
Sample records for cadmium 122

  1. Cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Stoeppler, M. (Kernforschungsanlage Juelich G.m.b.H. (Germany, F.R.). Inst. fuer Angewandte Physikalische Chemie); Piscator, M. (Karolinska Inst., Stockholm (Sweden). Dept. of Environmental Hygiene) (eds.)


    The proceedings contain the 18 papers presented at the workshop. They are dealing with the following themes: Toxicity, carcinogenesis and metabolism of cadmium, epidemiology; environmental occurrence; quantitative analysis and quality assessment. (MG) With 57 figs., 79 tabs.

  2. Environmental cadmium and breast cancer risk



    Breast cancer is the most prevalent women's cancer, with an age-adjusted incidence of 122.9 per 100,000 US women. Cadmium, a ubiquitous carcinogenic pollutant with multiple biological effects, has been reported to be associated with breast cancer in one US regional case-control study. We examined the association of breast cancer with urinary cadmium (UCd), in a case-control sample of women living on Long Island (LI), NY (100 with breast cancer and 98 without), a region with an especially high...

  3. Cadmium and zinc relationships. (United States)

    Elinder, C G; Piscator, M


    Cadmium and zinc concentrations in kidney and liver have been measured under different exposure situations in different species including man. The results show that zinc increases almost equimolarly with cadmium in kidney after long-term low-level exposure to cadmium, e.g., in man, horse, pig, and lamb. In contrast, the increase of zinc follows that of cadmium to only a limited extent, e.g., in guinea pig, rabbit, rat, mouse, and chicks. In liver, the cadmium--zinc relationship seems to be reversed in such a way that zinc increases with cadmium more markedly in laboratory animals than in higher mammals. These differences between cadmium and zinc relationships in humans and large farm animals and those in commonly used laboratory animals must be considered carefully before experimental data on cadmium and zinc relationships in laboratory animals can be extrapolated to humans.

  4. 40 CFR 89.122 - Certification. (United States)


    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Certification. 89.122 Section 89.122... EMISSIONS FROM NEW AND IN-USE NONROAD COMPRESSION-IGNITION ENGINES Emission Standards and Certification Provisions § 89.122 Certification. (a) If, after a review of the manufacturer's application, request...

  5. 7 CFR 1260.122 - Promotion. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Promotion. 1260.122 Section 1260.122 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Definitions § 1260.122 Promotion. Promotion means any action, including...

  6. 49 CFR 1.22 - Structure. (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false Structure. 1.22 Section 1.22 Transportation Office of the Secretary of Transportation ORGANIZATION AND DELEGATION OF POWERS AND DUTIES Office of the Secretary § 1.22 Structure. (a) Secretary and Deputy Secretary. The Secretary and Deputy Secretary...

  7. 46 CFR 122.503 - Voyage plan. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Voyage plan. 122.503 Section 122.503 Shipping COAST... Emergencies § 122.503 Voyage plan. (a) The master of the following vessels shall prepare a voyage plan: (1) A... United States Great Lakes port from a Canadian Great Lakes port. (b) The voyage plan required...

  8. 19 CFR 122.37 - Precleared aircraft. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Precleared aircraft. 122.37 Section 122.37 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Landing Requirements § 122.37 Precleared aircraft. (a) Application. This section applies when aircraft carrying...

  9. 19 CFR 122.64 - Other aircraft. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Other aircraft. 122.64 Section 122.64 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Clearance of Aircraft and Permission To Depart § 122.64 Other aircraft. Clearance or permission to depart shall be...

  10. 19 CFR 122.63 - Scheduled airlines. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scheduled airlines. 122.63 Section 122.63 Customs... AIR COMMERCE REGULATIONS Clearance of Aircraft and Permission To Depart § 122.63 Scheduled airlines... scheduled airlines covered by this subpart. (a) Clearance at other than airport of final departure....

  11. 25 CFR 122.9 - Annual report. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Annual report. 122.9 Section 122.9 Indians BUREAU OF... EDUCATION § 122.9 Annual report. The Osage Tribal Education Committee shall submit an annual report on OMB approved Form 1076-0106, Higher Education Annual Report, to the Assistant Secretary or his/her...

  12. 46 CFR 122.410 - Watchmen. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Watchmen. 122.410 Section 122.410 Shipping COAST GUARD... OVERNIGHT ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS OPERATIONS Crew Requirements § 122.410 Watchmen. The... suitable number of watchmen patrol throughout the vessel during the nighttime, whether or not the vessel...

  13. 46 CFR 122.702 - Maintenance. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Maintenance. 122.702 Section 122.702 Shipping COAST..., Maintenance, and Inspection of Lifesaving Equipment § 122.702 Maintenance. (a) The manufacturer's instructions for onboard maintenance of survival craft, rescue boats, and launching appliances, manufactured on...

  14. 21 CFR 168.122 - Lactose. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Lactose. 168.122 Section 168.122 Food and Drugs... § 168.122 Lactose. (a) Lactose is the carbohydrate normally obtained from whey. It may be anhydrous or... the following specifications: (1) The lactose content is not less than 98.0 percent, mass over mass...

  15. 7 CFR 953.122 - Fiscal period. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Fiscal period. 953.122 Section 953.122 Agriculture... STATES Rules and Regulations Change in Date for Completing Nominations, Term of Office, and Fiscal Period § 953.122 Fiscal period. The fiscal period, pursuant to § 953.9, which began on April 1, 1976, shall...

  16. 29 CFR 1917.122 - Employee exits. (United States)


    ... 29 Labor 7 2010-07-01 2010-07-01 false Employee exits. 1917.122 Section 1917.122 Labor Regulations...) MARINE TERMINALS Terminal Facilities § 1917.122 Employee exits. (a) Employee exits shall be clearly marked. (b) If an employee exit is not visible from employees' work stations, directional...

  17. 19 CFR 122.85 - Final airport. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Final airport. 122.85 Section 122.85 Customs... AIR COMMERCE REGULATIONS Procedures for Residue Cargo and Stopover Passengers § 122.85 Final airport. When an aircraft enters at the last domestic airport of discharge, the traveling general...

  18. 45 CFR 12.2 - Scope. (United States)


    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Scope. 12.2 Section 12.2 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION DISPOSAL AND UTILIZATION OF SURPLUS REAL PROPERTY FOR PUBLIC HEALTH PURPOSES § 12.2 Scope. This part is applicable to surplus real property located within any State which is appropriate...

  19. 21 CFR 606.122 - Instruction circular. (United States)


    ... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Instruction circular. 606.122 Section 606.122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) BIOLOGICS CURRENT GOOD MANUFACTURING PRACTICE FOR BLOOD AND BLOOD COMPONENTS Finished Product Control § 606.122 Instruction circular. An instruction...

  20. 47 CFR 12.2 - Backup power. (United States)


    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Backup power. 12.2 Section 12.2 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL REDUNDANCY OF COMMUNICATIONS SYSTEMS § 12.2 Backup power..., must have an emergency backup power source (e.g., batteries, generators, fuel cells) for all...

  1. 42 CFR 421.122 - Performance standards. (United States)


    ... 42 Public Health 3 2010-10-01 2010-10-01 false Performance standards. 421.122 Section 421.122... (CONTINUED) MEDICARE PROGRAM MEDICARE CONTRACTING Intermediaries § 421.122 Performance standards. (a) Development of standards. In addition to the performance criteria (§ 421.120), CMS develops...

  2. Cadmium and zinc relationships

    Energy Technology Data Exchange (ETDEWEB)

    Elinder, C.; Piscator, M.


    Higher mammals, such as homo sapiens, accumulate zinc in kidney cortex almost equimolarly with cadmium. A different pattern seems to be present in liverthere is a limited increase of zinc in two species of large farm animals compared with a marked increase in the laboratory. In large farm animals, an equimolar increase of zinc with cadmium in renal cortex seems to indicate that the form of metallothionein that binds equal amounts of cadmium and zinc in present. Differences in cadmium and zinc relationships in large animals and humans compared with laboratory animals must be carefully considered. (4 graphs, 26 references)

  3. Environmental cadmium and breast cancer risk. (United States)

    Gallagher, Carolyn M; Chen, John J; Kovach, John S


    Breast cancer is the most prevalent women's cancer, with an age-adjusted incidence of 122.9 per 100,000 US women. Cadmium, a ubiquitous carcinogenic pollutant with multiple biological effects, has been reported to be associated with breast cancer in one US regional case-control study. We examined the association of breast cancer with urinary cadmium (UCd), in a case-control sample of women living on Long Island (LI), NY (100 with breast cancer and 98 without), a region with an especially high rate of breast cancer (142.7 per 100,000 in Suffolk County) and in a representative sample of US women (NHANES 1999-2008, 92 with breast cancer and 2,884 without). In a multivariable logistic model, both samples showed a significant trend for increased odds of breast cancer across increasing UCd quartiles (NHANES, p=0.039 and LI, p=0.023). Compared to those in the lowest quartile, LI women in the highest quartile had increased risk for breast cancer (OR=2.69; 95% CI=1.07, 6.78) and US women in the two highest quartiles had increased risk (OR=2.50; 95% CI=1.11, 5.63 and OR=2.22; 95% CI=.89, 5.52, respectively). Further research is warranted on the impact of environmental cadmium on breast cancer risk in specific populations and on identifying the underlying molecular mechanisms.

  4. Zinc and cadmium monosalicylates

    Energy Technology Data Exchange (ETDEWEB)

    Kharitonov, Yu.Ya.; Tujebakhova, Z.K. (Moskovskij Khimiko-Tekhnologicheskij Inst. (USSR))


    Zinc and cadmium monosalicylates of the composition MSal, where M-Zn or Cd, Sal - twice deprotonated residue of salicylic acid O-HOC/sub 6/H/sub 4/COOH (H/sub 2/Sal), are singled out and characterized. When studying thermograms, thermogravigrams, IR absorption spectra, roentgenograms of cadmium salicylate compounds (Cd(OC/sub 6/H/sub 4/COO) and products of their thermal transformations, the processes of thermal decomposition of the compounds have been characterized. The process of cadmium monosalicylate decomposition takes place in one stage. Complete loss of salicylate acido group occurs in the range of 320-460 deg. At this decomposition stage cadmium oxide is formed. A supposition is made that cadmium complex has tetrahedral configuration, at that, each salicylate group plays the role of tetradentate-bridge ligand. The compound evidently has a polymer structure.

  5. Dicty_cDB: SLC122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC122 (Link to dictyBase) - - - Contig-U16325-1 SLC122Z (Link... to Original site) - - SLC122Z 330 - - - - Show SLC122 Library SL (Link to library) Clone ID SLC122 (Link Representative seq. ID SLC12...2Z (Link to Original site) Representative DNA sequence >SLC122 (SLC122Q) /CSM/SL/SLC1-A/SLC122Q.Seq.d/ XXXXX...: ---rlskinl*tswlprkp*mrfktw*tplcir*ttnr*mg**slrfrlqsskc*scn*c l*spkgsktt**ysikqf

  6. Dicty_cDB: SFH122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFH122 (Link to dictyBase) - - - Contig-U16294-1 SFH122P (Link to Original site) SF...H122F 550 SFH122Z 669 SFH122P 1219 - - Show SFH122 Library SF (Link to library) Clone ID SF...e URL Representative seq. ID SF...H122P (Link to Original site) Representative DNA sequence >SFH122 (SFH122Q) /CSM/SF/SFH1-A/SFH...QSIPHDRYVIIIEGSEE SG--- ---RAENQLTGEVDKRLHVEIPQHRLDQIAKCAEILGETIYDEXSWYKNTTPVTKDLTQL MINKTWYPTICITGAEGIPHTSNAGNVMRTHTTVKVSVRLPPSF

  7. Dicty_cDB: SSG122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG122 (Link to dictyBase) - - - Contig-U16327-1 SSG122Z (Link... to Original site) - - SSG122Z 589 - - - - Show SSG122 Library SS (Link to library) Clone ID SSG122 (Link Representative seq. ID SSG12...2Z (Link to Original site) Representative DNA sequence >SSG122 (SSG122Q) /CSM/SS/SSG1-A/SSG122Q.Seq.d/ XXXXX...CGRFVRYIPDATNTNQFTFA EYTTNQCTVQVTPAVTNTFTCADQTSSHALGSDWSGVCKITATPAPTVTPTVTPTVTPTV TPTPTNTPNPTPSQTSTTTGSASTVV

  8. 9 CFR 122.1 - Definitions. (United States)


    ... or infectious disease of animals (including poultry). (e) Vectors. All animals (including poultry... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Definitions. 122.1 Section 122.1 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  9. 9 CFR 122.2 - Permits required. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Permits required. 122.2 Section 122.2 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES... Office of Management and Budget under control number 0579-0015)...

  10. 19 CFR 122.21 - Application. (United States)


    ... U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Private Aircraft § 122.21 Application. This subpart applies to all private aircraft as defined in § 122.1(h). No other provisions of this part apply to private aircraft, except where stated...

  11. 19 CFR 122.84 - Intermediate airport. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Intermediate airport. 122.84 Section 122.84... Intermediate airport. (a) Application. The provisions of this section apply at any U.S. airport to which an... aircraft arrives at the next airport, the aircraft commander or agent shall make entry by filing the:...

  12. 19 CFR 122.42 - Aircraft entry. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Aircraft entry. 122.42 Section 122.42 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Entry and Entry Documents; Electronic Manifest Requirements...

  13. 19 CFR 122.43 - General declaration. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false General declaration. 122.43 Section 122.43 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Entry and Entry Documents; Electronic Manifest Requirements...

  14. 19 CFR 122.45 - Crew list. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Crew list. 122.45 Section 122.45 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Entry and Entry Documents; Electronic Manifest Requirements for...

  15. 19 CFR 122.47 - Stores list. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Stores list. 122.47 Section 122.47 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Entry and Entry Documents; Electronic Manifest Requirements for...

  16. 19 CFR 122.75 - Complete manifest. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Complete manifest. 122.75 Section 122.75 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Documents Required for Clearance and Permission To Depart;...

  17. 19 CFR 122.77 - Clearance certificate. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Clearance certificate. 122.77 Section 122.77 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Documents Required for Clearance and Permission To Depart;...

  18. 27 CFR 21.122 - Pyridine bases. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Pyridine bases. 21.122....122 Pyridine bases. (a) Alkalinity. One ml of pyridine bases dissolved in 10 ml of water is titrated.... Dissolve 1 ml of pyridine bases in 100 ml of water. (1) Ten ml of this solution are treated with 5 ml of...

  19. Effect of the bentonite application on the cadmium mobility in an Argisol

    Directory of Open Access Journals (Sweden)

    Hugo Orlando Carvallo Guerra


    Full Text Available Aiming to evaluate the effect of doses of bentonite (0, 30 and 60 t ha-1 in the mobility of cadmium on an Argisol, tests of mobility in soil columns with different cadmium concentrations (50, 250 and 450 mg kg-1 of soil and steady state flux, were conducted, determining its flux density and percolation velocity. The cadmium was dislocated by pulse, the solution containing the cadmium initially infiltrated into the soil for a given time period and afterwards the soil was lixiviated with distilled water. Leachates were collected every 10 minutes during 80 minutes of water percolation. The solutions percolated, expressed in pore volumes, were 6.33, 2.28 and 1.93 for the 0, 30 and 60 t ha-1 of bentonite, respectively, being one pore volume equal to 1.22 cm3. The concentration of cadmium was measured by atomic absorption spectrophotometry. At the end of the experiment, the columns were dismounted and the concentrations of cadmium in the soil at different depths (0-10, 10-20, 20-30 e 30-40 cm were also determined. The results showed that the flux density and velocity of water percolation of the water solution were significantly reduced by the addition of bentonite to the soil. The levels of cadmium in the soil did not affect these mobility parameters. Increasing doses of bentonite favored the adsorption of cadmium in the soil.

