieve more efficient operation than the ORC-CAES system under the same temperature of exhaust gas; meanwhile, the larger compression ratio can lead to the higher efficiency for the KC-CAES system than that of ORC-CAES with the constant temperature of the exhaust gas. In addition, the evolutionary multi-objective algorithm is conducted between the thermodynamic and economic performances to find the optimal parameters of the two systems. The optimum results indicate that the solutions with an exergy efficiency of around 59.74% and 53.56% are promising for KC-CAES and ORC-CAES system practical designs, respectively.

  10. Compressed air energy storage: preliminary design and site development program in an aquifer. Final draft, Task 1: establish facility design criteria and utility benefits

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-10-01

    Compressed air energy storage (CAES) has been identified as one of the principal new energy storage technologies worthy of further research and development. The CAES system stores mechanical energy in the form of compressed air during off-peak hours, using power supplied by a large, high-efficiency baseload power plant. At times of high electrical demand, the compressed air is drawn from storage and is heated in a combustor by the burning of fuel oil, after which the air is expanded in a turbine. In this manner, essentially all of the turbine output can be applied to the generation of electricity, unlike a conventional gas turbine which expends approximately two-thirds of the turbine shaft power in driving the air compressor. The separation of the compression and generation modes in the CAES system results in increased net generation and greater premium fuel economy. The use of CAES systems to meet the utilities' high electrical demand requirements is particularly attractive in view of the reduced availability of premium fuels such as oil and natural gas. This volume documents the Task 1 work performed in establishing facility design criteria for a CAES system with aquifer storage. Information is included on: determination of initial design bases; preliminary analysis of the CAES system; development of data for site-specific analysis of the CAES system; detailed analysis of the CAES system for three selected heat cycles; CAES power plant design; and an economic analysis of CAES.

  11. Differentiation of Attention-Related Problems in Childhood Absence Epilepsy

    Science.gov (United States)

    Vega, Clemente; Vestal, Matthew; DeSalvo, Matthew; Berman, Rachel; Chung, MiHae; Blumenfeld, Hal; Spann, Marisa N.

    2010-01-01

    The current study examined the specific types of attention-related problems CAE children experience and the role of disease factors on the development of attention-related problems. Thirty-eight subjects with CAE and 46 healthy controls, ages 6 to 16 participated in the study. The Behavior Assessment System for Children (BASC) was completed by parents, and the Attention Problems and Hyperactivity subscales were used to characterize CAE children’s problems. Item analysis within the subscales revealed that CAE children demonstrated higher rates of hyperactive (overactivity and fidgetiness) and inattentive (forgetfulness and distractibility) problems, and required more supervision. Within CAE analyses revealed that those who were actively having seizures were more impatient and those with a longer duration of illness were less proficient in completing homework. Children with CAE are at risk for certain inattentive and hyperactive problems, which can differ depending on duration of illness and active seizure status. PMID:20674507

  12. Attention Contributes to Arithmetic Deficits in New-Onset Childhood Absence Epilepsy

    Directory of Open Access Journals (Sweden)

    Dazhi Cheng

    2017-09-01

    Full Text Available Neuropsychological studies indicate that new-onset childhood absence epilepsy (CAE is associated with deficits in attention and executive functioning. However, the contribution of these deficits to impaired academic performance remains unclear. We aimed to examine whether attention and executive functioning deficits account for the academic difficulties prevalent in patients with new-onset CAE. We analyzed cognitive performance in several domains, including language, mathematics, psychomotor speed, spatial ability, memory, general intelligence, attention, and executive functioning, in 35 children with new-onset CAE and 33 control participants. Patients with new-onset CAE exhibited deficits in mathematics, general intelligence, attention, and executive functioning. Furthermore, attention deficits, as measured by a visual tracing task, accounted for impaired arithmetic performance in the new-onset CAE group. Therefore, attention deficits, rather than impaired general intelligence or executive functioning, may be responsible for arithmetic performance deficits in patients with new-onset CAE.

  13. Underground-Energy-Storage Program, 1982 annual report

    Energy Technology Data Exchange (ETDEWEB)

    Kannberg, L.D.

    1983-06-01

    Two principal underground energy storage technologies are discussed--Seasonal Thermal Energy Storage (STES) and Compressed Air Energy Storage (CAES). The Underground Energy Storage Program objectives, approach, structure, and milestones are described, and technical activities and progress in the STES and CAES areas are summarized. STES activities include aquifer thermal energy storage technology studies and STES technology assessment and development. CAES activities include reservoir stability studies and second-generation concepts studies. (LEW)

  14. Small Scale Air Driven Generator

    Science.gov (United States)

    2016-12-01

    generating power from stored compressed air. A. WHAT IS CAES AND WHY USE IT? Compressed air energy storage, or CAES, is the concept of using renewable ...Brayton cycle to produce the power [5,6]. The difference between the two is that CAES uses renewable energy sources to pump air into large caverns...generate and store electrical energy . This goal was achieved by pairing two key enabling technologies to produce mechanical work which was then used to

  15. Optimal design of compressed air energy storage systems

    Energy Technology Data Exchange (ETDEWEB)

    Ahrens, F. W.; Sharma, A.; Ragsdell, K. M.

    1979-01-01

    Compressed air energy storage (CAES) power systems are currently being considered by various electric utilities for load-leveling applications. Models of CAES systems which employ natural underground aquifer formations, and present an optimal design methodology which demonstrates their economic viability are developed. This approach is based upon a decomposition of the CAES plant and utility grid system into three partially-decoupled subsystems. Numerical results are given for a plant employing the Media, Illinois Galesville aquifer formation.

  16. Gene : CBRC-CREM-01-0987 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available tis briggsae] 7e-33 34% MALDIFDVEYLMKYPSLMFSIFGFITNLIHVFFLTRDLKNNPIFVFLTVICVTDLVYLATVAVDETVAVLNYIDHKNCISYINL...etical protein CBG17086 [Caenorhabditis briggsae] emb|CAE70488.1| Hypothetical protein CBG17086 [Caenorhabdi

  17. Underground pumped hydro storage and compressed air energy storage: an analysis of regional markets and development potential

    Energy Technology Data Exchange (ETDEWEB)

    None

    1977-03-01

    The analysis had the following objectives: (1) a survey of the regional markets within the continental United States to identify three regions most suitable for UPHS and CAES; (2) a national survey with emphasis on the three selected regions to determine developmental potential and costs of UPHS and CAES; (3) determine cost effectiveness of UPHS and CAES and their market share in future electric systems; and (4) recommend research, development and demonstration work to realize the timely commercialization of UPHS and CAES system. (TFD)

  18. CONSTRUCCIÓN DE SUBJETIVIDADES POLÍTICAS DE NIÑAS, NIÑOS Y JÓVENES, EN EL CONTEXTO DE LA EXPERIENCIA EDUCATIVA CAE, EN LOS ANDES CENTRALES DEL PERÚ:UN REFERENTE DE CONSTITUCIÓN SOCIOCULTURAL, SOCIOAMBIENTAL

    Directory of Open Access Journals (Sweden)

    MARCO TULIO PEÑA

    2013-07-01

    Full Text Available El presente artículo es producto de los desarrollos investigativos y reflexivos de la experiencia educativa “Construcción de subjetividades políticas de niñas, niños y jóvenes quechuahablantes, en el contexto de la experiencia ‘Comunidades Andinas Educativas’ en los Andes centrales del Perú: un referente de educación alternativa”. Desarrollada entre los años 2008-2009 y 2012, con la participación integral de los actores que formaron parte de esta investigación en el distrito de Pucará, provincia de Huancayo, departamento de Junín, Andes centrales del Perú. El trabajo se presentó como tesis de la Maestría en Desarrollo Educativo y Social en el Centro Internacional de Educación y Desarrollo Humano (Cinde y la Universidad Pedagógica Nacional (Bogotá, Colombia, 2013. Desde el contexto de recuperación de la experiencia educativa, se buscó significar conocimientos en torno a la construcción de subjetividades políticas de niñas, niños y jóvenes andinos considerando su universo sociocultural y socioambiental, diverso y particularizado de las comunidades andinas quechuas. La investigación se enmarcó en la modalidad de la sistematización de experiencias educativas mediante el establecimiento de unidades categoriales interpretativas devenidas de los hitos o momentos centrales, referidas a los procesos de formación y constitución de Asociaciones Educativas Infantiles (AEI y de interpretación, para este caso en la formación de habilidades interculturales y de sostenibilidad medioambiental. Dicho trabajo develó aportes significativos relacionados con la educación comunitaria y alternativa en el aporte a los procesos de motivación y construcción de subjetividades Políticas de niñas, niños y jóvenes andinos, desde contexto sociocultural y socioambiental particularizado y diverso del universo y cosmovisión andina.

  19. Comparative study of the effects of photodynamic therapy and conventional therapy on ligature induced peri-implantitis in dogs; Estudo comparativo dos efeitos do laser de baixa potencia associado a fotossensibilizador e terapia convencional em periimplantes induzidas em mandibulas de caes

    Energy Technology Data Exchange (ETDEWEB)

    Hayek, Ricardo Rada Ahmad

    2004-07-01

    Progressive peri-implanter bone losses, which are accompanied by inflammatory process in the soft tissues is referred to as peri-implantitis. The aim of this study was to compare the effects of lethal photosensitisation with the conventional technique on bacterial reduction in ligature induced peri-implantitis in dogs. Seventeen third pre-molars of Labrador dogs were extracted and, immediately after, the implants were submerged. After osteointegration, peri-implantitis was induced. After 4 months, ligature were removed and the same period was waited for natural induction of bacterial plaque. The dogs were randomly divided into two groups. In the conventional group, they were treated with the conventional techniques of mucoperiosteal flaps for scaling the implant surface and irrigate it. In the laser group, only mucoperiosteal scaling was carried out before photodynamic therapy. On the peri-implanter pocket an azulene paste was injected and a GaAlAs low-power laser ({lambda}= 660 nm, P= 30 mW, E= 5,4 J and {delta}t= 3 min.). Microbiological samples were obtained before and immediately after treatment. One implant was removed to be analyzed by scan electron microscopy to verify contamination on the implant surface. The results of this study showed that Prevotella sp., Fusobacterium e S. Beta-haemolyticus were significantly reduced for the conventional and laser groups. (author)

  20. Avaliação de métodos de projeto de sistemas de refrigeração aplicados a moldes fabricados por vazamento de resina epóxi(vre), através de estudos em sistema CAE

    OpenAIRE

    Pistorello, Roberto Angelo

    2012-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia Mecânica. Moldes protótipos obtidos por vazamento de resina epóxi (VRE) são ferramentas utilizadas durante o desenvolvimento de produtos plásticos injetados e possibilitam a avaliação do projeto do molde e da peça antes da fabricação da ferramenta definitiva, através da moldagem de uma série de protótipos funcionais. Entretanto, o tempo de ciclo e as temperaturas des...

  1. Coronary Artery Ectasia Are Frequently Observed in Patients With Bicuspid Aortic Valves With and Without Dilatation of the Ascending Aorta.

    Science.gov (United States)

    Meindl, Christine; Achatz, Birgit; Huber, Deborah; Baessler, Andrea; Hubauer, Ute; Meisinger, Christa; Hengstenberg, Christian; Erdmann, Jeanette; Buchner, Stefan; Maier, Lars; Schunkert, Heribert; Debl, Kurt; Fischer, Marcus

    2016-10-01

    The presence of coronary artery ectasia (CAE) is influenced by genetic factors and related to the presence of aneurysms in other vascular beds. Bicuspid aortic valve (BAV) disease is frequently accompanied by ascending aortic aneurysm. Because the aortic valve and the proximal parts of the coronary arteries share a common embryonic origin, we hypothesized that CAE is associated with BAV disease. One hundred seventy-seven patients with suspected aortic valve disease (n=94 BAV, n=83 tricuspid aortic valve) underwent both cardiac magnetic resonance imaging and coronary angiography. To confirm the association of CAE with BAV, the frequency of CAE was evaluated in an in-house BAV registry (n=600, n=231 with available coronary angiogram) and compared with the frequency of CAE in the German Myocardial Infarction (MI) Family Study, in which the heritability of CAE was formerly established (n=899). Furthermore, the frequency of CAE was investigated in an observational registry of real-life patients undergoing coronary angiography for clinically indicated reasons (n=3.097) and in a subgroup of the KORA MI study (Cooperative Health Research in the Region of Augsburg), which is a population-based MI registry (n=403).Compared with tricuspid aortic valve disease, CAE occurred more than twice as frequently in cardiac magnetic resonance-confirmed BAV disease (17% versus 44%; P<0.0001) and CAE was observed similarly often in subjects with BAV with (37%) and without (54%, P=0.11) ascending aortic pathology. The common appearance of CAE in patients with BAV could be independently confirmed in the BAV registry (frequency 37%), whereas CAE was found less frequently in family history of positive MI patients (21%), sporadic MI without familial disposition (10%), and rarely in unrelated real-life catheterization patients (6%). To our knowledge, our data show for the first time that ectatic coronary artery disease is a common appearance of BAV disease with and without ascending aortic

  2. Cutaneous adverse events during treatment of chronic inflammatory rheumatic conditions with tumor necrosis factor antagonists: study using the Spanish registry of adverse events of biological therapies in rheumatic diseases.

    Science.gov (United States)

    Hernández, M Victoria; Sanmartí, Raimon; Cañete, Juan D; Descalzo, Miguel A; Alsina, Mercè; Carmona, Loreto; Gomez-Reino, Juan J

    2013-12-01

    To analyze the incidence rate (IR) and risk factors of cutaneous adverse events (CAE) in patients with chronic inflammatory rheumatic diseases treated with tumor necrosis factor (TNF) antagonists. We analyzed all patients from the BIOBADASER (Base de Datos de Productos Biológicos de la Sociedad Española de Reumatología) registry treated with a TNF antagonist (infliximab, etanercept, or adalimumab). Data collected included age, sex, diagnosis and duration of rheumatic disease, type of TNF antagonist, and concomitant treatment. Type of CAE was classified as local or systemic cutaneous manifestation related to treatment administration (infusion reaction), infection, malignancy, or autoimmune skin disease. Time of onset of CAE and outcome were also recorded. The IRs of CAE per 1,000 patient-years of exposure with 95% confidence intervals (95% CIs) were estimated. Multivariable analysis was performed to identify potential risk factors for CAE. A total of 5,437 patients were included, representing 17,330 patient-years of exposure. A total of 920 CAE were reported; the IRs per 1,000 patient-years were 53 (95% CI 50-57) for CAE, 28 (95% CI 25-30) for infection, 15 (95% CI 13-17) for infusion reactions, 5 (95% CI 4-6) for autoimmune skin diseases, and 3 (95% CI 2-4) for skin malignancy. The mean time between starting TNF antagonist treatment and CAE was 1.78 years. In 32% of patients, CAE required TNF antagonist withdrawal. The main risk factors for CAE were female sex and treatment with infliximab, leflunomide, and glucocorticoids. The IR of CAE in patients treated with TNF antagonists is significant and should be addressed carefully, and withdrawal of therapy is required in some cases. Copyright © 2013 by the American College of Rheumatology.

  3. Mean platelet volume in patients with coronary artery ectasia.

    Science.gov (United States)

    Sen, Nihat; Tavil, Yusuf; Yazici, Hüseyin Ugur; Hizal, Fatma; Açikgöz, Sadik Kadri; Abaci, Adnan; Cengel, Atiye

    2007-08-01

    Mean platelet volume (MPV) is an indicator of platelet activation, a central process in the pathophysiology of coronary heart disease. The importance of coronary artery ectasia (CAE) lies in the fact that in 85% of cases it is accompanied by atherosclerotic coronary disease. The present study was designed to investigate MPV values in CAE patients in comparison with individuals with normal coronary angiograms. MPV was measured in 67 consecutive patients (mean age: 55.3+/-9.7 years) with isolated CAE and 55 control subjects (mean age: 53.6+/-10.1 years). Coronary artery ectasia was defined as without any stenotic lesion, on visual assessment, of the coronary arteries with a luminal dilatation 1.5-fold or more of the adjacent normal coronary segments. Four subgroups were composed according to the extension of CAE in coronary arteries. MPV was significantly higher in patients with CAE than in the control group (9.27+/-1.32 vs. 8.40+/-0.95, p<0.001). There were no statistically significant differences in MPV among the subgroups with different CAE severity. It was shown for the first time that patients with CAE have higher MPVs than control subjects with normal coronary angiograms. Hence MPV might be used as a follow-up marker in patients with CAE with or without coronary artery disease.

  4. Gene : CBRC-CBRI-05-0431 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0431 V A Nematode chemoreceptors SRJ38_CAEEL 3e-05 20% ref|XP_00167520...6.1| Hypothetical protein CBG04968 [Caenorhabditis briggsae] emb|CAE57007.1| Hypothetical protein CBG24876 [Caenorhabditis br...iggsae] emb|CAE61194.1| Hypothetical protein CBG04968 [Caenorhabditis briggsae] 0.0 100% MI

  5. Hypolipidemic effect of aqueous leaf extract of carmona microphylla ...

    African Journals Online (AJOL)

    Purpose: To investigate the hypolipidemic effects of the aqueous leaf extract of Carmona microphylla (Lam.) G. Don. (CAE) in vitro and in vivo. Methods: The lipid-lowering effect of CAE was investigated in oleic acid (OA)-induced steatosis in HepG2 liver cells, as well as in high-fat diet (HFD)- and triton WR-1339 ...

  6. African Crop Science Journal: Contact

    African Journals Online (AJOL)

    Principal Contact. Dr. J.S. Tenywa Editor-in-Chief Faculty of Agriculture. Makerere University PO Box 7062 Kampala Uganda. Alternative email address: acsj@caes.mak.ac.ug. Email: acss@caes.mak.ac.ug. Support Contact. Editor Email: johntenywa@gmail.com. ISSN: 2072-6589. AJOL African Journals Online. HOW TO ...

  7. Efecto de un calentamiento con estiramientos estáticos y dinámicos sobre el salto horizontal y la capacidad para repetir esprint con cambio de dirección. [Effect of warm-up with static and dynamic stretching on the horizontal jump and repeated sprint ability with changes of direction

    National Research Council Canada - National Science Library

    Sánchez-Sánchez, Javier; Rodríguez-Fernández, Alejandro; Villa-Vicente, J. Gerardo; Petisco-Rodríguez, Cristina; Ramírez-Campillo, Rodrigo; Gonzalo-Skok, Oliver

    2017-01-01

    ... aeróbico sin estiramiento (CAE), con estiramiento estático (CAES) y con estiramiento dinámico (CAED). Se estudió el efecto agudo de cada calentamiento sobre el rendimiento en una prueba de salto horizontal...

  8. Affinity (tropism) of caprine arthritis encephalitis virus for brain cells ...

    African Journals Online (AJOL)

    In this study, explant cultures prepared from the brain of new-born goat-kid were infected with. Caprine Arthritis Encephalitis (CAE) virus- a retrovirus affecting goats. The specific brain cell types infected by the (CAE) virus were determined using reverse-transcription polymerase chain reaction (RTPCR) and transmission ...

  9. Enduring Inequities, Imagined Futures--Circulating Policy Discourses and Dilemmas in the Anthropology of Education

    Science.gov (United States)

    McCarty, Teresa L.

    2012-01-01

    This article is a slightly revised version of the CAE Presidential Address delivered at the Annual Meeting of the American Anthropological Association in New Orleans, LA on November 20, 2010. The address inaugurated a CAE program change in which a full evening session was devoted to the talk, including commentaries by Hugh Mehan and Sofia…

  10. Compressed Air Energy Storage in Denmark

    DEFF Research Database (Denmark)

    Salgi, Georges Garabeth; Lund, Henrik

    2006-01-01

    Compressed air energy storage system (CAES) is a technology which can be used for integrating more fluctuating renewable energy sources into the electricity supply system. On a utility scale, CAES has a high feasibility potential compared to other storage technologies. Here, the technology...

  11. 75 FR 67697 - Privacy Act of 1974; Systems of Records

    Science.gov (United States)

    2010-11-03

    ... enrollment status at a Center for Academic Excellence (CAE) to include anticipated date of graduation... limited to information necessary to establish the identity of the individual, including name, address, and..., via the DoD IASP recruitment or retention application process; Center for Academic Excellence (CAE...

  12. 76 FR 61679 - Privacy Act of 1974; Systems of Records

    Science.gov (United States)

    2011-10-05

    ... Academic Excellence (CAE) to included anticipated date of graduation, proposed university(ies) and proposed... necessary to establish the identity of the individual, including name, address, and taxpayer identification... application process; Centers for Academic Excellence (CAE)/Institutions via the grants application process...

  13. Electric power generating plant having direct-coupled steam and compressed-air cycles

    Science.gov (United States)

    Drost, M.K.

    1981-01-07

    An electric power generating plant is provided with a Compressed Air Energy Storage (CAES) system which is directly coupled to the steam cycle of the generating plant. The CAES system is charged by the steam boiler during off peak hours, and drives a separate generator during peak load hours. The steam boiler load is thereby levelized throughout an operating day.

  14. Electric power generating plant having direct coupled steam and compressed air cycles

    Science.gov (United States)

    Drost, Monte K.

    1982-01-01

    An electric power generating plant is provided with a Compressed Air Energy Storage (CAES) system which is directly coupled to the steam cycle of the generating plant. The CAES system is charged by the steam boiler during off peak hours, and drives a separate generator during peak load hours. The steam boiler load is thereby levelized throughout an operating day.

  15. Applications and Problems of Computer Assisted Education in Turkey

    Science.gov (United States)

    Usun, Salih

    2006-01-01

    This paper focuses on the Computer Assisted Education (CAE) in Turkey; reviews of the related literature; examines the projects, applications and problems on the Computer Assisted Education (CAE) in Turkey compares with the World; exposes the positive and negative aspects of the projects; a number of the suggestion presents on the effective use of…

  16. Efficiency of Compressed Air Energy Storage

    DEFF Research Database (Denmark)

    Elmegaard, Brian; Brix, Wiebke

    2011-01-01

    The simplest type of a Compressed Air Energy Storage (CAES) facility would be an adiabatic process consisting only of a compressor, a storage and a turbine, compressing air into a container when storing and expanding when producing. This type of CAES would be adiabatic and would if the machines...... electricity storage is 25-45% and thus has a quite low efficiency, which is close to the efficiency of the simple diabatic CAES-process. Adiabatic CAES would reach significantly higher storage efficiency about 70-80%....... were reversible have a storage efficiency of 100%. However, due to the specific capacity of the storage and the construction materials the air is cooled during and after compression in practice, making the CAES process diabatic. The cooling involves exergy losses and thus lowers the efficiency...

  17. Evaluation of the in vitro anti-hyperglycemic effect of Cinnamomum cassia derived phenolic phytochemicals, via carbohydrate hydrolyzing enzyme inhibition.

    Science.gov (United States)

    Kang, B-H; Racicot, K; Pilkenton, S J; Apostolidis, E

    2014-06-01

    Cinnamomum cassia (cinnamon) proanthocyanidins (PACs) are believed to have anti-hyperglycemic potential via stimulation of insulin sensitivity. The present study investigates the carbohydrate hydrolyzing enzyme inhibition of cinnamon PACs. Five grams of cinnamon bark powder were extracted in 100 mL acetone solution (CAE) (acetone: water: hydrochloric acid, 70:29.9:0.01) for 2 h at room temperature and in 100 mL deionized water for 30 min at 90 °C (CWE). PACs were purified from CAE using LH-20 (CAE-PAC) to be further evaluated. PAC contents were evaluated by 4-Dimethylaminocinnamaldehyde (DMAC) assay and yielded 795, 177 and 123 mg/g, for CAE-PAC, CAE and CWE respectively. The total phenolic contents of CAE and CWE were determined to be 152 and 134 mg/g respectively. All extracts were adjusted to the same PAC content (180, 90, 45 and 20 μg) and the inhibitory activity against rat α-glucosidase was determined. The CAE-PAC fraction had very low rat α-glucosidase inhibitory activity, CAE had the highest (IC50 0.474 mg/mL total phenolic (TP) basis) followed by CWE (IC50 0.697 mg/mL TP basis). The specific maltase and sucrase inhibitory activities were determined and CAE (IC50 0.38 and 0.10 mg/mL TP basis) had higher inhibition than CWE (IC50 0.74 and 0.37 mg/mL TP basis). Results suggest that the observed bioactivity is not PAC dependent and that CAE has a higher anti-hyperglycemic potential than CWE via inhibition of carbohydrate hydrolyzing enzymes.

  18. Effects of the topographical extent of coronary artery ectasia on coronary blood flow in patients with aortic aneurysms.

    Science.gov (United States)

    Ikenaga, Hiroki; Kurisu, Satoshi; Watanabe, Noriaki; Shimonaga, Takashi; Higaki, Tadanao; Iwasaki, Toshitaka; Utsunomiya, Hiroto; Mitsuba, Naoya; Ishibashi, Ken; Dohi, Yoshihiro; Imai, Katsuhiko; Sueda, Taijiro; Kihara, Yasuki

    2015-11-01

    Aortic aneurysms are associated with coronary artery ectasia (CAE). However, the relation between the extent of CAE and coronary blood flow in patients with aortic aneurysms is not fully understood. This study was undertaken to assess the angiographic characteristics and effects of the topographical extent of CAE on coronary blood flow in patients with aortic aneurysms. This study consisted of 93 consecutive patients with aortic aneurysms (AA group) and 79 patients without aortic aneurysms who had angiographically normal coronary arteries as the control group (Control group). Coronary flow velocity was determined using the thrombolysis in myocardial infarction frame count (TFC) and the topographical extent of CAE was assessed. In the AA group, 43 patients (46.2 %) had significant coronary artery stenosis and 37 patients (40.2 %) had diffuse CAE. TFC was significantly higher in the AA group than in the control group in all 3 coronary arteries. Furthermore, mean corrected TFC (CTFC) was significantly higher in the AA group than in the control group (40.1 ± 10.7 vs. 25.8 ± 6.5, p < 0.001). In the AA group, mean CTFC in patients with diffuse CAE was significantly higher than that in patients with segmental CAE (50.2 ± 8.7 vs. 33.6 ± 5.2, p < 0.001). The mean CTFC correlated positively with the topographical extent of CAE. Many patients with aortic aneurysms were accompanied with angiographic coronary artery stenosis and CAE. Furthermore, patients with aortic aneurysms had higher CTFC than those without aortic aneurysms and it was primarily driven by more frequent prevalence of diffuse CAE.

  19. Performance Study of Salt Cavern Air Storage Based Non-Supplementary Fired Compressed Air Energy Storage System

    Science.gov (United States)

    Chen, Xiaotao; Song, Jie; Liang, Lixiao; Si, Yang; Wang, Le; Xue, Xiaodai

    2017-10-01

    Large-scale energy storage system (ESS) plays an important role in the planning and operation of smart grid and energy internet. Compressed air energy storage (CAES) is one of promising large-scale energy storage techniques. However, the high cost of the storage of compressed air and the low capacity remain to be solved. This paper proposes a novel non-supplementary fired compressed air energy storage system (NSF-CAES) based on salt cavern air storage to address the issues of air storage and the efficiency of CAES. Operating mechanisms of the proposed NSF-CAES are analysed based on thermodynamics principle. Key factors which has impact on the system storage efficiency are thoroughly explored. The energy storage efficiency of the proposed NSF-CAES system can be improved by reducing the maximum working pressure of the salt cavern and improving inlet air pressure of the turbine. Simulation results show that the electric-to-electric conversion efficiency of the proposed NSF-CAES can reach 63.29% with a maximum salt cavern working pressure of 9.5 MPa and 9 MPa inlet air pressure of the turbine, which is higher than the current commercial CAES plants.

  20. Technical and economic assessment of fluidized bed augmented compressed air energy-storage system. Volume II. Introduction and technology assessment

    Energy Technology Data Exchange (ETDEWEB)

    Giramonti, A.J.; Lessard, R.D.; Merrick, D.; Hobson, M.J.

    1981-09-01

    The results are described of a study subcontracted by PNL to the United Technologies Research Center on the engineering feasibility and economics of a CAES concept which uses a coal fired, fluidized bed combustor (FBC) to heat the air being returned from storage during the power production cycle. By burning coal instead of fuel oil, the CAES/FBC concept can completely eliminate the dependence of compressed air energy storage on petroleum fuels. The results of this assessment effort are presented in three volumes. Volume II presents a discussion of program background and an in-depth coverage of both fluid bed combustion and turbomachinery technology pertinent to their application in a CAES power plant system. The CAES/FBC concept appears technically feasible and economically competitive with conventional CAES. However, significant advancement is required in FBC technology before serious commercial commitment to CAES/FBC can be realized. At present, other elements of DOE, industrial groups, and other countries are performing the required R and D for advancement of FBC technology. The CAES/FBC will be reevaluated at a later date when FBC technology has matured and many of the concerns now plaguing FBC are resolved. (LCL)

  1. Characteristics of Se’i (Rotenesse Smoked Meat Treated with Coconut Shell Liquid Smoked and Citrus aurantifolia Extract

    Directory of Open Access Journals (Sweden)

    G. E. M. Malelak

    2015-08-01

    Full Text Available The objective of this study was to investigate the effect of Citrus aurantifolia extract (CAE, coconut shell liquid smoke (CSLS and the combination of CAE and CSLS (CACS on se’i characteristics. A completely randomized design was assigned in this experiment. Treatments used were: se’i treated with 5% (v/v CAE, CSLS 5% (v/v, (CAE : CSL 1:1 / (CACS and untreated se’i as a control (C. Parameters measured were: aroma, color, taste, pH, residual nitrite, total bacterial count, Coliform, Staphylococcus aureus, Escherichia coli, and Salmonella. The data of aroma, color, and taste were analyzed by using Kruskal-Wallis test followed by Mann-Whitney test. The pH, residual nitrite, and bacterial data were analyzed with analysis of variance (ANOVA followed by least significant differences test. Results showed that CAE caused the highest score at both aroma and taste (P<0.05. CSLS caused the lowest residual nitrite (27 ppm (P<0.05. Application of CAE and CACS could reduce total bacteria (P<0.05 at least 1 log. Color, pH, and Coliform number were not significantly different. S. aureus, E. coli, and Salmonella were negative in all se’i samples. CAE gives the best organoleptics and bacteriological characteristics while CSLS is more effective in reducing nitrite.

  2. Comparison of the acute effects of high-intensity interval training and continuous aerobic walking on inhibitory control.

    Science.gov (United States)

    Kao, Shih-Chun; Westfall, Daniel R; Soneson, Jack; Gurd, Brendon; Hillman, Charles H

    2017-09-01

    The purpose of this study was to investigate the effects of a single bout of high-intensity interval training (HIIT) and continuous aerobic exercise (CAE) on inhibitory control. The P3 component of the stimulus-locked ERP was collected in 64 young adults during a modified flanker task following 20 min of seated rest, 20 min of CAE, and 9 min of HIIT on separate days in counterbalanced order. Participants exhibited shorter overall reaction time following CAE and HIIT compared to seated rest. Response accuracy improved following HIIT in the task condition requiring greater inhibitory control compared to seated rest and CAE. P3 amplitude was larger following CAE compared to seated rest and HIIT. Decreased P3 amplitude and latency were observed following HIIT compared to seated rest. The current results replicated previous findings indicating the beneficial effect of acute CAE on behavioral and neuroelectric indices of inhibitory control. With a smaller duration and volume of exercise, a single bout of HIIT resulted in additional improvements in inhibitory control, paralleled by a smaller and more efficient P3 component. In sum, the current study demonstrated that CAE and HIIT differentially facilitate inhibitory control and its underlying neuroelectric activation, and that HIIT may be a time-efficient approach for enhancing cognitive health. © 2017 Society for Psychophysiological Research.