  20. Dicty_cDB: CHS122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS122 (Link to dictyBase) - - - Contig-U11458-1 CHS122P (Link to Original site) CHS1...22F 663 CHS122Z 819 CHS122P 1462 - - Show CHS122 Library CH (Link to library) Clone ID CHS1...e URL Representative seq. ID CHS1...22P (Link to Original site) Representative DNA sequence >CHS122 (CHS122Q) /CSM/CH/CHS1-A/CHS1...ant alignments: (bits) Value CHS122 (CHS122Q) /CSM/CH/CHS1-A/CHS122Q.Seq.d/ 2391 0.0 SSG440 (SSG440Q) /CSM/S

  1. Cadmium status in Egypt

    Institute of Scientific and Technical Information of China (English)


    It is inferred from these studies that releases of Cd are still increasing and it is recommended that measures must be taken to reduce emissions of cadmium. Any cadmium discharged into the Egyptian environment may move from one compartment to another at varying rates,resulting in an accumulation in compartments such as soils and biota. Such accumulation can be expected to increase with continued emissions,and attention should be given to all sources of cadmium, natural as well as anthropogenic especially in the industrial cities in Egypt. Cadmium present in sewage, as well as industrial effluent (also, other liquid and solid wastes) and sewage sludge will increase levels in soils and is xpected to contribute to dietary levels and body burdens. The current information indicates that such effects may have to be evaluated over long periods of time, possibly as long as 50 - 100 years.

  2. Structure of doubly-even cadmium nuclei studied by {beta}decay

    Energy Technology Data Exchange (ETDEWEB)

    Rinta-Antila, S.; Wang, Y.; Dendooven, P.; Huikari, J.; Kankainen, A.; Kolhinen, V.S.; Lhersonneau, G.; Nieminen, A.; Nummela, S.; Penttilae, H.; Peraejaervi, K.; Szerypo, J.; Wang, J.C. [University of Jyvaeskylae, Department of Physics, (YFL), Jyvaeskylae (Finland); Jokinen, A.; Aeystoe, J. [University of Jyvaeskylae, Department of Physics, (YFL), Jyvaeskylae (Finland); University of Helsinki, Helsinki Institute of Physics, Helsinki (Finland)


    We have studied the structure of even-even cadmium isotopes via beta decay of ground and excited isomeric states of parent silver isotopes. Measurements of mass A=116, 118 and 120 cadmium nuclides were carried out at an ion guide isotope separation on-line facility at the University of Jyvaeskylae. Decay schemes of {sup 116m}Ag, {sup 118m}Ag, {sup 120g}Ag and {sup 120m}Ag are considerably extended. Obtained data have enabled extension of available systematics of the three-phonon states to more neutron-rich cadmium nuclei. As a continuation we have conducted an experiment at ISOLDE, CERN to study heavier A=122, 124, and 126 cadmium nuclides, the analysis of the collected data is underway. (orig.)

  3. TABLE III. Deaths in 122 U.S. cities (United States)

    U.S. Department of Health & Human Services — TABLE III. Deaths in 122 U.S. cities - 2014.122 Cities Mortality Reporting System. Each week, the vital statistics offices of 122 cities across the United States...

  4. Plausible Mechanisms of Cadmium Carcinogenesis (United States)

    Cadmium is a transition metal and an ubiquitous environmental and industrial pollutant. Laboratory animal studies and epidemiological studies have shown that exposure to cadmium is associated with various organ toxicities and carcinogenic effects. Several national and internation...

  5. 5 CFR 185.122 - Discovery. (United States)


    ... § 185.122 Discovery. (a) The following types of discovery are authorized: (1) Requests for production of... document or of the truth of any relevant fact; (3) Written interrogatories; and (4) Depositions. (b)...

  6. Dicty_cDB: VSI122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSI122 (Link to dictyBase) - - - Contig-U16039-1 VSI122P (Link to Original site) VSI...122P (Link to Original site) Representative DNA sequence >VSI122 (VSI122Q) /CSM/VS/VSI1-A/VSI1...122F 544 VSI122Z 402 VSI122P 946 - - Show VSI122 Library VS (Link to library) Clone ID VSI...122 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16039-1 Original site... URL Representative seq. ID VSI

  7. 29 CFR 1910.1027 - Cadmium. (United States)


    ... battery Plate making, plate preparation 50 All other processes 15 Zinc/Cadmium refining* Cadmium refining... as an airborne concentration of cadmium of 2.5 micrograms per cubic meter of air (2.5 µg/m3... air cadmium level to which an employee is exposed means the exposure to airborne cadmium that...

  8. Dicty_cDB: VHF122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available px xsl*pperekv*pqksqiltnstknskqfkshfefs Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF...VH (Link to library) VHF122 (Link to dictyBase) - - - Contig-U16260-1 VHF122P (Link to Original site) VHF...122F 573 VHF122Z 653 VHF122P 1206 - - Show VHF122 Library VH (Link to library) Clone ID VHF...e URL Representative seq. ID VHF...122P (Link to Original site) Representative DNA sequence >VHF122 (VHF122Q) /CSM/VH/VHF1-A/VHF

  9. Dietary cadmium exposure and risk of postmenopausal breast cancer: a population-based prospective cohort study. (United States)

    Julin, Bettina; Wolk, Alicja; Bergkvist, Leif; Bottai, Matteo; Akesson, Agneta


    The ubiquitous food contaminant cadmium has features of an estrogen mimetic that may promote the development of estrogen-dependent malignancies, such as breast cancer. However, no prospective studies of cadmium exposure and breast cancer risk have been reported. We examined the association between dietary cadmium exposure (at baseline, 1987) and the risk of overall and estrogen receptor (ER)-defined (ER(+) or ER(-)) breast cancer within a population-based prospective cohort of 55,987 postmenopausal women. During an average of 12.2 years of follow-up, 2,112 incident cases of invasive breast cancer were ascertained (1,626 ER(+) and 290 ER(-)). After adjusting for confounders, including consumption of whole grains and vegetables (which account for 40% of the dietary exposure, but also contain putative anticarcinogenic phytochemicals), dietary cadmium intake was positively associated with overall breast cancer tumors, comparing the highest tertile with the lowest [rate ratio (RR), 1.21; 95% confidence interval (CI), 1.07-1.36; P(trend) = 0.02]. Among lean and normal weight women, statistically significant associations were observed for all tumors (RR, 1.27; 95% CI, 1.07-1.50) and for ER(+) tumors (RR, 1.25; 95% CI, 1.03-1.52) and similar, but not statistically significant associations were found for ER(-) tumors (RR, 1.22; 95% CI, 0.76-1.93). The risk of breast cancer increased with increasing cadmium exposure similarly within each tertile of whole grain/vegetable consumption and decreased with increasing consumption of whole grain/vegetables within each tertile of cadmium exposure (P(interaction) = 0.73). Overall, these results suggest a role for dietary cadmium in postmenopausal breast cancer development.

  10. Cadmium - is it hazardous

    Energy Technology Data Exchange (ETDEWEB)

    Zartner-Nyilas, G.; Valentin, H.; Schaller, K.H.; Schiele, R.


    The report summarizes the state of knowledge and experience on cadmium. Biological, toxicological and epidemiological data have been evaluated. Cd pollution of the environment is reviewed under the aspect of human health. Uptake in food, threshod values of Cd exposure of the population, types and extent of health hazards, possible carcinogenic effects and future fields of research are discussed.

  11. Cadmium and cancer. (United States)

    Hartwig, Andrea


    Cadmium is an established human and animal carcinogen. Most evidence is available for elevated risk for lung cancer after occupational exposure; however, associations between cadmium exposure and tumors at other locations including kidney, breast, and prostate may be relevant as well. Furthermore, enhanced cancer risk may not be restricted to comparatively high occupational exposure, but may also occur via environmental exposure, for example in areas in close proximity to zinc smelters. The underlying mechanisms are still a matter of manifold research activities. While direct interactions with DNA appear to be of minor importance, elevated levels of reactive oxygen species (ROS) have been detected in diverse experimental systems, presumably due to an inactivation of detoxifying enzymes. Also, the interference with proteins involved in the cellular response to DNA damage, the deregulation of cell growth as well as resistance to apoptosis appears to be involved in cadmium-induced carcinogenicity. Within this context, cadmium has been shown to disturb nucleotide excision repair, base excision repair, and mismatch repair. Particularly sensitive targets appear to be proteins with zinc-binding structures, present in DNA repair proteins such as XPA, PARP-1 as well as in the tumor suppressor protein p53. Whether or not these interactions are due to displacement of zinc or due to reactions with thiol groups involved in zinc complexation or in other critical positions under realistic exposure conditions remains to be elucidated. Further potential mechanisms relate to the interference with cellular redox regulation, either by enhanced generation of ROS or by reaction with thiol groups involved in the regulation of signaling pathways. Particularly the combination of these multiple mechanisms may give rise to a high degree of genomic instability evident in cadmium-adapted cells, relevant not only for tumor initiation, but also for later steps in tumor development.

  12. 7 CFR 946.122 - Reports. (United States)


    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Rules and Regulations Special Purpose Certificates § 946.122 Reports. Each handler shipping potatoes under and pursuant to a special purpose certificate shall supply to the committee, upon request,...

  13. 7 CFR 12.2 - Definitions. (United States)


    ... the Secretary of Agriculture HIGHLY ERODIBLE LAND AND WETLAND CONSERVATION General Provisions § 12.2... corporation within USDA organized under the provisions of 15 U.S.C. 714 et seq. Conservation District (CD... and implement soil and water conservation activities or programs. Conservation plan means the...

  14. 19 CFR 122.182 - Security provisions. (United States)


    ... demand an approved access seal issued by Customs. The approved Customs access seal must be in the... this section or upon demand by any authorized Customs officer for any cause referred to in § 122.187(a... will inform the applicant of the current Federal Bureau of Investigation user fee for...

  15. Cadmium in Sweden - environmental risks

    Energy Technology Data Exchange (ETDEWEB)

    Parkman, H.; Iverfeldt, Aa. [Swedish Environmental Research Inst. (Sweden); Borg, H.; Lithner, G. [Stockholm Univ. (Sweden). Inst. for Applied Environmental Research


    This report aims at assessing possible effects of cadmium in the Swedish environment. Swedish soils and soft freshwater systems are, due to a generally poor buffering capacity, severely affected by acidification. In addition, the low salinity in the Baltic Sea imply a naturally poor organism structure, with some important organisms living close to their limit of physiological tolerance. Cadmium in soils is mobilized at low pH, and the availability and toxicity of cadmium in marine systems are enhanced at low salinity. The Swedish environment is therefore extra vulnerable to cadmium pollution. The average concentrations of cadmium in the forest mor layers, agricultural soils, and fresh-waters in Sweden are enhanced compared to `back-ground concentrations`, with a general increasing trend from the north to the south-west, indicating strong impact of atmospheric deposition of cadmium originating from the central parts of Europe. In Swedish sea water, total cadmium concentrations, and the fraction of bio-available `free` cadmium, generally increases with decreasing salinity. Decreased emissions of cadmium to the environment have led to decreasing atmospheric deposition during the last decade. The net accumulation of cadmium in the forest mor layer has stopped, and even started to decrease. In northern Sweden, this is due to the decreased deposition, but in southern Sweden the main reason is increased leakage of cadmium from the topsoil as a consequence of acidification. As a result, cadmium in the Swedish environments is undergoing an extended redistribution between different soil compartments, and from the soils to the aquatic systems. 90 refs, 23 figs, 2 tabs. With 3 page summary in Swedish

  16. Renal cadmium overload without nephrotoxicity.



    A redundant nickel/cadmium battery worker was investigated for non-specific fatigue after completing five years in the industry. Sensitive techniques for in-vivo organ cadmium measurement showed a moderate accumulation in the liver but a very large concentration in the kidneys. Despite this, overall glomerular and tubular function were not impaired. It was concluded that the mechanism of proteinuria observed in some cadmium workers is obscure and not clearly related to the degree of kidney sa...


    Directory of Open Access Journals (Sweden)

    Henryka Langauer-Lewowicka


    Full Text Available The paper presents some information about current status of cadmium as an environmental health problem. Agricultural uses of phosphate fertilizers, sewage sludge and industrial uses of Cd are the major source of widespread of this metal at trace levels into the general environment and human foodstuffs. It is well known that high cadmium (Cd exposure causes renal damage, anemia, enteropathy, osteoporosis, osteomalacia, whereas the dose-response relationship at low levels exposure is less established. During the last decade an increasing number of studies have found an adverse health effects due to low environmental exposure to Cd. Many authors try to determine the relationship between Cd intake and Cd toxicity indicators, especially dealing renal tubular damage. The level of b2-microglobulin in urine is regarded as the most sensitive biomarker of renal disfunction due to low environmental Cd concentrations.

  18. Speciation of Dissolved Cadmium

    DEFF Research Database (Denmark)

    Holm, Peter Engelund; Andersen, Sjur; Christensen, Thomas Højlund


    Equilibrium dialysis and ion exchange methods, as well as computer calculations (GEOCHEM), were applied for speciation of dissolved cadmium (Cd) in test solutions and leachate samples. The leachate samples originated from soil, compost, landfill waste and industrial waste. The ion exchange (IE...... leachates showed different Cd speciation patterns as expected. Some leachates were dominated by free divalent Cd (1-70%), some by inorganic complexes (1-87%), and some by organic complexes (7-98%)....

  19. Deaths in 122 U.S. cities - 1962-2016. 122 Cities Mortality Reporting System (United States)

    U.S. Department of Health & Human Services — This file contains the complete set of data reported to 122 Cities Mortality Reposting System. The system was retired as of 10/6/2016. While the system was running...

  20. Is cadmium hazardous to health. Cadmium - ein Gesundheitsrisiko

    Energy Technology Data Exchange (ETDEWEB)

    Zartner-Nyilas, G.; Valentin, H.; Schaller, K.H.; Schiele, R.


    This study entitled ''Is cadmium hazardous to health'' summarizes the current state of knowledge on and experience with cadmium. The authors have made efforts to take into account the more recent literature relating to cadmium. The data evaluated were, especially, biological, toxicological, and epidemiological ones. A principal object was to try to assess the importance of the presence of cadmium in the environment to man. The interest was focused on the uptake of heavy metals with food, danger thresholds for the cadmium exposure of the population, nature and extent of eventual damage to health including possible carcinogenous effects, and suggestions for further points of main emphasis in research. 3 figs., 12 tabs.

  1. (120) and (122-bar) monazite deformation twins

    Energy Technology Data Exchange (ETDEWEB)

    Hay, R.S


    Unusual features of (120) and (122-bar) deformation twins in monazite (monoclinic LaPO{sub 4}) are described and analyzed. These features are kinks and other irregularities in (120) twins, and V-shaped indentations on (120) and (122-bar) twin planes. Twinning shear analysis suggests that the kinks are a type II deformation twin mode with shear direction ({eta}{sub 1}) of [21-bar0]. This complements previous analysis based on atom shuffling considerations. Shear strain compatibility requires extensive plastic deformation in the kink. The V-shaped indentations may be analogous to similar structures in b.c.c metal deformation twins. Deformation mechanisms that may be associated with these structures are discussed.

  2. 19 CFR 122.26 - Entry and clearance. (United States)


    ... AIR COMMERCE REGULATIONS Private Aircraft § 122.26 Entry and clearance. Private aircraft, as defined... information as set forth in § 122.22(c), and grants electronic clearance via electronic mail or telephone....

  3. 1 CFR 12.2 - Code of Federal Regulations. (United States)


    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Code of Federal Regulations. 12.2 Section 12.2... REGISTER PUBLICATIONS OFFICIAL DISTRIBUTION WITHIN FEDERAL GOVERNMENT § 12.2 Code of Federal Regulations. (a) Copies of the Code of Federal Regulations in paper or microfiche form shall be made available...

  4. 19 CFR 122.86 - Substitution of aircraft. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Substitution of aircraft. 122.86 Section 122.86 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Procedures for Residue Cargo and Stopover Passengers § 122.86 Substitution of aircraft. (a) Application. The...

  5. 32 CFR 724.122 - Recorder, NDRB Panel. (United States)


    ... 32 National Defense 5 2010-07-01 2010-07-01 false Recorder, NDRB Panel. 724.122 Section 724.122 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Definitions § 724.122 Recorder, NDRB Panel. A panel member responsible for briefing an...

  6. 19 CFR 122.5 - Reproduction of Customs forms. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Reproduction of Customs forms. 122.5 Section 122.5 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS General Definitions and Provisions § 122.5 Reproduction of Customs...

  7. 19 CFR 122.30 - Other Customs laws and regulations. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Other Customs laws and regulations. 122.30 Section 122.30 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Private Aircraft § 122.30 Other Customs laws and...

  8. 19 CFR 122.2 - Other Customs laws and regulations. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Other Customs laws and regulations. 122.2 Section 122.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS General Definitions and Provisions § 122.2 Other...

  9. 19 CFR 122.181 - Definition of Customs security area. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Definition of Customs security area. 122.181 Section 122.181 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Access to Customs Security Areas § 122.181 Definition...

  10. 19 CFR 122.4 - English language required. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false English language required. 122.4 Section 122.4... TREASURY AIR COMMERCE REGULATIONS General Definitions and Provisions § 122.4 English language required. A translation in the English language shall be attached to the original and each copy of any form or...

  11. 46 CFR 122.360 - Use of auto pilot. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Use of auto pilot. 122.360 Section 122.360 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE THAN 150... Requirements § 122.360 Use of auto pilot. Whenever an automatic pilot is used the master shall ensure that:...

  12. 46 CFR 122.340 - Vessels carrying vehicles. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Vessels carrying vehicles. 122.340 Section 122.340... Miscellaneous Operating Requirements § 122.340 Vessels carrying vehicles. (a) Automobiles or other vehicles must... vehicles freely in the event of fire or other disaster. The decks, where necessary, must be...

  13. 39 CFR 122.2 - Stand-alone special services. (United States)


    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Stand-alone special services. 122.2 Section 122.2 Postal Service UNITED STATES POSTAL SERVICE POST OFFICE SERVICES SERVICE STANDARDS FOR MARKET-DOMINANT SPECIAL SERVICES PRODUCTS § 122.2 Stand-alone special services. (a) The service standard for P. O....

  14. 42 CFR 483.122 - FFP for NF services. (United States)


    ... 42 Public Health 5 2010-10-01 2010-10-01 false FFP for NF services. 483.122 Section 483.122 Public... Annual Review of Mentally Ill and Mentally Retarded Individuals § 483.122 FFP for NF services. (a) Basic...(e)(7)(E) of the Act, FFP is available in State expenditures for NF services provided to a...

  15. 19 CFR 122.115 - Labeling of cargo. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Labeling of cargo. 122.115 Section 122.115 Customs... AIR COMMERCE REGULATIONS Transit Air Cargo Manifest (TACM) Procedures § 122.115 Labeling of cargo. A warning label, as required by § 18.4(e) of this chapter, shall be attached to all transit air cargo...

  16. 19 CFR 122.11 - Designation as international airport. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Designation as international airport. 122.11...; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Classes of Airports § 122.11 Designation as international airport. (a) Procedure. International airports, as defined in § 122.1(e), will be designated after...

  17. 19 CFR 122.14 - Landing rights airport. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Landing rights airport. 122.14 Section 122.14... TREASURY AIR COMMERCE REGULATIONS Classes of Airports § 122.14 Landing rights airport. (a) Permission to land. Permission to land at a landing rights airport may be given as follows: (1) Scheduled flight....

  18. TABLE III. Deaths in 122 U.S. cities (United States)

    U.S. Department of Health & Human Services — TABLE III. Deaths in 122 U.S. cities – 2016. 122 Cities Mortality Reporting System — Each week, the vital statistics offices of 122 cities across the United...

  19. 46 CFR 122.704 - Maintenance of falls. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Maintenance of falls. 122.704 Section 122.704 Shipping..., Maintenance, and Inspection of Lifesaving Equipment § 122.704 Maintenance of falls. (a) Each fall used in a... fall must be renewed when necessary due to deterioration or at internals of not more than 5...

  20. 46 CFR 122.208 - Accidents to machinery. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Accidents to machinery. 122.208 Section 122.208 Shipping... Voyage Records § 122.208 Accidents to machinery. The owner, managing operator, or master shall report damage to a boiler, unfired pressure vessel, or machinery that renders further use of the item...

  1. Cadmium exposure in the Swedish environment

    Energy Technology Data Exchange (ETDEWEB)



    This report gives a thorough description of cadmium in the Swedish environment. It comprises three parts: Cadmium in Sweden - environmental risks;, Cadmium in goods - contribution to environmental exposure;, and Cadmium in fertilizers, soil, crops and foods - the Swedish situation. Separate abstracts have been prepared for all three parts

  2. Cadmium carcinogenesis – some key points



    The article presents briefly the main mechanisms of cadmium carcinogenesis and the most important sites of cancer (lung, breast, prostate, testes, kidney) induced by cadmium. In spite of some evidence showing carcinogenic potential of cadmium, further research is still required to elucidate the relative contributions of various molecular mechanisms involved in cadmium carcinogenesis

  3. Cadmium carcinogenesis – some key points

    Directory of Open Access Journals (Sweden)

    Loreta Strumylaite


    Full Text Available The article presents briefly the main mechanisms of cadmium carcinogenesis and the most important sites of cancer (lung, breast, prostate, testes, kidney induced by cadmium. In spite of some evidence showing carcinogenic potential of cadmium, further research is still required to elucidate the relative contributions of various molecular mechanisms involved in cadmium carcinogenesis

  4. Cadmium immobilization by hydroxyapatite

    Directory of Open Access Journals (Sweden)

    Smičiklas Ivana D.


    Full Text Available The contamination of air, soil and water by cadmium is a great environmental problem. If cadmium occurs in nature in ionic form, soluble in water, it easily enters into the food chain. Hydroxyapatite (HAP, Ca-o(POAe(OH2 is a sparingly soluble salt and an excellent matrix for the removal of heavy metals from solutions. Considerable research attention has been paid to the bond between Cc/2+ ions and synthetic hydroxyapatite of known composition. The sorption mechanism is complex. The dominant process is ion exchange, but surface adsorption, surface complexation and coprecipitation can also contribute to the overall mechanism. The sorption capacity depends on the characteristics of hydroxyapatite itself and on the experimental conditions. Under optimum conditions a maximum capacity of 0.8 mol Cd2+/mol HAP can be achieved. HAP is a potential sorbent for the remediation of contaminated water and soil, for industrial waste treatment, and it is also referenced as a material that can be used as a barrier around waste depositories.

  5. Lead and cadmium in meat and meat products consumed by the population in Tenerife Island, Spain. (United States)

    González-Weller, D; Karlsson, L; Caballero, A; Hernández, F; Gutiérrez, A; González-Iglesias, T; Marino, M; Hardisson, A


    The aim of this study was to determine the levels of lead and cadmium in chicken, pork, beef, lamb and turkey samples (both meat and meat products), collected in the island of Tenerife (Spain). Lead and cadmium were measured by graphite furnace atomic absorption spectrometry (GFAAS). Mean concentrations of lead and cadmium were 6.94 and 1.68 microg kg(-1) in chicken meat, 5.00 and 5.49 microg kg(-1) in pork meat, 1.91 and 1.90 microg kg(-1) in beef meat and 1.35 and 1.22 microg kg(-1) in lamb meat samples, respectively. Lead was below the detection limit in turkey samples and mean cadmium concentration was 5.49 microg kg(-1). Mean concentrations of lead and cadmium in chicken meat product samples were 3.16 and 4.15 microg kg(-1), 4.89 and 6.50 microg kg(-1) in pork meat product, 6.72 and 4.76 microg kg(-1) in beef meat product and 9.12 and 5.98 microg kg(-1) in turkey meat product samples, respectively. The percentage contribution of the two considered metals to provisional tolerable weekly intake (PTWI) was calculated for meat and meat products. Statistically significant differences were found for lead content in meats between the chicken and pork groups and the turkey and beef groups, whereas for cadmium concentrations in meats, significant differences were observed between the turkey and chicken, beef and lamb groups. In meat products, no clear differences were observed for lead and cadmium between the various groups.

  6. Cadmium effects on the thyroid gland. (United States)

    Jancic, Snezana A; Stosic, Bojan Z


    Cadmium has been listed as one of the 126 priority pollutants and a category I carcinogen. Carcinogenic effects of cadmium on the lungs, testicles, and prostate are widely recognized, but there has been insufficient research on the effect of cadmium on the thyroid gland. Cadmium has the affinity to accumulate not only in the liver, kidneys, and pancreas but also in the thyroid gland. It has been established that cadmium blood concentration correlates positively with its accumulation in the thyroid gland. Women of fertile age have higher cadmium blood and urine concentrations than men. In spite of its redox inertia, cadmium brings about oxidative stress and damage to the tissue by indirect mechanisms. Mitochondria are considered to be the main intracellular targets for cadmium. Colloid cystic goiter, adenomatoid follicular hyperplasia with low-grade dysplasia and thyroglobulin hypo- and asecretion, and parafollicular cell diffuse and nodular hyperplasia and hypertrophy are often found in chronic cadmium toxicity.

  7. Enrichment of cadmium in biomasses

    Energy Technology Data Exchange (ETDEWEB)

    Gwenner, C.; Wittig, H.; Glombitza, F.


    The uptake of cadmium ions from an aqueous solution by living, resting, and dead biomasses was investigated. The dependence of the uptaked amounts on pH-value of the medium, temperature and concentration of cadmium ions is demonstrated as well as the rate of uptake. Maximum realisable concentrations were 12 mg/g biomass in living cells and about 20 mg/g biomass in resting or dead cells, respectively.

  8. 40 CFR Appendix J to Part 122 - NPDES Permit Testing Requirements for Publicly Owned Treatment Works (§ 122.21(j)) (United States)


    ... Publicly Owned Treatment Works (§ 122.21(j)) J Appendix J to Part 122 Protection of Environment... POLLUTANT DISCHARGE ELIMINATION SYSTEM Pt. 122, App. J Appendix J to Part 122—NPDES Permit Testing Requirements for Publicly Owned Treatment Works (§ 122.21(j)) Table 1A—Effluent Parameters for All...

  9. [Severe parachuting accident. Analysis of 122 cases]. (United States)

    Krauss, U; Mischkowsky, T


    Based on a population of 122 severely injured patients the causes of paragliding accidents and the patterns of injury are analyzed. A questionnaire is used to establish a sport-specific profile for the paragliding pilot. The lower limbs (55.7%) and the lower parts of the spine (45.9%) are the most frequently injured parts of the body. There is a high risk of multiple injuries after a single accident because of the tremendous axial power. The standard of equipment is good in over 90% of the cases. Insufficient training and failure to take account of geographical and meteorological conditions are the main determinants of accidents sustained by paragliders, most of whom are young. Nevertheless, 80% of our patients want to continue paragliding. Finally some advice is given on how to prevent paragliding accidents and injuries.

  10. Transition probabilities in the (5) candidate 122Ba

    CERN Document Server

    Bizzeti, P G; Tonev, D; Giannatiempo, A; Ur, C A; Dewald, A; Melon, B; Michelagnoli, C; Petkov, P; Bazzacco, D; Costin, A; de Angelis, G; Della Vedova, F; Fantuzi, M; Farnea, E; Fransen, C; Gadea, A; Lenzi, S; Lunardi, S; Marginean, N; Marginean, R; Menegazzo, R; Mengoni, D; Moeller, O; Nannini, A; Napoli, D R; Nespolo, M; Pavan, P; Perego, A; Petrache, C M; Pietralla, N; Alvarez, C Rossi; Sona, P


    To investigate the possible X(5) character of 122Ba, suggested by the ground state band energy pattern, the lifetimes of the lowest yrast states of 122Ba have been measured, via the Recoil Distance Doppler-Shift method. The relevant levels have been populated by using the 108Cd(16O,2n)122Ba and the Sn(13C,3n)122Ba reactions. The B(E2) values deduced in the present work are compared to the predictions of the X(5) model and to calculations performed in the framework of the IBA-1 and IBA-2 models.

  11. Zinc-induced protection against cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Early, J.L.; Schnell, R.C.


    Pretreatment of male rats with cadmium acetate potentiates the duration of hexobarbital hypnosis and inhibits the rate of hepatic microsomal drug metabolism. Pretreatment of rats with zinc acetate protects against these alterations in drug action elicited by cadmium.

  12. Metallothionein and bioaccumulation of cadmium in juvenile bluegills exposed to aqueous and sediment-associated cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Cope, W.G.


    The author evaluated metallothionein (MT), free (unbound) hepatic cadmium and whole body cadmium as indicators of cadmium exposure in juvenile bluegills Lepomis macrochirus in laboratory tests. Two types of cadmium exposure were tested; aqueous and sediment-associated. In the aqueous tests, fish were exposed to cadmium (0.0 to 32.3 [mu]g/L) in an intermittent-flow diluter. In the sediment-associated cadmium test, fish were exposed to resuspended river sidment containing 1.3 to 21.4 [mu]g Cd/g (dry weight) at a nominal total suspended solids concentration of 1,000 mg/L in revolving, circular glass exposure chambers. Total cadmium concentrations were measured in various bluegill liver fractions, whole bluegill, water, and resuspended sediment to assess the partitioning and bioaccumulation of cadmium after the tests. Mean concentrations of MT and free cadmium in bluegill livers and concentrations of cadmium in whole bluegills were positively correlated with aqueous cadmium concentration and were equally suitable as indicators of aqueous cadmium exposure. Sediment-associated cadmium was biologically available, but to a lesser extent than aqueous cadmium. Cadmium concentrations in whole bluegills exposed to resuspended river sediment were 1.5- to 3.5-fold the concentrations in bluegills in sediment-free controls. Free cadmium and MT concentrations in bluegill liver and whole-body cadmium concentrations in bluegills were positively correlated with the cadmium concentrations in filtered water, resuspended sediment, and bulk river sediment; however, whole-body cadmim concentrations were a more sensitive indicator of exposure to sediment-associated cadmium than either free cadmium or MT concentratons in liver.

  13. Bioavailability of cadmium from linseed and cocoa

    DEFF Research Database (Denmark)

    Hansen, Max; Sloth, Jens Jørgen; Rasmussen, Rie Romme

    In Denmark and EU the exposure of cadmium from food is at a level that is relatively close to the Tolerable Daily Intake (TDI). This report describes an investigation of the bioavailability of cadmium in selected food items known to contain high levels of cadmium. The purpose was to provide data ...... or crushed linseed nor the intake of cocoa and chocolate....