  3. Predominant vasogenic edema in a patient with fatal cerebral air embolism.

    Science.gov (United States)

    Tanaka, Ryota; Shimada, Yoshiaki; Shimura, Hideki; Oizumi, Hideki; Hattori, Nobutaka; Tanaka, Shigeki

    2012-08-01

    Cerebral air embolism (CAE) is a rare neurologic complication that can occur in patients undergoing various medical procedures or trauma. CAE can sometimes result in death caused by severe brain edema. In spite of these implications, the pathophysiologic mechanisms and radiologic features of fatal CAE remain to be elucidated. In this case report, a patient with carcinomatous pleuritis lost consciousness and developed quadriplegia and had generalized seizures during intrathoracic lavage. Serial computed tomography (CT) revealed the presence of air in intracranial blood vessels following severe brain edema; these are typically observed on the CT scans of patients with fatal CAE. Diffusion-weighted imaging (DWI) of the brain obtained at 24 hours after the onset of CAE revealed scattered cortical gyriform high signal intensity often observed in CAE cases, whereas the apparent diffusion coefficient and T2-weighted imaging revealed diffuse hyperintensity in the subcortical deep white matter, indicating vasogenic edema. Our case showed predominant vasogenic edema rather than cortical ischemic changes in the subcortical deep white matter area. These findings indicate that diffuse subcortical vasogenic edema could be the main cause of mortality in fatal CAE. Copyright © 2012 National Stroke Association. Published by Elsevier Inc. All rights reserved.

  4. Chokeberry Anthocyanin Extract as Pancreatic β-Cell Protectors in Two Models of Induced Oxidative Stress

    Directory of Open Access Journals (Sweden)

    Dumitriţa Rugină

    2015-01-01

    Full Text Available The aim of this study was to investigate the protective effects of a chokeberry anthocyanin extract (CAE on pancreatic β-cells (βTC3 exposed to hydrogen peroxide- (H2O2- and high glucose- (HG- induced oxidative stress conditions. In order to quantify individual anthocyanins high performance liquid chromatography (HPLC coupled to photodiode array (PDA was used. The identification of the fragment ion pattern of anthocyanins was carried out by electrospray ionization mass spectrometry (LC-ESI-MS. The results showed that physiologically achievable concentrations of CAE (1, 5, and 10 μM protect βTC3 against H2O2- and HG-induced cytotoxicity. Antioxidant enzymes such as superoxide dismutase (SOD, catalase (CAT, and glutathione peroxidase (GPx were increased in pancreatic β-cells pretreated with CAE compared to cells exposed to the prooxidant agents. GSH levels initially reduced after exposure to H2O2 and HG were restored by pretreatment with CAE. Insulin secretion in βTC3 cells was enhanced by CAE pretreatment. CAE restored the insulin pool and diminished the intracellular reactive oxygen species level in glucose-induced stress condition in βTC3 cells. These results demonstrate that anthocyanins from CAE were biologically active, showing a secretagogue potential and an antioxidative protection of enzymatic systems, conferring protection against H2O2 and glucose toxicity in βTC3 cells.

  5. Impact of insulin like growth factor-1 in development of coronary artery ectasia

    Directory of Open Access Journals (Sweden)

    Ibrahim Faruk Akturk

    2014-09-01

    Full Text Available Coronary artery ectasia (CAE is characterized by inappropriate dilatation of the coronary vasculature. The mechanisms of CAE are not well known. Insulin-like growth factor-1 (IGF-1 may make endothelial cells and smooth muscle cells more sensitive to the effects of growth hormone. In the present study, we hypothesized that IGF-1 may have an impact on the formation of ectasia and aneurysm in arterial system, and aimed to investigate the associations between the presence of CAE and serum IGF-1 levels in patients undergoing coronary angiography. The study included 2.980 subjects undergoing elective diagnostic coronary angiography. We selected 40 patients diagnosed with CAE as CAE group and 44 subjects with absolutely normal coronary arteries were assigned as normal control group. IGF-1 levels were measured in both groups of patients. Groups were similar in terms of age, sex and coronary artery disease risk factors. The serum IGF-1 levels were significantly higher in CAE patients with 109.64±54.64 ng/mL than in controls with 84.76±34.01 ng/mL (p=0.016. HDL levels were lower in ectasia group with 41.5±10.7 mg/dL than controls with 47.7±10.4 mg/dL (p=0.018. By means of logistic regression analysis, high IGF-1 and low HDL levels were found to be independent risk factors for the presence of CAE (p<0.02, p<0.016, respectively. The study revealed that there was a positive correlation between serum IGF-1 levels and presence of CAE, and high IGF-1 levels and low HDL levels were independent risk factors for the presence of CAE. Future studies are needed to confirm these results.

  6. Relationship Between Plasma Levels of Soluble CD40 Ligand and the Presence and Severity of Isolated Coronary Artery Ectasia.

    Science.gov (United States)

    Ozde, Cem; Korkmaz, Ahmet; Kundi, Harun; Oflar, Ersan; Ungan, Ismail; Xankisi, Vusal; Nurlu, Nilhan

    2016-01-01

    We aimed to investigate whether soluble CD40 ligand (CD40L) levels are higher in patients with isolated coronary artery ectasia (CAE) compared to patients with angiographically normal coronary arteries and those with stable coronary artery disease (CAD). In all, 55 patients with isolated CAE without stenosis, 55 with stable CAD, and 55 control participants with angiographically normal coronary arteries were included. The CAE severity was determined according to the Markis classification. Plasma levels of soluble CD40 ligand were measured by enzyme-linked immunosorbent assay. The baseline characteristics of the 3 groups were similar. Plasma levels of soluble CD40 ligand were significantly higher in patients with CAE and CAD than in controls (2.6 ± 3.1 ng/mL and 2.0 ± 3.1 ng/mL vs 1.8 ± 2.1 ng/mL, P = .004). No difference was found between the CAE and CAD groups. Soluble CD40 ligand level was significantly higher in the type 1 Markis subgroup than that in the type 3 or type 4 subgroups ( P = .01). A receiver operating characteristic curve analysis revealed that soluble CD40 ligand level >1.2 ng/mL identified patients with isolated CAE. Significantly higher levels of soluble CD40 ligand were detected in patients with CAE than that in control participants with normal coronary arteries, suggesting that soluble CD40 ligand may be involved in the pathogenesis of CAE. The CD40-CD40 ligand system likely plays a role in the pathogenesis of CAE.

  7. Attention impairment in childhood absence epilepsy : An impulsivity problem?

    NARCIS (Netherlands)

    Cerminara, Caterina; D'Agati, Elisa; Casarelli, Livia; Kaunzinger, Ivo; Lange, Klaus W.; Pitzianti, Mariabernarda; Parisi, Pasquale; Tucha, Oliver; Curatolo, Paolo

    Although attention problems have often been described in children with childhood absence epilepsy (CAE), the use of different methodological approaches, neuropsychological tests, and heterogeneous experimental groups has prevented identification of the selective areas of attention deficit in this

  8. ORF Alignment: NC_006086 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006086 gi|50914876 >1edt0 6 248 223 459 1e-24 ... emb|CAE84954.1| chitin binding protein [Debaryomyces robe...rtsiae] ... Length = 237 ... Query: 138 WHDKTSDPTEKDKVNSMGELPKEVDLAFIFHDWTKDYSL

  9. Gene : CBRC-CBRI-08-0146 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-08-0146 UN B UNKNOWN SRJ38_CAEEL 0.12 18% emb|CAE73846.1| Hypothetical pr...otein CBG21420 [Caenorhabditis briggsae] 8e-61 100% MPXITLFFSHLLVTVIMTLFYEYSYYFTQCGFVTTSIANTLFIYLTILHIKKITGP

  10. NUE - Novel Universal Ensemble Capability for Overset Grids Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Intelligent Light makers of the FieldView CFD/CAE Post-processing tool, proposes to develop NUE (pronounced noo-ae) - a Novel and Universal capability that manages...

  11. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936399 >1qr0A 1 183 5 186 1e-25 ... emb|CAE28777.1| possible lipopeptide antibiotics... ... possible lipopeptide antibiotics iturin a biosynthesis ... protein [Rhodopseudomonas palu

  12. 75 FR 11917 - Chrysler LLC, Technology Center, Including On-Site Leased Workers from Aerotek, Ajilon, Altair...

    Science.gov (United States)

    2010-03-12

    .../Belcan, Bartech Group Cae Tech, CDI Information Services, Cer-Cad Engineering Resources, Computer Consultants of America, Computer Engrg Services, Compuware, Controller Technologies, Data Communications Corp... Consultants of America, Computer Engrg Services, Compuware, Controller Technologies, Data Communications Corp...

  13. Unilateral cross bite treated by corticotomy-assisted expansion: two case reports

    Directory of Open Access Journals (Sweden)

    Al-Hubail Aziza

    2010-05-01

    Full Text Available Abstract Background True unilateral posterior crossbite in adults is a challenging malocclusion to treat. Conventional expansion methods are expected to have some shortcomings. The aim of this paper is to introduce a new technique for treating unilateral posterior crossbite in adults, namely, corticotomy-assisted expansion (CAE applied on two adult patients: one with a true unilateral crossbite and the other with an asymmetrical bilateral crossbite, both treated via modified corticotomy techniques and fixed orthodontic appliances. Methods Two cases with asymmetric maxillary constriction were treated using CAE. Results In both cases, effective asymmetrical expansion was achieved using CAE, and functional occlusion was established as well. Conclusions Unilateral CAE presents an effective and reliable technique to treat true unilateral crossbite.

  14. Unilateral cross bite treated by corticotomy-assisted expansion: two case reports

    National Research Council Canada - National Science Library

    Hassan, Ali H; AlGhamdi, Ali T; Al-Fraidi, Ahmad A; Al-Hubail, Aziza; Hajrassy, Manar K

    2010-01-01

    .... Conventional expansion methods are expected to have some shortcomings. The aim of this paper is to introduce a new technique for treating unilateral posterior crossbite in adults, namely, corticotomy-assisted expansion (CAE...

  15. Controlling Uncertain Dynamical Systems

    Indian Academy of Sciences (India)

    Author Affiliations. N Ananthkrishnan1 Rashi Bansal2. Head, CAE Analysis & Design Zeus Numerix Pvt Ltd. M-03, SINE, IIT Bombay Powai Mumbai 400076, India. MTech (Aerospace Engineering) with specialization in Dynamics & Control from IIT Bombay.

  16. The New Center for Advanced Energy Studies

    Energy Technology Data Exchange (ETDEWEB)

    L.J. Bond; K. Kostelnik; R.A. Wharton; A. Kadak

    2006-06-01

    A secure and affordable energy supply is essential for achieving U.S. national security, in continuing U.S. prosperity and in laying the foundation to enable future economic growth. The next generation energy workforce in the U.S. is a critical element in meeting both national and global energy needs. The Center for Advanced Energy Studies (CAES) was established in 2005 in response to U.S. Department of Energy (DOE) requirements. CAES, located at the new Idaho National Laboratory (INL), will address critical energy education, research, policy study and training needs. CAES is a unique joint partnership between the Battelle Energy Alliance (BEA), the State of Idaho, an Idaho University Consortium (IUC), and a National University Consortium (NUC). CAES will be based in a new facility that will foster collaborative academic and research efforts among participating institutions.

  17. Lifecycle Cost Analysis of Hydrogen Versus Other Technologies for Electrical Energy Storage

    Energy Technology Data Exchange (ETDEWEB)

    Steward, D. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Saur, G. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Penev, M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ramsden, T. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2009-11-01

    This report presents the results of an analysis evaluating the economic viability of hydrogen for medium- to large-scale electrical energy storage applications compared with three other storage technologies: batteries, pumped hydro, and compressed air energy storage (CAES).

  18. Computers in engineering, 1991

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, G.; Shoup, T.E.

    1991-01-01

    This book is covered under the following topics: Robotics, Computers in Fluid Mechanics/Thermal Systems, CAD/CAM/CAE, Finite Element techniques, Computers in Education, Engineering Database Management, and Artificial Intelligence and Expert Systems.

  19. End-to-End Printed-Circuit Board Assembly Design Using Altium Designer and Solid Works Systems

    National Research Council Canada - National Science Library

    A. M. Goncharenko; A. E. Kurnosenko; V. G. Kostikov; A. V. Lavrov; V. A. Soloviev

    2015-01-01

    .... The article offers an alternate approach to the end-to-end simultaneous development in Altium Designer / Solid Works CAD/CAE systems, which enables a radically shortened time to design new devices...

  20. Gene : CBRC-CBRI-05-0365 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0365 Novel V B Serpentine receptor-like proteins SRX45_CAEEL 2e-12 22%... ref|XP_001674437.1| Hypothetical protein CBG19050 [Caenorhabditis briggsae] ref|XP_001674576.1| Hypothetica...l protein CBG19209 [Caenorhabditis briggsae] emb|CAE71976.1| Hypothetical protein CBG19050 [Caenorhabditis br...iggsae] emb|CAE72115.1| Hypothetical protein CBG19209 [Caenorhabditis briggsae

  1. Gene : CBRC-CBRI-05-0341 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0341 pseudo Novel V A Serpentine receptor-like proteins SRX45_CAEEL 7e...-17 26% ref|XP_001674439.1| Hypothetical protein CBG19053 [Caenorhabditis briggsae] ref|XP_001674578.1| Hypo...thetical protein CBG19212 [Caenorhabditis briggsae] emb|CAE71978.1| Hypothetical protein CBG19053 [Caenorhabditis br...iggsae] emb|CAE72117.1| Hypothetical protein CBG19212 [Caenorhabditis bri

  2. Studies on the potential protective effect of cinnamon against bisphenol A- and octylphenol-induced oxidative stress in male albino rats

    Directory of Open Access Journals (Sweden)

    Ashraf M. Morgan

    2014-01-01

    Full Text Available Among the numerous chemicals discharged into the surrounding environment, bisphenol A (BPA and octylphenol (OP have been shown to increase oxidative stress in body by disturbing the prooxidant/antioxidant balance of cells. Cinnamon aqueous extract (CAE is a natural product rich in polyphenolic compounds that have antioxidant activity. This study was designed to investigate the protective efficacy of CAE against oxidative disorders induced by BPA and OP in male albino rats. Animals were divided into 6 groups (10 rats each and treated orally, 3 times weekly for 50 days. Group 1: control vehicle (olive oil; group 2 (25 mg BPA/kg b.wt./day; group 3 (25 mg OP/kg b.wt./day; group 4 (200 mg CAE/kg b.wt./day; group 5 (CAE 2 h before BPA administration; and group 6 (CAE 2 h before OP administration. BPA- and OP-exposed groups showed insignificant elevation in the final body weight; weight gains and significant reduction only in the relative kidneys weight. Also, BPA and OP exposure resulted in significant increase in serum urea, creatinine and kidney, brain, testicular malondialdehyde (MDA levels. Significant reduction in tissues reduced glutathione (GSH contents; catalase (CAT and superoxide dismutase (SOD activities were also recorded in BPA and OP exposed animals compared to the control vehicle group. Pretreatment with CAE 2 h either before BPA or OP administration ameliorated the BPA- and OP-induced body weight; weight gains and relative organs weight changes and biochemical adverse effects. CAE pretreatment also protected against the recorded pathological changes in kidney, brain and testis. In conclusion, CAE could ameliorate the oxidative toxic effects of BPA and OP indicating its protective antioxidant effect.

  3. A Case of Isolated Coronary Artery Ectasia in the Setting of Chronic Inflamation From human Immunodeficiency Virus Infection.

    Science.gov (United States)

    Heckle, Mark R; Askari, Raza; Morsy, Mohamed; Ibebuogu, Uzoma N

    2016-01-01

    Coronary artery ectasia also known as dilated coronopathy is a relatively rare finding that is most commonly associated with atherosclerosis. Several alternative reasons including congenital malformations and chronic inflammation have been identified as a cause of CAE. In this case, we discuss a 61-year-old male with postoperative chest pain who was found to have localized CAE in the absence of significant atherosclerosis. We also elucidate the recently proposed markers of chronic inflammation that might be associated with coronary artery ectasia.

  4. Disease: H00808 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00808 Idiopathic generalized epilepsies (IGEs), including: Childhood absence epilepsy... (CAE); Juvenile absence epilepsy (JAE); Juvenile myoclonic epilepsy (JME); Epilepsy with generalized to...nic-clonic seizures alone; Familial infantile myoclonic epilepsy (FIME) Idiopathic generalized epilepsies (I...GEs) are the most common types of epilepsy in childhood and adolescence. Based on... the main seizure type and age at onset, four classic subsyndromes exist: childhood absence epilepsy (CAE), juvenile absence epilepsy

  5. Antioxidant, anticlastogenic and radioprotective effect of Coleus aromaticus on Chinese hamster fibroblast cells (V79) exposed to gamma radiation.

    Science.gov (United States)

    Rao, B S Satish; Shanbhoge, R; Upadhya, D; Jagetia, G C; Adiga, S K; Kumar, P; Guruprasad, K; Gayathri, P

    2006-07-01

    Coleus aromaticus (Benth, Family: Laminaceae), Indian Oregano native to India and Mediterranean, is well known for its medicinal properties. A preliminary study was undertaken to elucidate in vitro free radical scavenging potential and inhibition of lipid peroxidation by C.aromaticus hydroalcoholic extract (CAE). Anti-clastogenic and radioprotective potential of CAE were studied using micronucleus assay after irradiating Chinese hamster fibroblast (V79) cells. CAE at 10, 20, 40, 60, 80, 100 and 120 mug/ml resulted in a dose-dependent increase in radical scavenging ability against various free radicals viz., 1,1-diphenyl-2-picrylhydrazyl (DPPH), 2,2-azinobis (3-ethylbenzothiazoline-6-sulfonic acid) (ABTS), superoxide anion (O(2)(*-)), hydroxyl (OH(*)) and nitric oxide (NO(*)) generated in vitro. A maximum scavenging potential was noticed at 100 mug/ml and a saturation point was reached thereafter with the increasing doses of CAE. The free radical scavenging potential of the extract was in the order of DPPH > ABTS > Superoxide > Hydroxyl > Nitric oxide. CAE also exhibited a moderate inhibition of lipid peroxidation in vitro, with a maximum inhibition at 60 mug/ml (33%), attaining saturation at higher doses. The extract also rendered protection against radiation induced DNA damage, as evidenced by the significant (P < 0.05) decrease in the percentage of radiation-induced micronucleated cells (MN) and frequency of micronuclei (total). A maximum anticlastogneic effect/ radioprotection was noticed at a very low concentration i.e., 5 mug/ml of CAE, treated 1 h prior to 2 Gy of gamma radiation. A significant (P < 0.0001) anticlastogenic/radioprotective effect was also observed when the cells were treated with an optimum dose of CAE (5 mug/ml) 1 h prior to 0.5, 1, 2 and 4 Gy of gamma radiation compared with the respective radiation control groups. Overall, our results established an efficient antioxidant, anticlastogenic and radioprotective potential of CAE, which may be of

  6. Computer-aided-engineering system for modeling and analysis of ECLSS integration testing

    Science.gov (United States)

    Sepahban, Sonbol

    1987-01-01

    The accurate modeling and analysis of two-phase fluid networks found in environmental control and life support systems is presently undertaken by computer-aided engineering (CAE) techniques whose generalized fluid dynamics package can solve arbitrary flow networks. The CAE system for integrated test bed modeling and analysis will also furnish interfaces and subsystem/test-article mathematical models. Three-dimensional diagrams of the test bed are generated by the system after performing the requisite simulation and analysis.

  7. Studies on the potential protective effect of cinnamon against bisphenol A- and octylphenol-induced oxidative stress in male albino rats.

    Science.gov (United States)

    Morgan, Ashraf M; El-Ballal, Salah S; El-Bialy, Badre E; El-Borai, Nermeen B

    2014-01-01

    Among the numerous chemicals discharged into the surrounding environment, bisphenol A (BPA) and octylphenol (OP) have been shown to increase oxidative stress in body by disturbing the prooxidant/antioxidant balance of cells. Cinnamon aqueous extract (CAE) is a natural product rich in polyphenolic compounds that have antioxidant activity. This study was designed to investigate the protective efficacy of CAE against oxidative disorders induced by BPA and OP in male albino rats. Animals were divided into 6 groups (10 rats each) and treated orally, 3 times weekly for 50 days. Group 1: control vehicle (olive oil); group 2 (25 mg BPA/kg b.wt./day); group 3 (25 mg OP/kg b.wt./day); group 4 (200 mg CAE/kg b.wt./day); group 5 (CAE 2 h before BPA administration); and group 6 (CAE 2 h before OP administration). BPA- and OP-exposed groups showed insignificant elevation in the final body weight; weight gains and significant reduction only in the relative kidneys weight. Also, BPA and OP exposure resulted in significant increase in serum urea, creatinine and kidney, brain, testicular malondialdehyde (MDA) levels. Significant reduction in tissues reduced glutathione (GSH) contents; catalase (CAT) and superoxide dismutase (SOD) activities were also recorded in BPA and OP exposed animals compared to the control vehicle group. Pretreatment with CAE 2 h either before BPA or OP administration ameliorated the BPA- and OP-induced body weight; weight gains and relative organs weight changes and biochemical adverse effects. CAE pretreatment also protected against the recorded pathological changes in kidney, brain and testis. In conclusion, CAE could ameliorate the oxidative toxic effects of BPA and OP indicating its protective antioxidant effect.

  8. Incidence of esophageal cancer in Sri Lanka: Analysis of cancer registry data and comparison with other South Asian populations.

    Science.gov (United States)

    Wickramasinghe, Dakshitha P; Samarasekera, Dharmabandhu N

    2017-10-01

    The objectives of this study were to report the incidence of Carcinoma of Esophagus (CaE) in Sri Lanka and to compare these values with other cancer registry data of the region and with migrant populations. We compared the data published by the National Cancer Control Program over the last two decades with data from the National Cancer Registry Programme of the Indian Council of Medical Research and Karachi Cancer Registry. SEERstat was used to analyze the surveillance, epidemiology and end results database to analyze data on Indian migrant population. CaE was the fourth most common cancer overall and among females and third most common cancer among males. The incidence of CaE rises with age in both sexes, with a peak in the 70-74 year age group. There was a disproportionately higher number of CaE in the Tamil population (chi-square test, P Sri Lanka was squamous cell carcinoma, Not otherwise specified (NOS) (n = 750, 70.5%), followed by adenocarcinoma, NOS (n = 83, 7.8%). India, Pakistan and Sri Lanka have comparable age-adjusted incidence and age distribution of CaE. All migrant populations had lower incidence of CaE than original population or population in their present country. Both cigarette smoking and alcohol consumption are more prevalent in Sri Lankan males than females. The incidence of CaE and its distribution among age groups in Sri Lanka was comparable to other countries of the region. Persons of Tamil ethnicity have a higher risk of developing CaE. © 2016 John Wiley & Sons Australia, Ltd.

  9. The relationship between elevated magnesium levels and coronary artery ectasia.

    Science.gov (United States)

    Yolcu, Mustafa; Ipek, Emrah; Turkmen, Serdar; Ozen, Yücel; Yildirim, Erkan; Sertcelik, Alper; Ulusoy, Fatih Rifat

    Coronary artery ectasia (CAE) without specific symptoms is the localised or diffuse swelling of the epicardial coronary arteries. Magnessium (Mg) plays an important role in cardiac excitability, vascular tonus, contractibility, reactivity and vasodilatation. In our research, we aimed to study the vasodilatory effect of Mg in the aetiopathogenesis of ectasia. Patients identified during routine coronary angiograms in our clinic between January 2010 and 2013 were included in the study. Sixty-two patients with isolated CAE, 57 with normal coronary angiograms (NCA), 73 with severe coronary artery disease (CAD), and 95 with stenosis of at least one coronary artery and CAE (CAD + CAE) were included in the study. Serum Mg levels were measured in mg/dl after 12 hours of fasting. There were no statistically significant differences between the groups in terms of age, hypertension, smoking, hyperlipidaemia, diabetes mellitus, family history of coronary artery disease and medications used. Serum glucose, thyroid stimulating hormone (TSH), urea, total cholesterol, triglyceride, low-density lipoprotein (LDL) cholesterol, sodium and potassium levels were similar in all groups. Serum Mg levels were 1.90 ± 0.19 mg/dl in patients with isolated CAE, 1.75 ± 0.19 mg/dl in those with CAD, 1.83 ± 0.20 mg/dl in those with CAD + CAE, and 1.80 ± 0.16 mg/dl in the NCA group. These results show that Mg levels were higher in ectasia patients with or without CAD. The histopathological characteristics of patients with CAE were similar to those with CAD. The specific mechanism of abnormal luminal dilatation seen in CAE however remains to be elucidated. Mg is a divalent cation with powerful vasodilatory effects. In our study, serum Mg levels were found to be statistically higher in ectasia patients with or without CAD.

  10. Inflammatory mediators of coronary artery ectasia

    OpenAIRE

    Yuan, Shi-Min

    2014-01-01

    The exact mechanisms underlying coronary artery ectasia (CAE) remain uncertain. This study aims to investigate whether and how inflammatory mediators play a role in the pathogenesis of CAE. The data sources of this study were located by literature searches on MEDLINE, Highwire Press and Google search engine for the year range 2000-2013. The most sensitive of the four types of plasma inflammatory mediators were cell adhesion molecules and systemic inflammatory markers followed by cytokines, wh...

  11. High-performance genetic analysis on microfabricated capillary array electrophoresis plastic chips fabricated by injection molding.

    Science.gov (United States)

    Dang, Fuquan; Tabata, Osamu; Kurokawa, Masaya; Ewis, Ashraf A; Zhang, Lihua; Yamaoka, Yoshihisa; Shinohara, Shouji; Shinohara, Yasuo; Ishikawa, Mitsuru; Baba, Yoshinobu

    2005-04-01

    We have developed a novel technique for mass production of microfabricated capillary array electrophoresis (mu-CAE) plastic chips for high-speed, high-throughput genetic analysis. The mu-CAE chips, containing 10 individual separation channels of 50-microm width, 50-microm depth, and a 100-microm lane-to-lane spacing at the detection region and a sacrificial channel network, were fabricated on a poly(methyl methacrylate) substrate by injection molding and then bonded manually using a pressure-sensitive sealing tape within several seconds at room temperature. The conditions for injection molding and bonding were carefully characterized to yield mu-CAE chips with well-defined channel and injection structures. A CCD camera equipped with an image intensifier was used to monitor simultaneously the separation in a 10-channel array with laser-induced fluorescence detection. High-performance electrophoretic separations of phiX174 HaeIII DNA restriction fragments and PCR products related to the human beta-globin gene and SP-B gene (the surfactant protein B) have been demonstrated on mu-CAE plastic chips using a methylcellulose sieving matrix in individual channels. The current work demonstrated greatly simplified the fabrication process as well as a detection scheme for mu-CAE chips and will bring the low-cost mass production and application of mu-CAE plastic chips for genetic analysis.

  12. Central washout sign in computer-aided evaluation of breast MRI: preliminary results

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Eun Sook (Dept. of Radiology, Samsung Medical Center, Sungkyunkwan Univ. School of Medicine, Seoul (Korea, Republic of)), e-mail: mathilda0330@gmail.com; Choi, Hye Young (Dept. of Radiology, Gyeongsang National Univ. Hospital, Jinju (Korea, Republic of)); Lee, Byung Hee (Dept. of Radiology, Korea Cancer Centre Hospital, Seoul (Korea, Republic of)); Noh, Woo-Chul (Dept. of Surgery, Korea Cancer Centre Hospital, Seoul (Korea, Republic of)); Kim, Rock Bum (Dept. of Preventive Medicine, Gyeongsang National Univ., Jinju (Korea, Republic of))

    2011-04-15

    Background: Although computer-aided evaluation (CAE) programs were introduced to help differentiate benign tumors from malignant ones, the set of CAE-measured parameters that best predict malignancy have not yet been established. Purpose: To assess the value of the central washout sign on CAE color overlay images of breast MRI. Material and Methods: We evaluated the frequency of the central washout sign using CAE. The central washout sign was determined so that thin, rim-like, persistent kinetics were seen in the periphery of the tumor. Then, sequentially, plateau and washout kinetics appeared. Two additional CAE-delayed kinetic variables were compared with the central washout sign for assessment of diagnostic utility: the predominant enhancement type (washout, plateau, or persistent) and the most suspicious enhancement type (any washout > any plateau > any persistent kinetics). Results: One hundred and forty-nine pathologically proven breast lesions (130 malignant, 19 benign) were evaluated. A central washout sign was associated with 87% of malignant lesions but only 11% of benign lesions. Significant differences were found when delayed-phase kinetics were categorized by the most suspicious enhancement type (P< 0.001) and the presence of the central washout sign (P< 0.001). Under the criteria of the most suspicious kinetics, 68% of benign lesions were assigned as plateau or washout pattern. Conclusion: The central washout sign is a reliable indicator of malignancy on CAE color overlay images of breast MRI

  13. Anacardium occidentale L. extract in cosmetic formulations: benefits for oily skin

    Directory of Open Access Journals (Sweden)

    Daiane G. Mercurio

    2017-07-01

    Full Text Available Cashew (Annacardium occidentale L, family: Anacardiaceae. is a native plant from tropical America, and is widely cultivated in Asia and Africa. It has great socioeconomic importance for Brazil and for many other countries. Cashew apple (Anacardium occidentale L., extract (CAE is rich in tannins, flavonoids, amino acids, anacardic acids and vitamin C, which can provide desirable benefits to oily skin. The aim of this study was to assess the antioxidant activity of CAE and the improvement of oily skin after application of a sunscreen containing this extract. The antioxidant activity of CAE was evaluated by chemioluminescence assay. A sunscreen was developed and added (FC, or not (F, with 3.5% of CAE. Transepidermal water loss, stratum corneum water content, sebum content and skin microrelief were evaluated before and after two and four hours of a single application of the F or FC formulations. FC effects on skin were also evaluated after a 28 day-period of twice daily applications on the faces of 12 volunteers. Skin imaging techniques were used to evaluate skin pores and comedones, and sensory analysis was performed. CAE showed antioxidant activity and the FC formulation controlled the sebum secretion after two and four hours. FC reduced the number of skin pores (24% and did not increase the number of comedones. These results indicate that CAE is an innovative active ingredient from Brazilian biodiversity with antioxidant activity and efficacy to improve oily skin conditions.

  14. Centella asiatica extract protects against amyloid β1–40-induced neurotoxicity in neuronal cells by activating the antioxidative defence system

    Directory of Open Access Journals (Sweden)

    Chien-Li Chen

    2016-10-01

    Full Text Available Centella asiatica (雷公根 léi gōng gēn is a traditional medicinal herb with high antioxidant activity, which decreases amyloid-β (Aβ deposition in the brain. At the same time, aggregated Aβ-induced oxidative stress is the trigger in the pathogenesis of Alzheimer's disease (AD. Here, we investigated the ability of C. asiatica ethanol extract (CAE to protect PC12 and IMR32 cells from Aβ1–40-induced production of reactive oxygen species (ROS and concomitant neurotoxicity. Aggregated Aβ1–40 treatment resulted in reduced cell viability, which can be reversed by cotreatment with 25, 50, and 100 μg/mL CAE. Moreover, CAE eliminated the Aβ1–40-mediated increase in ROS production. Thus, CAE-mediated protection against aggregated Aβ1–40-induced neurotoxicity is attributable to modulation of the antioxidative defense system in cells, including the activities of superoxide dismutase, catalase, glutathione peroxidase, glutathione reductase, and levels of glutathione and glutathione disulfide by CAE. This emphasizes the potential therapeutic and preventive value of CAE in the treatment of AD.