  14. Arsenic, Cadmium, Lead, and Mercury in Sweat: A Systematic Review

    Directory of Open Access Journals (Sweden)

    Margaret E. Sears


    Full Text Available Arsenic, cadmium, lead, and mercury exposures are ubiquitous. These toxic elements have no physiological benefits, engendering interest in minimizing body burden. The physiological process of sweating has long been regarded as “cleansing” and of low risk. Reports of toxicant levels in sweat were sought in Medline, Embase, Toxline, Biosis, and AMED as well as reference lists and grey literature, from inception to March 22, 2011. Of 122 records identified, 24 were included in evidence synthesis. Populations, and sweat collection methods and concentrations varied widely. In individuals with higher exposure or body burden, sweat generally exceeded plasma or urine concentrations, and dermal could match or surpass urinary daily excretion. Arsenic dermal excretion was severalfold higher in arsenic-exposed individuals than in unexposed controls. Cadmium was more concentrated in sweat than in blood plasma. Sweat lead was associated with high-molecular-weight molecules, and in an interventional study, levels were higher with endurance compared with intensive exercise. Mercury levels normalized with repeated saunas in a case report. Sweating deserves consideration for toxic element detoxification. Research including appropriately sized trials is needed to establish safe, effective therapeutic protocols.

  15. 36 CFR 12.2 - Purpose of National Cemeteries. (United States)


    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Purpose of National Cemeteries. 12.2 Section 12.2 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE... United States. Such areas are protected, managed and administered as suitable and dignified...

  16. TABLE III. Deaths in 122 U.S. cities (United States)

    U.S. Department of Health & Human Services — TABLE III. Deaths in 122 U.S. cities - 2015122 Cities Mortality Reporting System ��� Each week, the vital statistics offices of 122 cities across the United...

  17. 19 CFR 122.157 - Documents required for clearance. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Documents required for clearance. 122.157 Section 122.157 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT... clearance. As a condition precedent to clearance, the aircraft commander shall present to Customs: (a)...

  18. 21 CFR 139.122 - Enriched nonfat milk macaroni products. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Enriched nonfat milk macaroni products. 139.122... Macaroni and Noodle Products § 139.122 Enriched nonfat milk macaroni products. (a) Each of the enriched macaroni products made with nonfat milk for which a definition and standard of identity is prescribed...

  19. 9 CFR 122.4 - Suspension or revocation of permits. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Suspension or revocation of permits. 122.4 Section 122.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ORGANISMS...

  20. 28 CFR 0.122 - Office on Violence Against Women. (United States)


    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Office on Violence Against Women. 0.122...-Office on Violence Against Women § 0.122 Office on Violence Against Women. (a) The Director, Office on Violence Against Women, under the general authority of the Attorney General, shall: (1) Exercise the......

  1. 46 CFR 122.608 - Fuel shutoff valves. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Fuel shutoff valves. 122.608 Section 122.608 Shipping....608 Fuel shutoff valves. Remote fuel shutoff stations must be marked in clearly legible letters at least 25 millimeters (1 inch) high indicating purpose of the valve and direction of operations....

  2. 9 CFR 122.3 - Application for permits. (United States)


    ... 122.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ORGANISMS AND VECTORS § 122... use to which each will be put. (Approved by the Office of Management and Budget under control...

  3. 47 CFR 76.122 - Satellite network non-duplication. (United States)


    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Satellite network non-duplication. 76.122... MULTICHANNEL VIDEO AND CABLE TELEVISION SERVICE Network Non-duplication Protection, Syndicated Exclusivity and Sports Blackout § 76.122 Satellite network non-duplication. (a) Upon receiving notification pursuant...

  4. 40 CFR 1065.122 - Engine cooling and lubrication. (United States)


    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Engine cooling and lubrication. 1065.122 Section 1065.122 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... lubrication. (a) Engine cooling. Cool the engine during testing so its intake-air, oil, coolant, block,...

  5. 38 CFR 39.122 - Inspections, audits, and reports. (United States)


    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Inspections, audits, and reports. 39.122 Section 39.122 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS... Single Audit Act of 1984 (see part 41 of this chapter). (b) A State will make an annual report on VA...

  6. 7 CFR 955.122 - Change in nomination deadlines. (United States)


    ... position as alternate of the Committee which is vacant, or about to become vacant. Such nominations shall... 7 Agriculture 8 2010-01-01 2010-01-01 false Change in nomination deadlines. 955.122 Section 955... ONIONS GROWN IN GEORGIA Rules and Regulations § 955.122 Change in nomination deadlines. Pursuant to §...

  7. 40 CFR 122.49 - Considerations under Federal law. (United States)


    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Considerations under Federal law. 122... Conditions § 122.49 Considerations under Federal law. The following is a list of Federal laws that may apply... must be followed. When the applicable law requires consideration or adoption of particular...

  8. 50 CFR 14.122 - Food and water. (United States)


    ... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Food and water. 14.122 Section 14.122... water. (a) A nonhuman primate shall be provided water suitable for drinking within 4 hours prior to... carrier shall provide suitable drinking water to any primate at least every 12 hours after acceptance...

  9. 29 CFR 780.122 - Activities relating to race horses. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Activities relating to race horses. 780.122 Section 780.122... Activities relating to race horses. Employees engaged in the breeding, raising, and training of horses on..., employees engaged in the racing, training, and care of horses and other activities performed off the farm...

  10. 19 CFR 122.12 - Operation of international airports. (United States)


    ... Administration in 14 CFR part 91. (2) Customs and Border Protection. CBP, based on security or other risk... 19 Customs Duties 1 2010-04-01 2010-04-01 false Operation of international airports. 122.12...; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Classes of Airports § 122.12 Operation of...

  11. 19 CFR 122.48 - Air cargo manifest. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Air cargo manifest. 122.48 Section 122.48 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Entry and Entry Documents; Electronic Manifest Requirements...

  12. 19 CFR 122.74 - Incomplete (pro forma) manifest. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Incomplete (pro forma) manifest. 122.74 Section 122.74 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT...; Electronic Manifest Requirements for Passengers, Crew Members, and Non-Crew Members Onboard...

  13. 19 CFR 122.46 - Crew purchase list. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Crew purchase list. 122.46 Section 122.46 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Entry and Entry Documents; Electronic Manifest Requirements...

  14. 19 CFR 122.80 - Verification of statement. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Verification of statement. 122.80 Section 122.80 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Documents Required for Clearance and Permission To Depart;...

  15. 19 CFR 122.41 - Aircraft required to enter. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Aircraft required to enter. 122.41 Section 122.41 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Entry and Entry Documents; Electronic Manifest Requirements...

  16. 19 CFR 122.44 - Crew baggage declaration. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Crew baggage declaration. 122.44 Section 122.44 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Entry and Entry Documents; Electronic Manifest Requirements...

  17. 27 CFR 9.122 - Western Connecticut Highlands. (United States)


    ... Highlands. 9.122 Section 9.122 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... (Litchfield-Hartford-New Haven County line); (6) The boundary then travels approximately 7 miles west along the Litchfield-New Haven County line to Connecticut Route #8 at Waterville in the Town of...

  18. CD 122 - Bread wheat, suitable for cultivation across southern Brazil

    Directory of Open Access Journals (Sweden)

    Francisco de Assis Franco


    Full Text Available The cultivar CD 122 was tested in the wheat-producing regions VCU 1, 2 and 3, with an average grain yield of 3,527 kg ha-1 when fungicide-treated, exceeding the average of the control cultivars by 5%. CD 122 is resistant to leaf rust and was classified as bread wheat.

  19. 19 CFR 122.156 - Release of passengers. (United States)


    ... Service or by a Customs officer acting on behalf of that agency. ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Release of passengers. 122.156 Section 122.156 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF...

  20. Oral cadmium chloride intoxication in mice

    DEFF Research Database (Denmark)

    Andersen, O; Nielsen, J B; Svendsen, P


    Diethyldithiocarbamate (DDC) is known to alleviate acute toxicity due to injection of cadmium salts. However, when cadmium chloride was administered by the oral route, DDC enhanced rather than alleviated the acute toxicity; both oral and intraperitoneal (i.p.) administration of DDC had this effect....... Thus, orally administered DDC enhanced cadmium-induced duodenal and ileal tissue damage and inhibition of peristalsis, as indicated by an increased intestinal transit time. At low cadmium doses, the whole-body retention of cadmium was increased by oral DDC administration. Intraperitoneally administered...

  1. Arsenic-cadmium interaction in rats. (United States)

    Díaz-Barriga, F; Llamas, E; Mejía, J J; Carrizales, L; Santoyo, M E; Vega-Vega, L; Yáñez, L


    Simultaneous exposure to cadmium and arsenic is highly probable in the urban area of San Luis Potosi, Mexico due to common localization of copper and zinc smelters. Therefore, in this work, rats were intraperitoneally exposed either to cadmium or arsenic alone, or simultaneously to both metals. The effects of these treatments on three different toxicological parameters were studied. Cadmium modified the LD50 of arsenic and conversely arsenic modified the LD50 for cadmium. At the histopathological level, arsenic appeared to protect against the cadmium effects, especially on testes. This protective effect seemed to be related to the glutathione levels found in this tissue: rats exposed to both arsenic and cadmium, presented glutathione values intermediate to those observed after exposure to either metal alone; arsenic had the highest value and cadmium the lowest. In liver, rats exposed to arsenic, cadmium or arsenic and cadmium, presented glutathione values below those in the saline group, with the lowest value corresponding to the arsenic and cadmium treatment. The results appear to support the proposed interaction between arsenic and cadmium and coexposure to both metals seems to alter certain effects produced by either metal alone.

  2. Insulin Expression in Rats Exposed to Cadmium

    Institute of Scientific and Technical Information of China (English)


    Objectives To investigate the effects of cadmium exposure on insulin expression in rats. Methods Eighteen adult SD assessed. The levels of cadmium and zinc in pancreas, blood and urine glucose, serum insulin and urine NAG (N-acyetyl-β-glucosaminidase) were determined. The gene expressions of metallothionein (MT) and insulin were also measured,and the oral glucose tolerance tests (OGTT) were carried out. Results The contents of cadmium in pancreas in cadmium-treated rats were higher than that in the control group, which was associated with slight increase of zinc in pancreas.not change significantly after cadmium administration, and the UNAG had no change in Cd-treated group. The gene expression the change of the expression of insulin, MT-Ⅰ and MT-Ⅱ genes. Cadmium can influence the biosynthesis of insulin, but does not induce the release of insulin. The dysfunction of pancreas occurs earlier than that of kidney after administration of cadmium.

  3. A 122 GHz SiGe active subharmonic mixer



    A 122 GHz subharmonic mixer for a radar-based sensor has been realized.It is fabricated in SiGe: C-HBT technology with a transit frequency of about 200 GHz. The conversion gain of the mixer is 23 dB at aLO-frequency of 60GHz with +3 dBm of power and a RF-input of 122.5GHz.The measured SSB noise figure at 122.5GHz is 12 dB.

  4. Modulation of cadmium bioaccumulation and enhancing cadmium tolerance in Pichia kudriavzevii by sodium chloride preincubation. (United States)

    Ma, Ning; Li, Chunsheng; Zhang, Dandan; Yu, Jinzhi; Xu, Ying


    Application of growing microorganisms for cadmium removal is limited by the sensitivity of living cells to cadmium. The effects of sodium chloride (NaCl) preincubation on the cadmium bioaccumulation and tolerance of Pichia kudriavzevii and Saccharomyces cerevisiae were investigated in this study. NaCl preincubation significantly reduced the intracellular and cell-surface cadmium bioaccumulation of P. kudriavzevii at both 6 and 20 mg L(-1) cadmium, while no obvious effect was observed in S. cerevisiae except that the intracellular cadmium bioaccumulation at 20 mg L(-1) cadmium was reduced obviously by 20-60 g L(-1)  NaCl. For both yeasts, the improved contents of protein and proline after NaCl preincubation contributed to the cadmium tolerance. The thiol contents in P. kudriavzevii under cadmium stress were alleviated by NaCl preincubation, which might be due to the decrease of intracellular cadmium bioaccumulation. NaCl preincubation enhanced the contents of glycerol and trehalose in P. kudriavzevii under cadmium stress, while no acceleration was observed in S. cerevisiae. The results suggested that NaCl preincubation could be applied in cadmium removal by growing P. kudriavzevii to increase the cadmium tolerance of the yeast.

  5. 46 CFR 122.202 - Notice of marine casualty. (United States)


    ... Administration (OSHA) in 29 Code of Federal Regulations (CFR) part 1904. (c) Notice given as required by § 122... condition before the occurrence, but does not include the cost of salvage, cleaning, gas freeing,...

  6. Bioaccumulation of cadmium by growing Zygosaccharomyces rouxii and Saccharomyces cerevisiae. (United States)

    Li, Chunsheng; Jiang, Wei; Ma, Ning; Zhu, Yinglian; Dong, Xiaoyan; Wang, Dongfeng; Meng, Xianghong; Xu, Ying


    Bioaccumulation via growing cells is a potential technique for heavy metal removal from food materials. The cadmium bioaccumulation characteristics by growing Zygosaccharomyces rouxii and Saccharomyces cerevisiae were investigated. Z. rouxii displayed powerful cadmium removal ability at low cadmium concentrations, which mainly depended on the intracellular cadmium bioaccumulation. The percentage of intracellular cadmium bioaccumulation of both yeasts obviously decreased with the increase of initial biomass and cadmium concentrations. Low pH and elevated concentrations of zinc and copper significantly decreased the intracellular cadmium bioaccumulation of both yeasts but improved the cadmium tolerance and the cell-surface cadmium bioaccumulation of Z. rouxii. Cadmium removal of Z. rouxii was improved by zinc and copper conditionally. Z. rouxii that possessed more powerful cadmium tolerance and removal ability at low pH and high concentration of competing ions can be developed into a potential cadmium removal agent using in complex food environment in future.

  7. Cadmium content of plants as affected by soil cadmium concentration

    Energy Technology Data Exchange (ETDEWEB)

    Lehoczky, E. [Pannon Univ. of Agricultural Sciences, Keszthely (Hungary); Szabados, I.; Marth, P. [Plant Health and Soil Conservation Station, Higany (Hungary)


    Pot experiments were conducted in greenhouse conditions to study the effects of increasing cadmium (Cd) levels on biomass production and Cd contents in corn, (Zea mays L.), garlic (Allium sativum L.), and spinach (Spinacia oleracea L.). Plants were grown in two soil types: Eutric cambisol soil and A gleyic luvisol soil. Spinach proved to be the most sensitive to Cd treatments as its biomass considerably decreased with the increasing Cd levels. Cadmium contents of the three crops increased with increasing levels of Cd applications. Statistical differences were observed in the Cd contents of crops depending on soil type. With the same Cd rates, Cd tissue concentration of test plants grown in the strongly acidic Gleyic luvisol soil were many times higher than that of plants grown in a neutral Eutric cambisol soil. 14 refs., 4 tabs.

  8. Tolerance to cadmium and cadmium-binding ligands in Great Salt Lake brine shrimp (Artemia salina)

    Energy Technology Data Exchange (ETDEWEB)

    Jayasekara, S.; Drown, D.B.; Sharma, R.P.


    Information on the accumulation of cadmium in cytosolic proteins of Great Lake brine shrimp (Artemia salina) was obtained from animals collected directly from the lake and also from animal hatched and maintained in three sublethal concentrations of cadmium (0.5, 2.0, 5.0 ppm) in saltwater aquaria. Brine shrimp growth under these conditions was monitored by measuring body lengths during a 7-day exposure period. Heat-stable, cadmium-binding ligands were isolated and identified by Sephadex G-75 chromatography and atomic absorption spectrophotometry. Cadmium was found to be equally distributed between high and low molecular weight proteins in animals collected from the lake and the 0.5 ppm cadmium group. There was also a slight growth stimulation noted in the 0.5-pm group. Higher cadmium incorporation was noted in low molecular weight fractions with increasing cadmium concentration in the exposure media. Low molecular weight fractions were also found to have high uv absorption characteristics at 250 nm and low absorption at 280 nm. Molecular weight of the cadmium-binding ligands was found to be 11,000 as estimated by the gel filtration method. De novo synthesis of this protein was increased as a function of cadmium concentration in the media. However, slow accumulation of cadmium in other protein fractions was also noticed in higher cadmium exposure groups, suggesting the existence of possible tolerance mechanisms in brine shrimp exposed to suspected acute cadmium concentrations.