  15. Centella asiatica Leaf Extract Protects Against Indomethacin-Induced Gastric Mucosal Injury in Rats.

    Science.gov (United States)

    Zheng, Hong-Mei; Choi, Myung-Joo; Kim, Jae Min; Cha, Kyung Hoi; Lee, Kye Wan; Park, Yu Hwa; Hong, Soon-Sun; Lee, Don Haeng

    2016-01-01

    The present study evaluated the protective effect of Centella asiatica (gotu kola) leaf extract (CAE) against indomethacin (IND)-induced gastric mucosal injury in rats. Gastric mucosal injury was induced by the oral administration of IND to the rats after a 24 h fast. CAE (50 or 250 mg/kg) or lansoprazole (a reference drug) was orally administrated 30 min before the IND administration, and 5 h later, the stomachs were removed to quantify the lesions. Orally administered CAE significantly reduced IND-induced gastric injury. The histopathological observations (hematoxylin-eosin and Periodic acid-Schiff staining) confirmed the protection against gastric mucosal injury. Also, CAE decreased the malondialdehyde content compared to the control group. Moreover, pretreatment with CAE resulted in a significant reduction in the elevated expression of tumor necrosis factor, Cyclooxygenase (COX)-2, and inducible nitric oxide synthase. These results suggested that CAE possesses gastroprotective effects against IND-induced gastric mucosal injury, which could be attributed to its ability to inhibit lipid peroxidation and stimulate gastric mucus secretion in the rat gastric mucosa.

  16. Prevalence and morphology of coronary artery ectasia with dual-source CT coronary angiography

    Energy Technology Data Exchange (ETDEWEB)

    Leschka, Sebastian [University Hospital Zurich, Institute of Diagnostic Radiology, Zurich (Switzerland); Kantonsspital St. Gallen, Institute of Radiology, St. Gallen (Switzerland); Stolzmann, Paul; Scheffel, Hans; Marincek, Borut; Alkadhi, Hatem [University Hospital Zurich, Institute of Diagnostic Radiology, Zurich (Switzerland); Wildermuth, Simon [Kantonsspital St. Gallen, Institute of Radiology, St. Gallen (Switzerland); Plass, Andre; Genoni, Michele [University Hospital Zurich, Clinic for Cardiovascular Surgery, Zurich (Switzerland)

    2008-12-15

    To assess the prevalence and morphological characteristics of coronary artery ectasia (CAE) with CT coronary angiography (CTCA) in comparison to conventional catheterangiography (CCA). Dual-source CTCA examinations from 677 consecutive patients (223 women; median age 57 years) were retrospectively evaluated by two blinded observers for the presence of CAE defined as a diameter enlargement {>=}1.5 times the diameter of adjacent normal coronary segments. Vessel diameters and contrast attenuation within and proximal to ectatic segments were measured. CCA was used to compare measurements obtained from CTCA with the coronary flow velocity by using the thrombolysis in myocardial infarction (TIMI) frame count. CTCA identified CAE in 20 of 677 (3%) patients. CCA was performed in ten of these patients. CAE diameter measurements with CTCA (10.0 {+-} 5.4 mm) correlated significantly (r = 0.92, p < 0.001) with the CCA measurements (8.8 {+-} 4.9 mm), but had higher diameters (levels of agreement: -1.0 to 3.4 mm). Contrast attenuation was significantly lower in the ectatic (343 {+-} 63 HU) than in the proximal (394 {+-} 60 HU) segments (p < 0.01). The attenuation difference significantly correlated with the CAE ratio (r = 0.67, p < 0.01) and the TIMI frame count (r = 0.58, p < 0.05). The prevalence of CAE in a population examined by CTCA is around 3%. Contrast attenuation measurements with CTCA correlate well with the flow alterations assessed with CCA. (orig.)

  17. Effect of Concentrated Apple Extract on Experimental Colitis Induced by Acetic Acid.

    Science.gov (United States)

    Pastrelo, Maurício Mercaldi; Dias Ribeiro, Carla Caroline; Duarte, Joselmo Willamys; Bioago Gollücke, Andréa Pitelli; Artigiani-Neto, Ricardo; Ribeiro, Daniel Araki; Miszputen, Sender Jankiel; Fujiyama Oshima, Celina Tizuko; Ribeiro Paiotti, Ana Paula

    2017-01-01

    Reactive oxygen and nitrogen species (ROS/RNS) play a crucial role in inflammatory bowel disease (IBD) exacerbating the chronic inflammatory process. Endogenous and diet antioxidants can neutralize these compounds. The apple is widely consumed, with several antioxidant activity compounds. The present study evaluated the effects of concentrated apple extract (CAE) in acetic acid induced colitis. 29 Wistar male rats were randomized into 5 groups. G1-Sham/saline solution, G2-CAE/control, G3-acetic acid/control, G4-curative- CAE treatment and G5-preventive-CAE treatment. Eight days later, the animals were euthanized and the colonic segment resected for macroscopic and histological analysis. Gene expression was evaluated for inducible nitric oxide synthase (iNOS), cyclooxygenase-2 (COX-2), catalase and copper and zinc superoxide dismutase (CuZnSOD) by quantitative real time PCR, while protein expression was assessed for iNOS, COX-2 and 8-hydroxy-20-deoxyguanosine (8-OHdG) via immunohistochemistry. The groups G3, G4 and G5 had weight loss, while G5 had weight increase at the end of the experiment. The treatment with CAE reduced the macroscopic and microscopic injury, decreased iNOS mRNA expression and increased CuZnSOD mRNA expression in animals with induced acetic acid-colitis. The findings of the present study suggest that CAE treatment exerts an antioxidant role by downregulating iNOS and upregulating CuZnSOD.

  18. Thermal reservoir sizing for adiabatic compressed air energy storage

    Energy Technology Data Exchange (ETDEWEB)

    Kere, Amelie; Goetz, Vincent; Py, Xavier; Olives, Regis; Sadiki, Najim [Perpignan Univ. (France). PROMES CNRS UPR 8521; Mercier-Allart, Eric [EDF R et D, Chatou (France)

    2012-07-01

    Despite the operation of the two existing industrial facilities to McIntosh (Alabama), and for more than thirty years, Huntorf (Germany), electricity storage in the form of compressed air in underground cavern (CAES) has not seen the development that was expected in the 80s. The efficiency of this form of storage was with the first generation CAES, less than 50%. The evolving context technique can significantly alter this situation. The new generation so-called Adiabatic CAES (A-CAES) is to retrieve the heat produced by the compression via thermal storage, thus eliminating the necessity of gas to burn and would allow consideration efficiency overall energy of the order of 70%. To date, there is no existing installation of A-CAES. Many studies describe the principal and the general working mode of storage systems by adiabatic compression of air. So, efficiencies of different configurations of adiabatic compression process were analyzed. The aim of this paper is to simulate and analyze the performances of a thermal storage reservoir integrated in the system and adapted to the working conditions of a CAES.

  19. Experimental investigation of stability, frequency and toroidal mode number of compressional Alfvén eigenmodes in DIII-D

    Science.gov (United States)

    Tang, S.; Thome, K.; Pace, D.; Heidbrink, W. W.; Carter, T. A.; Crocker, N. A.; NSTX-U Collaboration; DIII-D Collaboration

    2017-10-01

    An experimental investigation of the stability of Doppler-shifted cyclotron resonant compressional Alfvén eigenmodes (CAE) using the flexible DIII-D neutral beams has begun to validate a theoretical understanding and realize the CAE's diagnostic potential. CAEs are excited by energetic ions from neutral beams [Heidbrink, NF 2006], with frequencies and toroidal mode numbers sensitive to the fast-ion phase space distribution, making them a potentially powerful passive diagnostic. The experiment also contributes to a predictive capability for spherical tokamak temperature profiles, where CAEs may play a role in energy transport [Crocker, NF 2013]. CAE activity was observed using the recently developed Ion Cyclotron Emission diagnostic-high bandwidth edge magnetic sensors sampled at 200 MS/s. Preliminary results show CAEs become unstable in BT ramp discharges below a critical threshold in the range 1.7 - 1.9 T, with the exact value increasing as density increases. The experiment will be used to validate simulations from relevant codes such as the Hybrid MHD code [Belova, PRL 2015]. This work was supported by US DOE Grants DE-SC0011810 and DE-FC02-04ER54698.

  20. Therapeutic Effects of Cortex acanthopanacis Aqueous Extract on Bone Metabolism of Ovariectomized Rats

    Directory of Open Access Journals (Sweden)

    Zhiguo Zhang

    2012-01-01

    Full Text Available The aim of this study was to evaluate effects of aqueous extract from Cortex acanthopanacis (CAE on osteoporosis rats induced by ovariectomy (OVX using aqueous extract from Folium Epimedii (FEE as positive control agent. Three-month-old female rats that underwent OVX were treated with CAE. After 12 weeks, bone mineral density (BMD and indices of bone histomorphometry of tibia were measured. Levels of protein and mRNA expression of osteoprotegerin (OPG and receptor activator of nuclear factor kappa-B ligand (RANKL in tibia were evaluated. In addition, the serum concentrations of osteocalcin (OC, interleukin-1 beta (IL-1β, interleukin-6 (IL-6, calcitonin (CT, and parathyroid hormone (PTH were determined. Administration of CAE significantly prevented OVX-induced rats from gain of the body weight. Treatment with CAE increased bone mass remarkably and showed a significant inhibitory effect on bone resorption by downregulating significantly the expression of RANKL in tibia of OVX rats. Meanwhile, treatment of CAE significantly reduced serum level of IL-1β and increased level of CT in OVX rats. This suggests that CAE has the potential to be used as an alternative therapeutic agent for postmenopausal osteoporosis.

  1. [Municipal School Nutrition Councils in Santa Catarina, Brazil: characterization and performance profile].

    Science.gov (United States)

    Gabriel, Cristine Garcia; Machado, Manuella de Souza; Schmitz, Bethsáida de Abreu Soares; Corso, Arlete Catarina Tittoni; Caldeiras, Gilberto Veras; de Vasconcelos, Francisco de Assis Guedes

    2013-04-01

    The aim of this study is to assess Municipal School Nutrition Councils (CAEs) of the Brazilian School Nutrition Program (PNAE) in the state of Santa Catarina, Brazil. A cross-sectional study was conducted with a sample of municipalities in the state (n = 152; 52%). CAE presidents were interviewed and asked about the counselor profile, attributions performed and the relation of CAEs with other local councils. Poisson regression analysis was conducted to obtain unadjusted and adjusted prevalence ratios and the adjusted model adopted a hierarchic approach. The majority of councils analyzed their accounting reports, monitored resources and strived for quality of the CAEs at all levels. They coordinated the storage of food, participated in establishing the menu, monitored the purchasing of food and had an internal control system. However, only 22.4% carried out all their attributions once or more per year. A positive association was found between an adequate performance of the CAE and relations with other local councils. The awareness of the CAEs, as well as a stimulus to acting jointly with other councils and actors involved with food and nutrition security, are essential to ensure the right to healthy and adequate nutrition at school.

  2. Ca-Eskola incorporation in clinopyroxene: limitations and petrological implications for eclogites and related rocks

    Science.gov (United States)

    Schroeder-Frerkes, F.; Woodland, A. B.; Uenver-Thiele, L.; Klimm, K.; Knapp, N.

    2016-12-01

    Clinopyroxene is an essential mineral in eclogitic rocks. It commonly contains minor amounts of the defect-bearing Ca-Eskola (CaEs, Ca0.5□0.5AlSi2O6) component, with higher concentrations generally considered to indicate a high-pressure origin at least within the coesite stability field. Changes in pressure and temperature conditions can lead to exsolution of this component as a free SiO2 phase, which may have a number of petrological implications. This makes it important to understand the factors that maximize CaEs incorporation in clinopyroxene. We have undertaken a series of experiments at high pressures and temperatures (4-10 GPa and 1000-1350 °C) to further investigate the systematics of CaEs incorporation in eclogite-like clinopyroxene and the factors responsible for maximizing CaEs contents. Two simple chemical systems were chosen that allow unambiguous interpretation of the results: (1) CMAS + H2O and (2) two compositions in the NCMAS system. All experimental products contained clinopyroxene and garnet along with either a free SiO2 phase or a silicate melt. Coexisting garnet is grossular-rich, generally with X gr ≥ 0.67. Compositional variations are attributable to the presence or absence of melt and changes in modal amounts of garnet at different pressure-temperature conditions. Even small amounts of H2O lower the solidus temperature and the presence of a melt reduces the SiO2 activity, which destabilizes the CaEs component in clinopyroxene. The CaEs and the Ca-Tschermaks (CaTs, CaAl2SiO6) components in clinopyroxene decrease with increasing jadeite mole fraction, which is also a function of pressure and bulk Al content. Modeling X-ray powder diffraction data yields a molar volume for the CaEs endmember of V CaEs = 60.87(63) cm3, which reasonably agrees with a literature value that was estimated from natural samples. In the presence of coexisting coesite, the CaEs and CaTs do not vary independently of each other, being controlled by the internal

  3. A single-center study evaluating the effect of the controlled adverse environment (CAEsm model on tear film stability

    Directory of Open Access Journals (Sweden)

    Abelson R

    2012-11-01

    Full Text Available Richard Abelson,1,2 Keith J Lane,3 John Rodriguez,3 Patrick Johnston,3 Endri Angjeli,3 George Ousler,3 Douglas Montgomery11School of Computing, Informatics, and Decision Systems Engineering, Arizona State University, 2Statistics and Data Corporation, Tempe, AZ; 3Ora, Inc, Andover, MA, USAPurpose: To investigate use of an improved ocular tear film analysis protocol (OPI 2.0 in the Controlled Adverse Environment (CAESM model of dry eye disease, and to examine the utility of new metrics in the identification of subpopulations of dry eye patients.Methods: Thirty-three dry eye subjects completed a single-center, single-visit, pilot CAE study. The primary endpoint was mean break-up area (MBA as assessed by the OPI 2.0 system. Secondary endpoints included corneal fluorescein staining, tear film break-up time, and OPI 2.0 system measurements. Subjects were also asked to rate their ocular discomfort throughout the CAE. Dry eye endpoints were measured at baseline, immediately following a 90-minute CAE exposure, and again 30 minutes after exposure.Results: The post-CAE measurements of MBA showed a statistically significant decrease from the baseline measurements. The decrease was relatively specific to those patients with moderate to severe dry eye, as measured by baseline MBA. Secondary endpoints including palpebral fissure size, corneal staining, and redness, also showed significant changes when pre- and post-CAE measurements were compared. A correlation analysis identified specific associations between MBA, blink rate, and palpebral fissure size. Comparison of MBA responses allowed us to identify subpopulations of subjects who exhibited different compensatory mechanisms in response to CAE challenge. Of note, none of the measures of tear film break-up time showed statistically significant changes or correlations in pre-, versus post-CAE measures.Conclusion: This pilot study confirms that the tear film metric MBA can detect changes in the ocular surface

  4. Chronic adverse events and quality of life after radiochemotherapy in anal cancer patients. A single institution experience and review of the literature

    Energy Technology Data Exchange (ETDEWEB)

    Fakhrian, K. [Universitaetsklinikum Bochum, Marienhospital Herne (Germany). Dept. of Radiation Oncology; Technische Univ. Muenchen, Klinikum Rechts der Isar (Germany). Dept. of Radiation Oncoalogy; Sauer, T.; Klemm, S.; Molls, M. [Technische Univ. Muenchen, Klinikum Rechts der Isar (Germany). Dept. of Radiation Oncoalogy; Dinkel, A. [Technische Univ. Muenchen, Klinikum Rechts der Isar (Germany). Dept. of Psychosomatic Medicine and Psychotherapy; Schuster, T. [Technische Univ. Muenchen, Klinikum Rechts der Isar (Germany). Inst. of Medical Statistics and Epidemiology; Geinitz, H. [Technische Univ. Muenchen, Klinikum Rechts der Isar (Germany). Dept. of Radiation Oncoalogy; Krankenhaus der Barmherzigen Schwestern, Linz (Austria). Dept. of Radiation Oncology

    2013-06-15

    Purpose: To report on chronic adverse events (CAE) and quality of life (QOL) after radiochemotherapy (RCT) in patients with anal cancer (AC). Patients and methods: Of 83 patients who had received RCT at our department between 1988 and 2011, 51 accepted the invitation to participate in this QOL study. CAE were evaluated using the Common Terminology Criteria for Adverse Events (CTCAE) v. 4.0 and QOL was assessed with the Functional Assessment of Cancer Therapy-Colorectal (FACT-C) questionnaire. Results: CAE could be evaluated in 49 patients. There was a tendency toward a higher rate of grade 3 CAE in female patients, i.e. 18 out of 37 (49 %) vs. 2 out of 12 (17 %) male patients (p = 0.089). The most common grade 3 CAE were dyspareunia and vaginal symptoms (itching, burning and dryness) in 35 and 22 % of female patients, respectively, followed by stool incontinence in 13 % of all patients (6 out of 49). Both FACT-C and CAE information were available for 42 patients, allowing evaluation of the impact of CAE on QOL. The median total FACT-C score was 110 (40-132) out of a possible maximum of 136. The absence of grade 3 CAE (115 vs. 94, p = 0.001); an interval of {>=} 67 months after the end of the treatment (111 vs. 107, p = 0.010), no stool incontinence vs. grade 3 stool incontinence (111 vs. 74, p = 0.009), higher education (114 vs. 107, p = 0.013) and no dyspareunia vs. grade 3 dyspareunia (116 vs. 93, p = 0.012) were significantly associated with a higher median FACT-C score. Conclusion: The majority of AC patients treated with RCT have acceptable overall QOL scores, which are comparable to those of the normal population. Patients with grade 3 CAE - particularly dyspareunia and fecal incontinence - have a poorer QOL compared to patients without CAE. In order to improve long-term QOL, future strategies might aim at a reduction in dose to the genitalia and more intensive patient support measures. (orig.)

  5. Relationship between total and differential leukocyte counts and isolated coronary artery ectasia.

    Science.gov (United States)

    Kocaman, Sinan Altan; Taçoy, Gülten; Sahinarslan, Asife; Cengel, Atiye

    2008-08-01

    Coronary artery ectasia (CAE) is a clinical entity characterized by localized or diffuse dilatation of more than or equal to 1.5 times that of the normal adjacent segments of vessels. Although the etiopathogenesis is not clearly understood, some studies have shown that CAE may be a form of atherosclerosis and has more potent inflammatory properties. Leukocytes have a crucial role in the development of inflammatory processes. We aimed to investigate a possible relationship between leukocytes and the coronary ectatic process without coronary artery disease (CAD) and to compare it with the inflammatory atherosclerotic process related to leukocytes. The study population consisted of 371 patients. We divided the patients into three groups: 42 patients with isolated CAE as group I, 279 patients with CAD as group II, and 50 control participants with normal coronary arteries (NCA) as group III. The counts of total leukocytes (7348+/-1898, 7569+/-1619, and 6770+/-1748 cells/mm, P=0.002), neutrophils (4260+/-2169, 4529+/-1380, and 4040+/-1649 cells/mm, P=0.037) and monocytes (630+/-216, 583+/-198, and 480+/-140 cells/mm, P<0.001) were significantly different among the CAE, CAD, and NCA groups, respectively. The CAE group also had significantly higher leukocyte and subtype counts than the nonobstructive CAD subgroup and NCA group. This study demonstrates that total and differential leukocyte counts, which play an important role in inflammation, are increased in patients with isolated CAE. In conclusion, this study's findings show that leukocytes may play an important role in the development of CAE independently of the atherosclerotic process.

  6. Technical and economic assessment of fluidized-bed-augmented compressed-air energy-storage system: system load following capability

    Energy Technology Data Exchange (ETDEWEB)

    Lessard, R.D.; Blecher, W.A.; Merrick, D.

    1981-09-01

    The load-following capability of fluidized bed combustion-augmented compressed air energy storage systems was evaluated. The results are presented in two parts. The first part is an Executive Summary which provides a concise overview of all major elements of the study including the conclusions, and, second, a detailed technical report describing the part-load and load following capability of both the pressurized fluid bed combustor and the entire pressurized fluid bed combustor/compressed air energy storage system. The specific tasks in this investigation were to: define the steady-state, part-load operation of the CAES open-bed PFBC; estimate the steady-state, part-load performance of the PFBC/CAES system and evaluate any possible operational constraints; simulate the performance of the PFBC/CAES system during transient operation and assess the load following capability of the system; and establish a start-up procedure for the open-bed PFBC and evaluate the impact of this procedure. The conclusions are encouraging and indicate that the open-bed PFBC/CAES power plant should provide good part-load and transient performance, and should have no major equipment-related constraints, specifically, no major problems associated with the performance or design of either the open-end PFBC or the PFBC/CAES power plant in steady-state, part-load operation are envisioned. The open-bed PFBC/CAES power plant would have a load following capability which would be responsive to electric utility requirements for a peak-load power plant. The open-bed PFBC could be brought to full operating conditions within 15 min after routine shutdown, by employing a hot-start mode of operation. The PFBC/CAES system would be capable of rapid changes in output power (12% of design load per minute) over a wide output power range (25% to 100% of design output). (LCL)

  7. Antiviral and Virucidal Activities of N-Cocoyl-L-Arginine Ethyl Ester

    Directory of Open Access Journals (Sweden)

    Hisashi Yamasaki

    2011-01-01

    Full Text Available Various amino acid-derived compounds, for example, Nα-Cocoyl-L-arginine ethyl ester (CAE, alkyloxyhydroxylpropylarginine, arginine cocoate, and cocoyl glycine potassium salt (Amilite, were examined for their virucidal activities against herpes simplex virus type 1 and 2 (HSV-1 and HSV-2, influenza A virus (IAV, and poliovirus type 1 (PV-1 in comparison to benzalkonium chloride (BKC and sodium dodecylsulfate (SDS as a cationic and anionic control detergent and also to other commercially available disinfectants. While these amino acid-derived compounds were all effective against HSV-1 and HSV-2, CAE and Amilite were the most effective. These two compounds were, however, not as effective against IAV, another enveloped virus, as against HSV. Cytotoxicity of CAE was weak; at 0.012%, only 5% of the cells were killed under the conditions, in which 100% cells were killed by either SDS or BKC. In addition to these direct virucidal effects, CAE inhibited the virus growth in the HSV-1- or PV-1-infected cells even at 0.01%. These results suggest a potential application of CAE as a therapeutic or preventive medicine against HSV superficial infection at body surface.

  8. Characterization of the metallo-dependent amidohydrolases responsible for “auxiliary” leucinyl removal in the biosynthesis of 2,2′-bipyridine antibiotics

    Directory of Open Access Journals (Sweden)

    Ming Chen

    2017-06-01

    Full Text Available 2,2′-Bipyridine (2,2′-BiPy is an attractive core structure present in a number of biologically active natural products, including the structurally related antibiotics caerulomycins (CAEs and collismycins (COLs. Their biosynthetic pathways share a similar key 2,2′-BiPy-l-leucine intermediate, which is desulfurated or sulfurated at C5, arises from a polyketide synthase/nonribosomal peptide synthetase hybrid assembly line. Focusing on the common off-line modification steps, we here report that the removal of the “auxiliary” l-leucine residue relies on the metallo-dependent amidohydrolase activity of CaeD or ColD. This activity leads to the production of similar 2,2′-BiPy carboxylate products that then receive an oxime functionality that is characteristic for both CAEs and COLs. Unlike many metallo-dependent amidohydrolase superfamily proteins that have been previously reported, these proteins (particularly CaeD exhibited a strong zinc ion-binding capacity that was proven by site-specific mutagenesis studies to be essential to proteolytic activity. The kinetics of the conversions that respectively involve CaeD and ColD were analyzed, showing the differences in the efficiency and substrate specificity of these two proteins. These findings would generate interest in the metallo-dependent amidohydrolase superfamily proteins that are involved in the biosynthesis of bioactive natural products.

  9. Secure Distributed Detection under Energy Constraint in IoT-Oriented Sensor Networks

    Directory of Open Access Journals (Sweden)

    Guomei Zhang

    2016-12-01

    Full Text Available We study the secure distributed detection problems under energy constraint for IoT-oriented sensor networks. The conventional channel-aware encryption (CAE is an efficient physical-layer secure distributed detection scheme in light of its energy efficiency, good scalability and robustness over diverse eavesdropping scenarios. However, in the CAE scheme, it remains an open problem of how to optimize the key thresholds for the estimated channel gain, which are used to determine the sensor’s reporting action. Moreover, the CAE scheme does not jointly consider the accuracy of local detection results in determining whether to stay dormant for a sensor. To solve these problems, we first analyze the error probability and derive the optimal thresholds in the CAE scheme under a specified energy constraint. These results build a convenient mathematic framework for our further innovative design. Under this framework, we propose a hybrid secure distributed detection scheme. Our proposal can satisfy the energy constraint by keeping some sensors inactive according to the local detection confidence level, which is characterized by likelihood ratio. In the meanwhile, the security is guaranteed through randomly flipping the local decisions forwarded to the fusion center based on the channel amplitude. We further optimize the key parameters of our hybrid scheme, including two local decision thresholds and one channel comparison threshold. Performance evaluation results demonstrate that our hybrid scheme outperforms the CAE under stringent energy constraints, especially in the high signal-to-noise ratio scenario, while the security is still assured.

  10. Biochemical response of the Africanized honeybee exposed to fipronil.

    Science.gov (United States)

    Roat, Thaisa C; Carvalho, Stephan M; Palma, Mário S; Malaspina, Osmar

    2017-06-01

    Bees are recognized worldwide for their social, economic, and environmental value. In recent decades they have been seriously threatened by diseases and high levels of pesticide use. The susceptibility of bees to insecticides makes them an important terrestrial model for assessing environmental quality, and various biomarkers have been developed for such assessments. The present study aimed to evaluate the activity of the enzymes acetylcholinesterase (AChE), carboxylesterase (CaE), and glutathione-S-transferase (GST) in Africanized honeybees exposed to fipronil. The results showed that fipronil at a sublethal dose (0.01 ng/bee) modulates the activity of CaE in all isoforms analyzed (CaE-1, CaE-2, and CaE-3) in both newly emerged and aged bees, and does not affect the activity of AChE or GST. The recovery of the bees after fipronil exposure was also investigated, and these results demonstrated that even the cessation of fipronil ingestion might not lead to complete recovery of individual bees. Even at low doses, fipronil was shown to cause changes in the activity of key enzymes in bees. The possible consequences of these changes are discussed. Environ Toxicol Chem 2017;36:1652-1660. © 2016 SETAC. © 2016 SETAC.

  11. Preoperative and intraoperative predictors of cardiac adverse events after general, vascular, and urological surgery.

    Science.gov (United States)

    Kheterpal, Sachin; O'Reilly, Michael; Englesbe, Michael J; Rosenberg, Andrew L; Shanks, Amy M; Zhang, Lingling; Rothman, Edward D; Campbell, Darrell A; Tremper, Kevin K

    2009-01-01

    The authors sought to determine the incidence and risk factors for perioperative cardiac adverse events (CAEs) after noncardiac surgery using detailed preoperative and intraoperative hemodynamic data. The authors conducted a prospective observational study at a single university hospital from 2002 to 2006. All American College of Surgeons-National Surgical Quality Improvement Program patients undergoing general, vascular, and urological surgery were included. The CAE outcome definition included cardiac arrest, non-ST elevation myocardial infarction, Q-wave myocardial infarction, and new clinically significant cardiac dysrhythmia within the first 30 postoperative days. Four years of data demonstrated that of 7,740 noncardiac operations, 83 patients (1.1%) experienced a CAE within 30 days. Nine independent predictors were identified (P or = 68, body mass index > or = 30, emergent surgery, previous coronary intervention or cardiac surgery, active congestive heart failure, cerebrovascular disease, hypertension, operative duration > or = 3.8 h, and the administration of 1 or more units of packed red blood cells intraoperatively. The c-statistic of this model was 0.81 +/- 0.02. Univariate analysis demonstrated that high-risk patients experiencing a CAE were more likely to experience an episode of mean arterial pressure 100 (22% vs. 34%, P = 0.05). In comparison with current risk stratification indices, the inclusion of intraoperative elements improves the ability to predict a perioperative CAE after noncardiac surgery.

  12. Economic Modeling of Compressed Air Energy Storage

    Directory of Open Access Journals (Sweden)

    Rui Bo

    2013-04-01

    Full Text Available Due to the variable nature of wind resources, the increasing penetration level of wind power will have a significant impact on the operation and planning of the electric power system. Energy storage systems are considered an effective way to compensate for the variability of wind generation. This paper presents a detailed production cost simulation model to evaluate the economic value of compressed air energy storage (CAES in systems with large-scale wind power generation. The co-optimization of energy and ancillary services markets is implemented in order to analyze the impacts of CAES, not only on energy supply, but also on system operating reserves. Both hourly and 5-minute simulations are considered to capture the economic performance of CAES in the day-ahead (DA and real-time (RT markets. The generalized network flow formulation is used to model the characteristics of CAES in detail. The proposed model is applied on a modified IEEE 24-bus reliability test system. The numerical example shows that besides the economic benefits gained through energy arbitrage in the DA market, CAES can also generate significant profits by providing reserves, compensating for wind forecast errors and intra-hour fluctuation, and participating in the RT market.

  13. Secure Distributed Detection under Energy Constraint in IoT-Oriented Sensor Networks.

    Science.gov (United States)

    Zhang, Guomei; Sun, Hao

    2016-12-16

    We study the secure distributed detection problems under energy constraint for IoT-oriented sensor networks. The conventional channel-aware encryption (CAE) is an efficient physical-layer secure distributed detection scheme in light of its energy efficiency, good scalability and robustness over diverse eavesdropping scenarios. However, in the CAE scheme, it remains an open problem of how to optimize the key thresholds for the estimated channel gain, which are used to determine the sensor's reporting action. Moreover, the CAE scheme does not jointly consider the accuracy of local detection results in determining whether to stay dormant for a sensor. To solve these problems, we first analyze the error probability and derive the optimal thresholds in the CAE scheme under a specified energy constraint. These results build a convenient mathematic framework for our further innovative design. Under this framework, we propose a hybrid secure distributed detection scheme. Our proposal can satisfy the energy constraint by keeping some sensors inactive according to the local detection confidence level, which is characterized by likelihood ratio. In the meanwhile, the security is guaranteed through randomly flipping the local decisions forwarded to the fusion center based on the channel amplitude. We further optimize the key parameters of our hybrid scheme, including two local decision thresholds and one channel comparison threshold. Performance evaluation results demonstrate that our hybrid scheme outperforms the CAE under stringent energy constraints, especially in the high signal-to-noise ratio scenario, while the security is still assured.

  14. Assessment of retiming tidal power from Bay of Fundy using compressed air energy storage

    Energy Technology Data Exchange (ETDEWEB)

    1988-03-01

    The objective of the study is to examine the economic viability of using compressed air energy storage (CAES) to retime cyclic power from the proposed tidal power plant at the mouth of Cumberland Basin in the Bay of Fundy. The study objective was met by preparing prefeasibility level cost and energy estimates based on conceputal arrangements of air compressor, generating plants and underground storage facilities, and relating these estimates to the potential marketability of the retimed power and energy. The CAES system in general is outlined and then the CAES system for the site is described: equipment, geological aspects in constructing the plant, and economic and marketing factors and estimates involved are also given. The report examines: alternative tidal power/CAES installations, CAES systems, and marketability. The study concludes that it is feasible to implement the proposal, based on readily available equipment and methodology, but the use of the compressed air energy system proposed to provide additional energy stoage from utilities is unlikely to be economically attractive. 26 figs., 11 tabs.

  15. Compressed Air Energy Storage System Control and Performance Assessment Using Energy Harvested Index

    Directory of Open Access Journals (Sweden)

    Hanif SedighNejad

    2014-01-01

    Full Text Available In this paper a new concept for control and performance assessment of compressed air energy storage (CAES systems in a hybrid energy system is introduced. The proposed criterion, based on the concept of energy harvest index (HEI, measures the capability of a storage system to capture renewable energy. The overall efficiency of the CAES system and optimum control and design from the technical and economic point of view is presented. A possible application of this idea is an isolated community with significant wind energy resource. A case study reveals the usefulness of the proposed criterion in design, control and implementation of a small CAES system in a hybrid power system (HPM for an isolated community. Energy harvested index and its effectiveness in increasing the wind penetration rate in the total energy production is discussed.