  9. Long-term creep strength degradation in T122/P122 steels for USC power plants

    Energy Technology Data Exchange (ETDEWEB)

    Igarashi, M.; Yoshizawa, M. [Corporate Research and Development Laboratories, Hyogo (Japan); Iseda, A. [Tubular Products Technology Department, Tokyo (Japan); Matsuo, H.; Kan, T. [Quality Control and Technical Service Department, Hyogo (Japan)


    Creep rupture and deformation behavior of KA-SUS410J3 type steels (equivalent to ASME P122/T122) with different Cr content and the resultant matrix phases such as {alpha}' (martensite) and {alpha}'+ {delta} (martensite and deltaferrite) has been studied using creep testing and a detailed TEM observation. New allowable tensile stress values of the steels with two different Cr content levels set using the region splitting method in Japan are tabulated. Long-term creep rupture strength, in particular, of the {alpha}'+ {delta} dual phase steel is found to be lower than that expected from the short-term creep testing. Fine grain microstructure is found to enhance the creep deformation at lower stress region and decrease in fine MX and unequal distribution of MX in the ferrite matrix are to be the major causes of the strength degradation in the {alpha}'+ {delta} dual phase steel with the higher Cr content. It is concluded that the heterogeneous creep deformation is much more pronounced at lower stress level in the dual phase steel, which is due to inhomogeneous microstructure consisting of {alpha}'+{delta} phase matrix and the relevant heterogeneous distribution of fine precipitates such as MX and M{sub 23}C{sub 6} in the {delta} ferrite matrix and near the interface between the soft {delta} ferrite and the hard martensite ({alpha}') phases. Homogeneous microstructure is a key for achieving the long-term creep strength in the advanced ferritic steels at elevated temperatures over 600 C. KA-SUS410J2TB steel (designated as HCM12) is found to exhibit a similar creep strength degradation, which is mainly due to a similar microstructure of KA-SUS410J3 type steel with the higher Cr content. (orig.)

  10. Zone refining of cadmium and related characterization

    Indian Academy of Sciences (India)

    N R Munirathnam; D S Prasad; Ch Sudheer; J V Rao; T L Prakash


    We present the zone refining results of cadmium using horizontal resistive zone refiner under constant flow of moisture free hydrogen gas. The boron impurity in cadmium can be avoided using quartz (GE 214 grade) boat in lieu of high pure graphite boat. The analytical results using inductively coupled plasma optical emission spectrometry (ICPOES) show that majority of the impurities are less than the detection limits. Comparatively, zinc is the most difficult impurity element to remove in cadmium matrix by zone refining.

  11. The Epigenetic Effects of Prenatal Cadmium Exposure. (United States)

    Vilahur, Nadia; Vahter, Marie; Broberg, Karin


    Prenatal exposure to the highly toxic and common pollutant cadmium has been associated with adverse effects on child health and development. However, the underlying biological mechanisms of cadmium toxicity remain partially unsolved. Epigenetic disruption due to early cadmium exposure has gained attention as a plausible mode of action, since epigenetic signatures respond to environmental stimuli and the fetus undergoes drastic epigenomic rearrangements during embryogenesis. In the current review, we provide a critical examination of the literature addressing prenatal cadmium exposure and epigenetic effects in human, animal, and in vitro studies. We conducted a PubMed search and obtained eight recent studies addressing this topic, focusing almost exclusively on DNA methylation. These studies provide evidence that cadmium alters epigenetic signatures in the DNA of the placenta and of the newborns, and some studies indicated marked sexual differences for cadmium-related DNA methylation changes. Associations between early cadmium exposure and DNA methylation might reflect interference with de novo DNA methyltransferases. More studies, especially those including environmentally relevant doses, are needed to confirm the toxicoepigenomic effects of prenatal cadmium exposure and how that relates to the observed health effects of cadmium in childhood and later life.

  12. Improvement of cadmium phytoremediation after soil inoculation with a cadmium-resistant Micrococcus sp. (United States)

    Sangthong, Chirawee; Setkit, Kunchaya; Prapagdee, Benjaphorn


    Cadmium-resistant Micrococcus sp. TISTR2221, a plant growth-promoting bacterium, has stimulatory effects on the root lengths of Zea mays L. seedlings under toxic cadmium conditions compared to uninoculated seedlings. The performance of Micrococcus sp. TISTR2221 on promoting growth and cadmium accumulation in Z. mays L. was investigated in a pot experiment. The results indicated that Micrococcus sp. TISTR2221significantly promoted the root length, shoot length, and dry biomass of Z. mays L. transplanted in both uncontaminated and cadmium-contaminated soils. Micrococcus sp. TISTR2221 significantly increased cadmium accumulation in the roots and shoots of Z. mays L. compared to uninoculated plants. At the beginning of the planting period, cadmium accumulated mainly in the shoots. With a prolonged duration of cultivation, cadmium content increased in the roots. As expected, little cadmium was found in maize grains. Soil cadmium was significantly reduced with time, and the highest percentage of cadmium removal was found in the bacterial-inoculated Z. mays L. after transplantation for 6 weeks. We conclude that Micrococcus sp. TISTR2221 is a potent bioaugmenting agent, facilitating cadmium phytoextraction in Z. mays L.

  13. Syntheses and structural characterization of new dithiophosphinato cadmium complexes

    Indian Academy of Sciences (India)

    Ertuğrul Gazi̇ Sağlam; Nurcan Acar; Yasemi̇n Süzen; Berline Mougang-Soumé; Tuncer Hökelek


    New cadmium complexes of 4-methoxyphenyl dithiophosphinic acids, H3CO-C6H4-(R)PS2H were prepared. The five dithiophosphinato ligands (L) involved were of the general structure H3CO-C6H4-(R)PS2−with R= 3-methylbutyl, (L1); n-butyl, (L2); 2-methylpropyl, (L3); 1-methylpropyl, (L4) and 2-propyl, (L5).To the best of our knowledge, this is the first report on the preparation and characterization of the n-butyl-derivative. The acid forms of the ligands were obtained by treatment of the Lawesson reagent, (LR) [2,4-bis(4-methoxyphenyl)-1,3,2,4-dithiadiphosphetane-2,4-disulfide] with the corresponding Grignard reagent in dry diethylether. The acids formed were transformed into easily crystallizable ammonium salts (NH4L) for purification. These salts were treated with CdCl2 in ethanol at room temperature to produce the bis-dithiophosphinato cadmium complexes ([Cd(L)2]2) exclusively. The structures of the complexes were elucidated by elemental analysis, MS, FTIR and Raman spectroscopy techniques as well as 1H-, 13C- and 31P- NMR. The crystal structures of [Cd(L1)2]2 and [Cd(L2)2]2 were also studied as examples. X-ray studies confirmed the nonplanar, four-coordination geometry of the complexes and indicate that electron delocalization prevails in the PS$_{−}^{2}$ moiety of the dithiophosphinato groups.

  14. The Effect of Cadmium on Physiological Indices, Growth Parameters and Nutrient Concentration in Tomato in Soilless Culture

    Directory of Open Access Journals (Sweden)

    Z. Ghasemi


    Full Text Available In order to determine the effects of cadmium on growth, physiological parameters, and nutritional elements’ concentration in tomato organs in a soilless system, an experiment was conducted in greenhouse of Isfahan Agricultural and Natural Resources Research Center in 2008 with a complete randomized block design with two treatments and 6 replications. The treatments were nutritional solutions of Hoagland with and without cadmium (20 µM. The measured indices included: RGR, NAR, RLGR, LAR, SLA, LWR, LWCA, length of the stem, fresh and dry weight of root and shoot, amount of sugar, photosynthetic pigments, and concentration of nitrogen, potassium, phosphorous, calcium, magnesium, iron, zinc, copper, manganese, and cadmium in root, stem, leaves and fruit. The results showed that cadmium (20 µM had significant effects on some measured growth indices. Growth parameters such as RGR, NAR, RLGR, Ls, RDW, RFW, SFW and SDW decreased 13.3, 19.1, 13.3, 18.8, 59.5, 58.7, 53.9 and 65.3%, respectively, and SLA increased 12.2%. But physiological parameters were not significantly affected by cadmium. The Cd concentration in all organs increased except fruit, compared with control which was Cd free. High cadmium concentration had significant effects on concentration of Mn and Cu in the root, Mn and P in the stem and Mn in the leaves. Concentration of Mn increased 5.3 and 87.6% in the leaves and stem, respectively, while it decreased 58.4% in the root. Concentration of P increased 33.3% and Cu increased 2times more in the stem. However, Ca concentration decreased 76.7% in the fruit, compared with the control. In conclusion, it is not recommended to grow tomato in the soils with high Cd concentration (polluted soil because of its negative effects on tomato growth.

  15. Electrodialytic Removal of Cadmium from Straw Ash

    DEFF Research Database (Denmark)

    Hansen, Henrik; Ottosen, Lisbeth M.; Villumsen, Arne;


    A problem with flyash from straw and wood combustion is the high level of heavy metals, especially cadmium. Two electrodialytic remediation experiments were carried out on cadmium polluted flyash from straw combustion. The flyash could be cleaned to 1/3 of its initial level after 24 days...

  16. Cadmium and children : Exposure and health effects

    NARCIS (Netherlands)

    Schoeters, G.; Hond, E. Den; Zuurbier, M.; Naginiene, R.; Hazel, P.J. van den; Stilianakis, N.; Ronchetti, R.; Koppe, J.G.


    Cadmium exposure and accumulation in the body start at young age. Exposure routes in children are mainly via food, environmental tobacco smoke and house dust. Excretion from the body is limited. Cadmium accumulation in the kidney is responsible for effects such as nephrotoxicity and osteoporosis whi

  17. Cadmium and children: exposure and health effects. (United States)

    Schoeters, Greet; Den Hond, Elly; Zuurbier, Moniek; Naginiene, Rima; van den Hazel, Peter; Stilianakis, Nikolaos; Ronchetti, Roberto; Koppe, Janna G


    Cadmium exposure and accumulation in the body start at young age. Exposure routes in children are mainly via food, environmental tobacco smoke and house dust. Excretion from the body is limited. Cadmium accumulation in the kidney is responsible for effects such as nephrotoxicity and osteoporosis which are observed at adult age. Cadmium exposure through inhalation is also associated with lung cancer in adulthood. Although transfer to the neonate through the placenta and through breast milk is limited, teratogenic and developmental effects were observed in experimental animals. The database on human studies involving children is limited, yet effects on motoric and perceptual behaviour in children have been associated with elevated in utero cadmium exposure. In school age children urinary cadmium levels were associated with immune suppressive effects. More studies are needed to confirm these results. Experimental data in vitro and in animals refer to effects of cadmium on the hypothalamus-pituitary axis at different levels. This may lead to disorders of the endocrine and/or immune system. Cadmium exposure at early age should be limited as much as possible to prevent direct effects on children and to prevent accumulation of cadmium which may have serious health effects only becoming manifest at older age.

  18. Immunoassay for Cadmium Detection and Quantification

    Institute of Scientific and Technical Information of China (English)



    Objective To detect cadmium in environmental and food samples by graphite furnace atomic absorption spectroscopy (GFAAS) and inductively coupled plasma atomic emission spectroscopy (ICPAES). Methods An indirect competitive enzyme-linked immunosorbent assay (IC-ELISA) was developed based on a cadmium-specific monoclonal antibody.IC-ELISA for cadmium in environmental and food samples was evaluated. Results IC-ELISA showed an IC50 of 45.6 μg/L with a detection limit of 1.95 μg/L for cadmium,and showed a mean recovery ranging 97.67%-107.08%.The coefficient of variations for intra- and iuterassay was 3.41%-6.61% and 4.70%-9.21%,respectively.The correlation coefficient between IC-ELISA and GFAAS was 0.998. Conclusion IC-ELISA can detect and quantify cadmium residue in environmental or food samples.

  19. Cadmium a metalloestrogen: are we convinced? (United States)

    Silva, Nalinda; Peiris-John, Roshini; Wickremasinghe, Rajitha; Senanayake, Hemantha; Sathiakumar, Nalini


    Metalloestrogens are inorganic metal ions that bind to and activate oestrogen receptors. They are implicated in the aetiology of oestrogen-dependent diseases such as cancers of the breast and endometrium as well as endometriosis. Cadmium is one of the most studied metalloestrogens. In this review, scientific evidence for the oestrogenic effects of cadmium is critically evaluated to determine if there is sufficient evidence to support cadmium as an aetiological factor of oestrogen-dependent disease in humans. Results of the review indicated that, although the in vitro and in vivo evidence of the oestrogenic properties of cadmium was persuasive, evidence from population-based human studies remains conflicting. Considerable knowledge gaps exist on the potential oestrogenic effect of cadmium in humans. Research that focuses on bridging these knowledge gaps would be useful in preventing and managing oestrogen-dependent disease in humans.

  20. Rüsselsheim 122 und die Federmessergruppen am Unteren Main


    Loew, Stefan


    Der spätpaläolithische Federmesser-Fundort Rüsselsheim 122 ist ein Siedlungsplatz, der sich über das Vorkommen von Laacher-See-Tephra in den Fundschichten an das Ende der Allerödzeit um 11.000 v. Chr datieren läßt. Rüsselsheim 122 bietet durch seine Variabilität an Rohmaterialien hervorragende Möglichkeiten zur Analyse von räumlichen Fundverteilungen und Siedlungsstrukturen. Über eine Korrespondenzanalyse der Fundquadrate und ihrer Inhalte, kombiniert mit einer Dateninterpolation (Interpolati...

  1. Cadmium mobility and accumulation in soils of the European Communities

    NARCIS (Netherlands)

    Fraters B; van Beurden AUCJ


    In this overview of the effects of cadmium pollution on agricultural soils in the European Community, both the cadmium loads on agricultural land and the soil sensitivity to cadmium accumulation have been estimated. Cadmium loads have been estimated separately for arable land and grassland. The ef

  2. Sealed nickel-cadmium battery

    Energy Technology Data Exchange (ETDEWEB)


    Overcharge protection, and especially the chargeability of a sealed Ni/Cd battery with high currents is improved by rolling a carbon-containing powdered material into the surface of the negative electrode, which material catalyzes the reduction of oxygen. Wetting of the electrode with a Tylose dispersion prior to application of the powder (by powdering, vibration or in an agitator) improves the adhesion of the powder. The cadmium electrode thus prepared combines in itself the functions of a negative principal electrode and of an auxiliary oxygen electrode.