  16. [Cefuroxime axetil, a new oral cephalosporin for treating infections of the ORL field: clinical synthesis].

    Science.gov (United States)

    Westphal, J F

    1990-01-01

    Cefuroxime axetil (C.A.E.) is a broad spectrum cephalosporin, suitable for oral route. Its antibacterial activity includes all the pathogens usually responsible for E.N.T. infection, with low M.I.C.'s: H. influenzae, S. pneumoniae, S. aureus, S. pyogene. The stability of the drug against betalactamases, especially those produced by H. influenzae, associated with good bio availability (50%) and tissue penetration (30%) account for the potent in vivo bactericidal activity and clinical efficacy of cefuroxime axetil. More than 1,000 patients had been enrolled in controlled clinical trials: the success rates yielded by C.A.E. were 98%, 96% and 91%, respectively for pharingitis/tonsilitis, otitis media and acute sinusitis. C.A.E. is at least as effective as amoxycillin/clavulanic acid and safety appears to be better.

  17. Structural Performance’s Optimally Analysing and Implementing Based on ANSYS Technology

    Science.gov (United States)

    Han, Na; Wang, Xuquan; Yue, Haifang; Sun, Jiandong; Wu, Yongchun

    2017-06-01

    Computer-aided Engineering (CAE) is a hotspot both in academic field and in modern engineering practice. Analysis System(ANSYS) simulation software for its excellent performance become outstanding one in CAE family, it is committed to the innovation of engineering simulation to help users to shorten the design process, improve product innovation and performance. Aimed to explore a structural performance’s optimally analyzing model for engineering enterprises, this paper introduced CAE and its development, analyzed the necessity for structural optimal analysis as well as the framework of structural optimal analysis on ANSYS Technology, used ANSYS to implement a reinforced concrete slab structural performance’s optimal analysis, which was display the chart of displacement vector and the chart of stress intensity. Finally, this paper compared ANSYS software simulation results with the measured results,expounded that ANSYS is indispensable engineering calculation tools.

  18. ST-Segment Elevation Myocardial Infarction as a Result of Coronary Artery Ectasia-Related Intracoronary Thrombus in a Patient with Liver Cirrhosis

    Directory of Open Access Journals (Sweden)

    Ji Woong Roh

    2015-11-01

    Full Text Available Coronary artery ectasia (CAE is a rare condition defined as the dilatation of coronary artery to at least 1.5 times larger than the normal adjacent coronary artery. Clinical manifestations of CAE vary, ranging from asymptomatic to ST-segment elevation myocardial infarction (STEMI. Because of its rarity and clinical diversity, the best treatment strategy and prognosis for CAE remain unclear. We describe a case of STEMI caused by intracoronary thrombus formation within an ectatic area in a patient with liver cirrhosis (LC. The patient was successfully managed by thrombus aspiration only, without balloon angioplasty or stent implantation, and maintained by dual antiplatelet therapy with aspirin and ticagrelor, a potent new P2Y12 inhibitor.

  19. Changing arctic ecosystems—What is causing the rapid increase of snow geese in northern Alaska?

    Science.gov (United States)

    Hupp, Jerry W.; Ward, David H.; Whalen, Mary E.; Pearce, John M.

    2015-09-10

    Through the Changing Arctic Ecosystems (CAE) initiative, the U.S. Geological Survey (USGS) informs key resource management decisions for Arctic Alaska by providing scientific information on current and future ecosystem response to a warming climate. The Arctic Coastal Plain (ACP) of northern Alaska is a key study area within the USGS CAE initiative. This region has experienced a warming trend over the past decades, leading to decreased sea ice, permafrost thaw, and an advancement of spring phenology. The number of birds on the ACP also is changing, marked by increased populations of the four species of geese that nest in the region. The Snow Goose (Chen caerulescens) is the most rapidly increasing of these species. USGS CAE research is quantifying these changes and their implications for management agencies.

  20. The future of computer-aided design and engineering at CERN

    CERN Document Server

    Høimyr, Nils-Joar

    2004-01-01

    This working note discusses design and engineering processes at CERN and Computer Aided Design and Engineering tools. The main focus of this note is Mechanical design and CAE activities and how to share and organize the data produced by CAD/CAE tools. These issues cannot be addressed without taking a global view of the engineering activities at CERN. As more and more of the detailed design work is done by external suppliers, the design processes at CERN change. Traditional design work where draftsmen are producing drawings on the request from engineers is replaced by conceptual design work done by domain specialists and engineers. Furthermore CAD and FEM tools have evolved from specialist tools to mainstream utilities mastered by most engineers. Design activities nowadays can now be carried out directly by the project engineer without the use of a design (drawing) office. This environment poses different requirements for design- and engineering support activities as well as the selection of CAE-tools. Design ...

  1. Reactivity to conspicuousness and alcohol use among college students: the moderating effect of alcohol expectancies.

    Science.gov (United States)

    Crawford, Lizabeth A; Novak, Katherine B

    2004-12-01

    The analysis of self-report data from 147 college undergraduates suggested that alcohol expectancies moderate the effect of a dispositional susceptibility to embarrassment elicited by undesired conspicuousness [center-of-attention-induced embarrassability (CAE)] on drinking behavior. Individuals unlikely to experience embarrassment when they engage in behaviors that make them stand out in a crowd, a common occurrence when one drinks to excess, drank heavily if they expected alcohol to make them more assertive socially. Students with similar beliefs about the effects of alcohol on social interaction who were high in CAE consumed substantially less alcohol than the latter individuals. Their overall levels of drinking were more comparable to those of the low-expectancy participants, suggesting that the disdain for conspicuousness characteristic of people with a susceptibility to CAE may counteract the desire for social disinhibition that often motivates alcohol consumption.

  2. Automatic characterization of dynamics in Absence Epilepsy

    DEFF Research Database (Denmark)

    Petersen, Katrine N. H.; Nielsen, Trine N.; Kjær, Troels W.

    2013-01-01

    Dynamics of the spike-wave paroxysms in Childhood Absence Epilepsy (CAE) are automatically characterized using novel approaches. Features are extracted from scalograms formed by Continuous Wavelet Transform (CWT). Detection algorithms are designed to identify an estimate of the temporal development...... of frequencies in the paroxysms. A database of 106 paroxysms from 26 patients was analyzed. The database is large compared to other known studies in the field of dynamics in CAE. CWT is more efficient than the widely used Fourier transform due to CWTs ability to recognize smaller discontinuities and variations....... The use of scalograms and the detection algorithms result in a potentially usable clinical tool for dividing CAE patients into subsets. Differences between the grouped paroxysms may turn out to be useful from a clinical perspective as a prognostic indicator or when adjusting drug treatment....

  3. Thermodynamic Efficiency of Pumped Heat Electricity Storage

    Science.gov (United States)

    Thess, André

    2013-09-01

    Pumped heat electricity storage (PHES) has been recently suggested as a potential solution to the large-scale energy storage problem. PHES requires neither underground caverns as compressed air energy storage (CAES) nor kilometer-sized water reservoirs like pumped hydrostorage and can therefore be constructed anywhere in the world. However, since no large PHES system exists yet, and theoretical predictions are scarce, the efficiency of such systems is unknown. Here we formulate a simple thermodynamic model that predicts the efficiency of PHES as a function of the temperature of the thermal energy storage at maximum output power. The resulting equation is free of adjustable parameters and nearly as simple as the well-known Carnot formula. Our theory predicts that for storage temperatures above 400°C PHES has a higher efficiency than existing CAES and that PHES can even compete with the efficiencies predicted for advanced-adiabatic CAES.

  4. Phospholipase D mediated transphosphatidylation as a possible new pathway of ethanol metabolism in isolated rat pancreatic acini

    Energy Technology Data Exchange (ETDEWEB)

    Rydzewska, G.; Jurkowska, G.; Gabryelewicz, A. [Akademia Medyczna, Bialystok (Poland)

    1996-12-31

    Activation of pancreatic phospholipase D (PLD) has been previously observed in response to caerulein (Cae), phorbol myristate acetate and growth factors. The physiological role of PLD in pancreatic cells still remains unclear. In the presence of ethanol, PLD catalysed transphosphatidylation reaction, forming phosphatidylethanol (PEt). This study was thus undertaken to determine the involvement of PLD in ethanol metabolism in isolated pancreatic acini and to show the potential physiological consequences of transphosphatidylation. Dispersed pancreatic acini prelabelled with 3H myristic acid were incubated with 500 pM Cae in the presence or absence of different concentrations of ethanol, and labelled phosphatidylethanol (3H PEt) production or phosphatidic acid (3H PA) accumulation were measured. The production of PEt after Cae stimulation in pancreatic acini was significant from 0.5% up to 4% of ethanol in the medium and was not dependent on increasing concentration of ethanol. Prolonged up to 2 h stimulation with Cae in the presence of 1% ethanol did not increase PEt production which was almost stable since 5 min of stimulation. In the presence of different concentrations of ethanol (1-4%), the significant inhibition of PA accumulation was obtained after Cae stimulation, similar to inhibition with a specific PLD inhibitor-wortmannin. These data indicate that Cae activated PLD in the presence of ethanol caused PEt production in pancreatic acini. During formation of PEt in pancreatic acinar cells significant and parallel inhibition of PA accumulation was observed. This indicates the relation of PLD activation in isolated pancreatic acini to ethanol metabolism. Ethanol can act as an inhibitor of PLD activity. Since PA, a product of PLD, is known as a second messenger probably involved in cell proliferation and differentiation, this may suggest a potentially new mechanism for pancreatic tissue injury after ethanol ingestion. (author). 32 refs, 5 figs.

  5. Efecto de un calentamiento con estiramientos estáticos y dinámicos sobre el salto horizontal y la capacidad para repetir esprint con cambio de dirección. [Effect of warm-up with static and dynamic stretching on the horizontal jump and repeated sprint ability with changes of direction].

    OpenAIRE

    Javier Sánchez-Sánchez; Alejandro Rodríguez-Fernández; J. Gerardo Villa-Vicente; Cristina Petisco-Rodríguez; Rodrigo Ramírez-Campillo; Oliver Gonzalo-Skok

    2017-01-01

    El objetivo de este trabajo ha sido comparar el efecto de tres calentamientos diferentes (calentamiento aeróbico de baja intensidad, estiramiento estático y estiramiento dinámico) sobre el salto horizontal y la capacidad de repetir esprint con cambios de dirección. Diecisiete practicantes de deportes de equipo de 20.8±1.1 años realizaron 3 tipos de calentamiento (10 min): ejercicio aeróbico sin estiramiento (CAE), con estiramiento estático (CAES) y con estiramiento dinámico (CAED). Se estudió...

  6. Algorithm describing pressure distribution of non-contact TNT explosion

    Directory of Open Access Journals (Sweden)

    Radosław Kiciński

    2014-12-01

    Full Text Available [b]Abstract[/b]. The aim of this study is to develop a computational algorithm, describing the shock wave pressure distribution in the space induced by non-contact TNT explosion. The procedure describes pressure distribution on a damp surface of the hull. Simulations have been carried out using Abaqus/CAE. The study also shows the pressure waveform descriptions provided by various authors and presents them in charts. The formulated conclusions convince efficiency of the algorithm application.[b]Keywords:[/b] Underwater explosion, shock wave, CAE, TNT, Kobben class submarine

  7. Improved simulation method of automotive spot weld failure with an account of the mechanical properties of spot welds

    Science.gov (United States)

    Wu, H.; Meng, X. M.; Fang, R.; Huang, Y. F.; Zhan, S.

    2017-12-01

    In this paper, the microstructure and mechanical properties of spot weld were studied, the hardness of nugget and heat affected zone (HAZ) were also tested by metallographic microscope and microhardness tester. The strength of the spot weld with the different parts' area has been characterized. According to the experiments result, CAE model of spot weld with HAZ structure was established, and simulation results of different lap-shear CAE models were analyzed. The results show that the spot weld model which contained the HAZ has good performance and more suitable for engineering application in spot weld simulation.

  8. Study of the effect of the variation of automatic exposure control in computed tomography; Estudio del efecto de la variacion del control automatico de exposicion en tomografia computarizada

    Energy Technology Data Exchange (ETDEWEB)

    Nersissian, D. Y.; Capeleti, F. F.; Furquin, T. A. C.; Melo, C. S.

    2011-07-01

    Teams computed tomography (CT) contain the current automatic control of exposure (CAE) which vary from the current X-ray tube in clinical protocols and deliver lower doses than those with fixed current. Alone is not enough control of dose, you need an acceptable image quality ensuring an accurate diagnosis. The TC regulate the flow of two ways: by considering the thickness of the patient and the attenuation by different tissues that intercept the x-ray Besides the advantage, there is the responsibility of proper use of different CAE systems, which require particular knowledge of each manufacturer of the CT.

  9. Liquefaction mechanism induced by dynamic excitation modeled in Plaxis AE with the use of UBC and MOHR–coulomb constitutive relationships

    Directory of Open Access Journals (Sweden)

    Borowiec Anna

    2016-03-01

    Full Text Available Computer Aided Engineering (CAE is commonly used in modern design of the various types of structures. There are two main issues/aspects that should be consider while using CAE in Geotechnics: the basic theory and material model. The paper deals with a problem of choosing the proper constitutive relationships which according to the authors are equally important in obtaining correct and reasonable results. This problem is illustrated by an example of dynamic calculations of fully saturated non-cohesive soils where liquefaction phenomenon is most likely to occur.

  10. Linkage and association analysis of CACNG3 in childhood absence epilepsy

    DEFF Research Database (Denmark)

    Everett, Kate V; Chioza, Barry; Aicardi, Jean

    2007-01-01

    Childhood absence epilepsy (CAE) is an idiopathic generalised epilepsy characterised by absence seizures manifested by transitory loss of awareness with 2.5-4 Hz spike-wave complexes on ictal EEG. A genetic component to aetiology is established but the mechanism of inheritance and the genes...... involved are not fully defined. Available evidence suggests that genes encoding brain expressed voltage-gated calcium channels, including CACNG3 on chromosome 16p12-p13.1, may represent susceptibility loci for CAE. The aim of this work was to further evaluate CACNG3 as a susceptibility locus by linkage...

  11. Three-Dimensional Computational Fluid Dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Haworth, D.C.; O' Rourke, P.J.; Ranganathan, R.

    1998-09-01

    Computational fluid dynamics (CFD) is one discipline falling under the broad heading of computer-aided engineering (CAE). CAE, together with computer-aided design (CAD) and computer-aided manufacturing (CAM), comprise a mathematical-based approach to engineering product and process design, analysis and fabrication. In this overview of CFD for the design engineer, our purposes are three-fold: (1) to define the scope of CFD and motivate its utility for engineering, (2) to provide a basic technical foundation for CFD, and (3) to convey how CFD is incorporated into engineering product and process design.

  12. Compressed air energy storage technology program. Annual report for 1980

    Energy Technology Data Exchange (ETDEWEB)

    Kannberg, L.D.

    1981-06-01

    All of the major research funded under the Compressed Air Energy Storage Technology Program during the period March 1980 to March 1981 is described. This annual report is divided into two segments: Reservoir Stability Studies and Second-Generation Concepts Studies. The first represents research performed to establish stability criteria for CAES reservoirs while the second reports progress on research performed on second-generation CAES concepts. The report consists of project reports authored by research engineers and scientists from PNL and numerous subcontractors including universities, architect-engineering, and other private firms.

  13. NREL Software Aids Offshore Wind Turbine Designs (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2013-10-01

    NREL researchers are supporting offshore wind power development with computer models that allow detailed analyses of both fixed and floating offshore wind turbines. While existing computer-aided engineering (CAE) models can simulate the conditions and stresses that a land-based wind turbine experiences over its lifetime, offshore turbines require the additional considerations of variations in water depth, soil type, and wind and wave severity, which also necessitate the use of a variety of support-structure types. NREL's core wind CAE tool, FAST, models the additional effects of incident waves, sea currents, and the foundation dynamics of the support structures.

  14. Conselhos Municipais de Alimentação Escolar em Santa Catarina: caracterização e perfil de atuação Municipal School Nutrition Councils in Santa Catarina, Brazil: characterization and performance profile

    Directory of Open Access Journals (Sweden)

    Gilberto Veras Caldeiras

    2013-04-01

    Full Text Available O objetivo deste estudo é avaliar os Conselhos Municipais de Alimentação Escolar (CAE no Estado de Santa Catarina. Investigação transversal em amostra de municípios catarinenses (n = 152; 52%. Entrevistaram-se preferencialmente os presidentes dos CAE, pesquisando-se o perfil dos conselheiros, as atribuições realizadas e a relação do CAE com outras instâncias de controle social. Utilizou-se Regressão de Poisson para obter razões de prevalências bruta e ajustada. No modelo ajustado seguiu-se uma abordagem hierárquica. A maioria dos conselhos analisava a prestação de contas, fiscalizava os recursos, zelava pela qualidade do PNAE em todos os níveis, orientava o armazenamento dos alimentos, participava da elaboração do cardápio, acompanhava a compra de gêneros e tinha regimento interno. Entretanto, apenas 22,4% realizavam todas as atribuições com frequência maior ou igual à anual. Verificou-se associação positiva entre uma boa atuação do CAE e existência de relação com outros conselhos locais. A sensibilização dos CAE e o estímulo à atua­ção articulada com outros conselhos e atores envolvidos com a segurança alimentar e nutricional, são essenciais para a garantia do direito à alimentação saudável e adequada nas escolas.The aim of this study is to assess Municipal School Nutrition Councils (CAEs of the Brazilian School Nutrition Program (PNAE in the state of Santa Catarina, Brazil. A cross-sectional study was conducted with a sample of municipalities in the state (n = 152; 52%. CAE presidents were interviewed and asked about the counselor profile, attributions performed and the relation of CAEs with other local councils. Poisson regression analysis was conducted to obtain unadjusted and adjusted prevalence ratios and the adjusted model adopted a hierarchic approach. The majority of councils analyzed their accounting reports, monitored resources and strived for quality of the CAEs at all levels. They

  15. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936401 >1xktA 8 266 465 736 4e-19 ... emb|CAE28779.1| possible Condensation... domain, peptide synthetase [Rhodopseudomonas ... palustris CGA009] ref|NP_948677.1| possible Condensation

  16. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936401 >1l5aA 5 413 24 449 2e-42 ... emb|CAE28779.1| possible Condensation... domain, peptide synthetase [Rhodopseudomonas ... palustris CGA009] ref|NP_948677.1| possible Condensation

  17. Modelling and Motion Analysis of Five-Bar 5R Mechanism

    OpenAIRE

    Budniak Z.; Bil T.

    2014-01-01

    This article presents the use of the potential of the present-day CAD/CAE systems in modelling and a kinematic analysis of a spatial five-membered lever mechanism 5R. A simulation model was developed. On the grounds of the methodology developed, numerical analysis was conducted. The results of the analysis are presented in diagrams.

  18. NCBI nr-aa BLAST: CBRC-XTRO-01-2525 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2525 ref|NP_947919.1| putative alginate o-acetyltransferase AlgI [Rhod...opseudomonas palustris CGA009] emb|CAE28018.1| putative alginate o-acetyltransferase AlgI [Rhodopseudomonas palustris CGA009] NP_947919.1 0.79 37% ...

  19. Giant subcortical high-frequency SEPs in idiopathic generalized epilepsy: a protective mechanism against seizures?

    Science.gov (United States)

    Restuccia, Domenico; Valeriani, Massimiliano; Della Marca, Giacomo

    2007-01-01

    Recently, we found that high-frequency somatosensory evoked potentials (HF-SEPs), which are modulated by arousal-related structures, were abnormally enhanced during N-REM sleep in two seizure-free IGE patients [Restuccia D, Rubino M, Valeriani M, Della Marca G. Increase of brainstem high-frequency SEP subcomponents during light sleep in seizure-free epileptic patients. Clin Neurophysiol 2005; 116: 1774-1778]. Here, we aimed at verifying whether similar HF-SEP abnormalities were significantly correlated to the clinical outcome in a larger population of untreated IGE patients. Patients were classified as Juvenile Myoclonic epilepsy (JME; six patients) and Childhood or Juvenile Absence epilepsy (CAE and JAE, six patients). They were untreated because newly diagnosed, or because seizure-free. HF-SEPs from patients were compared with those obtained from 21 healthy volunteers. HF-SEPs were abnormally enhanced in all seizure-free CAE-JAE patients, whereas they were normal in all JME patients and in CAE-JAE patients with frequent seizures. Not only scalp distribution, but also dipolar source analysis suggested a subcortical origin for these enhanced subcomponents, possibly in the brainstem. The enhancement of HF-SEPs might reflect the hyperactivity of arousal-related brainstem structures; such an enhancement was found in all seizure-free CAE-JAE patients, while it was never observed in JME patients. We speculate that the hyperactivity of arousal-related brainstem structures might account for the different clinical outcome among IGE subsyndromes.

  20. SwissProt search result: AK100510 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100510 J023099M11 (P48751) Anion exchange protein 3 (Neuronal band 3-like protein...) (Solute carrier family 4 member 3) (Cardiac/brain band 3-like protein) (CAE3/BAE3) B3A3_HUMAN 4e-22 ...

  1. SwissProt search result: AK072421 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072421 J023086K01 (P48751) Anion exchange protein 3 (Neuronal band 3-like protein...) (Solute carrier family 4 member 3) (Cardiac/brain band 3-like protein) (CAE3/BAE3) B3A3_HUMAN 2e-34 ...

  2. SwissProt search result: AK060451 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060451 001-011-G04 (P48751) Anion exchange protein 3 (Neuronal band 3-like protei...n) (Solute carrier family 4 member 3) (Cardiac/brain band 3-like protein) (CAE3/BAE3) B3A3_HUMAN 1e-14 ...

  3. Download this PDF file

    African Journals Online (AJOL)

    infected by the virus as proviral DNA was detected in infected cultures by amplification of a. 414 base-pair (bp) fragment of the viral gag-gene by Reverse Transcription- Polymerase. Chain Reaction (RT-PCR) technique. The present study revealed that microglia are the target brain cells infected by the CAE virus.

  4. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  5. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

  6. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  7. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  8. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  9. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  10. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34556750 >1wqgA 1 184 3 186 4e-49 ... ref|NP_906565.1| RIBOSOME RECYCLING... FACTOR [Wolinella succinogenes DSM 1740] ... emb|CAE09465.1| RIBOSOME RECYCLING FACTOR [Wolinella ...

  11. AA~AA, __ ----__ --____ _ v VVVV v

    Indian Academy of Sciences (India)

    Schrodinger's Cat States. A N Maheshwari and V P Srivastava. Recently, a group of scientists (see Monroe and others in Suggested Reading) of the. National Institute of Standards and. Technology (NIST) have reported that they have generated at the single atom level. 'Schrodinger cae like states of matter. This is.

  12. Critical Autoethnography Conference 2016: A Factionalized Review

    Directory of Open Access Journals (Sweden)

    Esther Fitzpatrick

    2017-03-01

    Full Text Available In this factionalised script, I provide a review of the Critical Autoethnography (CAE Conference, which took place in Melbourne, Australia, July 21-22, 2016. Participants gathered from across the globe to discuss the themes of affect, animacies, and objects from a critical autoethnographic vantage point.

  13. Perinatal asphyxia in a specialist hospital in Port Harcourt, Nigeria

    African Journals Online (AJOL)

    owner

    2012-12-07

    Dec 7, 2012 ... 25. Aziken M, Omo-Aghoja L, Ok- onofua F. Perceptions and attitudes of pregnant women towards cae- sarean section in urban Nigeria. Acta Obstet Gynecol Scand 200;. 86:42-47. 26. Onah HE, Ikeako LC, Iloabachie. GC: Factors associated with the use of maternity services in Enugu, southeastern Nigeria.

  14. Constructing A New Japanese Development Design Model NJ-DDM: Intellectual Evolution of an Automobile Product Design

    Directory of Open Access Journals (Sweden)

    Kakuro Amasaka

    2015-11-01

    Full Text Available The author constructs a New Japanese Development Design Model “NJ-DDM” utilizing CAE to realize “simultaneous achievement of QCD” (quality, cost and delivery in automobile development design by evolving the super-short-term development design process. Based on this, the author verifies the validity of this model in intellectual evolution of an automobileproduct design.

  15. NCBI nr-aa BLAST: CBRC-GACU-10-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-10-0021 ref|YP_177714.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] pir||A70524 probable PPE protein - Mycobacterium tuberculosis (strain H37RV) emb|CAE55269.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177714.1 1e-30 41% ...

  16. Intellectual functioning in children with epilepsy: Frontal lobe epilepsy, childhood absence epilepsy and benign epilepsy with centro-temporal spikes

    OpenAIRE

    Lopes, Ana Filipa; Simões, Mário R.; Monteiro, José Paulo; Fonseca, Maria José; Martins, Cristina; Ventosa, Lurdes; Lourenço, Laura; Robalo, Conceição

    2013-01-01

    The purpose of our study is to describe intellectual functioning in three common childhood epilepsy syndromes - frontal lobe epilepsy (FLE), childhood absence epilepsy (CAE) and benign epilepsy with centro-temporal spikes (BECTS). And also to determine the influence of epilepsy related variables, type of epilepsy, age at epilepsy onset, duration and frequency of epilepsy, and treatment on the scores.

  17. Gene : CBRC-CBRE-01-0853 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0853 UN C UNKNOWN SC6A1_HUMAN 2e-80 49% ref|XP_001673789.1| Hypothetic...al protein CBG23167 [Caenorhabditis briggsae] emb|CAE75218.1| Hypothetical protein CBG23167 [Caenorhabditis br

  18. Gene : CBRC-CBRE-01-1546 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1546 Novel UN A Nematode chemoreceptors SRJ38_CAEEL 1e-07 19% ref|XP_0...01673486.1| Hypothetical protein CBG23540 [Caenorhabditis briggsae] emb|CAE75522.1| Hypothetical protein CBG23540 [Caenorhabditis br

  19. Gene : CBRC-CBRI-05-0152 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0152 Novel V A Nematode chemoreceptors SRJ38_CAEEL 2e-75 45% ref|XP_00...1673142.1| Hypothetical protein CBG01297 [Caenorhabditis briggsae] emb|CAE58203.1| Hypothetical protein CBG01297 [Caenorhabditis br

  20. Gene : CBRC-CBRE-01-1274 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1274 Novel UN A Serpentine receptor-like proteins SRT55_CAEEL 6e-16 27...% ref|XP_001673244.1| Hypothetical protein CBG01415 [Caenorhabditis briggsae] emb|CAE58305.1| Hypothetical p...rotein CBG01415 [Caenorhabditis briggsae] 6e-85 66% MLNRDLLRYPAFKIMVSLALCDIPSVCVNSIATGIMGYHGIVFCDYPRLIFFLGAN

  1. Gene : CBRC-CBRI-02-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-02-0045 Novel II A Sre proteins SRE37_CAEEL 4e-39 35% ref|XP_001680190.1|... Hypothetical protein CBG20945 [Caenorhabditis briggsae] emb|CAE73490.1| Hypothetical protein CBG20945 [Caenorhabditis br

  2. Gene : CBRC-CBRE-01-0161 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0161 UN C UNKNOWN NTCP5_HUMAN 2e-24 31% ref|XP_001671950.1| Hypothetic...al protein CBG13872 [Caenorhabditis briggsae] emb|CAE68204.1| Hypothetical protein CBG13872 [Caenorhabditis br

  3. Gene : CBRC-CBRI-02-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-02-0050 II A Srg proteins SRG17_CAEEL 7e-45 57% ref|XP_001680219.1| Hypot...hetical protein CBG20982 [Caenorhabditis briggsae] emb|CAE73519.1| Hypothetical protein CBG20982 [Caenorhabditis br

  4. Gene : CBRC-CBRI-03-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-03-0006 III A Srg proteins SRG9_CAEEL 2e-70 78% ref|XP_001664677.1| Hypot...hetical protein CBG17482 [Caenorhabditis briggsae] emb|CAE70737.1| Hypothetical protein CBG17482 [Caenorhabditis br

  5. Gene : CBRC-CBRI-03-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-03-0004 III A Srg proteins SRG8_CAEEL 6e-90 70% ref|XP_001664675.1| Hypot...hetical protein CBG17484 [Caenorhabditis briggsae] emb|CAE70739.1| Hypothetical protein CBG17484 [Caenorhabditis br

  6. Gene : CBRC-CBRE-01-0101 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0101 Novel UN A Serpentine receptor-like proteins SRT55_CAEEL 2e-11 32...% ref|XP_001675699.1| Hypothetical protein CBG05666 [Caenorhabditis briggsae] emb|CAE61716.1| Hypothetical p...rotein CBG05666 [Caenorhabditis briggsae] 9e-79 88% MAYGITINLIYIPMIGVMIEKEQFKMSCFKIMSFLTLIDILALSVNSIITGFLSYH

  7. Gene : CBRC-CBRI-05-0455 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0455 Novel V D UNKNOWN SRX10_CAEEL 4e-04 30% ref|XP_001675360.1| Hypot...hetical protein CBG22815 [Caenorhabditis briggsae] emb|CAE74931.1| Hypothetical protein CBG22815 [Caenorhabditis br

  8. Gene : CBRC-CBRI-03-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-03-0039 Novel III A Srb proteins SRB11_CAEEL 4e-36 48% ref|XP_001666387.1...| Hypothetical protein CBG21146 [Caenorhabditis briggsae] emb|CAE73646.1| Hypothetical protein CBG21146 [Caenorhabditis br

  9. Gene : CBRC-CBRI-05-0477 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0477 V A Serpentine receptor-like proteins SRX10_CAEEL 1e-14 31% ref|X...P_001675630.1| Hypothetical protein CBG05581 [Caenorhabditis briggsae] emb|CAE61647.1| Hypothetical protein ...CBG05581 [Caenorhabditis briggsae] 4e-81 100% MMTLHRILIFLSPMRSTKWFTDIKVAAYCILVCFLVFNWLLVQQVSSCTLNFNALTSFLESA

  10. Gene : CBRC-CBRI-05-0390 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0390 Novel V B UNKNOWN MSHR_COLGU 0.13 26% ref|XP_001674782.1| Hypothe...tical protein CBG11560 [Caenorhabditis briggsae] emb|CAE66310.1| Hypothetical protein CBG11560 [Caenorhabditis br

  11. Gene : CBRC-CBRI-05-0202 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0202 Novel V A Nematode chemoreceptors SRJ38_CAEEL 1e-26 27% ref|XP_00...1673186.1| Hypothetical protein CBG01348 [Caenorhabditis briggsae] emb|CAE58247.1| Hypothetical protein CBG01348 [Caenorhabditis br

  12. Gene : CBRC-CBRE-01-1267 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1267 Novel UN B UNKNOWN NK3R_MOUSE 0.053 24% ref|XP_001674417.1| Hypot...hetical protein CBG19025 [Caenorhabditis briggsae] emb|CAE71956.1| Hypothetical protein CBG19025 [Caenorhabditis br

  13. Gene : CBRC-CBRI-06-0081 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-06-0081 Novel X B UNKNOWN SRD47_CAEEL 5e-55 38% ref|XP_001677619.1| Hypot...hetical protein CBG05288 [Caenorhabditis briggsae] emb|CAE61420.1| Hypothetical protein CBG05288 [Caenorhabditis br

  14. Gene : CBRC-CBRE-01-1100 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1100 Novel UN B UNKNOWN LEU1_BUCUM 0.69 29% ref|XP_001670945.1| Hypoth...etical protein CBG19904 [Caenorhabditis briggsae] emb|CAE72685.1| Hypothetical protein CBG19904 [Caenorhabditis br

  15. Gene : CBRC-CBRI-05-0224 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0224 Novel V B UNKNOWN NU2M_MUNMN 0.26 23% ref|XP_001673249.1| Hypothe...tical protein CBG01420 [Caenorhabditis briggsae] emb|CAE58310.1| Hypothetical protein CBG01420 [Caenorhabditis br

  16. Gene : CBRC-CBRE-01-0499 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0499 Novel UN A Serpentine receptor-like proteins SRT55_CAEEL 6e-13 25...% ref|XP_001673244.1| Hypothetical protein CBG01415 [Caenorhabditis briggsae] emb|CAE58305.1| Hypothetical p...rotein CBG01415 [Caenorhabditis briggsae] 3e-82 64% MLNPDFLRFPAFKIMVSLALCDIPSVCVDSIATGIMGYHGIVFCDYPRLIFFLGAN

  17. Gene : CBRC-CBRE-01-1065 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1065 Novel UN A UNKNOWN CTR2_OCTVU 0.26 25% ref|XP_001673073.1| Hypoth...etical protein CBG01222 [Caenorhabditis briggsae] emb|CAE58134.1| Hypothetical protein CBG01222 [Caenorhabditis br

  18. Gene : CBRC-CBRE-01-0491 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0491 Novel UN A Serpentine receptor-like proteins SRX10_CAEEL 2e-14 25...% ref|XP_001675676.1| Hypothetical protein CBG05640 [Caenorhabditis briggsae] emb|CAE61693.1| Hypothetical p...rotein CBG05640 [Caenorhabditis briggsae] 8e-47 47% MILFSLIFTFICITSLTFNLFLFYVTYKLNDKRFRDIFGPSLTLLCTFSYEHTFYL

  19. Gene : CBRC-CBRE-01-0202 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0202 Novel UN B UNKNOWN SRJ38_CAEEL 0.003 23% ref|XP_001673452.1| Hypo...thetical protein CBG08563 [Caenorhabditis briggsae] emb|CAE63973.1| Hypothetical protein CBG08563 [Caenorhabditis br

  20. Gene : CBRC-CBRI-06-0058 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-06-0058 Novel X A UNKNOWN QRFPR_RAT 3e-09 41% ref|XP_001677218.1| Hypothe...tical protein CBG16910 [Caenorhabditis briggsae] emb|CAE70357.1| Hypothetical protein CBG16910 [Caenorhabditis br

  1. Gene : CBRC-CBRI-05-0275 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0275 Novel V B Nematode chemoreceptors SRJ38_CAEEL 5e-39 29% ref|XP_00...1673730.1| Hypothetical protein CBG23243 [Caenorhabditis briggsae] emb|CAE75277.1| Hypothetical protein CBG23243 [Caenorhabditis br

  2. Gene : CBRC-CBRI-05-0141 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0141 V A UNKNOWN CYB6_BIGNA 0.019 26% ref|XP_001673023.1| Hypothetical... protein CBG01164 [Caenorhabditis briggsae] emb|CAE58083.1| Hypothetical protein CBG01164 [Caenorhabditis br

  3. Gene : CBRC-CBRI-05-0240 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0240 pseudo Novel V A UNKNOWN OR9Q2_HUMAN 0.12 22% ref|XP_001673391.1|... Hypothetical protein CBG08631 [Caenorhabditis briggsae] emb|CAE64034.1| Hypothetical protein CBG08631 [Caenorhabditis br

  4. Gene : CBRC-CBRI-05-0194 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0194 Novel V B Nematode chemoreceptors MVIN_AQUAE 0.73 26% ref|XP_0016...73175.1| Hypothetical protein CBG01336 [Caenorhabditis briggsae] emb|CAE58236.1| Hypothetical protein CBG01336 [Caenorhabditis br

  5. Gene : CBRC-CBRI-05-0488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0488 Novel V A Nematode chemoreceptors SRJ38_CAEEL 2e-09 24% ref|XP_00...1675713.1| Hypothetical protein CBG05681 [Caenorhabditis briggsae] emb|CAE61730.1| Hypothetical protein CBG05681 [Caenorhabditis br

  6. Gene : CBRC-CBRE-01-0356 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0356 Novel UN B Serpentine receptor-like proteins SRT55_CAEEL 3e-08 27...% ref|XP_001672333.1| Hypothetical protein CBG11307 [Caenorhabditis briggsae] emb|CAE66090.1| Hypothetical p...rotein CBG11307 [Caenorhabditis briggsae] 2e-72 81% MTYGTIFEILFIPCLLAMRDKDLWRMSCYKIMFFVGIVDMLALAMNSISTGYLAYE

  7. Gene : CBRC-CBRE-01-1333 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1333 Novel UN A Nematode chemoreceptors SRJ38_CAEEL 5e-07 20% ref|XP_0...01672228.1| Hypothetical protein CBG11436 [Caenorhabditis briggsae] emb|CAE66196.1| Hypothetical protein CBG11436 [Caenorhabditis br

  8. Gene : CBRC-CBRI-04-0104 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-04-0104 Novel IV A Nematode chemoreceptors SRJ38_CAEEL 3e-10 18% ref|XP_0...01671242.1| Hypothetical protein CBG01681 [Caenorhabditis briggsae] emb|CAE58526.1| Hypothetical protein CBG01681 [Caenorhabditis br

  9. Gene : CBRC-CBRI-05-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0073 Novel V A Serpentine receptor-like proteins OL146_MOUSE 0.041 24%... ref|XP_001672695.1| Hypothetical protein CBG21804 [Caenorhabditis briggsae] emb|CAE74133.1| Hypothetical pr...otein CBG21804 [Caenorhabditis briggsae] 1e-121 76% MSTIITTVSLSALVFSFINVLLNLYLLFMVFCKSKFSKNSSGLFLIYFRFAVDMLY

  10. Gene : CBRC-CBRE-01-0123 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0123 Novel UN A Nematode chemoreceptors SRH72_CAEEL 5e-04 28% ref|XP_0...01672511.1| Hypothetical protein CBG00824 [Caenorhabditis briggsae] emb|CAE57800.1| Hypothetical protein CBG00824 [Caenorhabditis br

  11. Gene : CBRC-CBRI-05-0424 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0424 Novel V A Serpentine receptor-like proteins SRX45_CAEEL 3e-22 27%... ref|XP_001675200.1| Hypothetical protein CBG04962 [Caenorhabditis briggsae] emb|CAE61188.1| Hypothetical pr...otein CBG04962 [Caenorhabditis briggsae] 1e-122 89% MIPFLHYYRALVNWAVLYAILKLKSFNHSFGFLSANQAIVDALHGSMFLFYFCPMV

  12. Gene : CBRC-CBRE-01-1236 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1236 Novel UN A Nematode chemoreceptors SRJ38_CAEEL 5e-08 17% ref|XP_0...01670507.1| Hypothetical protein CBG05795 [Caenorhabditis briggsae] emb|CAE61825.1| Hypothetical protein CBG05795 [Caenorhabditis br

  13. Gene : CBRC-CBRE-01-1418 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1418 Novel UN A UNKNOWN O51A4_HUMAN 1e-04 28% ref|XP_001673394.1| Hypo...thetical protein CBG08628 [Caenorhabditis briggsae] emb|CAE64031.1| Hypothetical protein CBG08628 [Caenorhabditis br

  14. Gene : CBRC-CBRI-05-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0006 Novel V A UNKNOWN YYO1_CAEEL 0.024 23% ref|XP_001672213.1| Hypoth...etical protein CBG11453 [Caenorhabditis briggsae] emb|CAE66211.1| Hypothetical protein CBG11453 [Caenorhabditis br

  15. Gene : CBRC-CBRI-05-0361 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0361 V B UNKNOWN SRD18_CAEEL 3e-38 49% ref|XP_001674533.1| Hypothetica...l protein CBG19158 [Caenorhabditis briggsae] emb|CAE72072.1| Hypothetical protein CBG19158 [Caenorhabditis br

  16. Gene : CBRC-CBRE-01-1571 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1571 UN B UNKNOWN GP139_HUMAN 2e-04 24% ref|XP_001679405.1| Hypothetic...al protein CBG02871 [Caenorhabditis briggsae] emb|CAE59486.1| Hypothetical protein CBG02871 [Caenorhabditis br

  17. Gene : CBRC-CBRI-06-0096 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-06-0096 pseudo Novel X A Nematode chemoreceptors SRD50_CAEEL 1e-80 57% re...f|XP_001677897.1| Hypothetical protein CBG07442 [Caenorhabditis briggsae] emb|CAE63140.1| Hypothetical prote...in CBG07442 [Caenorhabditis briggsae] 1e-133 92% MMSPLESQLVLIFTVFFNVYLFSAISAQLLLLFLIKTCKVTALKDMRLYLLNILILQFI

  18. Gene : CBRC-CBRI-08-0168 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-08-0168 Novel UN B Serpentine receptor-like proteins SRT55_CAEEL 5e-09 25...% ref|XP_001672822.1| Hypothetical protein CBG10386 [Caenorhabditis briggsae] emb|CAE65426.1| Hypothetical p...rotein CBG10386 [Caenorhabditis briggsae] 7e-69 57% MDYISTDFQMSLTYLLWNGLEMNLDYYQCPTEPKPSEIRRELWGAYFCWTGLILIL

  19. Gene : CBRC-CBRI-06-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-06-0054 Novel X B UNKNOWN YCF1_NYMAL 0.030 25% ref|XP_001676987.1| Hypoth...etical protein CBG10912 [Caenorhabditis briggsae] emb|CAE65804.1| Hypothetical protein CBG10912 [Caenorhabditis br

  20. Gene : CBRC-CBRE-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1304 pseudo Novel UN B Nematode chemoreceptors SRD1_CAEEL 1e-04 23% re...f|XP_001669303.1| Hypothetical protein CBG15825 [Caenorhabditis briggsae] emb|CAE69598.1| Hypothetical prote...in CBG15825 [Caenorhabditis briggsae] 8e-40 42% MIRPIHIVPYIAFLGAQVFNSLLIYFIIARSDKQIGDFRYIMGLFAFYAIFYSWVGIFTQ

  1. Gene : CBRC-CBRI-05-0484 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0484 V A Serpentine receptor-like proteins SRT55_CAEEL 4e-10 30% ref|X...P_001675699.1| Hypothetical protein CBG05666 [Caenorhabditis briggsae] emb|CAE61716.1| Hypothetical protein ...CBG05666 [Caenorhabditis briggsae] 1e-85 100% MTYGIVVNLLYIPMISVMMEKEQFKMSCFKIMTFLTIIDIFALTVNSIITGFLSYHGAVYCT

  2. Gene : CBRC-CBRI-05-0354 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0354 pseudo Novel V A Nematode chemoreceptors NRM_DROPS 4.7 25% ref|XP..._001674525.1| Hypothetical protein CBG19150 [Caenorhabditis briggsae] emb|CAE72064.1| Hypothetical protein C

  3. Gene : CBRC-CBRE-01-0747 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0747 Novel UN A Nematode chemoreceptors SRD32_CAEEL 9e-06 30% ref|XP_0...01674724.1| Hypothetical protein CBG19383 [Caenorhabditis briggsae] emb|CAE72264.1| Hypothetical protein CBG19383 [Caenorhabditis br

  4. Gene : CBRC-CBRE-01-1128 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1128 pseudo Novel UN A Serpentine receptor-like proteins ANKH_XENLA 1....3 23% ref|XP_001672730.1| Hypothetical protein CBG21841 [Caenorhabditis briggsae] emb|CAE74168.1| Hypothetic...al protein CBG21841 [Caenorhabditis briggsae] 1e-31 40% MLLFYYKFGIDVLMGITEAVFLTFVIFFTLFHEYLKDYKNFIIYFSLPGSTL

  5. Gene : CBRC-CBRE-01-1030 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1030 Novel UN A Sre proteins SRE45_CAEEL 1e-75 39% ref|XP_001680019.1|... Hypothetical protein CBG20745 [Caenorhabditis briggsae] emb|CAE73318.1| Hypothetical protein CBG20745 [Caenorhabditis br

  6. Gene : CBRC-CBRE-01-0505 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0505 Novel UN A Serpentine receptor-like proteins SRT55_CAEEL 8e-13 32...% ref|XP_001675699.1| Hypothetical protein CBG05666 [Caenorhabditis briggsae] emb|CAE61716.1| Hypothetical p...rotein CBG05666 [Caenorhabditis briggsae] 4e-73 82% MIYGITINLIYIPMIGVMIEKEQFKMSCFKIMSFLTVIDILALSVNSIITGFLSYH

  7. Gene : CBRC-CBRI-05-0158 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0158 Novel V A Nematode chemoreceptors OPRK_RAT 0.003 27% ref|XP_00167...3061.1| Hypothetical protein CBG01210 [Caenorhabditis briggsae] emb|CAE58122.1| Hypothetical protein CBG01210 [Caenorhabditis br

  8. Gene : CBRC-CBRE-01-0806 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0806 pseudo Novel UN A UNKNOWN FMAR_DROME 9e-09 21% ref|XP_001676800.1...| Hypothetical protein CBG14781 [Caenorhabditis briggsae] emb|CAE68822.1| Hypothetical protein CBG14781 [Caenorhabditis br

  9. Gene : CBRC-CBRI-02-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-02-0052 Novel II B Srg proteins SRG16_CAEEL 1e-31 45% ref|XP_001680225.1|... Hypothetical protein CBG20988 [Caenorhabditis briggsae] emb|CAE73525.1| Hypothetical protein CBG20988 [Caenorhabditis br

  10. Gene : CBRC-CBRE-01-0303 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0303 Novel UN D UNKNOWN MRP1_HUMAN 1e-94 46% ref|XP_001666963.1| Hypot...hetical protein CBG08146 [Caenorhabditis briggsae] emb|CAE63648.1| Hypothetical protein CBG08146 [Caenorhabditis br

  11. Gene : CBRC-CBRE-01-1456 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1456 Novel UN A Nematode chemoreceptors SRD7_CAEEL 6e-37 30% ref|XP_00...1671183.1| Hypothetical protein CBG01751 [Caenorhabditis briggsae] emb|CAE58585.1| Hypothetical protein CBG01751 [Caenorhabditis br

  12. Gene : CBRC-CBRE-01-0954 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0954 Novel UN A Nematode chemoreceptors YIPF1_MOUSE 0.44 24% ref|XP_00...1674860.1| Hypothetical protein CBG04557 [Caenorhabditis briggsae] emb|CAE60848.1| Hypothetical protein CBG04557 [Caenorhabditis br

  13. Gene : CBRC-CBRI-05-0323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0323 pseudo Novel V A UNKNOWN AGTR1_SHEEP 0.027 20% ref|XP_001674263.1...| Hypothetical protein CBG09288 [Caenorhabditis briggsae] emb|CAE64544.1| Hypothetical protein CBG09288 [Caenorhabditis br

  14. Gene : CBRC-CBRI-04-0036 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-04-0036 Novel IV B UNKNOWN RAD50_METJA 1.2 27% ref|XP_001669876.1| Hypoth...etical protein CBG22591 [Caenorhabditis briggsae] emb|CAE74763.1| Hypothetical protein CBG22591 [Caenorhabditis br

  15. Gene : CBRC-CBRI-05-0156 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0156 Novel V A Nematode chemoreceptors SRJ38_CAEEL 2e-06 19% ref|XP_00...1673035.1| Hypothetical protein CBG01179 [Caenorhabditis briggsae] emb|CAE58095.1| Hypothetical protein CBG01179 [Caenorhabditis br

  16. Gene : CBRC-CBRI-06-0069 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-06-0069 Novel X A Orphan receptors YRC3_CAEEL 0.0 71% ref|XP_001677452.1|... Hypothetical protein CBG15435 [Caenorhabditis briggsae] emb|CAE69349.1| Hypothetical protein CBG15435 [Caenorhabditis br

  17. Gene : CBRC-CBRE-01-0462 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0462 Novel UN A Serpentine receptor-like proteins SRT55_CAEEL 2e-16 28...% ref|XP_001673244.1| Hypothetical protein CBG01415 [Caenorhabditis briggsae] emb|CAE58305.1| Hypothetical p...rotein CBG01415 [Caenorhabditis briggsae] 3e-84 65% MLNRDLLRYPVFKIMVSLALCDIPSVCVNSIATGIMGYHGIVFCDYPRLIFLLGAN

  18. Gene : CBRC-CBRE-01-0909 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0909 Novel UN A Nematode chemoreceptors SRD32_CAEEL 1e-04 25% ref|XP_0...01674783.1| Hypothetical protein CBG11561 [Caenorhabditis briggsae] emb|CAE66311.1| Hypothetical protein CBG11561 [Caenorhabditis br

  19. Gene : CBRC-CBRI-05-0288 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0288 Novel V C UNKNOWN GPR35_MOUSE 0.060 21% ref|XP_001673793.1| Hypot...hetical protein CBG23163 [Caenorhabditis briggsae] emb|CAE75214.1| Hypothetical protein CBG23163 [Caenorhabditis br

  20. Gene : CBRC-CBRI-05-0389 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0389 Novel V A Nematode chemoreceptors SRJ38_CAEEL 0.005 20% ref|XP_00...1674781.1| Hypothetical protein CBG11559 [Caenorhabditis briggsae] emb|CAE66309.1| Hypothetical protein CBG11559 [Caenorhabditis br

  1. Gene : CBRC-CBRE-01-0972 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0972 Novel UN A UNKNOWN YT66_CAEEL 0.009 18% ref|XP_001675496.1| Hypot...hetical protein CBG18624 [Caenorhabditis briggsae] emb|CAE71652.1| Hypothetical protein CBG18624 [Caenorhabditis br

  2. Gene : CBRC-CBRE-01-1243 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1243 Novel UN A Nematode chemoreceptors SRJ38_CAEEL 1e-07 19% ref|XP_0...01670504.1| Hypothetical protein CBG05799 [Caenorhabditis briggsae] emb|CAE61829.1| Hypothetical protein CBG05799 [Caenorhabditis br

  3. Gene : CBRC-CBRE-01-1106 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1106 Novel UN B Serpentine receptor-like proteins SRX45_CAEEL 2e-07 25...% ref|XP_001673129.1| Hypothetical protein CBG01283 [Caenorhabditis briggsae] emb|CAE58190.1| Hypothetical p...rotein CBG01283 [Caenorhabditis briggsae] 3e-69 59% MLYFNFEVFQITLLGCVLNWCIFYGIHKLTSFNNSFGYLSANQALADALHSTTFLL

  4. Gene : CBRC-CBRI-05-0222 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0222 V B Serpentine receptor-like proteins SRT55_CAEEL 8e-07 27% ref|X...P_001673246.1| Hypothetical protein CBG01417 [Caenorhabditis briggsae] emb|CAE58307.1| Hypothetical protein ...CBG01417 [Caenorhabditis briggsae] 2e-62 100% MLFSKIRTIFQPNIYRNVPHTINNLVVSASTTGLYIYMCIFLLYKKGKSTNSMWMSRNKNQV

  5. Gene : CBRC-CBRI-05-0181 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0181 Novel V A Serpentine receptor-like proteins PAR1_MOUSE 0.003 25% ...ref|XP_001674530.1| Hypothetical protein CBG19155 [Caenorhabditis briggsae] emb|CAE72069.1| Hypothetical pro...tein CBG19155 [Caenorhabditis briggsae] 4e-56 39% MTPKLYLGLVSFSFSSLAIFLNFLIAPPIIHLAFVERKNTFYVIAFFNLLSDLLQLFA

  6. Gene : CBRC-CBRI-06-0047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-06-0047 X A UNKNOWN OR4P4_HUMAN 0.003 21% ref|XP_001676851.1| Hypothetica...l protein CBG14836 [Caenorhabditis briggsae] emb|CAE68873.1| Hypothetical protein CBG14836 [Caenorhabditis br

  7. Gene : CBRC-CBRE-01-0426 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0426 Novel UN B Nematode chemoreceptors HAK4_ORYSJ 1.1 23% ref|XP_0016...73175.1| Hypothetical protein CBG01336 [Caenorhabditis briggsae] emb|CAE58236.1| Hypothetical protein CBG01336 [Caenorhabditis br

  8. Gene : CBRC-CBRE-01-1209 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1209 Novel UN B UNKNOWN GLMS_SHEON 2.0 31% ref|XP_001670945.1| Hypothe...tical protein CBG19904 [Caenorhabditis briggsae] emb|CAE72685.1| Hypothetical protein CBG19904 [Caenorhabditis br

  9. Gene : CBRC-CBRI-03-0042 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-03-0042 III A Orphan receptors YKR5_CAEEL 0.0 76% ref|XP_001666687.1| Hyp...othetical protein CBG22950 [Caenorhabditis briggsae] emb|CAE75040.1| Hypothetical protein CBG22950 [Caenorhabditis br

  10. Gene : CBRC-CBRI-05-0169 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0169 Novel V A Nematode chemoreceptors SRJ38_CAEEL 2e-07 21% ref|XP_00...1673076.1| Hypothetical protein CBG01225 [Caenorhabditis briggsae] emb|CAE58137.1| Hypothetical protein CBG01225 [Caenorhabditis br

  11. Gene : CBRC-CBRE-01-0543 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0543 Novel UN A Serpentine receptor-like proteins SRT55_CAEEL 0.40 23%... ref|XP_001673396.1| Hypothetical protein CBG08624 [Caenorhabditis briggsae] emb|CAE64029.1| Hypothetical pr...otein CBG08624 [Caenorhabditis briggsae] 7e-77 88% MYGASYCDFPNFIYISGSIGLGCWCSACLTCLVLALNRILDMVCPLMVKTYFRGLRT

  12. Gene : CBRC-CBRI-05-0086 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0086 Novel V A Nematode chemoreceptors SRH72_CAEEL 4e-09 21% ref|XP_00...1672799.1| Hypothetical protein CBG10354 [Caenorhabditis briggsae] emb|CAE65403.1| Hypothetical protein CBG10354 [Caenorhabditis br

  13. Gene : CBRC-CBRI-05-0442 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0442 pseudo V A Nematode chemoreceptors SRH72_CAEEL 1e-11 22% ref|XP_0...01675272.1| Hypothetical protein CBG22615 [Caenorhabditis briggsae] emb|CAE74784.1| Hypothetical protein CBG22615 [Caenorhabditis br

  14. Gene : CBRC-CBRE-01-1562 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1562 Novel UN B UNKNOWN UPPP_METMP 1.6 35% ref|XP_001677579.1| Hypothe...tical protein CBG05226 [Caenorhabditis briggsae] emb|CAE61380.1| Hypothetical protein CBG05226 [Caenorhabditis br

  15. Gene : CBRC-CBRI-05-0453 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0453 V A Serpentine receptor-like proteins OPSD_MOUSE 6e-06 18% ref|XP..._001675358.1| Hypothetical protein CBG22812 [Caenorhabditis briggsae] emb|CAE74929.1| Hypothetical protein C

  16. Gene : CBRC-CBRE-01-0679 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0679 pseudo Novel UN B UNKNOWN MVIN_BUCBP 0.51 27% ref|XP_001674409.1|... Hypothetical protein CBG19015 [Caenorhabditis briggsae] emb|CAE71948.1| Hypothetical protein CBG19015 [Caenorhabditis br

  17. Gene : CBRC-CBRI-05-0419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0419 Novel V A Nematode chemoreceptors ALG10_GIBZE 1.7 26% ref|XP_0016...75171.1| Hypothetical protein CBG04925 [Caenorhabditis briggsae] emb|CAE61159.1| Hypothetical protein CBG04925 [Caenorhabditis br

  18. Gene : CBRC-CBRI-02-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-02-0003 II A Sra proteins SRA9_CAEEL 7e-51 47% ref|XP_001678286.1| Hypoth...etical protein CBG18722 [Caenorhabditis briggsae] emb|CAE71738.1| Hypothetical protein CBG18722 [Caenorhabditis br

  19. Gene : CBRC-CBRE-01-1047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1047 Novel UN B UNKNOWN VRP1_YEAST 3e-05 27% ref|XP_001664991.1| Hypot...hetical protein CBG13262 [Caenorhabditis briggsae] emb|CAE67694.1| Hypothetical protein CBG13262 [Caenorhabditis br

  20. Gene : CBRC-CBRI-04-0061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-04-0061 IV B UNKNOWN SRX45_CAEEL 3e-09 21% ref|XP_001670581.1| Hypothetic...al protein CBG05707 [Caenorhabditis briggsae] emb|CAE61752.1| Hypothetical protein CBG05707 [Caenorhabditis br

  1. Gene : CBRC-CBRE-01-0181 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0181 Novel UN C UNKNOWN YXFA_LACLA 0.46 26% ref|XP_001665629.1| Hypoth...etical protein CBG17977 [Caenorhabditis briggsae] emb|CAE71123.1| Hypothetical protein CBG17977 [Caenorhabditis br

  2. Gene : CBRC-CBRI-05-0134 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0134 V A UNKNOWN SRD63_CAEEL 8e-28 28% ref|XP_001672988.1| Hypothetica...l protein CBG01125 [Caenorhabditis briggsae] emb|CAE58048.1| Hypothetical protein CBG01125 [Caenorhabditis br

  3. Gene : CBRC-CBRE-01-0338 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0338 Novel UN A Serpentine receptor-like proteins FFAR2_RAT 0.77 32% r...ef|XP_001673424.1| Hypothetical protein CBG08595 [Caenorhabditis briggsae] emb|CAE64001.1| Hypothetical prot...ein CBG08595 [Caenorhabditis briggsae] 5e-64 63% MRIFPGGSYLIITVINLFCDFAPYNVTVMFGLVGFNLMEIRSFLAAIIAIERVLATTIP

  4. Gene : CBRC-CBRI-05-0101 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0101 V A Serpentine receptor-like proteins SRT55_CAEEL 3e-08 22% ref|X...P_001672817.1| Hypothetical protein CBG10379 [Caenorhabditis briggsae] emb|CAE65421.1| Hypothetical protein ...CBG10379 [Caenorhabditis briggsae] 8e-95 98% MLVLAIYDISSIFIHSISTGILGFYGIPFCDYPRIIACLGGVALGSWMGCCIASMALAVIRIC

  5. Gene : CBRC-CBRI-08-0157 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-08-0157 UN A Serpentine receptor-like proteins WZYE_PHOLL 0.20 26% ref|XP..._001675529.1| Hypothetical protein CBG18659 [Caenorhabditis briggsae] emb|CAE71685.1| Hypothetical protein C

  6. Gene : CBRC-CBRI-04-0102 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-04-0102 IV A Nematode chemoreceptors SRD7_CAEEL 8e-48 32% ref|XP_00167118...3.1| Hypothetical protein CBG01751 [Caenorhabditis briggsae] emb|CAE58585.1| Hypothetical protein CBG01751 [Caenorhabditis br

  7. Gene : CBRC-CBRI-05-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0028 V B Serpentine receptor-like proteins SRT55_CAEEL 2e-07 26% ref|X...P_001672333.1| Hypothetical protein CBG11307 [Caenorhabditis briggsae] emb|CAE66090.1| Hypothetical protein ...CBG11307 [Caenorhabditis briggsae] 1e-99 100% MSPDAWTSQFGMQRPILGIISISYGSIMEVLFIPSLLAMLDKDLWCLSCYKIMFFVGIVDML

  8. Gene : CBRC-CBRE-01-0255 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0255 Novel UN A Nematode chemoreceptors SRJ38_CAEEL 1e-05 25% ref|XP_0...01671931.1| Hypothetical protein CBG13894 [Caenorhabditis briggsae] emb|CAE68223.1| Hypothetical protein CBG13894 [Caenorhabditis br

  9. Microorganisms' mediated reduction of β-ketoesters

    African Journals Online (AJOL)

    STORAGESEVER

    2008-10-20

    Oct 20, 2008 ... purified oxidoreductases require expensive cofactors for performing the ... maintained on MRS medium at 4oC and transferred every 2 weeks. ... 1:2:0.11. CAE was recovered by vacuum distillation (50 - 51oC,. 20 mm Hg) with 89% yield against MCA.The purity of compound was established by GC as 98%.

  10. Créer des possibilités d'emploi pour les jeunes en Afrique de l'Est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Afrique de l'Est (CAE), mais les jeunes de la région estiment qu'il est de plus en plus difficile de trouver un emploi décent. Un projet soutenu par le CRDI, Approches novatrices pour la création d'emplois pour les jeunes et leur ...

  11. Economic and technical feasibility study of compressed air storage

    Energy Technology Data Exchange (ETDEWEB)

    1976-03-01

    The results of a study of the economic and technical feasibility of compressed air energy storage (CAES) are presented. The study, which concentrated primarily on the application of underground air storage with combustion turbines, consisted of two phases. In the first phase a general assessment of the technical alternatives, economic characteristics and the institutional constraints associated with underground storage of compressed air for utility peaking application was carried out. The goal of this assessment was to identify potential barrier problems and to define the incentive for the implementation of compressed air storage. In the second phase, the general conclusions of the assessment were tested by carrying out the conceptual design of a CAES plant at two specific sites, and a program of further work indicated by the assessment study was formulated. The conceptual design of a CAES plant employing storage in an aquifer and that of a plant employing storage in a conventionally excavated cavern employing a water leg to maintain constant pressure are shown. Recommendations for further work, as well as directions of future turbo-machinery development, are made. It is concluded that compressed air storage is technically feasible for off-peak energy storage, and, depending on site conditions, CAES plants may be favored over simple cycle turbine plants to meet peak demands. (LCL)

  12. TIC et enseignement de la Chimie : au-delà des discours, quels dispositifs d’enseignement pour quels apprentissages?

    Directory of Open Access Journals (Sweden)

    MARIE-THÉRÈSE SALIBA

    2012-12-01

    Full Text Available In this research we suggest to take advantage of the opportunities offered by the new information and communication technologies (NICT. This new techno-scientific process of investigation will be realized via a laboratory of CAE (Computer assisted experimentations where the computer is the learning tool that seeks in real time concrete observations. Experimental know- how, and the using of abstract representations to solve problems. To do this, we have introduced innovated courses in Didactics based on ICT/CAE in our Masters programs in the Holy Spirit University of Kaslik (USEK. These courses are intended for initial and continuous training of our student-teachers in mathematics and science and technology. Subsequently, our student-teachers will use CAE with their students in high schools for teaching chemistry to test and validate the functional aspect of the environment CAE proposed. The educational validation of this paradigm will be based on the confrontation between a priori analysis and subsequent findings to measure the gap of understanding that students have acquired.

  13. Towards a Computational Theory of Definite Anaphora Comprehension in English Discourse.

    Science.gov (United States)

    1979-06-01

    sentence template information; for example, part of the case frane semantics for verbs may specify those cae positions which require a specific or...re____7 rential parser frane inapping term discourse Ep interpreter prcsor processor interpreter discourse interpreter. 1 An example of the PAL system

  14. Linkage and association analysis of CACNG3 in childhood absence epilepsy

    NARCIS (Netherlands)

    Everett, Kate V.; Chioza, Barry; Aicardi, Jean; Aschauer, Harald; Brouwer, Oebele; Callenbach, Petra; Covanis, Athanasios; Dulac, Olivier; Eeg-Olofsson, Orvar; Feucht, Martha; Friis, Mogens; Goutieres, Francoise; Guerrini, Renzo; Heils, Armin; Kjeldsen, Marianne; Lehesjoki, Anna-Elina; Makoff, Andrew; Nabbout, Rima; Olsson, Ingrid; Sander, Thomas; Siren, Auli; McKeigue, Paul; Robinson, Robert; Taske, Nichole; Rees, Michele; Gardiner, Mark

    Childhood absence epilepsy (CAE) is an idiopathic generalised epilepsy characterised by absence seizures manifested by transitory loss of awareness with 2.5 - 4 Hz spike - wave complexes on ictal EEG. A genetic component to aetiology is established but the mechanism of inheritance and the genes

  15. Coffea arabica extract and its constituents prevent photoaging by suppressing MMPs expression and MAP kinase pathway.