  3. Speciation of phytate ion in aqueous solution. Cadmium(II) interactions in aqueous NaCl at different ionic strengths

    Energy Technology Data Exchange (ETDEWEB)

    Stefano, Concetta de; Milea, Demetrio; Porcino, Nunziatina; Sammartano, Silvio [Universita di Messina, Dipartimento di Chimica Inorganica, Chimica Analitica e Chimica Fisica, Messina (Italy)


    Interactions between myo-inositol 1,2,3,4,5,6-hexakis(dihydrogen phosphate) (phytic acid) and cadmium(II) were studied by using potentiometry (at 25 C with the ISE-H{sup +} glass electrode) in different metal to ligand (Phy) ratios (1:1{<=}Cd{sup 2+}:Phy{<=}4:1) in NaCl{sub aq} at different ionic strengths (0.1{<=}I/mol L{sup -1}{<=}1). Nine Cd{sub i}H{sub j}Phy{sup (12-2i-j)-} species are formed with i=1 and 2 and 4{<=}j{<=}7; and trinuclear Cd{sub 3}H{sub 4}Phy{sup 2-}. Dependence of complex formation constants on ionic strength was modeled by using Specific ion Interaction Theory (SIT) equations. Phytate and cadmium speciation are also dependent on the metal to ligand ratio. Stability of Cd{sub i}H{sub j}Phy{sup (12-2i-j)-} species was modeled as a function of both the ligand protonation step (j) and the number of metal cations bound to phytate (i), and relationships found were used for the prediction of species other than those experimentally determined (mainly di- and tri-protonated complexes), allowing the possibility of modeling Phy and Cd(II) behavior in natural waters and biological fluids. A critical evaluation of phytate sequestering ability toward cadmium(II) has been made under several experimental conditions, and the determination of an empirical parameter has been proposed for an objective ''quantification'' of this ability. A thorough analysis of literature data on phytate-cadmium(II) complexes has been performed. (orig.)

  4. Hepatitis C virus RNA functionally sequesters miR-122

    DEFF Research Database (Denmark)

    Luna, Joseph M; Scheel, Troels K H; Danino, Tal


    Hepatitis C virus (HCV) uniquely requires the liver-specific microRNA-122 for replication, yet global effects on endogenous miRNA targets during infection are unexplored. Here, high-throughput sequencing and crosslinking immunoprecipitation (HITS-CLIP) experiments of human Argonaute (AGO) during...

  5. 19 CFR 122.94 - Certificate of lading for exportation. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certificate of lading for exportation. 122.94....94 Certificate of lading for exportation. (a) Required filing. This section applies to merchandise entered for transportation and exportation by aircraft. A certificate of lading for exportation and...

  6. 9 CFR 113.122 - Salmonella Choleraesuis Bacterin. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Choleraesuis Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.122 Salmonella Choleraesuis Bacterin. Salmonella Choleraesuis Bacterin shall be prepared from a culture of Salmonella choleraesuis which has been inactivated and...

  7. 7 CFR 1220.122 - Qualified State Soybean Board. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Qualified State Soybean Board. 1220.122 Section 1220... SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE SOYBEAN PROMOTION, RESEARCH, AND CONSUMER INFORMATION Soybean Promotion and Research Order Definitions §...

  8. 19 CFR 122.118 - Exportation from port of arrival. (United States)


    ... copy. (2) Exportation copy. The exportation copy shall be filed by the exporting airline when clearance... aircraft's clearance documents. The exportation and clearance copies shall show the exporting airline's... 19 Customs Duties 1 2010-04-01 2010-04-01 false Exportation from port of arrival. 122.118...

  9. 5 CFR 838.122 - State courts' responsibilities. (United States)


    ... Section 838.122 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE... creditors and the requirements of this part for awarding such benefits; (c) Using the terminology defined in this part only when it intends to use the meaning given to that terminology by this part;...

  10. 5 CFR 550.122 - Computation of night pay differential. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Computation of night pay differential... REGULATIONS PAY ADMINISTRATION (GENERAL) Premium Pay Night Pay § 550.122 Computation of night pay differential. (a) Absence on holidays or in travel status. An employee is entitled to a night pay differential...

  11. 42 CFR 84.122 - Breathing resistance test; minimum requirements. (United States)


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Breathing resistance test; minimum requirements. 84... Masks § 84.122 Breathing resistance test; minimum requirements. (a) Resistance to airflow will be measured in the facepiece or mouthpiece of a gas mask mounted on a breathing machine both before and...

  12. Response of Saccharomyces cerevisiae to cadmium stress

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Luciana Mara Costa; Ribeiro, Frederico Haddad; Neves, Maria Jose [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Lab. de Radiobiologia], e-mail:; Porto, Barbara Abranches Araujo; Amaral, Angela M.; Menezes, Maria Angela B.C. [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Lab. de Ativacao Neutronica], e-mail:; Rosa, Carlos Augusto [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Microbiologia], e-mail: carlrosa@icb.ufmg


    The intensification of industrial activity has been greatly contributing with the increase of heavy metals in the environment. Among these heavy metals, cadmium becomes a serious pervasive environmental pollutant. The cadmium is a heavy metal with no biological function, very toxic and carcinogenic at low concentrations. The toxicity of cadmium and several other metals can be mainly attributed to the multiplicity of coordination complexes and clusters that they can form. Some aspects of the cellular response to cadmium were extensively investigated in the yeast Saccharomyces cerevisiae. The primary site of interaction between many toxic metals and microbial cells is the plasma membrane. Plasma-membrane permeabilisation has been reported in a variety of microorganisms following cadmium exposure, and is considered one mechanism of cadmium toxicity in the yeast. In this work, using the yeast strain S. cerevisiae W303-WT, we have investigated the relationships between Cd uptake and release of cellular metal ions (K{sup +} and Na{sup +}) using neutron activation technique. The neutron activation was an easy, rapid and suitable technique for doing these metal determinations on yeast cells; was observed the change in morphology of the strains during the process of Cd accumulation, these alterations were observed by Transmission Electron Microscopy (TEM) and Scanning Electron Microscopy (SEM) during incorporation of cadmium. (author)

  13. Response of Pleurotus ostreatus to cadmium exposure

    Energy Technology Data Exchange (ETDEWEB)

    Favero, N.; Bressa, G.; Costa, P. (Univ. of Padua (Italy))


    The possibility of utilizing agroindustrial wastes in the production of edible, high-quality products (e.g., mushrooms) implies the risk of bringing toxic substances, such as heavy metals, into the human food chain. Thus, growth in the presence of cadmium and cadmium accumulation limits have been studied in the industrially cultivated fungus P. ostreatus. Fruit body production is substantially unaffected in the presence of 25, 139, and 285 mg Cd/kg of dried substrate. Cadmium concentration in fruit bodies is related to cadmium substrate level, the metal being present at higher levels in caps (22-56 mg/kg dry wt) than in stems (13-36 mg/kg dry wt). Concentration factor (CF), very low in the controls (about 2), further decreases in treated specimens. The presence of a cadmium control mechanism in this fungi species is suggested. Fruit body cadmium levels could, however, represent a risk for P. ostreatus consumers, according to FAO/WHO limits related to weekly cadmium intake.

  14. Interactions of cadmium and zinc during pregnancy

    Energy Technology Data Exchange (ETDEWEB)

    Sorell, T.L.


    The interactions of cadmium exposure and zinc during pregnancy were investigated by studying rats exposed to 0, 5, 50, or 100 ppm cadmium (as CdCl{sub 2}) in the drinking water from day 6 to day 20 of pregnancy. On day 20 of pregnancy, fetuses of rats exposed to 50 and 100 ppm of cadmium were slightly but significantly smaller than those of control animals. Fetal weight was negatively correlated with fetal cadmium concentration and positively correlated with fetal cadmium concentration. Significant fetal cadmium accumulation occurred in both the 50 and 100 ppm cadmium exposure groups; fetal zinc concentrations were decreased. Maternal liver and kidney zinc concentrations were slightly elevated, and the possible role of maternal organ sequestration of available zinc is discussed. The activity of two zinc metalloenzymes, alkaline phosphatase and {delta}-aminolevulinic acid dehydratase, was decreased in maternal and fetal tissues, providing evidence of an alteration in zinc metabolism. In addition, the placental transport of {sup 65}Zn was characterized in control animals and compared to exposed groups; placental zinc transport was significantly decreased in the 50 and 100 ppm exposure groups.

  15. Cadmium inhalation and male reproductive toxicity

    Energy Technology Data Exchange (ETDEWEB)

    Ragan, H.A.; Mast, T.J. (Battelle Pacific Northwest Laboratories, Richland, WA (USA))


    Cadmium is a highly toxic element that is cumulative and has a long biological half-life in mammals. The severe toxicity of cadmium in man has been known for more than 100 years. Despite the knowledge that cadmium is toxic, only 20 human cases of poisoning via ingestion were recorded prior to 1941, whereas in the ensuing five-year period more than 680 cases of cadmium poisonings from accidental oral ingestion of this metal were documented. Some of the recorded effects of exposure to cadmium in laboratory animals include renal tubular damage, placental and testicular necrosis, structural and functional liver damage, osteomalacia, testicular tumors, teratogenic malformations, anemia, hypertension, pulmonary edema, chronic pulmonary emphysema, and induced deficiencies of iron, copper, and zinc. Some of these effects have also been observed in human after accidental exposures to cadmium oxide fumes and are characteristic of the syndrome described in Japan as Itai Itai disease in which ingestion of cadmium is the inciting chemical.134 references.

  16. Use of oxygen consumption and ammonium excretion to evaluate the sublethal toxicity of cadmium and zinc on Litopenaeus schmitti (Burkenroad, 1936, Crustacea). (United States)

    Barbieri, Edison


    Penaeid shrimps are important resources for worldwide fisheries and aquaculture. In Brazil, Litopenaeus schmitti (L. schmitti) is a important commercially exploited species and is an ideal animal for studying the impairment caused by the effects of heavy metals that are often detected in coastal areas. The main purpose of the present study was to detect the acute toxicity of cadmium and zinc to L. schmitti and investigate their effects on oxygen consumption and ammonium excretion, investigations that have not been carried out in this species before. First, the acute toxicity of cadmium and zinc to L. schmitti 24, 48, 72, and 96-hour medium lethal concentration was examined, which resulted in the following values: 0.98, 0.54, 0.32, and 0.18 mg/L for cadmium and 1.64, 1.22, 0.86, and 0.31 mg/L for zinc. Furthermore, we also found that exposure of shrimp to cadmium and zinc caused an inhibition in oxygen consumption of 55.92 and 44.09%, respectively, relative to the control. However, after separate exposure to cadmium and zinc, elevations in ammonium excretion were obtained, which were 174.28 and 162.5% higher than the control, respectively.

  17. [Association between cadmium and breast cancer]. (United States)

    Strumylaite, Loreta; Bogusevicius, Algirdas; Ryselis, Stanislovas; Pranys, Darius; Poskiene, Lina; Kregzdyte, Rima; Abdrachmanovas, Olegas; Asadauskaite, Rūta


    Cadmium is a known human lung carcinogen, although some studies indicate a link between cadmium exposure and human breast cancer. The objective of this study was to assess cadmium concentration in breast tissue samples of patients with breast cancer and benign breast tumor. MATERIAL AND METHODS. The concentration of cadmium was determined in breast tissue samples of 21 breast cancer and 19 benign tumor patients. Two samples of breast tissue from each patient, i.e. tumor and normal tissue close to tumor, were taken for the analysis. Cadmium was determined by atomic absorption spectrometry (Perkin-Elmer, Zeeman 3030). RESULTS. In patients with breast cancer, the mean cadmium concentration was 33.1 ng/g (95% CI, 21.9-44.4) in malignant breast tissue and 10.4 ng/g (95% CI, 5.6-15.2) in normal breast tissue (P=0.002). In patients with benign tumor, the corresponding values were 17.5 ng/g (95% CI, 8.4-26.5) and 11.8 ng/g (95% CI, 5.1-18.5) (P=0.3144). There was a statistically significant difference in cadmium concentration between malignant and benign breast tissues (P=0.009). CONCLUSION. The data obtained show that cadmium concentration is significantly higher in malignant breast tissue as compared with normal breast tissue of the same women or benign breast tissue. Further studies are necessary to determine the association between cadmium concentration in malignant breast tissue and estrogen receptor level, and smoking.

  18. Biochemical Effects of Cadmium Exposure and the Potential Pharmacologic Significance of Cadmium Mediated Hydrolase Inhibition (United States)


    increase Cd absorption from the intestines (Larson and Piscator 1971; Itokawa, Abe et al. 197 4; Pond and Walker 1975). Pyridoxine, vitamin B 6 , is...considerations on uptake and retention of cadmium in human kidney cortex. Cadmium in the Environment. L. Friberg, M. Piscator and G. F. Nordberg. Cleveland...Columbia, Missouri, University of Missouri. Larson, S.-E. and M. Piscator (1971). "Effect of cadmium on skeletal tissue in normal and calcium

  19. Cadmium Toxicity to Ringed Seals (Phoca hispida)

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, R.; Riget, F. F.;

    as laboratory mammals. We have studied possible cadmium induced histopathological changes in the kidneys as well as a demineralisation of the skeletal system (DXA-scanning of lumbal vertebraes). No obvious cadmium induced toxic changes were found. Food composition and physiological adaptations may explain......Cadmium concentrations in kidneys from ringed seals (Phoca hispida) from North West Greenland (Qaanaaq) are high. Concentrations range at level known to induce renal toxic effects (mainly tubulopathy) and demineralisation (osteopenia) of the skeletal system (Fanconi's Syndrome) in humans as well...


    Cadmium consumed in foods grown on soils contaminated by industrial Cd+Zn discharge has caused renal tubular dysfunction in exposed humans in discrete situations. However, lack of understanding about environmental Cd has caused wide concern that generalpopulations may...

  1. Some Aspects of Sealed Nickel Cadmium Cells

    Directory of Open Access Journals (Sweden)

    P. K. Saha


    Full Text Available Sealed Nickel Cadmium Cell system is termed till today as the most reliable power pack for electronic apparatus specially in low temperature use. This paper brings out the development and production of sealed nickel cadmium cells of pocket plate construction. The author who has gained experience in production of Ni-Cd cells in East Germany discusses also the major problems faced by the battery manufactures of to-day.

  2. Screening micro-organisms for cadmium absorption from aqueous solution and cadmium absorption properties of Arthrobacter nicotianae. (United States)

    Tsuruta, Takehiko; Umenai, Daishi; Hatano, Tomonobu; Hirajima, Tsuyoshi; Sasaki, Keiko


    To obtain basic information on how microbial cells absorb cadmium from aqueous solution, we examined cadmium absorption in various micro-organisms. Of 51 micro-organism strains tested, we found that some Gram-positive bacteria, such as, Arthrobacter nicotianae and Bacillus subtilis, and some actinomycetes, such as, Streptomyces flavoviridis and S. levoris were highly capable of absorbing cadmium from an aqueous solution. A. nicotianae absorbed the largest amount of cadmium, over 800 μmol cadmium per gram of dry wt. cells. However, cadmium absorption by A. nicotianae was affected by the solution pH, cadmium concentration, and cell density. The absorption of cadmium was very rapid. Some factors that affected cadmium absorption by A. nicotianae cells were also discussed.

  3. Cadmium exposure and breast cancer risk. (United States)

    McElroy, Jane A; Shafer, Martin M; Trentham-Dietz, Amy; Hampton, John M; Newcomb, Polly A


    Cadmium, a highly persistent heavy metal, has been categorized as a probable human carcinogen by the U.S. Environmental Protection Agency. Primary exposure sources include food and tobacco smoke. We carried out a population-based case-control study of 246 women, aged 20-69 years, with breast cancer and 254 age-matched control subjects. We measured cadmium levels in urine samples by inductively coupled plasma mass spectrometry and conducted interviews by telephone to obtain information on known breast cancer risk factors. Odds ratios (ORs) and 95% confidence intervals (CIs) for breast cancer by creatinine-adjusted cadmium levels were calculated by multivariable analysis. Statistical tests were two-sided. Women in the highest quartile of creatinine-adjusted cadmium level (> or = 0.58 microg/g) had twice the breast cancer risk of those in the lowest quartile (cadmium level (P(trend) = .01). Based on this study, the absolute risk difference is 45 (95% CI = 0 to 77) per 100,000 given an overall breast cancer rate of 124 per 100,000. Whether increased cadmium is a causal factor for breast cancer or reflects the effects of treatment or disease remains to be determined.