    Science.gov (United States)

    Chiang, Hsiu-Mei; Lin, Tsen-Jung; Chiu, Chen-Yuan; Chang, Chiung-Wen; Hsu, Kuo-Chiu; Fan, Pei-Ching; Wen, Kuo-Ching

    2011-01-01

    UV is a potent factor in skin photoaging and photocarcinogenesis. Therefore, investigating the inhibiting mechanisms of photoaging would be useful to enable development of agents to slow down the aging process. UV-irradiation increased metalloproteinase (MMP)-1, -3, and -9 and then causes collagen and elastin degradation, leading to the formation of coarse wrinkles and sagging skin. Polyphenols, a group of compounds, possessing a variety of biological activities including inhibition of MMP-1 and elastase, are widely distributed in plants including Coffea arabica. In this study, Coffea arabica leaves extract (CAE), its hydrolysates (CAH), chlororgenic acid and caffeic acid, are studied for their anti-photoaging effect. Coffea arabica leaves were extracted with methanol, and the extract was hydrolyzed with different concentrations of hydrochloric acid. The various concentrations of CAE, CAH, chlororgenic acid and caffeic acid were subject to MMPs and elastase inhibition tests. The fibroblast was used for collagen synthesis and MMP-1, -3, -9 inhibition tests on herbal extracts. The results showed that CAE stimulated type I procollagen expression, inhibited MMP-1, -3, -9 expression and inhibited the phosphorylation of JNK, ERK and p38. The results suggest that CAE can prevent photo-damage in skin through inhibiting MMP expression and MAP kinase pathway. Copyright © 2010 Elsevier Ltd. All rights reserved.

  16. A Comparison of Perceptions of Administrative Tasks and Professional Development Needs of Chairpersons/Heads of Departments in Australia and the U.S.

    Science.gov (United States)

    Seagren, Alan T.; Creswell, John W.

    Management tasks of department chairs and their perceived needs for staff development were studied in Australian Colleges of Advanced Education (CAE), U.S. state colleges, and a U.S. university. Data were obtained from 679 Australian and 98 U.S. department heads, using similar instruments developed by the Nebraska-Lincoln Task Force on Management…

  17. NCBI nr-aa BLAST: CBRC-DNOV-01-0407 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0407 ref|NP_887655.1| FMN-dependent dehydrogenase [Bordetella bronchiseptic...a RB50] emb|CAE31607.1| FMN-dependent dehydrogenase [Bordetella bronchiseptica RB50] NP_887655.1 6.6 27% ...

  18. NCBI nr-aa BLAST: CBRC-DDIS-04-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-04-0000 ref|NP_889639.1| ABC transporter, ATP-binding protein [Bordetella bronchiseptic...a RB50] emb|CAE33595.1| ABC transporter, ATP-binding protein [Bordetella bronchiseptica RB50] NP_889639.1 4e-68 38% ...

  19. NCBI nr-aa BLAST: CBRC-XTRO-01-0811 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0811 ref|NP_891493.1| hypothetical protein BB4959 [Bordetella bronchiseptic...a RB50] emb|CAE35323.1| putative membrane protein [Bordetella bronchiseptica RB50] NP_891493.1 2e-18 34% ...

  20. NCBI nr-aa BLAST: CBRC-MMUS-11-0135 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-11-0135 ref|NP_889714.1| hypothetical protein BB3178 [Bordetella bronchiseptic...a RB50] emb|CAE33670.1| conserved hypothetical protein [Bordetella bronchiseptica RB50] NP_889714.1 3.0 26% ...

  1. NCBI nr-aa BLAST: CBRC-TGUT-37-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-37-0075 ref|NP_890205.1| hypothetical protein BB3670 [Bordetella bronchiseptic...a RB50] emb|CAE35643.1| putative membrane protein [Bordetella bronchiseptica RB50] NP_890205.1 0.80 35% ...

  2. NCBI nr-aa BLAST: CBRC-XTRO-01-0311 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0311 ref|NP_891493.1| hypothetical protein BB4959 [Bordetella bronchiseptic...a RB50] emb|CAE35323.1| putative membrane protein [Bordetella bronchiseptica RB50] NP_891493.1 1e-26 30% ...

  3. NCBI nr-aa BLAST: CBRC-DNOV-01-1857 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1857 ref|NP_889799.1| multidrug resistance protein [Bordetella bronchiseptic...a RB50] emb|CAE33755.1| multidrug resistance protein [Bordetella bronchiseptica RB50] NP_889799.1 8.6 23% ...

  4. NCBI nr-aa BLAST: CBRC-DNOV-01-0156 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0156 ref|NP_887655.1| FMN-dependent dehydrogenase [Bordetella bronchiseptic...a RB50] emb|CAE31607.1| FMN-dependent dehydrogenase [Bordetella bronchiseptica RB50] NP_887655.1 8.8 34% ...

  5. NCBI nr-aa BLAST: CBRC-LAFR-01-2188 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2188 ref|NP_887772.1| hypothetical protein BB1226 [Bordetella bronchiseptic...a RB50] emb|CAE31724.1| putative membrane protein [Bordetella bronchiseptica RB50] NP_887772.1 0.37 27% ...

  6. NCBI nr-aa BLAST: CBRC-XTRO-01-0648 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0648 ref|NP_890139.1| putative iron uptake protein [Bordetella bronchiseptic...a RB50] emb|CAE35577.1| putative iron uptake protein [Bordetella bronchiseptica RB50] NP_890139.1 2e-95 42% ...

  7. NCBI nr-aa BLAST: CBRC-DYAK-04-0110 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-04-0110 ref|NP_889241.1| hypothetical protein BB2704 [Bordetella bronchiseptic...a RB50] emb|CAE33197.1| Putative membrane protein [Bordetella bronchiseptica RB50] NP_889241.1 0.044 25% ...

  8. NCBI nr-aa BLAST: CBRC-DNOV-01-1620 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1620 ref|NP_887655.1| FMN-dependent dehydrogenase [Bordetella bronchiseptic...a RB50] emb|CAE31607.1| FMN-dependent dehydrogenase [Bordetella bronchiseptica RB50] NP_887655.1 9.9 27% ...

  9. NCBI nr-aa BLAST: CBRC-XTRO-01-0575 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0575 ref|NP_890560.1| putative binding-protein-dependent permease [Bordetella bronchiseptic...a RB50] emb|CAE34389.1| putative binding-protein-dependent permease [Bordetella bronchiseptica RB50] NP_890560.1 1e-110 67% ...

  10. NCBI nr-aa BLAST: CBRC-XTRO-01-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0044 ref|NP_887857.1| putative membrane transport protein [Bordetella bronchiseptic...a RB50] emb|CAE31809.1| putative membrane transport protein [Bordetella bronchiseptica RB50] NP_887857.1 4e-99 68% ...

  11. NCBI nr-aa BLAST: CBRC-DNOV-01-0780 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0780 ref|NP_889904.1| putative transmembrane transport protein [Bordetella bronchiseptic...a RB50] emb|CAE33862.1| putative transmembrane transport protein [Bordetella bronchiseptica RB50] NP_889904.1 4.0 32% ...

  12. Beneficial Effects of the Genus Aloe on Wound Healing, Cell Proliferation, and Differentiation of Epidermal Keratinocytes.

    Science.gov (United States)

    Moriyama, Mariko; Moriyama, Hiroyuki; Uda, Junki; Kubo, Hirokazu; Nakajima, Yuka; Goto, Arisa; Akaki, Junji; Yoshida, Ikuyo; Matsuoka, Nobuya; Hayakawa, Takao

    2016-01-01

    Aloe has been used as a folk medicine because it has several important therapeutic properties. These include wound and burn healing, and Aloe is now used in a variety of commercially available topical medications for wound healing and skin care. However, its effects on epidermal keratinocytes remain largely unclear. Our data indicated that both Aloe vera gel (AVG) and Cape aloe extract (CAE) significantly improved wound healing in human primary epidermal keratinocytes (HPEKs) and a human skin equivalent model. In addition, flow cytometry analysis revealed that cell surface expressions of β1-, α6-, β4-integrin, and E-cadherin increased in HPEKs treated with AVG and CAE. These increases may contribute to cell migration and wound healing. Treatment with Aloe also resulted in significant changes in cell-cycle progression and in increases in cell number. Aloe increased gene expression of differentiation markers in HPEKs, suggesting roles for AVG and CAE in the improvement of keratinocyte function. Furthermore, human skin epidermal equivalents developed from HPEKs with medium containing Aloe were thicker than control equivalents, indicating the effectiveness of Aloe on enhancing epidermal development. Based on these results, both AVG and CAE have benefits in wound healing and in treatment of rough skin.

  13. Relationships and Responsibilities

    Science.gov (United States)

    Lomawaima, K. Tsianina

    2013-01-01

    This commentary on Bryan Brayboy's 2011 Presidential address to the Council on Anthropology & Education focuses on the concepts and performance embedded in Dr. Brayboy's demonstration of "how his stories are his theories." Central concepts are academic life in a neoliberal world driven by the myth of disinterested markets, CAE's clear mission of…

  14. Senior Audit and Risk Management Officer | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Primary Duties or Responsibilities Internal Audit Engagements Planning the Audit Engagement Assists the Chief Audit Executive (CAE) to communicate and launch the audit with management; Learns about the audit entity to ensure it is well understood and that its risks have been comprehensively assessed; Formulates ...

  15. A prospective trial of customized adherence enhancement plus long-acting injectable antipsychotic medication in homeless or recently homeless individuals with schizophrenia or schizoaffective disorder

    Science.gov (United States)

    Sajatovic, Martha; Levin, Jennifer; Ramirez, Luis F.; Hahn, David Y.; Tatsuoka, Curtis; Bialko, Christopher S.; Cassidy, Kristin A.; Fuentes-Casiano, Edna; Williams, Tiffany D.

    2014-01-01

    Background Treatment non-adherence in people with schizophrenia is associated with relapse and homelessness. Building upon the usefulness of long-acting medication, and our work in psychosocial interventions to enhance adherence, we conducted a prospective uncontrolled trial of customized adherence enhancement (CAE) plus long-acting injectable antipsychotic (LAI) using haloperidol decanoate in 30 homeless or recently homeless individuals with schizophrenia and schizoaffective disorder. Methods Participants received monthly CAE and LAI (CAE-L) for 6 months. Primary outcomes were adherence as measured by the Tablets Routine Questionnaire (TRQ) and housing status. Secondary outcomes included psychiatric symptoms, functioning, side effects, and hospitalizations. Results Mean age of participants was 41.8 years (SD 8.6), mainly minorities (90% African-American) and mainly single/never married (70%). Most (97%) had past or current substance abuse, and had been incarcerated (97%). Ten individuals (33%) terminated the study prematurely. CAE-L was associated with good adherence to LAI (76% at 6 months) and dramatic improvement in oral medication adherence, which changed from missing 46% of medication at study enrollment to missing only 10% at study end (p = 0.03). There were significant improvements in psychiatric symptoms (pschizoaffective disorder. Additional research is needed on effective and practical approaches to improving health outcomes for homeless people with serious mental illness. PMID:24434094

  16. Gene : CBRC-XTRO-01-3655 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3655 Novel UN C UNKNOWN TRPC2_RAT 6e-32 27% ref|NP_001089174.1| putative transient... receptor potential channel [Xenopus laevis] emb|CAE09056.1| putative transient receptor potenti

  17. NCBI nr-aa BLAST: CBRC-EEUR-01-1166 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-1166 ref|YP_670866.1| putative L-fucose permease [Escherichia coli 536...] emb|CAE85172.1| hypothetical protein [Escherichia coli] gb|ABG70965.1| putative L-fucose permease [Escherichia coli 536] YP_670866.1 2.6 27% ...

  18. Computer-aided evaluation as an adjunct to revised BI-RADS Atlas: improvement in positive predictive value at screening breast MRI

    Energy Technology Data Exchange (ETDEWEB)

    Gweon, Hye Mi; Cho, Nariya; Seo, Mirinae; Chu, A. Jung; Moon, Woo Kyung [Seoul National University College of Medicine and Seoul National University Hospital, Department of Radiology, Seoul (Korea, Republic of)

    2014-08-15

    To investigate whether kinetic features via magnetic resonance (MR)-computer-aided evaluation (CAE) can improve the positive predictive value (PPV) of morphological descriptors for suspicious lesions at screening breast MRI. One hundred and sixteen consecutive, suspiciously enhancing lesions detected at contralateral breast MRI screening in 116 women with newly-diagnosed breast cancers were included. Morphological descriptors according to the revised BI-RADS Atlas and kinetic features from MR-CAE were analysed. The PPV of each descriptor was analysed to identify subgroups in which PPV could be improved by the addition of MR-CAE. When biopsy recommendations were downgraded to follow-up in cases where there were both the absence of enhancement at a 50 % threshold and the absence of delayed washout, PPV increased from 0.328 (95 % CI, 0.249-0.417) to 0.500 (95 % CI, 0.387- 0.613). Two ductal carcinoma in situ (DCIS) non-mass enhancement (NME) lesions were missed. Application of downgrading criteria to foci or masses led to increased PPV from 0.310 (95 % CI, 0.216-0.419) to 0.437 (95 % CI, 0.331-0.547) without missing cancers. MR-CAE has the potential to improve the PPV of breast MR imaging by reducing the number of false positives. When suspicious mass lesions do not show enhancement at a 50 % threshold nor delayed washout, follow-up rather than biopsy can be considered. (orig.)

  19. NCBI nr-aa BLAST: CBRC-SARA-01-0430 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0430 ref|NP_928319.1| hypothetical protein plu0985 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE13280.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_928319.1 1.9 22% ...

  20. NCBI nr-aa BLAST: CBRC-XTRO-01-0644 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0644 ref|NP_930412.1| TctA protein [Photorhabdus luminescens subsp. la...umondii TTO1] emb|CAE15557.1| TctA protein [Photorhabdus luminescens subsp. laumondii TTO1] NP_930412.1 1e-101 69% ...

  1. NCBI nr-aa BLAST: CBRC-CREM-01-1331 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1331 ref|NP_930083.1| hypothetical protein plu2849 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE15223.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_930083.1 2e-73 51% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1521 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1521 ref|NP_928273.1| hypothetical protein plu0937 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE13232.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_928273.1 1.2 25% ...

  3. NCBI nr-aa BLAST: CBRC-XTRO-01-2898 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2898 ref|NP_930444.1| hypothetical protein plu3217 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE15591.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_930444.1 0.23 26% ...

  4. NCBI nr-aa BLAST: CBRC-ATHA-02-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-02-0026 ref|NP_931276.1| hypothetical protein plu4084 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE16456.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_931276.1 0.71 25% ...

  5. NCBI nr-aa BLAST: CBRC-VPAC-01-0398 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0398 ref|NP_927540.1| hypothetical protein plu0174 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE12469.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_927540.1 0.29 24% ...

  6. NCBI nr-aa BLAST: CBRC-DSIM-03-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-03-0045 ref|NP_927998.1| hypothetical protein plu0653 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE12948.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_927998.1 0.029 27% ...

  7. NCBI nr-aa BLAST: CBRC-MDOM-01-0104 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-01-0104 ref|NP_927594.1| hypothetical protein plu0231 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE12526.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_927594.1 0.013 28% ...

  8. NCBI nr-aa BLAST: CBRC-CBRI-05-0026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRI-05-0026 ref|NP_927829.1| hypothetical protein plu0476 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE12771.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_927829.1 0.82 25% ...

  9. NCBI nr-aa BLAST: CBRC-DMEL-02-0064 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0064 ref|NP_929579.1| hypothetical protein plu2327 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE14620.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_929579.1 0.58 27% ...

  10. NCBI nr-aa BLAST: CBRC-VPAC-01-0201 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0201 ref|NP_927540.1| hypothetical protein plu0174 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE12469.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_927540.1 0.58 22% ...

  11. NCBI nr-aa BLAST: CBRC-VPAC-01-0156 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0156 ref|NP_927540.1| hypothetical protein plu0174 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE12469.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_927540.1 0.58 22% ...

  12. NCBI nr-aa BLAST: CBRC-VPAC-01-0543 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0543 ref|NP_927540.1| hypothetical protein plu0174 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE12469.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_927540.1 0.58 22% ...

  13. NCBI nr-aa BLAST: CBRC-XTRO-01-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0052 ref|NP_931482.1| hypothetical protein plu4306 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE16678.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_931482.1 1e-162 62% ...

  14. NCBI nr-aa BLAST: CBRC-MEUG-01-1875 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1875 ref|NP_927933.1| hypothetical protein plu0585 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE12880.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_927933.1 0.003 27% ...

  15. NCBI nr-aa BLAST: CBRC-VPAC-01-1619 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1619 ref|NP_927540.1| hypothetical protein plu0174 [Photorhabdus lumines...cens subsp. laumondii TTO1] emb|CAE12469.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] NP_927540.1 0.99 22% ...

  16. Preface and Program

    Directory of Open Access Journals (Sweden)

    Päivi Soppela

    2002-04-01

    Full Text Available A group of PhD students, post-doctoral scientists and senior scientists gathered together in Tromsø, August 1999 for the 1st CAES Workshop 'Reindeer 2000', in conjunction with the 10th Arctic Ungulate Conference (AUC. The purpose of the workshop was to stimulate the interdisciplinary approach and communication in studies relating to reindeer and reindeer husbandry.

  17. Pediatric Headache and Epilepsy Comorbidity in the Pragmatic Clinical Setting.

    Science.gov (United States)

    Papavasiliou, Antigone S; Bregianni, Marianna; Nikaina, Irene; Kotsalis, Charalambos; Paraskevoulakos, Evangelos; Bazigou, Helen

    2016-04-01

    Demographic and clinical data were collected from three cross-sectional samples, from the headache and epilepsy clinics according to respective protocols. During structured interviews, we examined the co-occurrence of headaches and epilepsy in children and their families: (1) 172 children from the headache clinic, were questioned for the number and type of epileptic seizures and epilepsy diagnosis. (2) Around 70 children from the epilepsy clinic for the frequency and type of headaches and headache syndrome diagnosis. (3) A total of 149 parents of children with benign childhood epilepsy with centro-temporal spikes (BCECTS) and childhood absence epilepsy (CAE), for the relative frequency of headaches in first- and second-degree relatives. Out of 172, 84 (48.8%) children with headache had a migraine and 60 (34.9%) had tension headaches; 3 children (1.7%) had epilepsy or unprovoked seizures. Migraine and epilepsy, co-occurred in 2/84 (2.3%). Eight out of 70 patients with epilepsy had headaches (11.4%); none had migraine. Around 43% of patients with BCECTS or CAE had a family history of headache, more prevalent in first-degree relatives of children with BCECTS than CAE. Contrary to existing literature, migraine and epilepsy, co-occurred infrequently in these highly selected samples. Family history of headache was frequent in patients with BCECTS and CAE, without any significant difference between the two. Georg Thieme Verlag KG Stuttgart · New York.

  18. List-learning and verbal memory profiles in childhood epilepsy syndromes.

    Science.gov (United States)

    Schraegle, William A; Nussbaum, Nancy L; Stefanatos, Arianna K

    2016-09-01

    Findings of material-specific influences on memory performance in pediatric epilepsy are inconsistent and merit further investigation. This study compared 90 children (aged 6years to 16years) with childhood absence epilepsy (CAE), frontal lobe epilepsy (FLE), and temporal lobe epilepsy (TLE) to determine whether they displayed distinct list-learning and verbal memory profiles on the California Verbal Learning Test - Children's Version (CVLT-C). Group comparison identified greater risk of memory impairment in children with TLE and FLE syndromes but not for those with CAE. While children with TLE performed worst overall on Short Delay Free Recall, groups with TLE and FLE performed similarly on Long Delay Free Recall. Contrast indices were then employed to explore these differences. Children with TLE demonstrated a significantly greater retroactive interference (RI) effect compared with groups with FLE and CAE. Conversely, children with FLE demonstrated a significantly worse learning efficiency index (LEI), which compares verbal memory following repetition with initial recall of the same list, than both children with TLE and CAE. These findings indicated shallow encoding related to attentional control for children with FLE and retrieval deficits in children with TLE. Finally, our combined sample showed significantly higher rates of extreme contrast indices (i.e., 1.5 SD difference) compared with the CVLT-C standardization sample. These results underscore the high prevalence of memory dysfunction in pediatric epilepsy and offer support for distinct patterns of verbal memory performance based on childhood epilepsy syndrome. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Associations among Teachers' Attitudes towards Computer-Assisted Education and TPACK Competencies

    Science.gov (United States)

    Baturay, Meltem Huri; Gökçearslan, Sahin; Sahin, Semsettin

    2017-01-01

    The current study investigates the attitudes of teachers towards Computer-Assisted Education (CAE) and their knowledge of technology, pedagogy and content via TPACK model that assesses the competencies for developing and implementing successful teaching. There were 280 participants in the study. The results of the study indicate that teachers'…

  20. SwissProt search result: AK070617 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK070617 J023062N03 (P48751) Anion exchange protein 3 (Neuronal band 3-like protein...) (Solute carrier family 4 member 3) (Cardiac/brain band 3-like protein) (CAE3/BAE3) B3A3_HUMAN 7e-22 ...

  1. COMPUTER MODELING IN THE DEVELOPMENT OF ARTIFICIAL VENTRICLES OF HEART

    Directory of Open Access Journals (Sweden)

    L. V. Belyaev

    2011-01-01

    Full Text Available In article modern researches of processes of development of artificial ventricles of heart are described. Advanta- ges of application computer (CAD/CAE technologies are shown by development of artificial ventricles of heart. The systems developed with application of the given technologies are submitted. 

  2. NCBI nr-aa BLAST: CBRC-AGAM-01-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-01-0038 ref|NP_938793.1| Putative cytochrome C biogenesis protein [Corynebacterium diphtheria...e NCTC 13129] emb|CAE48916.1| Putative cytochrome C biogenesis protein [Corynebacterium diphtheriae] NP_938793.1 1.6 24% ...

  3. NCBI nr-aa BLAST: CBRC-CREM-01-1346 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1346 ref|NP_939160.1| Na(+)/H(+) antiporter homolog [Corynebacterium diphtheria...e NCTC 13129] emb|CAE49312.1| Na(+)/H(+) antiporter homolog [Corynebacterium diphtheriae] NP_939160.1 2e-34 34% ...

  4. NCBI nr-aa BLAST: CBRC-PTRO-20-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-20-0007 ref|NP_938605.1| immunity-specific protein Beta241 [Corynebacterium diphtheria...e NCTC 13129] emb|CAE48718.1| immunity-specific protein Beta241 [Corynebacterium diphtheriae] NP_938605.1 1e-04 24% ...

  5. Training Effectiveness Evaluation of the Squad Engagement Training System (SETS)

    Science.gov (United States)

    1990-06-01

    Myron P. Viner "CAE-Link Corp. - , TiPO ?1990 June 1990 Approvud fcr public releas’u. distribution is unil~iutcd- 1 <.. --•( , . . ....-. ... a. .,,w n...SETS software . SETS, however, does provide the unique opportunity for realistic * OPFOR contact within the RC home-station training environment, and the

  6. The role of SCL2A1 in Early Onset and Childhood Absence Epilepsies

    DEFF Research Database (Denmark)

    Brusgaard, Klaus

    brother and the paternal grandmother. Conclusion: Our study confirmed the role of SLC2A1 mutation carriers in EOAE and demonstrated that SLC2A1 do not seem to play a major role in CAE and JAE. Since ketogenic diet is a well known treatment option in GLUT-1-deficiency, pediatricians as well as neurologists...

  7. Global career mobility, repatriation and career success of Dutch and Indian professionals

    NARCIS (Netherlands)

    Valk, Reimara

    2016-01-01

    This PhD research explores global career mobility of Dutch and Indian professionals categorized in three groups: 1) Company-Assigned Expatriates (CAEs);2) Independent Internationally Mobile Professionals (IIMPs) / Self-Initiated Expatriates (SIEs); 3) Repatriates.The purpose was to:- explore the

  8. NCBI nr-aa BLAST: CBRC-GGAL-35-0395 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0395 ref|NP_970055.1| hypothetical protein Bd3304 [Bdellovibrio bacter...iovorus HD100] emb|CAE78114.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio bacteriovorus HD100] NP_970055.1 9e-09 26% ...

  9. NCBI nr-aa BLAST: CBRC-LAFR-01-0334 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0334 ref|NP_968178.1| hypothetical protein Bd1274 [Bdellovibrio bacter...iovorus HD100] emb|CAE79171.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100] NP_968178.1 0.079 30% ...

  10. NCBI nr-aa BLAST: CBRC-GGAL-35-0069 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0069 ref|NP_970055.1| hypothetical protein Bd3304 [Bdellovibrio bacter...iovorus HD100] emb|CAE78114.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio bacteriovorus HD100] NP_970055.1 5e-06 24% ...

  11. NCBI nr-aa BLAST: CBRC-GGAL-35-0280 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0280 ref|NP_970055.1| hypothetical protein Bd3304 [Bdellovibrio bacter...iovorus HD100] emb|CAE78114.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio bacteriovorus HD100] NP_970055.1 8e-21 40% ...

  12. NCBI nr-aa BLAST: CBRC-DNOV-01-0407 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0407 ref|NP_969709.1| probable acyl-CoA dehydrogenase [Bdellovibrio ba...cteriovorus HD100] emb|CAE80702.1| probable acyl-CoA dehydrogenase [Bdellovibrio bacteriovorus HD100] NP_969709.1 1.7 39% ...

  13. NCBI nr-aa BLAST: CBRC-GGAL-35-0084 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0084 ref|NP_970055.1| hypothetical protein Bd3304 [Bdellovibrio bacter...iovorus HD100] emb|CAE78114.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio bacteriovorus HD100] NP_970055.1 1e-12 33% ...

  14. NCBI nr-aa BLAST: CBRC-TBEL-01-1221 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1221 ref|NP_970505.1| hypothetical protein Bd3799 [Bdellovibrio bacter...iovorus HD100] emb|CAE81159.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio bacteriovorus HD100] NP_970505.1 5.8 31% ...

  15. NCBI nr-aa BLAST: CBRC-PABE-14-0027 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-14-0027 ref|NP_970055.1| hypothetical protein Bd3304 [Bdellovibrio bacter...iovorus HD100] emb|CAE78114.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio bacteriovorus HD100] NP_970055.1 2e-05 26% ...

  16. NCBI nr-aa BLAST: CBRC-DNOV-01-1388 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1388 ref|NP_969709.1| probable acyl-CoA dehydrogenase [Bdellovibrio ba...cteriovorus HD100] emb|CAE80702.1| probable acyl-CoA dehydrogenase [Bdellovibrio bacteriovorus HD100] NP_969709.1 8.7 36% ...

  17. NCBI nr-aa BLAST: CBRC-GGAL-35-0297 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0297 ref|NP_970055.1| hypothetical protein Bd3304 [Bdellovibrio bacter...iovorus HD100] emb|CAE78114.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio bacteriovorus HD100] NP_970055.1 1e-17 30% ...

  18. NCBI nr-aa BLAST: CBRC-GGAL-35-0061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0061 ref|NP_970055.1| hypothetical protein Bd3304 [Bdellovibrio bacter...iovorus HD100] emb|CAE78114.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio bacteriovorus HD100] NP_970055.1 1e-28 37% ...

  19. NCBI nr-aa BLAST: CBRC-GGAL-35-0334 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0334 ref|NP_970055.1| hypothetical protein Bd3304 [Bdellovibrio bacter...iovorus HD100] emb|CAE78114.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio bacteriovorus HD100] NP_970055.1 2e-19 33% ...

  20. NCBI nr-aa BLAST: CBRC-TGUT-16-0000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-16-0000 ref|NP_970455.1| hypothetical protein Bd3745 [Bdellovibrio bacter...iovorus HD100] emb|CAE81109.1| hypothetical protein [Bdellovibrio bacteriovorus HD100] NP_970455.1 2e-06 48% ...

  1. NCBI nr-aa BLAST: CBRC-GGAL-35-0343 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0343 ref|NP_970055.1| hypothetical protein Bd3304 [Bdellovibrio bacter...iovorus HD100] emb|CAE78114.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio bacteriovorus HD100] NP_970055.1 2e-18 40% ...

  2. NCBI nr-aa BLAST: CBRC-DNOV-01-0816 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0816 ref|NP_969709.1| probable acyl-CoA dehydrogenase [Bdellovibrio ba...cteriovorus HD100] emb|CAE80702.1| probable acyl-CoA dehydrogenase [Bdellovibrio bacteriovorus HD100] NP_969709.1 9.0 36% ...

  3. NCBI nr-aa BLAST: CBRC-DDIS-04-0058 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-04-0058 ref|NP_970236.1| phosphoesterase [Bdellovibrio bacteriovorus HD10...0] emb|CAE78295.1| phosphoesterase [Bdellovibrio bacteriovorus HD100] NP_970236.1 8e-11 28% ...

  4. NCBI nr-aa BLAST: CBRC-GGAL-35-0043 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0043 ref|NP_970055.1| hypothetical protein Bd3304 [Bdellovibrio bacter...iovorus HD100] emb|CAE78114.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio bacteriovorus HD100] NP_970055.1 3e-13 33% ...

  5. Dicty_cDB: VHD861 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ae cDNA, mRNA sequence. 92 5e-14 1 ES217666 |ES217666.1 MpFVN_ag1_H24 Myzus persi...cae, line F001, PLRV free, whole female aphid library Myzus persicae cDNA clone MpFVN_ag1_H24, mRNA sequence

  6. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34556966 >1qb2B 1 108 320 423 4e-23 ... ref|NP_906781.1| SIGNAL RECOGNITION PARTICLE... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09681.1| SIGNAL RECOGNITION PARTICLE

  7. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34556966 >1ls1A 1 295 1 291 3e-67 ... ref|NP_906781.1| SIGNAL RECOGNITION PARTICLE... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09681.1| SIGNAL RECOGNITION PARTICLE

  8. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34556528 >1ls1A 1 293 1 289 6e-52 ... ref|NP_906343.1| SIGNAL RECOGNITION PARTICLE... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09243.1| SIGNAL RECOGNITION PARTICLE

  9. Gene : CBRC-TGUT-37-0500 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-37-0500 Novel UN D UNKNOWN PGBM_HUMAN 3e-25 49% ref|NP_001001876.1| basemen...t membrane-specific heparan sulfate proteoglycan core protein [Gallus gallus] emb|CAE51322.1| basement mem

  10. Slimming and Appetite-Suppressing Effects of Caraway Aqueous Extract as a Natural Therapy in Physically Active Women.

    Science.gov (United States)

    Kazemipoor, Mahnaz; Hamzah, Sareena; Hajifaraji, Majid; Radzi, Che Wan Jasimah Bt Wan Mohamed; Cordell, Geoffrey A

    2016-06-01

    Following the current 'Globesity' trend, there is an increasing demand for alternative natural therapies for weight management. Numerous phytoconstituents reduce body weight through suppressing appetite and reducing food intake. Caraway (Carum carvi L.) is one of the medicinal plants that is traditionally used for weight loss. In this study, the appetite-suppressing effects of caraway aqueous extract (CAE) on 70 aerobically trained, overweight, and obese women were examined in a triple-blind, placebo-controlled, clinical study. Subjects were randomly allocated into placebo and experimental groups and consumed either 30 mL/day of CAE or placebo without changing their diet or physical activity over a period of 90 days. Calorie and macronutrient intake and anthropometric indices were measured before and after the intervention. In addition, appetite changes were assessed through a visual analog scale and an ad libitum pizza test. After the intervention, the results showed a significant reduction in appetite levels and carbohydrate intake of the experimental group compared with the placebo group. All of the anthropometric indices were reduced significantly in CAE compared with placebo group (p < 0.01). These preliminary outcomes suggest that a dietary CAE might be effective in weight management of physically active, adult females, reducing their body size and hunger level. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  11. NCBI nr-aa BLAST: CBRC-DSIM-01-0027 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-01-0027 ref|NP_001089174.1| putative transient receptor potential channel... [Xenopus laevis] emb|CAE09056.1| putative transient receptor potential channel [Xenopus laevis] NP_001089174.1 8e-36 48% ...