  4. Yeast Interacting Proteins Database: YGL181W, YIL122W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available y (0) YIL122W POG1 Putative transcriptional activator that promotes recovery from...YIL122W Prey gene name POG1 Prey description Putative transcriptional activator that promotes recovery from

  5. Reviews of the environmental effects of pollutants: IV. Cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Hammons, A.S.; Huff, J.E.; Braunstein, H.M.; Drury, J.S.; Shriner, C.R.; Lewis, E.B.; Whitfield, B.L.; Towill, L.E.


    This report is a comprehensive, multidisciplinary review of the health and environmental effects of cadmium and specific cadmium derivatives. More than 500 references are cited. The cadmium body burden in animals and humans results mainly from the diet. In the United States, the normal intake of cadmium for adult humans is estimated at about 50 per day. Tobacco smoke is a significant additional source of cadmium exposure. The kidneys and liver together contain about 50% of the total cadmium body burden. Acute cadmium poisoning is primarily an occupational problem, generally from inhalation of cadmium fumes or dusts. In the general population, incidents of acute poisoning by inhaled or ingested cadmium or its compounds are relatively rare. The kidney is the primary target organ for toxicity from prolonged low-level exposure to cadmium. No causal relationship has been established between cadmium exposure and human cancer, although a possible link between cadmium and prostate cancer has been indicated. Cadmium has been shown to be teratogenic in rats, hamsters, and mice, but no such effects have been proven in humans. Cadmium has been reported to increase the frequency of chromosomal aberrations in cultured Chinese hamster ovary cells and in human peripheral leukocytes. The major concern about environmental cadmium is the potential effects on the general population. There is no substantial evidence of hazard from current levels of cadmium in air, water, or food. However, because cadmium is a cumulative poison and because present intake provides a relatively small safety margin, there are adequate reasons for concern over possible future increases in background levels.

  6. 5 CFR 610.122 - Variations in work schedules for educational purposes. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Variations in work schedules for educational purposes. 610.122 Section 610.122 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS HOURS OF DUTY Weekly and Daily Scheduling of Work Work Schedules § 610.122...

  7. 21 CFR 801.122 - Medical devices for processing, repacking, or manufacturing. (United States)


    ... manufacturing. 801.122 Section 801.122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND....122 Medical devices for processing, repacking, or manufacturing. A device intended for processing... act if its label bears the statement “Caution: For manufacturing, processing, or repacking”....

  8. 40 CFR 91.122 - Amending the application and certificate of conformity. (United States)


    ... certificate of conformity. 91.122 Section 91.122 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Standards and Certification Provisions § 91.122 Amending the application and certificate of conformity. (a... to a certificate of conformity or changes are to be made to a product line covered by a...

  9. 41 CFR 301-10.122 - What class of airline accommodations must I use? (United States)


    ... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false What class of airline accommodations must I use? 301-10.122 Section 301-10.122 Public Contracts and Property Management Federal Travel... Common Carrier Transportation Airline Accommodations § 301-10.122 What class of airline...

  10. 12 CFR 204.122 - Secondary market activities of international banking facilities. (United States)


    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Secondary market activities of international banking facilities. 204.122 Section 204.122 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF...) Interpretations § 204.122 Secondary market activities of international banking facilities. (a) Questions have...

  11. 19 CFR 122.188 - Issuance of temporary Customs access seal. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Issuance of temporary Customs access seal. 122.188 Section 122.188 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Access to Customs Security Areas § 122.188 Issuance...

  12. 14 CFR 21.122 - Location of or change to manufacturing facilities. (United States)


    ... § 21.122 Location of or change to manufacturing facilities. (a) An applicant may obtain a production... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Location of or change to manufacturing facilities. 21.122 Section 21.122 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT...

  13. 40 CFR 81.122 - Mississippi Delta Intrastate Air Quality Control Region. (United States)


    ... Quality Control Region. 81.122 Section 81.122 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Air Quality Control Regions § 81.122 Mississippi Delta Intrastate Air Quality Control Region. The Mississippi Delta Intrastate Air Quality Control Region consists of the territorial area encompassed by...

  14. 19 CFR 122.28 - Private aircraft taken abroad by U.S. residents. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Private aircraft taken abroad by U.S. residents. 122.28 Section 122.28 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Private Aircraft § 122.28 Private...

  15. 25 CFR 122.6 - Duties of the Osage Tribal Education Committee. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Duties of the Osage Tribal Education Committee. 122.6 Section 122.6 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES MANAGEMENT OF OSAGE JUDGMENT FUNDS FOR EDUCATION § 122.6 Duties of the Osage Tribal Education Committee. (a)...

  16. Identification of three relationships linking cadmium accumulation to cadmium tolerance and zinc and citrate accumulation in lettuce. (United States)

    Zorrig, Walid; Rouached, Aïda; Shahzad, Zaigham; Abdelly, Chedly; Davidian, Jean-Claude; Berthomieu, Pierre


    Lettuce (Lactuca sativa) is a plant species that shows high accumulation of cadmium, a toxic heavy metal. Lettuce is therefore a good model both for identifying determinants controlling cadmium accumulation in plant tissues and for developing breeding strategies aimed at limiting cadmium accumulation in edible tissues. In this work, 14-day-old plants from three lettuce varieties were grown for 8 days on media supplemented with cadmium concentrations ranging from 0 to 50 microM. Growth, as well as Cd(2+), Zn(2+), K(+), Ca(2+), NO(3)(-), SO(4)(2-), Cl(-), phosphate, malate and citrate root an shoot contents were analyzed. The three lettuce varieties Paris Island Cos, Red Salad Bowl and Kordaat displayed differential abilities to accumulate cadmium in roots and shoots, Paris Island Cos displaying the lowest cadmium content and Kordaat the highest. From the global analysis of the three varieties, three main trends were identified. First, a common negative correlation linked cadmium tissue content and relative dry weight reduction in response to cadmium treatments in the three varieties. Second, increasing cadmium concentration in the culture medium resulted in a parallel increase in zinc tissue content in all lettuce varieties. A common strong positive correlation between cadmium and zinc contents was observed for all varieties. This suggested that systems enabling zinc and cadmium transport were induced by cadmium. Finally, the cadmium treatments had a contrasting effect on anion contents in tissues. Interestingly, citrate content in shoots was correlated with cadmium translocation from roots to shoots, suggesting that citrate might play a role in cadmium transport in the xylem vessels. Altogether, these results shed light on three main strategies developed by lettuce to cope with cadmium, which could help to develop breeding strategies aimed at limiting cadmium accumulation in lettuce.

  17. Cadmium exposure induces hematuria in Korean adults

    Energy Technology Data Exchange (ETDEWEB)

    Han, Seung Seok [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Kim, Myounghee, E-mail: [Department of Dental Hygiene, College of Health Science, Eulji University, Gyeonggi-do 461-713 (Korea, Republic of); Lee, Su Mi [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Lee, Jung Pyo [Department of Internal Medicine, Seoul National University Boramae Medical Center, Seoul 156-707 (Korea, Republic of); Kim, Sejoong [Department of Internal Medicine, Seoul National University Bundang Hospital, Gyeonggi-do 463-707 (Korea, Republic of); Joo, Kwon Wook [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Lim, Chun Soo [Department of Internal Medicine, Seoul National University Boramae Medical Center, Seoul 156-707 (Korea, Republic of); Kim, Yon Su; Kim, Dong Ki [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of)


    Introduction: Toxic heavy metals have adverse effects on human health. However, the risk of hematuria caused by heavy metal exposure has not been evaluated. Methods: Data from 4701 Korean adults were obtained in the Korean National Health and Nutritional Examination Survey (2008–2010). Blood levels of the toxic heavy metals cadmium, lead, and mercury were measured. Hematuria was defined as a result of ≥+1 on a urine dipstick test. The odds ratios (ORs) for hematuria were measured according to the blood heavy metal levels after adjusting for multiple variables. Results: Individuals with blood cadmium levels in the 3rd and 4th quartiles had a greater OR for hematuria than those in the 1st quartile group: 3rd quartile, 1.35 (1.019–1.777; P=0.037); 4th quartile, 1.52 (1.140–2.017; P=0.004). When blood cadmium was considered as a log-transformed continuous variable, the correlation between blood cadmium and hematuria was significant: OR, 1.97 (1.224–3.160; P{sub trend}=0.005). In contrast, no significant correlations between hematuria and blood lead or mercury were found in the multivariate analyses. Discussion: The present study shows that high cadmium exposure is associated with a risk of hematuria. -- Highlights: • A high level of blood cadmium is associated with a high risk of hematuria. • This correlation is independent of several confounding factors. • Blood levels of lead and mercury are not associated with risk of hematuria. • This is the first study on the correlation between cadmium exposure and hematuria risk.

  18. Hazards to wildlife from soil-borne cadmium reconsidered (United States)

    Beyer, W.N.


    Cadmium is a toxic element that should be included in environmental risk assessments of contaminated soils. This paper argues, however, that hazards to wildlife from cadmium have often been overstated. The literature contains only meager evidence that wild animals have been seriously harmed by cadmium, even at severely contaminated sites. Although some researchers have reported that wildlife have accumulated concentrations of cadmium in their kidneys that were above suggested injury thresholds, the thresholds may be disputed, since they were well below the World Health Organization criterion of 200 mg/kg (wet weight) of cadmium in the renal cortex for protecting human health. Recent risk assessments have concluded that soil cadmium concentrations less than 1 mg/kg are toxic to soil organisms and wildlife, which implies that background concentrations of cadmium naturally found in soils are hazardous. An examination of the databases used to support these assessments suggested that the toxicity of cadmium has been exaggerated.

  19. Modeling cadmium in the feed chain and cattle organs

    NARCIS (Netherlands)

    Fels-Klerx, van der H.J.; Romkens, P.F.A.M.; Franz, E.; Raamsdonk, van L.W.D.


    The objectives of this study were to estimate cadmium contamination levels in different scenarios related to soil characteristics and assumptions regarding cadmium accumulation in the animal tissues, using quantitative supply chain modeling. The model takes into account soil cadmium levels, soil pH,

  20. MiR-122 in hepatitis B virus and hepatitis C virus dualinfection

    Institute of Scientific and Technical Information of China (English)

    Kyoungsub Song; Chang Han; Srikanta Dash; Luis A Balart; Tong Wu


    Hepatitis B virus (HBV) and hepatitis C virus (HCV)infections are the most common causes of chronicliver diseases and hepatocelluar carcinomas. Overthe past few years, the liver-enriched microRNA-122(miR-122) has been shown to differentially regulateviral replication of HBV and HCV. It is notable that thelevel of miR-122 is positively and negatively regulatedby HCV and HBV, respectively. Consistent with the welldocumentedphenomenon that miR-122 promotes HCVaccumulation, inhibition of miR-122 has been shown asan effective therapy for the treatment of HCV infectionin both chimpanzees and humans. On the other hand,miR-122 is also known to block HBV replication, andHBV has recently been shown to inhibit miR-122expression; such a reciprocal inhibition betweenmiR-122 and HBV suggests an intriguing possibilitythat miR-122 replacement may represent a potentialtherapy for treatment of HBV infection. As HBV andHCV have shared transmission routes, dual infection isnot an uncommon scenario, which is associated withmore advanced liver disease than either HBV or HCVmono-infection. Thus, there is a clear need to furtherunderstand the interaction between HBV and HCVand to delineate the role of miR-122 in HBV/HCV dualinfection in order to devise effective therapy. This reviewsummarizes the current understanding of HBV/HCVdual infection, focusing on the pathobiological role andtherapeutic potential of miR-122.

  1. Epidemiological aspects of cadmium in the environment

    Energy Technology Data Exchange (ETDEWEB)

    Piscator, M.


    Cadmium is highly toxic to man and it has an extremely long biological half-time. Under long-term low level exposure about one third of the total body burden is in the kidneys. In some European countries and USA mean renal cortical concentrations of cadmium 24-50 ppM wet weight at age 50 have been reported. In three areas in Japan the corresponding concentrations were 60 to 125 ppM wet weight. These normal concentrations have been thought to cause hypertension but so far epidemiological data are not available to support such a hypothesis. Renal tubular dysfunction may begin at a renal cortical concentration of about 200 ppM wet weight. In Japan extensive investigations have been carried out in several areas polluted by cadmium. Available data indicate that the prevalence of proteinuria is higher in the cadmium polluted areas and that the proteinuria is of the tubular type. Studies on dose-response relationships must include accurate and sensitive methods for the detection of low molecular weight proteinuria, which is an early sign in cadmium intoxication. 6 references, 1 table.

  2. Recycling of Spent Nickel-Cadmium Batteries

    Institute of Scientific and Technical Information of China (English)


    A technique for recycling spent nickel-cadmium batteries, which makes separation of cadmium and nickel possible, is developed by laboratory-scale experiments. NH3-H2CO3 aqueous solution was used in this leaching technique. Since neutralization and/or solvent extraction were not required in the separation procedure of nickel and cadmium, the closed systemization of the process becomes possible. Experimental results show that, (1) if the NH3 concentration of leaching solution is sufficiently high and the ratio of H2CO3 to NH3 is properly adjusted, both Ni(OH)2 and Cd(OH)2 react with NH3 and quickly dissolve into leaching solution, and (2) Ni(OH)2 can be converted into insoluble NiO by calcination at 500€癈, and CdO from Cd(OH)2 by calcination maintains good solubility in NH3-H2CO3 aqueous solution. As a conclusion, the recycling technique characterized by two step leaching can be developed based on such changes in dissolution behavior by calcination. Meanwhile, the yields of 99.8% for nickel and 97.6% for cadmium are obtained, and the purities of recovered nickel and cadmium are 99.9% and 98.6%, respectively.

  3. Effect of anions on Toxicity of Cadmium Applied to MIcrobial Biomass in Red Soil

    Institute of Scientific and Technical Information of China (English)



    A laboratory incubation experiment was conducted to elucidat the effects of associated anions on toxicity of cadmium applied to microbial biomass in the red soil. Cadmium was applied at six different levels,i.e.,O(background),5,15,30,60 and 100μg g-1 soil in the form of either cadmium acetate or cadmium chloride. Application of cadmium as cadmium acetate markedly reduced the soil microbial biomass carbon compared to cadmium applied as cadmium chlorde at all the tested levels.Similarly,organic carbon to biomass carbon ration in the soil was markedly increased by increasing the level of the cadmium in the soil as cadmium acetate,while the change wa much smaller in the case of cadmium chloride at the same cadmium levels.The results suggested that due consideration should be given to the source of cadmium while deciding the cadmium levles in experiments.