  12. NCBI nr-aa BLAST: CBRC-XTRO-01-3655 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3655 ref|NP_001089174.1| putative transient receptor potential channel... [Xenopus laevis] emb|CAE09056.1| putative transient receptor potential channel [Xenopus laevis] NP_001089174.1 0.0 95% ...

  13. NCBI nr-aa BLAST: CBRC-DRER-19-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-19-0045 ref|NP_001089174.1| putative transient receptor potential channel... [Xenopus laevis] emb|CAE09056.1| putative transient receptor potential channel [Xenopus laevis] NP_001089174.1 1e-109 65% ...

  14. NCBI nr-aa BLAST: CBRC-AGAM-04-0024 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-04-0024 ref|NP_001089174.1| putative transient receptor potential channel... [Xenopus laevis] emb|CAE09056.1| putative transient receptor potential channel [Xenopus laevis] NP_001089174.1 1e-158 42% ...

  15. NCBI nr-aa BLAST: CBRC-DMEL-01-0030 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-01-0030 ref|NP_001089174.1| putative transient receptor potential channel... [Xenopus laevis] emb|CAE09056.1| putative transient receptor potential channel [Xenopus laevis] NP_001089174.1 8e-36 48% ...

  16. Development of high performance casting analysis software by coupled parallel computation

    Directory of Open Access Journals (Sweden)

    Sang Hyun CHO

    2007-08-01

    Full Text Available Up to now, so much casting analysis software has been continuing to develop the new access way to real casting processes. Those include the melt flow analysis, heat transfer analysis for solidification calculation, mechanical property predictions and microstructure predictions. These trials were successful to obtain the ideal results comparing with real situations, so that CAE technologies became inevitable to design or develop new casting processes. But for manufacturing fields, CAE technologies are not so frequently being used because of their difficulties in using the software or insufficient computing performances. To introduce CAE technologies to manufacturing field, the high performance analysis is essential to shorten the gap between product designing time and prototyping time. The software code optimization can be helpful, but it is not enough, because the codes developed by software experts are already optimized enough. As an alternative proposal for high performance computations, the parallel computation technologies are eagerly being applied to CAE technologies to make the analysis time shorter. In this research, SMP (Shared Memory Processing and MPI (Message Passing Interface (1 methods for parallelization were applied to commercial software "Z-Cast" to calculate the casting processes. In the code parallelizing processes, the network stabilization, core optimization were also carried out under Microsoft Windows platform and their performances and results were compared with those of normal linear analysis codes.

  17. Design of Instrument Dials for Maximum Legibility. Part 5. Origin Location, Scale Break, Number Location, and Contrast Direction

    Science.gov (United States)

    1951-05-01

    experiment. Group I consiste’d ot 17 college rtudents. The group ca=e to the laboratory on two suooessive days and coupleted one test run usinZ all tour ...greater proportich of the grues errozs made. In view of the fact that the present test situation used slender dial pointers and involved pointer settings

  18. Studies on blends of cycloaliphatic epoxy resin with varying ...

    Indian Academy of Sciences (India)

    Differential scanning calorimetric (DSC), thermogravimetric analysis (TGA) and dynamic mechanical analysis (DMA) of the blends of cycloaliphatic epoxy (CAE) resin toughened with liquid elastomer such as carboxyl terminated butadiene acrylonitrile copolymer (CTBN) have been carried out. Exothermal heat of reaction ...

  19. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557363 >1bxdA 1 148 623 784 5e-23 ... ref|NP_907178.1| HYBRID HISTIDIN...E KINASE [Wolinella succinogenes DSM 1740] ... emb|CAE10078.1| HYBRID HISTIDINE KINASE [Wolinella ...

  20. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34558037 >1joyA 6 67 793 859 1e-06 ... ref|NP_907852.1| SENSOR/RESPONSE REGULATOR HYBRID... [Wolinella succinogenes DSM 1740] ... emb|CAE10752.1| SENSOR/RESPONSE REGULATOR HYBRID

  1. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557247 >1qo0E 11 194 5 193 3e-06 ... ref|NP_907062.1| TWO-COMPONENT HYBRID... SENSOR AND REGULATOR [Wolinella succinogenes ... DSM 1740] emb|CAE09962.1| TWO-COMPONENT HYBRID

  2. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557363 >1s8nA 1 188 804 992 2e-17 ... ref|NP_907178.1| HYBRID HISTIDIN...E KINASE [Wolinella succinogenes DSM 1740] ... emb|CAE10078.1| HYBRID HISTIDINE KINASE [Wolinella ...

  3. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557245 >1qo0E 14 185 7 175 2e-07 ... ref|NP_907060.1| TWO-COMPONENT HYBRID... SENSOR AND REGULATOR [Wolinella succinogenes ... DSM 1740] emb|CAE09960.1| TWO-COMPONENT HYBRID

  4. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39934627 >1jbeA 7 124 12 128 5e-24 ... ref|NP_907177.1| TWO-COMPONENT HYBRID... PROTEIN [Wolinella succinogenes DSM 1740] ... emb|CAE10077.1| TWO-COMPONENT HYBRID PROTEIN [Wolin

  5. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34556655 >1kgsA 2 188 7 191 3e-18 ... ref|NP_906470.1| HYBRID SENSORY HI...STIDINE KINASE [Wolinella succinogenes DSM 1740] ... emb|CAE09370.1| HYBRID SENSORY HISTIDINE KINASE

  6. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557245 >1id0A 1 144 226 372 4e-16 ... ref|NP_907060.1| TWO-COMPONENT HYBRID... SENSOR AND REGULATOR [Wolinella succinogenes ... DSM 1740] emb|CAE09960.1| TWO-COMPONENT HYBRID

  7. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557727 >1id0A 8 140 355 495 1e-15 ... ref|NP_907542.1| TWO-COMPONENT HYBRID... SENSOR AND REGULATOR [Wolinella succinogenes ... DSM 1740] emb|CAE10442.1| TWO-COMPONENT HYBRID

  8. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34558037 >1jbeA 7 123 1049 1164 5e-16 ... ref|NP_907852.1| SENSOR/RESPONSE REGULATOR HYBRID... [Wolinella succinogenes DSM 1740] ... emb|CAE10752.1| SENSOR/RESPONSE REGULATOR HYBRID

  9. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557247 >1id0A 3 142 230 372 5e-15 ... ref|NP_907062.1| TWO-COMPONENT HYBRID... SENSOR AND REGULATOR [Wolinella succinogenes ... DSM 1740] emb|CAE09962.1| TWO-COMPONENT HYBRID

  10. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34556655 >1bxdA 3 159 342 507 2e-25 ... ref|NP_906470.1| HYBRID SENSORY ...HISTIDINE KINASE [Wolinella succinogenes DSM 1740] ... emb|CAE09370.1| HYBRID SENSORY HISTIDINE KINAS

  11. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34558037 >1ii5A 5 224 518 736 5e-15 ... ref|NP_907852.1| SENSOR/RESPONSE REGULATOR HYBRID... [Wolinella succinogenes DSM 1740] ... emb|CAE10752.1| SENSOR/RESPONSE REGULATOR HYBRID

  12. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557363 >1wa9B 1 317 121 415 5e-08 ... ref|NP_907178.1| HYBRID HISTIDIN...E KINASE [Wolinella succinogenes DSM 1740] ... emb|CAE10078.1| HYBRID HISTIDINE KINASE [Wolinella ...

  13. ORF Alignment: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002937 gi|46579389 >1jbeA 7 124 12 128 5e-24 ... ref|NP_907177.1| TWO-COMPONENT HYBRID... PROTEIN [Wolinella succinogenes DSM 1740] ... emb|CAE10077.1| TWO-COMPONENT HYBRID PROTEIN [Woli

  14. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34558037 >1id0A 2 142 868 1023 9e-21 ... ref|NP_907852.1| SENSOR/RESPONSE REGULATOR HYBRID... [Wolinella succinogenes DSM 1740] ... emb|CAE10752.1| SENSOR/RESPONSE REGULATOR HYBRID

  15. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557362 >1s8nA 6 167 12 177 8e-25 ... ref|NP_907177.1| TWO-COMPONENT HYBRID... PROTEIN [Wolinella succinogenes DSM 1740] ... emb|CAE10077.1| TWO-COMPONENT HYBRID PROTEIN [Woli

  16. Long-term outcome of childhood absence epilepsy : Dutch Study of Epilepsy in Childhood

    NARCIS (Netherlands)

    Callenbach, Petra M. C.; Bouma, Paul A. D.; Geerts, Ada T.; Arts, Willem Frans M.; Stroink, Hans; Peeters, Els A. J.; van Donselaar, Cees A.; Peters, A. C. Boudewijn; Brouwer, Oebele F.

    We determined long-term outcome and the predictive value of baseline and EEG characteristics on seizure activity evolution in 47 children with newly diagnosed childhood absence epilepsy (CAE) included in the Dutch Study of Epilepsy in Childhood. All children were followed for 12-17 years. The

  17. Chinese Scientists | Women in Science | Initiatives | Indian Academy ...

    Indian Academy of Sciences (India)

    "Currently, the CAE has 38 female academicians, only accounting for 5.4percent of the total," Shi said. The China Association for women Scientists was officially established duringthe meeting, with the aim to help women scientists give full play to their role in economic and social development. The seminar, which attracted ...

  18. OPTIMIZATION OF THE TEHNOLOGICAL PROCESS OF THE PART ‘’CYLINDER PISTON” WITH NX 7.5 SOFTWARE

    Directory of Open Access Journals (Sweden)

    EFTIMIE Dorin

    2012-11-01

    Full Text Available This paper aims to present the optimization of processing the part “piston cylinder” with NX 7.5 software. CAD modeling is realized and analyzed with finite elements (CAE simulating deformation and maximum stretching and virtual technology manufacturing (CAM where were highlighted aspects regarding the sequence of the manufacturing operations and the technological parameters.

  19. Towards the antioxidant and chemical characterization of mycorrhizal mushrooms from Northeast Portugal

    OpenAIRE

    Filipa S. Reis; Sandrina A. Heleno; Barros, Lillian; Sousa, Maria João; Martins, Anabela; Santos-Buelga, Celestino; Isabel C. F. R. Ferreira

    2011-01-01

    Mushrooms are widely appreciated all over the world for their nutritional properties and pharmacological value as sources of important bioactive compounds. Mycorrhizal macrofungi associate with plant roots constituting a symbiotic relationship. This symbiosis could influence the production of secondary metabolites, including bioactive compounds. We focused on the evaluation of antioxidant potential and chemical composition of mycorrhizal mushrooms species from Northeast Portugal: Amanita cae...

  20. Exposiciones en la Biblioteca Luis Ángel Arango: Irene Balas y Henry Rasmussen

    Directory of Open Access Journals (Sweden)

    Luis Borobio

    1960-06-01

    Full Text Available La lluvia que cae sobre un estanque rompe los reflejos multicolores en infinitas formas caprichosas, cambiantes y siempre inéditas, que desaparecen y se renuevan sin que quizá las hayamos advertido. El sol ensaya en las nubes -espontáneamente modeladas por el viento- irisaciones insospechadas que nunca se repiten.

  1. Effect of bias voltage on microstructure and mechanical properties of ...

    Indian Academy of Sciences (India)

    Mechanical properties were deduced from nano-indentation measurements. The residual stress in all the coatings was compressive and increased with increasing bias voltage in a manner similar to that reported in literature for Ti–Al–N coatings deposited with CAE. The bias voltage was also found to significantly influence ...

  2. Computer aided engineering in exhaust aftertreatment systems design. Pt. 1. Spark ignition engine; Computergestuetzter Entwurf von Abgas-Nachbehandlungskonzepten. T. 1. Ottomotor

    Energy Technology Data Exchange (ETDEWEB)

    Stamatelos, A.M.; Koltsakis, G.C.; Kandylas, I.P. [Aristotelian Univ. of Thessaloniki (Greece)

    1999-02-01

    At the Aristotle University Thessaloniki, Greece, an integrated Computer Aided Engineering (CAE) methodology assisting the design of SI-engine exhaust aftertreatment systems employing the following computational tools was developed: A computer code which models transient exhaust system heat transfer, a tuneable computer code which models the transient operation of a three-way catalytic converter, a database containing chemical kinetics data for a variety of catalyst formulations, and a methodology for ageing assessment calculations. Application of the CAE methodology, which aids the exhaust aftertreatment system design engineer to meet the upcoming, increasingly stringent emission standards, is high-lighted by referring to a number of representative case studies. (orig.) [Deutsch] An der Aristoteles-Universitaet Thessaloniki, Griechenland, wurde eine computergestuetzte Methode (CAE) entwickelt, die den Entwurf und die Konstruktion von Abgasnachbehandlungskonzepten unterstuetzt. Die Methode setzt auf die folgenden Rechenmodelle und Datenbanken: Ein Rechenmodell zur Berechnung des Waermeuebergangs in Motorabgassystemen, ein Rechenmodell zur Abschaetzung des Katalysatorgegendrucks, eine Datenbank mit den chemischen Kinetikdaten fuer die verschiedenen Typen von Dreiwegekatalysatoren und eine computergestuetzte Prozedur zur Abschaetzung des Alterungsverhaltens von Dreiwegekatalysatoren. Integrierte CAE-Methoden koennen beim Entwurf von modernen Abgasnachbehandlungssystemen angewandt werden, um die Entwicklungszeit und -kosten betraechtlich zu reduzieren. (orig.)

  3. FEATURES OF THE CALCULATION OF VENTILATION DUCTS OF COMPLEX METAL FORM

    Directory of Open Access Journals (Sweden)

    M. V. Kaminets

    2016-01-01

    Full Text Available The method of calculating ventilation ducts metal mold. It is shown that the use of CAE-system allows calculations ventilation channels of metal mold for each casting individually, while taking into account both the configuration of the casting itself and the geometry of the gating system.

  4. Senior Audit and Risk Management Officer | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Manages and reviews the work of the audit team to ensure the collection, analysis, and documentation of relevant and sufficient evidence to support findings and ... objectives are met and that adequate, practical coverage is achieved; and; Plays a key role in assisting the CAE to manage the independent quality assurance ...

  5. Potential hazards of compressed air energy storage in depleted natural gas reservoirs.

    Energy Technology Data Exchange (ETDEWEB)

    Cooper, Paul W.; Grubelich, Mark Charles; Bauer, Stephen J.

    2011-09-01

    This report is a preliminary assessment of the ignition and explosion potential in a depleted hydrocarbon reservoir from air cycling associated with compressed air energy storage (CAES) in geologic media. The study identifies issues associated with this phenomenon as well as possible mitigating measures that should be considered. Compressed air energy storage (CAES) in geologic media has been proposed to help supplement renewable energy sources (e.g., wind and solar) by providing a means to store energy when excess energy is available, and to provide an energy source during non-productive or low productivity renewable energy time periods. Presently, salt caverns represent the only proven underground storage used for CAES. Depleted natural gas reservoirs represent another potential underground storage vessel for CAES because they have demonstrated their container function and may have the requisite porosity and permeability; however reservoirs have yet to be demonstrated as a functional/operational storage media for compressed air. Specifically, air introduced into a depleted natural gas reservoir presents a situation where an ignition and explosion potential may exist. This report presents the results of an initial study identifying issues associated with this phenomena as well as possible mitigating measures that should be considered.

  6. ANTIBODIES TO SKELETAL-MUSCLE IN MYASTHENIA-GRAVIS .1. DIAGNOSTIC-VALUE FOR THE DETECTION OF THYMOMA

    NARCIS (Netherlands)

    KUKS, JBM; LIMBURG, PC; HORST, G; OOSTERHUIS, HJGH

    1993-01-01

    The role of anti-muscle antibodies (AMA) in the diagnosis of thymoma in patients with myasthenia gravis (MG) is evaluated. We compared ELISA and Western blot assay for antibodies to citric acid muscle extract (a-CAE) with an immunofluorescence assay (IF). Sera from 234 selected MG patients and 123

  7. Antibodies to skeletal muscle in myasthenia gravis. Part 1. Diagnostic value for the detection of thymoma

    NARCIS (Netherlands)

    Kuks, J B; Limburg, P C; Horst, G; Dijksterhuis, J; Oosterhuis, H J

    1993-01-01

    The role of anti-muscle antibodies (AMA) in the diagnosis of thymoma in patients with myasthenia gravis (MG) is evaluated. We compared ELISA and Western blot assay for antibodies to citric acid muscle extract (a-CAE) with an immunofluorescence assay (IF). Sera from 234 selected MG patients and 123

  8. A Functional Theory of Creative Reading

    Science.gov (United States)

    1994-01-01

    injectors hand-held calculators ring-activated guns CAD/CAE/CAM (a) Science fiction science fact space elevators light sails terraforming transporters...Associates, Hillsdale, NJ. Wilensky, R. (1983). Planning and Understanding. Addison-Wesley, Reading, MA. WKRP Episode 60 (1980). Venus and The Man

  9. 77 FR 75619 - Proposed Collection; Comment Request

    Science.gov (United States)

    2012-12-21

    ...: Information Assurance Scholarship Program; OMB Control Number 0704-0486. Needs and Uses: The National Security Agency (NSA) is the Executive Administrator of the DoD Information Assurance Scholarship Program (IASP.... Centers of Academic Excellence in Information Assurance and Research (CAEs) interested in applying for...

  10. Teacher Training Programs for Computer Education and Computer Assisted Education in Turkey

    Science.gov (United States)

    Usun, Salih

    2007-01-01

    The aim of this descriptive study is to review the applications and problems on the teacher training programs for computer education and computer assisted education (CAE) in Turkey. The study, firstly, introduces some applications and major problems on using instructional media and computers in developing countries and instructional technology…

  11. Prospective trial of customized adherence enhancement plus long-acting injectable antipsychotic medication in homeless or recently homeless individuals with schizophrenia or schizoaffective disorder.

    Science.gov (United States)

    Sajatovic, Martha; Levin, Jennifer; Ramirez, Luis F; Hahn, David Y; Tatsuoka, Curtis; Bialko, Christopher S; Cassidy, Kristin A; Fuentes-Casiano, Edna; Williams, Tiffany D

    2013-12-01

    Treatment nonadherence in people with schizophrenia is associated with relapse and homelessness. Building on the usefulness of long-acting medication and our work in psychosocial interventions to enhance adherence, we conducted a prospective uncontrolled trial of customized adherence enhancement (CAE) plus long-acting injectable antipsychotic (LAI) using haloperidol decanoate in 30 homeless or recently homeless individuals with DSM-IV-defined schizophrenia or schizoaffective disorder. Participants received monthly CAE and LAI (CAE-L) for 6 months. Primary outcomes were adherence, as measured by the Tablets Routine Questionnaire, and housing status. Secondary outcomes included psychiatric symptoms, functioning, side effects, and hospitalizations. The study was conducted from July 2010 to December 2012. The mean age of participants was 41.8 years (SD = 8.6); they were mainly minorities (90%, n = 27 African-American) and mainly single/never married (70%, n = 21). Most (97%, n = 29) had past or current substance abuse and had been incarcerated (97%, n = 29). Ten individuals (33%) terminated the study prematurely. CAE-L was associated with good adherence to LAI (at 6 months, 76%) and dramatic improvement in oral medication adherence, which changed from missing 46% of medication at study enrollment to missing only 10% at study end (P = .03). There were significant improvements in psychiatric symptoms (P health outcomes for homeless people with serious mental illness. ClinicalTrials.gov identifier: NCT01152697. © Copyright 2013 Physicians Postgraduate Press, Inc.

  12. Evaluation of the Tp-Te Interval, QTc and P-Wave Dispersion in Patients With Coronary Artery Ectasia.

    Science.gov (United States)

    Conlon, Ronan; Tanner, Richard; David, Santhosh; Szeplaki, Gabor; Galvin, Joseph; Keaney, John; Keelan, Edward; Boles, Usama

    2017-12-01

    Coronary artery ectasia (CAE) is defined as a diffuse dilatation of the diameter of the ectatic segment of the coronary artery, 1.5 times greater than that of the adjacent segment. The Tp-Te interval, P-wave and QTc dispersions are relatively new electrocardiographic markers associated with an increased risk of developing arrhythmias. Despite CAE increasing in prevalence in recent years, there is a sparsity of data available about its arrhythmogenic effect. The aim of the study was to evaluate QTc, P-wave dispersion and Tp-Te and Tp-Te/QT ratio in patients with CAE. A retrospective comparative study was designed for consecutive age- and sex-matched patients. Twenty patients with isolated CAE (group 1) and 20 control subjects (group 2), with normal coronary arteries, were included. All patients presented with chest pain and coronary angiogram was indicated. Outcome measures included Tp-Te interval, Tp-Te/QT ratio, QTc dispersion and P-wave dispersion. Measurement of electrocardiogram (ECG) parameters was conducted using standardized digital online software. Descriptive and inferential statistics were performed. Mean Tp-Te (95.5 ± 9.01 ms) and Tp-Te/QT ratio (0.22 ± 0.02) were significantly prolonged in CAE group (Tp-Te: 84 ± 5.62 ms, P = 0.00009; Tp-Te/QT ratio: 0.20 ± 0.01, P = 0.00004). In addition, QTc (31.2 ± 3.71 ms) and P-wave dispersion (31.9 ± 5.46 ms) were significantly increased in comparison to the control group (QTc: 27.6 ± 2.82 ms, P = 0.00532 and 20 ± 3.77 ms, P = 0.00003 respectively). However, there was no difference in ventricular activation time (VAT) between groups. CAE ECGs were found to be associated with increased Tp-Te, Tp-Te/QT ratio, QTc intervals and P-wave dispersions. This may suggest that CAE existence has a pro-arrhythmogenic nature.

  13. Genetic profiling using genome-wide significant coronary artery disease risk variants does not improve the prediction of subclinical atherosclerosis: the Cardiovascular Risk in Young Finns Study, the Bogalusa Heart Study and the Health 2000 Survey--a meta-analysis of three independent studies.

    Directory of Open Access Journals (Sweden)

    Jussi A Hernesniemi

    Full Text Available BACKGROUND: Genome-wide association studies (GWASs have identified a large number of variants (SNPs associating with an increased risk of coronary artery disease (CAD. Recently, the CARDIoGRAM consortium published a GWAS based on the largest study population so far. They successfully replicated twelve already known associations and discovered thirteen new SNPs associating with CAD. We examined whether the genetic profiling of these variants improves prediction of subclinical atherosclerosis--i.e., carotid intima-media thickness (CIMT and carotid artery elasticity (CAE--beyond classical risk factors. SUBJECTS AND METHODS: We genotyped 24 variants found in a population of European ancestry and measured CIMT and CAE in 2001 and 2007 from 2,081, and 2,015 subjects (aged 30-45 years in 2007 respectively, participating in the Cardiovascular Risk in Young Finns Study (YFS. The Bogalusa Heart Study (BHS; n = 1179 was used as a replication cohort (mean age of 37.5. For additional replication, a sub-sample of 5 SNPs was genotyped for 1,291 individuals aged 46-76 years participating in the Health 2000 population survey. We tested the impact of genetic risk score (GRS(24SNP/CAD calculated as a weighted (by allelic odds ratios for CAD sum of CAD risk alleles from the studied 24 variants on CIMT, CAE, the incidence of carotid atherosclerosis and the progression of CIMT and CAE during a 6-year follow-up. RESULTS: CIMT or CAE did not significantly associate with GRS(24SNP/CAD before or after adjusting for classical CAD risk factors (p>0.05 for all in YFS or in the BHS. CIMT and CAE associated with only one SNP each in the YFS. The findings were not replicated in the replication cohorts. In the meta-analysis CIMT or CAE did not associate with any of the SNPs. CONCLUSION: Genetic profiling, by using known CAD risk variants, should not improve risk stratification for subclinical atherosclerosis beyond conventional risk factors among healthy young adults.

  14. Exacerbation of signs and symptoms of allergic conjunctivitis by a controlled adverse environment challenge in subjects with a history of dry eye and ocular allergy

    Directory of Open Access Journals (Sweden)

    Gomes PJ

    2013-01-01

    Full Text Available Paulo J Gomes,1 George W Ousler,1 Donna L Welch,1 Lisa M Smith,1 Jeffrey Coderre,1 Mark B Abelson1,21Ora Inc, Andover, MA; 2Harvard Medical School, Schepens Eye Research Institute, Boston, MA, USABackground: The goal of this study was to assess the effect of a controlled adverse environment (CAE challenge on subjects with both allergic conjunctivitis and dry eye.Methods: Thirty-three subjects were screened and 17 completed this institutional review board-approved study. Subjects underwent baseline ocular assessments and conjunctival allergen challenge (CAC on days 0 and 3. Those who met the ocular redness and itching criteria were randomized to receive either the controlled adverse environment (CAE challenge (group A, n = 9 or no challenge (group B, n = 8 at day 6. Thirty minutes after CAE/no-CAE, subjects were challenged with allergen and their signs and symptoms graded. Exploratory confocal microscopy was carried out in a subset of subjects at hourly intervals for 5 hours post-CAC on days 3 and 6.Results: Seven minutes post-CAC, subjects exposed to the CAE had significantly greater itching (difference between groups, 0.55 ± 0.25, P = 0.028, conjunctival redness (0.59 ± 0.19, P = 0.002, episcleral redness (0.56 ± 0.19, P = 0.003 and mean overall redness (mean of conjunctival, episcleral, and ciliary redness, 0.59 ± 0.14, P < 0.001. The mean score at 7, 15, and 20 minutes post-CAC for conjunctival redness (0.43 ± 0.17, P = 0.012, episcleral redness (0.49 ± 0.15, P = 0.001, mean overall redness in all regions (0.43 ± 0.15, P = 0.005, and mean chemosis (0.20 ± 0.08, P = 0.017 were also all significantly greater in CAE-treated subjects. Confocal microscopic images of conjunctival vessels after CAC showed more inflammation in CAE-treated subjects.Conclusion: In subjects with both dry eye and allergic conjunctivitis, exposure to adverse environmental conditions causes an ocular surface perturbation that can intensify allergic reactions

  15. The experience of admission to psychiatric hospital among Chinese adult patients in Hong Kong

    Directory of Open Access Journals (Sweden)

    Lam Linda

    2008-10-01

    Full Text Available Abstract Background The paper reports on a study to evaluate the psychometric properties and cultural appropriateness of the Chinese translation of the Admission Experience Survey (AES. Methods The AES was translated into Chinese and back-translated. Content validity was established by focus groups and expert panel review. The Chinese version of the Admission Experience Survey (C-AES was administered to 135 consecutively recruited adult psychiatric patients in the Castle Peak Hospital (Hong Kong SAR, China within 48 hours of admission. Construct validity was assessed by comparing the scores from patients admitted voluntarily versus patients committed involuntarily, and those received physical or chemical restraint versus those who did not. The relationship between admission experience and psychopathology was examined by correlating C-AES scores with the Brief Psychiatric Rating Scale (BPRS scores. Results Spearman's item-to-total correlations of the C-AES ranged from 0.50 to 0.74. Three factors from the C-AES were extracted using factor analysis. Item 12 was omitted because of poor internal consistency and factor loading. The factor structure of the Process Exclusion Scale (C-PES corresponded to the English version, while some discrepancies were noted in the Perceived Coercion Scale (C-PCS and the Negative Pressure Scale (C-NPS. All subscales had good internal consistencies. Scores were significantly higher for patients either committed involuntarily or subjected to chemical or physical restrain, independent on severity of psychotic symptoms. Conclusion The Chinese AES is a psychometrically sound instrument assessing the three different aspects of the experience of admission, namely "negative pressure, "process exclusion" and "perceived coercion". The potential of C-AES in exploring subjective experience of psychiatric admission and effects on treatment adherence should be further explored.

  16. Evaluation of Tp-Te interval and Tp-Te/QTc ratio in patients with coronary artery ectasia.

    Science.gov (United States)

    Karaagac, Kemal; Yontar, Osman Can; Tenekecioglu, Erhan; Vatansever, Fahriye; Ozluk, Ozlem Arican; Tutuncu, Ahmet; Yagcioglu, Pinar; Yilmaz, Mustafa

    2014-01-01

    Coronary artery ectasia (CAE) is commonly defined as local or generalized dilatation of a coronary vessel up to 1.5 times the diameter of an adjacent vessel. Tp-Te interval and Tp-Te/QT ratio have emerged as novel electrocardiographic markers of increased dispersion of ventricular repolarization. The aim of this study was to evaluate ventricular repolarization by using Tp-Te interval and Tp-Te/QT ratio in patients with CAE. Patients' records were retrospectively analyzed. Electrocardiogram of 28 patients, who were diagnosed as CAE were obtained and scanned. T wave peak to end interval, QT and corrected QT intervals and some other ECG intervals were measured. Electrocardiograms of age and sex matched 22 control individuals were also analyzed for comparison. Patients with critical coronary stenosis, moderate or severe valve disease, left and/or right heart failure, left and/or right ventricle hypertrophy, atrial fibrillation, moderate or severely abnormal electrolytes, right or left bundle block or patients who got pacemaker or ICD implanted and who undergo hemodialyses were excluded. Baseline characteristics and QT, QTc intervals were similar in both groups. Tp-Te (97.71 ± 8.7 vs 85.23 ± 7.1; p Te/QT (0.22 ± 0.0 vs 0.20 ± 0.0; p Te and Tp-Te/QT are relatively new markers which also indicate repolarization defects. Our results show that CAE patients significantly higher values of Tp-Te and Tp-Te/QT than controls. These measurements may indicate increased arrhythmogenesis risk for individuals with CAE.

  17. Liquid toroidal drop under uniform electric field

    Science.gov (United States)

    Zabarankin, Michael

    2017-06-01

    The problem of a stationary liquid toroidal drop freely suspended in another fluid and subjected to an electric field uniform at infinity is addressed analytically. Taylor's discriminating function implies that, when the phases have equal viscosities and are assumed to be slightly conducting (leaky dielectrics), a spherical drop is stationary when Q=(2R2+3R+2)/(7R2), where R and Q are ratios of the phases' electric conductivities and dielectric constants, respectively. This condition holds for any electric capillary number, CaE, that defines the ratio of electric stress to surface tension. Pairam and Fernández-Nieves showed experimentally that, in the absence of external forces (CaE=0), a toroidal drop shrinks towards its centre, and, consequently, the drop can be stationary only for some CaE>0. This work finds Q and CaE such that, under the presence of an electric field and with equal viscosities of the phases, a toroidal drop having major radius ρ and volume 4π/3 is qualitatively stationary-the normal velocity of the drop's interface is minute and the interface coincides visually with a streamline. The found Q and CaE depend on R and ρ, and for large ρ, e.g. ρ≥3, they have simple approximations: Q˜(R2+R+1)/(3R2) and CaE∼3 √{3 π ρ / 2 } (6 ln ⁡ρ +2 ln ⁡[96 π ]-9 )/ (12 ln ⁡ρ +4 ln ⁡[96 π ]-17 ) (R+1 ) 2/ (R-1 ) 2.

  18. Compressed air energy storage in offshore grids

    Energy Technology Data Exchange (ETDEWEB)

    Schroeder, S.T.; Meibom, P. (Technical Univ. of Denmark (DTU). Risoe National Lab. for Sustainable Energy, Roskilde (Denmark)); Crotogino, F.; Donadei, S. (KBB Underground Technologies, Hanover (Germany))

    2011-05-15

    Fluctuating renewable energy sources can be rendered more reliable by massive international grid extensions and by energy storages. The latter ones are partially discussed as offshore grids to combine the grid connection of offshore wind parks with international power trading. This paper gives a first assessment of offshore energy storage possibilities. Compressed air energy storage (CAES) is a technology that has been used successfully onshore for decades and is the most economic large-scale storage option after pumped hydro. More efficient adiabatic CAES is under development. At the same time, the oil and gas offshore industry provides enough experience to state that a CAES power plant could be installed and operated offshore even though at considerable higher costs. Suitable salt formations for the salt caverns exist in and around the North Sea and to a lower extent the Baltic Sea. Offshore energy storage can facilitate several issues in an offshore grid: firstly, it can delay or even replace the necessity for building interconnectors due to additional wind or wave power. Secondly, it can balance generation deviations due to forecast errors. Depending on market design, these have a negative effect on offshore generation or interconnector operation. Balancing forecast errors could allow operating the interconnectors in a more reliable and thus, more profitable way. If the offshore grid is considered a single price zone between countries, a storage has a lowering effect on electricity price volatility. The WILMAR planning tool is used to estimate these effects. Comparing onshore and offshore CAES, it is concluded that an an offshore adiabatic CAES can participate in several markets, but that this advantage is outweighed by an onshore unit's ability to provide spinning reserves. (Author)

  19. Analytical Design Package (ADP2): A computer aided engineering tool for aircraft transparency design

    Science.gov (United States)

    Wuerer, J. E.; Gran, M.; Held, T. W.

    1994-01-01

    The Analytical Design Package (ADP2) is being developed as a part of the Air Force Frameless Transparency Program (FTP). ADP2 is an integrated design tool consisting of existing analysis codes and Computer Aided Engineering (CAE) software. The objective of the ADP2 is to develop and confirm an integrated design methodology for frameless transparencies, related aircraft interfaces, and their corresponding tooling. The application of this methodology will generate high confidence for achieving a qualified part prior to mold fabrication. ADP2 is a customized integration of analysis codes, CAE software, and material databases. The primary CAE integration tool for the ADP2 is P3/PATRAN, a commercial-off-the-shelf (COTS) software tool. The open architecture of P3/PATRAN allows customized installations with different applications modules for specific site requirements. Integration of material databases allows the engineer to select a material, and those material properties are automatically called into the relevant analysis code. The ADP2 materials database will be composed of four independent schemas: CAE Design, Processing, Testing, and Logistics Support. The design of ADP2 places major emphasis on the seamless integration of CAE and analysis modules with a single intuitive graphical interface. This tool is being designed to serve and be used by an entire project team, i.e., analysts, designers, materials experts, and managers. The final version of the software will be delivered to the Air Force in Jan. 1994. The Analytical Design Package (ADP2) will then be ready for transfer to industry. The package will be capable of a wide range of design and manufacturing applications.

  20. Modeling of coupled thermodynamic and geomechanical performance of underground compressed air energy storage in lined rock caverns

    Energy Technology Data Exchange (ETDEWEB)

    Rutqvist, Jonny; Kim, Hyung-Mok; Ryu, Dong-Woo; Synn, Joong-Ho; Song, Won-Kyong

    2012-06-01

    We applied coupled nonisothermal, multiphase fluid flow and geomechanical numerical modeling to study the coupled thermodynamic and geomechanical performance of underground compressed air energy storage (CAES) in concrete-lined rock caverns. The paper focuses on CAES in lined caverns at relatively shallow depth (e.g., 100 m depth) in which a typical CAES operational pressure of 5 to 8 MPa is significantly higher than both ambient fluid pressure and in situ stress. We simulated a storage operation that included cyclic compression and decompression of air in the cavern, and investigated how pressure, temperature and stress evolve over several months of operation. We analyzed two different lining options, both with a 50 cm thick low permeability concrete lining, but in one case with an internal synthetic seal such as steel or rubber. For our simulated CAES system, the thermodynamic analysis showed that 96.7% of the energy injected during compression could be recovered during subsequent decompression, while 3.3% of the energy was lost by heat conduction to the surrounding media. Our geomechanical analysis showed that tensile effective stresses as high as 8 MPa could develop in the lining as a result of the air pressure exerted on the inner surface of the lining, whereas thermal stresses were relatively smaller and compressive. With the option of an internal synthetic seal, the maximum effective tensile stress was reduced from 8 to 5 MPa, but was still in substantial tension. We performed one simulation in which the tensile tangential stresses resulted in radial cracks and air leakage though the lining. This air leakage, however, was minor (about 0.16% of the air mass loss from one daily compression) in terms of CAES operational efficiency, and did not significantly impact the overall energy balance of the system. However, despite being minor in terms of energy balance, the air leakage resulted in a distinct pressure increase in the surrounding rock that could be

  1. A Feasibility Study on Operating Large Scale Compressed Air Energy Storage in Porous Formations

    Science.gov (United States)

    Wang, B.; Pfeiffer, W. T.; Li, D.; Bauer, S.

    2015-12-01

    Compressed air energy storage (CAES) in porous formations has been considered as one promising option of large scale energy storage for decades. This study, hereby, aims at analyzing the feasibility of operating large scale CAES in porous formations and evaluating the performance of underground porous gas reservoirs. To address these issues quantitatively, a hypothetic CAES scenario with a typical anticline structure in northern Germany was numerically simulated. Because of the rapid growth in photovoltaics, the period of extraction in a daily cycle was set to the early morning and the late afternoon in order to bypass the massive solar energy production around noon. The gas turbine scenario was defined referring to the specifications of the Huntorf CAES power plant. The numerical simulations involved two stages, i.e. initial fill and cyclic operation, and both were carried out using the Eclipse E300 simulator (Schlumberger). Pressure loss in the gas wells was post analyzed using an analytical solution. The exergy concept was applied to evaluate the potential energy amount stored in the specific porous formation. The simulation results show that porous formations prove to be a feasible solution of large scale CAES. The initial fill with shut-in periods determines the spatial distribution of the gas phase and helps to achieve higher gas saturation around the wells, and thus higher deliverability. The performance evaluation shows that the overall exergy flow of stored compressed air is also determined by the permeability, which directly affects the deliverability of the gas reservoir and thus the number of wells required.

  2. Safety and efficacy of MIM D3 ophthalmic solutions in a randomized placebo controlled Phase 2 clinical trial in patients with dry eye

    Directory of Open Access Journals (Sweden)

    Meerovitch K

    2013-06-01

    Full Text Available Karen Meerovitch,1 Gail Torkildsen,2 John Lonsdale,3 Heidi Goldfarb,4 Teresa Lama,1 Garth Cumberlidge,1 George W Ousler III5 1Mimetogen Pharmaceuticals Inc, Montreal, QC, Canada; 2Andover Eye Associates, Andover, MA, USA; 3Central Maine Eye Care, Lewiston, ME, USA; 4SDC, Tempe, AZ, USA; 5Ora Inc, Andover, MA, USA Purpose: To evaluate the safety and efficacy of ophthalmic MIM-D3, a tyrosine kinase TrkA receptor agonist, in patients with dry eye. Design: A prospective, two-center, randomized, double-masked, placebo-controlled Phase 2 study. Methods: A total of 150 dry eye patients were randomized 1:1:1 to study medication (1% MIM-D3, 5% MIM-D3, or placebo and dosed twice daily (BID for 28 days. Key eligibility criteria included exacerbation in corneal staining and ocular discomfort in the Controlled Adverse Environment (CAESM on two visits, separated by 1 week of BID dosing with artificial tears. Safety and efficacy were evaluated at baseline, throughout treatment, and for 2 weeks post-treatment. The pre-specified primary outcome measures were fluorescein corneal staining post-CAE at day 28 and diary worst symptom scores over 28 days. Secondary outcomes included the pre-, post-, and the change from pre- to post-CAE fluorescein and lissamine green staining in both corneal and conjunctival regions, as well as individual diary symptoms. Results: The prespecified primary endpoints were not met. Compared with placebo, fluorescein corneal staining at day 28 was significantly improved (P < 0.05 in the 1% MIM-D3 group for the assessment of change from pre-CAE to post-CAE. In addition, following CAE exposure, patients in the 1% MIM-D3 group showed significant improvements versus placebo (P < 0.05 in inferior fluorescein and lissamine green staining after 14 and 28 days. Compared with placebo, patients in the 5% MIM-D3 group reported significantly lower daily diary scores for ocular dryness (P < 0.05. In a subgroup defined by higher symptom scores during

  3. Studying Coxiella burnetii Type IV Substrates in the Yeast Saccharomyces cerevisiae: Focus on Subcellular Localization and Protein Aggregation.

    Science.gov (United States)

    Rodríguez-Escudero, María; Cid, Víctor J; Molina, María; Schulze-Luehrmann, Jan; Lührmann, Anja; Rodríguez-Escudero, Isabel

    2016-01-01

    Coxiella burnetii is a Gram-negative obligate parasitic bacterium that causes the disease Q-fever in humans. To establish its intracellular niche, it utilizes the Icm/Dot type IVB secretion system (T4BSS) to inject protein effectors into the host cell cytoplasm. The host targets of most cognate and candidate T4BSS-translocated effectors remain obscure. We used the yeast Saccharomyces cerevisiae as a model to express and study six C. burnetii effectors, namely AnkA, AnkB, AnkF, CBU0077, CaeA and CaeB, in search for clues about their role in C. burnetii virulence. When ectopically expressed in HeLa cells, these effectors displayed distinct subcellular localizations. Accordingly, GFP fusions of these proteins produced in yeast also decorated distinct compartments, and most of them altered cell growth. CaeA was ubiquitinated both in yeast and mammalian cells and, in S. cerevisiae, accumulated at juxtanuclear quality-control compartments (JUNQs) and insoluble protein deposits (IPODs), characteristic of aggregative or misfolded proteins. AnkA, which was not ubiquitinated, accumulated exclusively at the IPOD. CaeA, but not AnkA or the other effectors, caused oxidative damage in yeast. We discuss that CaeA and AnkA behavior in yeast may rather reflect misfolding than recognition of conserved targets in the heterologous system. In contrast, CBU0077 accumulated at vacuolar membranes and abnormal ER extensions, suggesting that it interferes with vesicular traffic, whereas AnkB associated with the yeast nucleolus. Both effectors shared common localization features in HeLa and yeast cells. Our results support the idea that C. burnetii T4BSS effectors manipulate multiple host cell targets, which can be conserved in higher and lower eukaryotic cells. However, the behavior of CaeA and AnkA prompt us to conclude that heterologous protein aggregation and proteostatic stress can be a limitation to be considered when using the yeast model to assess the function of bacterial effectors.

  4. Virtual X-ray imaging techniques in an immersive casting simulation environment

    Science.gov (United States)

    Li, Ning; Kim, Sung-Hee; Suh, Ji-Hyun; Cho, Sang-Hyun; Choi, Jung-Gil; Kim, Myoung-Hee

    2007-08-01

    A computer code was developed to simulate radiograph of complex casting products in a CAVE TM-like environment. The simulation is based on the deterministic algorithms and ray tracing techniques. The aim of this study is to examine CAD/CAE/CAM models at the design stage, to optimize the design and inspect predicted defective regions with fast speed, good accuracy and small numerical expense. The present work discusses the algorithms for the radiography simulation of CAD/CAM model and proposes algorithmic solutions adapted from ray-box intersection algorithm and octree data structure specifically for radiographic simulation of CAE model. The stereoscopic visualization of full-size of product in the immersive casting simulation environment as well as the virtual X-ray images of castings provides an effective tool for design and evaluation of foundry processes by engineers and metallurgists.

  5. The environment power system analysis tool development program

    Science.gov (United States)

    Jongeward, Gary A.; Kuharski, Robert A.; Kennedy, Eric M.; Stevens, N. John; Putnam, Rand M.; Roche, James C.; Wilcox, Katherine G.

    1990-01-01

    The Environment Power System Analysis Tool (EPSAT) is being developed to provide space power system design engineers with an analysis tool for determining system performance of power systems in both naturally occurring and self-induced environments. The program is producing an easy to use computer aided engineering (CAE) tool general enough to provide a vehicle for technology transfer from space scientists and engineers to power system design engineers. The results of the project after two years of a three year development program are given. The EPSAT approach separates the CAE tool into three distinct functional units: a modern user interface to present information, a data dictionary interpreter to coordinate analysis; and a data base for storing system designs and results of analysis.

  6. Adiabatic Liquid Piston Compressed Air Energy Storage

    DEFF Research Database (Denmark)

    Petersen, Tage; Elmegaard, Brian; Pedersen, Allan Schrøder

    This project investigates the potential of a Compressed Air Energy Storage system (CAES system). CAES systems are used to store mechanical energy in the form of compressed air. The systems use electricity to drive the compressor at times of low electricity demand with the purpose of converting...... the mechanical energy into electricity at times of high electricity demand. Two such systems are currently in operation; one in Germany (Huntorf) and one in the USA (Macintosh, Alabama). In both cases, an underground cavern is used as a pressure vessel for the storage of the compressed air. Both systems...... are in the range of 100 MW electrical power output with several hours of production stored as compressed air. In this range, enormous volumes are required, which make underground caverns the only economical way to design the pressure vessel. Both systems use axial turbine compressors to compress air when charging...

  7. A concept of an electricity storage system with 50 MWh storage capacity

    Directory of Open Access Journals (Sweden)

    Józef Paska

    2012-06-01

    Full Text Available Electricity storage devices can be divided into indirect storage technology devices (involving electricity conversion into another form of energy, and direct storage (in an electric or magnetic fi eld. Electricity storage technologies include: pumped-storage power plants, BES Battery Energy Storage, CAES Compressed Air Energy Storage, Supercapacitors, FES Flywheel Energy Storage, SMES Superconducting Magnetic Energy Storage, FC Fuel Cells reverse or operated in systems with electrolysers and hydrogen storage. These technologies have diff erent technical characteristics and economic parameters that determine their usability. This paper presents two concepts of an electricity storage tank with a storage capacity of at least 50 MWh, using the BES battery energy storage and CAES compressed air energy storage technologies.

  8. The Fracture Influence on the Energy Loss of Compressed Air Energy Storage in Hard Rock

    Directory of Open Access Journals (Sweden)

    Hehua Zhu

    2015-01-01

    Full Text Available A coupled nonisothermal gas flow and geomechanical numerical modeling is conducted to study the influence of fractures (joints on the complex thermohydromechanical (THM performance of underground compressed air energy storage (CAES in hard rock caverns. The air-filled chamber is modeled as porous media with high porosity, high permeability, and high thermal conductivity. The present analysis focuses on the CAES in hard rock caverns at relatively shallow depth, that is, ≤100 m, and the pressure in carven is significantly higher than ambient pore pressure. The influence of one discrete crack and multiple crackson energy loss analysis of cavern in hard rock media are carried out. Two conditions are considered during each storage and release cycle, namely, gas injection and production mass being equal and additional gas injection supplemented after each cycle. The influence of the crack location, the crack length, and the crack open width on the energy loss is studied.

  9. Fluid intelligence and neural mechanisms of conflict adaptation

    DEFF Research Database (Denmark)

    Liu, Tongran; Xiao, Tong; Jiannong, Shi

    2016-01-01

    The current study investigated whether adolescents with different intellectual levels have different conflict adaptation processes. Adolescents with high and average IQ abilities were enrolled, and their behavioral responses and event-related potentials (ERPs) were recorded during a modified Erik...... adaptation control processing with smaller SP amplitude-CAE values. In conclusion, the present study revealed the essential association between fluid intelligence and conflict adaptation processes....... that high IQ adolescents had shorter RTs than their average-IQ counterparts in the cI, iC, and iI conditions, with smaller RT-CAE values. These findings indicated that high IQ adolescents had superior conflict adaptation processes. The electrophysiological findings showed that the cI condition required more...

  10. Center for Advanced Energy Studies Program Plan

    Energy Technology Data Exchange (ETDEWEB)

    Kevin Kostelnik

    2005-09-01

    The world is facing critical energy-related challenges regarding world and national energy demands, advanced science and energy technology delivery, nuclear engineering educational shortfalls, and adequately trained technical staff. Resolution of these issues is important for the United States to ensure a secure and affordable energy supply, which is essential for maintaining U.S. national security, continued economic prosperity, and future sustainable development. One way that the U.S. Department of Energy (DOE) is addressing these challenges is by tasking the Battelle Energy Alliance, LLC (BEA) with developing the Center for Advanced Energy Studies (CAES) at the Idaho National Laboratory (INL). By 2015, CAES will be a self-sustaining, world-class, academic and research institution where the INL; DOE; Idaho, regional, and other national universities; and the international community will cooperate to conduct critical energy-related research, classroom instruction, technical training, policy conceptualization, public dialogue, and other events.

  11. Changing Arctic ecosystems: sea ice decline, permafrost thaw, and benefits for geese

    Science.gov (United States)

    Flint, Paul; Whalen, Mary; Pearce, John M.

    2014-01-01

    Through the Changing Arctic Ecosystems (CAE) initiative, the U.S. Geological Survey (USGS) strives to inform resource management decisions for Arctic Alaska by providing scientific information on current and future ecosystem response to a warming climate. A key area for the USGS CAE initiative has been the Arctic Coastal Plain of northern Alaska. This region has experienced a warming trend over the past 30 years, leading to reductions in sea ice and thawing of permafrost. Loss of sea ice has increased ocean wave action, leading to erosion and salt water inundation of coastal habitats. Saltwater tolerant plants are now thriving in these areas and this appears to be a positive outcome for geese in the Arctic. This finding is contrary to the deleterious effects that declining sea ice is having on habitats of ice-dependent animals, such as polar bear and walrus.

  12. Compressed air energy storage system reservoir size for a wind energy baseload power plant

    Energy Technology Data Exchange (ETDEWEB)

    Cavallo, A.J.

    1996-12-31

    Wind generated electricity can be transformed from an intermittent to a baseload resource using an oversized wind farm in conjunction with a compressed air energy storage (CAES) system. The size of the storage reservoir for the CAES system (solution mined salt cavern or porous media) as a function of the wind speed autocorrelation time (C) has been examined using a Monte Carlo simulation for a wind class 4 (wind power density 450 W m{sup -2} at 50 m hub height) wind regime with a Weibull k factor of 2.5. For values of C typically found for winds over the US Great Plains, the storage reservoir must have a 60 to 80 hour capacity. Since underground reservoirs account for only a small fraction of total system cost, this larger storage reservoir has a negligible effect on the cost of energy from the wind energy baseload system. 7 refs., 2 figs., 1 tab.

  13. Diseño asistido por computador

    OpenAIRE

    Rojas Lazo, Oswaldo; Universidad Nacional Mayor de San Marcos; Rojas Rojas, Luis; Universidad Nacional Mayor de San Marcos

    2014-01-01

    El diseño es una actividad que se proyecta hacia la solución de problemas planteados por el ser humano en su adaptación al medio que lo rodea, para la satisfacción de sus necesidades, para lo cual utiliza recursos como la tecnología CAD/CAE/CAM. Estas tecnologías se vienen aplicando a través de los métodos de la ingeniería concurrente. La técnica más desarrollada en la ingeniería asistida por computador (CAE), es la aplicación de los análisis por elementos finitos (FEA), que con la mejora de ...

  14. Déploiement du contrat d’accompagenement dans l’emploi et structures des marchés du travail locaux : Elements d’analyse sur données départementales en 2009

    OpenAIRE

    Olivier Baguelin

    2011-01-01

    Cet article décrit et analyse le déploiement territorial du Contrat d’accompagnement dans l’emploi (CAE) au cours de l’année 2009 en réponse à la crise. Dispositif emblématique de la politique nationale de l’emploi, le CAE est l’objet d’un pilotage très centralisé recherchant une action rapide et massive sur la comptabilité du chômage. Cette logique uniformisante se heurte à la diversité structurelle des marchés du travail locaux, telle que la révèlent les données 2008 du Recensement de la po...

  15. Analysis of the Forming Process of Conical-Like Helical Surfaces with Roller Tools

    OpenAIRE

    Kacalak W.; Budniak Z.; Szafraniec F.

    2017-01-01

    The article presents a methodology of an analysis and modeling of technological systems and the grinding process of conical-like helical surfaces with the use of modern CAD/CAE systems and calculations in the Matlab system. The methodology developed allows one to carry out simulation tests for the accuracy of the grinding process of helical surfaces taking into consideration the deviations of the location and shape of the system’s elements, axial and radial striking the spindle of the workpie...

  16. Modelling And Numerical Analysis Of Assembly System

    OpenAIRE

    Budniak Zbigniew

    2015-01-01

    The present articles covers a concept of the creation and testing of assembly systems with the use of modern CAD and CAE systems on the example of an assembly system designed for joining parts with circular surfaces that are fitted with positive clearance. The numerical investigations were based on the constructed spatial skeleton pattern of the system. The purpose of the simulation tests was to determine the impact of the measurement and angular inaccuracies of all the elements of the assemb...

  17. Design and Analysis of a Solar-Powered Compressed Air Energy Storage System

    Science.gov (United States)

    2016-12-01

    Union of Concerned Scientists, 2016, “The Hidden Cost of Fossil Fuels,” from http://www.ucsusa.org/clean- energy /coal-and-other- fossil -fuels/hidden- cost ...9 Figure 9. Operation of Constant-Pressure CAES System Combined with Hydraulic Energy Storage. Source: [41...of fossil fuels. As Figure 2 shows, the U.S. Department of Defense (DOD) energy usage dwarfs that of any other organization in the world, and it is

  18. Model based virtual startup of automation systems

    OpenAIRE

    Schob, U.; Böttcher, R; Blochwitz, T.; Oelsner, O.; Winter, M.

    2009-01-01

    This paper deals with the model generation for automation systems. A generic solution is presented, which analyses existing Computer Aided Engineering CAE) documents and thereof automatically generates simulation models. They are described as Modelica models and use a special library, customized for the automation branch. It contains common elements which can be parameterized with very few efforts. Additional components for the communication to the control are available. They support several ...

  19. Parts-on-Demand: Manufacturing Technology and Technology Transfer Assessment

    Science.gov (United States)

    1983-12-31

    This will mesh perfectly with the current rise in information technology: office automation, CAD, CAM, CAE, numerical control, robotics , and inte...Nippon Denso : from a suits of 40 models, batchc; *.f one to 40,000 can be made on one day’s notice. "Design for POD manufacture and POD assembly" do not...being applied to non-metal fabrication like composite Iayup and textile products assembly. Here, robots and oth- er programmable equipment can handle a

  20. The Value of CO2-Geothermal Bulk Energy Storage to Reducing CO2 Emissions Compared to Conventional Bulk Energy Storage Technologies

    Science.gov (United States)

    Ogland-Hand, J.; Bielicki, J. M.; Buscheck, T. A.

    2016-12-01

    Sedimentary basin geothermal resources and CO2 that is captured from large point sources can be used for bulk energy storage (BES) in order to accommodate higher penetration and utilization of variable renewable energy resources. Excess energy is stored by pressurizing and injecting CO2 into deep, porous, and permeable aquifers that are ubiquitous throughout the United States. When electricity demand exceeds supply, some of the pressurized and geothermally-heated CO2 can be produced and used to generate electricity. This CO2-BES approach reduces CO2 emissions directly by storing CO2 and indirectly by using some of that CO2 to time-shift over-generation and displace CO2 emissions from fossil-fueled power plants that would have otherwise provided electricity. As such, CO2-BES may create more value to regional electricity systems than conventional pumped hydro energy storage (PHES) or compressed air energy storage (CAES) approaches that may only create value by time-shifting energy and indirectly reducing CO2 emissions. We developed and implemented a method to estimate the value that BES has to reducing CO2 emissions from regional electricity systems. The method minimizes the dispatch of electricity system components to meet exogenous demand subject to various CO2 prices, so that the value of CO2 emissions reductions can be estimated. We applied this method to estimate the performance and value of CO2-BES, PHES, and CAES within real data for electricity systems in California and Texas over the course of a full year to account for seasonal fluctuations in electricity demand and variable renewable resource availability. Our results suggest that the value of CO2-BES to reducing CO2 emissions may be as much as twice that of PHES or CAES and thus CO2-BES may be a more favorable approach to energy storage in regional electricity systems, especially those where the topography is not amenable to PHES or the subsurface is not amenable to CAES.

  1. Progress of the Computer-Aided Engineering of Electric Drive Vehicle Batteries (CAEBAT) (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Pesaran, A. A.; Han, T.; Hartridge, S.; Shaffer, C.; Kim, G. H.; Pannala, S.

    2013-06-01

    This presentation, Progress of Computer-Aided Engineering of Electric Drive Vehicle Batteries (CAEBAT) is about simulation and computer-aided engineering (CAE) tools that are widely used to speed up the research and development cycle and reduce the number of build-and-break steps, particularly in the automotive industry. Realizing this, DOE?s Vehicle Technologies Program initiated the CAEBAT project in April 2010 to develop a suite of software tools for designing batteries.

  2. Compressed air energy storage with liquid air capacity extension

    OpenAIRE

    Kantharaj, Bharath; Garvey, Seamus D.; Pimm, Andrew James

    2015-01-01

    As renewable electricity generation capacity increases, energy storage will be required at larger scales. Compressed Air Energy Storage (CAES) at large scales, with effective management of heat, is recognised to have potential to provide affordable grid-scale energy storage. Where suitable geologies are unavailable, compressed air could be stored in pressurised steel tanks above ground, but this would incur significant storage costs. Liquid Air Energy Storage (LAES), on the other hand, does n...

  3. A Comparison of Variance-Controlled and Non-Controlled Principal Components

    Science.gov (United States)

    1990-03-01

    cortroled fadtors. Case 1 Metodology Tcie 3 showed the od"i dala ma*b-T gtood for Itne ii system aid 1K] stood for iuzdlon rcle ct node J. Nodes 1 and 2...comonent andy*. Cae 3 Meft rxogy Case 3folowed d eflytfom Case 1 aid used the same meTodology as Case 2. Sice the factors were aleatoryW-4 al #t was

  4. Model development for auralization of interior tyre noise

    OpenAIRE

    Löfdahl, Magnus

    2011-01-01

    Increasing competition has set pressure on the product development process to reduce development time and costs. Computer Aided Engineering (CAE) has been used to decrease development times by facilitating early predictions of product performances and qualities. Especially in early phases of product development, models with sufficient accuracy can provide valuable decision supports in order to pass legislations and fulfill customer expectations. Acoustic performance and sound quality are esse...

  5. NCBI nr-aa BLAST: CBRC-TNIG-22-0315 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-22-0315 ref|YP_177750.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||E70824 hypothetical glycine-rich protein Rv0746 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55316.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177750.1 7e-13 31% ...

  6. NCBI nr-aa BLAST: CBRC-CJAC-01-1322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1322 ref|YP_177968.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||C70974 hypothetical glycine-rich protein Rv3388 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55593.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177968.1 0.041 29% ...

  7. NCBI nr-aa BLAST: CBRC-XTRO-01-2365 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2365 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 0.17 36% ...

  8. NCBI nr-aa BLAST: CBRC-HSAP-15-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-15-0004 ref|YP_177750.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||E70824 hypothetical glycine-rich protein Rv0746 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55316.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177750.1 2e-10 33% ...

  9. A Comprehensive Method of Identifying Heat Shock Proteins (HSPs)

    OpenAIRE

    Pielesz A; Machnicka A; Binias D; Sarna E

    2016-01-01

    Because no model will ever completely replicate clinical human wound healing, it is essential that the model utilized be selected with care. Anatomically and physiologically, poultry skin is similar to human skin in many respects. Therefore, organic chicken skin (an ex-vivo burninjured skin model) was analysed in this study. Acetate electrophoresis (CAE), microbiological procedure, Fourier-transform infrared spectrometry (FTIR) and scanning electron microscopy analysis (SEM) were all carried ...

  10. A Lightweight Automobile Body Concept Featuring Ultra-Large, Thin-Wall Structural Magnesium Castings

    Science.gov (United States)

    Logan, Stephen

    This paper describes a lightweight automobile body concept utilizing a hybrid materials approach with emphasis on a magnesium and aluminum structure to support a high fuel-efficiency vehicle project. This approach resulted in a more than 40% weight reduction over a conventional steel body-in-white while achieving significantly improved staictural performance as evaluated through CAE simulations. A business case analysis was conducted and showed promising results. One concept vehicle was built for the purpose of demonstrating concept feasibility.

  11. Navy/Marine Corps Manager’s Desktop Guide for CALS Implementation. 2nd Edition

    Science.gov (United States)

    1993-06-30

    Gallery Hewlett - Parkard X X GRAFPACK-CGM * X GRAFPACK-GKS* X Graphporter * GSC X Graphwrlter II Lotus Development X Harvard Graphics Software Publishing X X...specific application domains. In 1988, at the International Conference on Computer Aided Design, two major electronic design work station vendors - Hewlett ...companies (National, Motorola and Texas Instruments); three CAE systems houses (Daisy Systems, Mentor Graphics and Hewlett -Packard); and the University of

  12. Conceptual Modeling via Logic Programming

    Science.gov (United States)

    1990-01-01

    Costs. Cost significant areas may fail to be identified for a and units of fiscal -year cost are the major particular analysis. Thus evaluation of the...subject to fiscal constraints. from all available sensors to reduce depend- This is of medium or low priority since there ence on sensor survivability...many caes it may not be possible or practica to sensors may be required to have reduced areas of coverage to prevent satunation atempt to increase the

  13. 219-IJBCS-Article-Dr R N -Nwaoguikpe

    African Journals Online (AJOL)

    RHUMSIKI

    are: Telferia occidentalis WAS (600±0.1), BUS (242±0.11), FAS (175±0.11) and CAE (2890±0.1); Allium cepa, WAS (1225±0.1), BUS ..... to their normal morphology is due to increased oxygen affinity. It can be inferred that these vegetables/ spices can provide profound nutritional and antisickling effectiveness for the ...

  14. Using causal reasoning for automated failure modes and effects analysis (FMEA)

    Science.gov (United States)

    Bell, Daniel; Cox, Lisa; Jackson, Steve; Schaefer, Phil

    The authors have developed a tool that automates the reasoning portion of a failure modes and effects analysis (FMEA). It is built around a flexible causal reasoning module that has been adapted to the FMEA procedure. The approach and software architecture have been proven. A prototype tool has been created and successfully passed a test and evaluation program. The authors are expanding the operational capability and adapting the tool to various CAD/CAE (computer-aided design and engineering) platforms.

  15. Untersuchungen zum Einfluss des Applikationszeitpunkts von Xenon auf die zentralnervoese Leistung von Ratten nach extrakorporaler Zirkulation und zerebralen Luftemboli

    OpenAIRE

    Klemmer, Katja Christina

    2007-01-01

    „Investigations on effects of Xenon application time on cerebral outcome following cardiopulmonary bypass with cerebral air embolism in the rat” Cerebral air embolism (CAE) is thought to be one of the risk factors for adverse cerebral outcome following cardiac surgery with cardiopulmonary bypass (CPB). Neurologic and neurocognitive deficits after cardiac surgery remain a common and severe complication, alleviating patients´ quality of life for years. Providing neuroprotective properties a...

  16. NCBI nr-aa BLAST: CBRC-TGUT-20-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-20-0006 ref|YP_177750.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||E70824 hypothetical glycine-rich protein Rv0746 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55316.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177750.1 0.003 38% ...

  17. NCBI nr-aa BLAST: CBRC-TSYR-01-1466 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1466 ref|YP_177750.1| PE-PGRS family protein [Mycobacterium tuberculosis... H37Rv] pir||E70824 hypothetical glycine-rich protein Rv0746 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55316.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177750.1 6e-21 35% ...

  18. NCBI nr-aa BLAST: CBRC-GGAL-35-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0050 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 2e-18 33% ...

  19. NCBI nr-aa BLAST: CBRC-PABE-17-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-17-0033 ref|YP_177982.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||D70807 hypothetical glycine-rich protein Rv3514 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55607.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177982.1 2e-14 32% ...

  20. NCBI nr-aa BLAST: CBRC-DYAK-04-0109 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-04-0109 ref|YP_177978.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||E70806 hypothetical glycine-rich protein Rv3507 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55603.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177978.1 9e-09 25% ...