  4. Patterns of gene expression in carp liver after exposure to a mixture of waterborne and dietary cadmium using a custom-made microarray

    Energy Technology Data Exchange (ETDEWEB)

    Reynders, Hans [Department of Biology, Research Unit Ecophysiology, Biochemistry and Toxicology Group, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium)]. E-mail:; Ven, Karlijn van der [Department of Biology, Research Unit Ecophysiology, Biochemistry and Toxicology Group, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium); Moens, Lotte N. [Department of Biology, Research Unit Ecophysiology, Biochemistry and Toxicology Group, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium); Remortel, Piet van [Department of Mathematics and Informatics, Intelligent Systems Laboratory, University of Antwerp, Middelheimlaan 1, B-2020 Antwerp (Belgium); De Coen, Wim M. [Department of Biology, Research Unit Ecophysiology, Biochemistry and Toxicology Group, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium); Blust, Ronny [Department of Biology, Research Unit Ecophysiology, Biochemistry and Toxicology Group, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium)


    Gene expression changes in carp liver tissue were studied after acute (3 and 24 h) and subchronic (7 and 28 days) exposure to a mixture of waterborne (9, 105 and 480 {mu}g/l) and dietary (9.5, 122 and 144 {mu}g/g) cadmium, using a custom-made microarray. Suppression subtractive hybridization-PCR (SSH-PCR) was applied to isolate a set of 643 liver genes, involved in multiple biological pathways, such as energy metabolism (e.g. glucokinase), immune response (e.g. complement C3) and stress and detoxification (e.g. cytochrome P450 2F2, glutathione-S-transferase pi). These genes were subsequently spotted on glass-slides for the construction of a custom-made microarray. Resulting microarray hybridizations indicated a highly dynamic response to cadmium exposure. At low exposure concentrations (9 {mu}g/l through water and 9.5 {mu}g/g dry weight through food) mostly energy-related genes (e.g. glucokinase, elastase) were influenced, while a general stress response was obvious through induction of several stress-related genes, including hemopexin and cytochrome P450 2F2, at high cadmium concentrations. In addition, fish exposed to the highest cadmium concentrations showed liver damage after 7 days of exposure, as measured by elevated alanine transaminase activity in plasma and increased liver water content (wet-to-dry weight ratio). Moreover, decreased hematocrit and growth were found at the end of the experiment. Altogether this study clearly demonstrated the importance of varying exposure conditions for the characterization of the molecular impact of cadmium and showed that microarray results can provide important information, required to unravel the molecular events and responses related to cadmium exposure.

  5. Projected shell model study of neutron-deficient 122Ce

    Indian Academy of Sciences (India)

    Rani Devi; B D Sehgal; S K Khosa


    The observed excited states of 122Ce nucleus have been studied in the frame-work of projected shell model (PSM). The yrast band has been studied up to spin 26 ħ. The first band crossing has been predicted above a rotational frequency of 0.4 MeV/ħ that corresponds to first backbending. The calculation reproduces the experimentally observed ground state band up to spin 14ħ. The electromagnetic quantities, transition quadrupole moments and -factors are predicted and there is a need to measure these quantities experimentally.

  6. Boron-doped cadmium oxide composite structures and their electrochemical measurements

    Energy Technology Data Exchange (ETDEWEB)

    Lokhande, B.J., E-mail: [Lab of Smart Mtrls Supercapacitive and Energy Studies, School of Physical Sciences, Solapur University, Solapur 413255, Maharashtra (India); Ambare, R.C. [Lab of Smart Mtrls Supercapacitive and Energy Studies, School of Physical Sciences, Solapur University, Solapur 413255, Maharashtra (India); Mane, R.S. [School of Physical Sciences, Swami Ramanand Teerth Marathwada University, Nanded 431606 (India); Bharadwaj, S.R. [Chemistry Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India)


    Graphical abstract: Conducting nano-fibrous 3% boron doped cadmium oxide thin films were prepared by SILAR and its super capacitive properties were studied. - Highlights: • Samples are of nanofibrous nature. • All samples shows pseudocapacitive behavior. • 3% B doped CdO shows good specific capacitance. • 3% B doped CdO shows maximum 74.93% efficiency at 14 mA/cm{sup 2}. • 3% B doped CdO shows 0.8 Ω internal resistance. - Abstract: Boron-doped and undoped cadmium oxide composite nanostructures in thin film form were prepared onto stainless steel substrates by a successive ionic layer adsorption and reaction method using aqueous solutions of cadmium nitrate, boric acid and 1% H{sub 2}O{sub 2}. As-deposited films were annealed at 623 K for 1 h. The X-ray diffraction study shows crystalline behavior for both doped and undoped films with a porous topography and nano-wires type architecture, as observed in SEM image. Wettability test confirms the hydrophilic surface with 58° contact angle value. Estimated band gap energy is around 1.9 eV. Electrochemical behavior of the deposited films is attempted in 1 M KOH electrolyte using cyclic voltammetry (CV), electrochemical impedance spectroscopy and galvanostatic charge–discharge tests. Maximum values of the specific capacitance, specific energy and specific power obtained for 3% B doped CdO film at 2 mV/s scan rate are 20.05 F/g, 1.22 Wh/kg and 3.25 kW/kg, respectively.

  7. Reduction of Cadmium Uptake of Rice Plants Using Soil Amendments in High Cadmium Contaminated Soil: A Pot Experiment

    Directory of Open Access Journals (Sweden)

    Dian Siswanto


    Full Text Available The aims of this study were to investigate the effect of agricultural residues on reducing cadmium uptake in rice plants. The rice plants growing on no cadmium/free cadmium soils (N, Cd soils (Cds, and Cd soils each amended with 1% w/w of coir pith (CP, coir pith modified with sodium hydroxide (CPm and corncob (CC under high cadmium contaminated soil with an average 145 mg Cd kg-1 soil were investigated. The results showed that the cumulative transpiration of rice grown in various treatments under high cadmium contaminated soil followed the order: Cds > CPm ≥ CP ≥ CC. These transpirations directly influenced cadmium accumulation in shoots and husks of rice plants. The CC and CP seemed to work to reduce the cadmium uptake by rice plants indicated by accumulated cadmium in the husk that were 2.47 and 7.38 mg Cd kg-1 dry weight, respectively. Overall, transpiration tended to drive cadmium accumulation in plants for rice grown in high cadmium contaminated soil. The more that plants uptake cadmium, the lower cadmium that remains in the soil.

  8. Cadmium accumulation by Axonopus compressus (Sw. P. Beauv and Cyperus rotundas Linn growing in cadmium solution and cadmium-zinc contaminated soil

    Directory of Open Access Journals (Sweden)

    Paitip Thiravetyan


    Full Text Available This research investigated the phyto-remediation potentials of Cyperus rotundas Linn (Nutgrass and Axonopus compressus (Sw. P. Beauv (Carpetgrass for cadmium removal from cadmium solution andcadmium-zinc contaminated soil. Plants growth in the solution showed that cadmium decreased the relative growth rate of both grasses. However, the amount of cadmium accumulated in shoot and root was increasedwith the increase in cadmium concentration and exposure time. Growth in fertile soil mixed with Cd-contaminated zinc silicate residue (65% Si, 19% Ca, 2% Zn, 1% Mg and 0.03% Cd at the ratio of 50:50 (w/wfor 30 days showed that C. rotundas Linn accumulated cadmium in root and shoot to 2,178 and 1,144 mg kg-1 dry weight, respectively. A. compressus (Sw. P. Beauv accumulated cadmium in root and shoot to 1,965and 669 mg kg-1 dry weight, respectively. Scanning electron microscope connected to energy-dispersive X-ray spectroscopy suggested that the mechanism of cadmium accumulation by both grasses involved thecadmium precipitation in the stable form of cadmium silicate, which indicated that C. rotundas Linn and A. compressus (Sw. P. Beauv could be grown to prevent soil erosion and to remediate cadmium-contaminatedsoil.


    Directory of Open Access Journals (Sweden)

    P. Bala Ramudu


    Full Text Available This paper presents the results of an experimental research undertaken to evaluate different purging solutions to enhance the removal of cadmium from spiked contaminated field soil by electrokinetic remediation. Three experiments were conducted when soil was saturated with deionised water and subsequently deionised water, ammonium citrate and sodium citrate were used as purging solutions at anode end. One experiment was conducted when the soil was saturated with ammonium citrate and itself was used as the purging solution. Results showed that 49% reduction of cadmium concentration was achieved in the case of soil saturated (washed with ammonium citrate as well as purging solution also was ammonium citrate. The soil pH and washing solutions were the most important factors in controlling the removal of cadmium in electrokinetic remediation process.

  10. Magnetron sputtered nanostructured cadmium oxide films for ammonia sensing

    Energy Technology Data Exchange (ETDEWEB)

    Dhivya, P. [Functional Nanomaterials and Devices Lab, Centre for Nanotechnology and Advanced Biomaterials and School of Electrical and Electronics Engineering, SASTRA University, Thanjavur-613 401 (India); Prasad, A.K. [Surface and Nanoscience Division, Materials Science Group, Indira Gandhi Centre for Atomic Research, Kalpakkam-603 102 (India); Sridharan, M., E-mail: [Functional Nanomaterials and Devices Lab, Centre for Nanotechnology and Advanced Biomaterials and School of Electrical and Electronics Engineering, SASTRA University, Thanjavur-613 401 (India)


    Nanostructured cadmium oxide (CdO) films were deposited on to glass substrates by reactive dc magnetron sputtering technique. The depositions were carried out for different deposition times in order to obtain films with varying thicknesses. The CdO films were polycrystalline in nature with cubic structure showing preferred orientation in (1 1 1) direction as observed by X-ray diffraction (XRD). Field-emission scanning electron microscope (FE-SEM) micrographs showed uniform distribution of grains of 30–35 nm size and change in morphology from spherical to elliptical structures upon increasing the film thickness. The optical band gap value of the CdO films decreased from 2.67 to 2.36 eV with increase in the thickness. CdO films were deposited on to interdigitated electrodes to be employed as ammonia (NH{sub 3}) gas sensor. The fabricated CdO sensor with thickness of 294 nm has a capacity to detect NH{sub 3} as low as 50 ppm at a relatively low operating temperature of 150 °C with quick response and recovery time. - Highlights: • Nanostructured CdO films were deposited on to glass substrates using magnetron sputtering. • Deposition time was varied in order to obtain films with different thicknesses. • The CdO films were polycrystalline in nature with preferred orientation along (1 1 1) direction. • The optical bandgap values of the films decreased on increasing the thickness of the films. • CdO films with different thickness such as 122, 204, 294 nm was capable to detect NH{sub 3} down to 50 ppm at operating temperature of 150 °C.

  11. Cadmium toxicity in the free-living nematode, Caenorhabditis elegans

    Energy Technology Data Exchange (ETDEWEB)

    Popham, J.D.; Webster, J.M.


    The effect of cadmium on the fecundity, growth, and fine structure of the free-living nematode Caenorhabditis elegans was studied. High concentrations of cadmium significantly decreased the fecundity and growth of these organisms. Electron microscopy showed that cadmium modifies the structure of the mitochondria in the esophagus and intestine, causes the formation of inclusion bodies in the nucleus of esophageal cells, and alters the morphology of cytosomes in the intestinal cells. The results suggest that the decreased fecundity and growth of cadmium-exposed C. elegans may be due to cadmium interfering with nutrient uptake or assimilation or both.

  12. Treatment of cadmium dust with two-stage leaching process

    Institute of Scientific and Technical Information of China (English)


    The treatment of cadmium dust with a two-stage leaching process was investigated to replace the existing sulphation roast-leaching processes. The process parameters in the first stage leaching were basically similar to the neutralleaching in zinc hydrometallurgy. The effects of process parameters in the second stage leaching on the extraction of zincand cadmium were mainly studied. The experimental results indicated that zinc and cadmium could be efficiently recoveredfrom the cadmium dust by two-stage leaching process. The extraction percentages of zinc and cadmium in two stage leach-ing reached 95% and 88% respectively under the optimum conditions. The total extraction percentage of Zn and Cdreached 94%.

  13. High-Statistics β+ / EC -Decay Study of 122Xe (United States)

    Jigmeddorj, Badamsambuu; S1292 Collaboration


    The Xe isotopes are centrally located in the Z > 50 , N vibrational structure influenced by proton subshell gaps, perhaps leading to shape-coexistence that could give rise to strong E 0 transitions. Recent work on 124Xe has established nearly identical quadrupole collectivity for the pairing vibrational 03+ band and the ground state band. However, in 122Xe, the 03+ state has not been firmly identified. A high-statistics 122Cs β+ / EC decay experiment to obtain detailed spectroscopic data for low-spin states was performed at the TRIUMF-ISAC facility using the 8 π γ-ray spectrometer and its auxiliary detectors including PACES, an array of five Si(Li) detectors, for conversion electron spectroscopy. The decay scheme has been considerably extended through a γ- γ coincidence analysis, and 0+ states have been identified via γ- γ angular correlations. This work supported by the Natural Sciences and Engineering Research Council of Canada and the National Research Council of Canada.

  14. Cadmium telluride quantum dots advances and applications

    CERN Document Server

    Donegan, John


    Optical Properties of Bulk and Nanocrystalline Cadmium Telluride, Núñez Fernández and M.I. VasilevskiyAqueous Synthesis of Colloidal CdTe Nanocrystals, V. Lesnyak, N. Gaponik, and A. EychmüllerAssemblies of Thiol-Capped CdTe Nanocrystals, N. GaponikFörster Resonant Energy Transfer in CdTe Nanocrystal Quantum Dot Structures, M. Lunz and A.L. BradleyEmission of CdTe Nanocrystals Coupled to Microcavities, Y.P. Rakovich and J.F. DoneganBiological Applications of Cadmium Telluride Semiconductor Quantum Dots, A. Le Cign

  15. Cadmium Exposure and Pancreatic Cancer in South Louisiana

    Directory of Open Access Journals (Sweden)

    Brian G. Luckett


    Full Text Available Cadmium has been hypothesized to be a pancreatic carcinogen. We test the hypothesis that cadmium exposure is a risk factor for pancreatic cancer with a population-based case-control study sampled from a population with persistently high rates of pancreatic cancer (south Louisiana. We tested potential dietary and nondietary sources of cadmium for their association with urinary cadmium concentrations which reflect long-term exposure to cadmium due to the accumulation of cadmium in the kidney cortex. Increasing urinary cadmium concentrations were significantly associated with an increasing risk of pancreatic cancer (2nd quartile OR = 3.34, 3rd = 5.58, 4th = 7.70; test for trend P≤0.0001. Potential sources of cadmium exposure, as documented in the scientific literature, found to be statistically significantly associated with increased risk of pancreatic cancer included working as a plumber, pipefitter or welder (OR = 5.88 and high consumption levels of red meat (4th quartile OR = 6.18 and grains (4th quartile OR = 3.38. Current cigarette smoking, at least 80 pack years of smoking, occupational exposure to cadmium and paints, working in a shipyard, and high consumption of grains were found to be statistically significantly associated with increased concentrations of urinary cadmium. This study provides epidemiologic evidence that cadmium is a potential human pancreatic carcinogen.

  16. Cadmium-induced cancers in animals and in humans. (United States)

    Huff, James; Lunn, Ruth M; Waalkes, Michael P; Tomatis, Lorenzo; Infante, Peter F


    Discovered in the early 1800s, the use of cadmium and various cadmium salts started to become industrially important near the close of the 19th century, rapidly thereafter began to flourish, yet has diminished more recently. Most cadmium used in the United States is a byproduct from the smelting of zinc, lead, or copper ores, and is used to manufacture batteries. Carcinogenic activity of cadmium was discovered first in animals and only subsequently in humans. Cadmium and cadmium compounds have been classified as known human carcinogens by the International Agency for Research on Cancer and the National Toxicology Program based on epidemiologic studies showing a causal association with lung cancer, and possibly prostate cancer, and studies in experimental animals, demonstrating that cadmium causes tumors at multiple tissue sites, by various routes of exposure, and in several species and strains. Epidemiologic studies published since these evaluations suggest that cadmium is also associated with cancers of the breast, kidney, pancreas, and urinary bladder. The basic metal cationic portion of cadmium is responsible for both toxic and carcinogenic activity, and the mechanism of carcinogenicity appears to be multifactorial. Available information about the carcinogenicity of cadmium and cadmium compounds is reviewed, evaluated, and discussed.

  17. Study of cadmium electrochemical deposition in sulfate medium

    Energy Technology Data Exchange (ETDEWEB)

    Montiel, T.; Solorza, O.; Sanchez, H.


    The cadmium electrochemical deposition process from sulfate medium was studied by means of different electrochemical techniques in both stationary and nonstationary diffusion regimes. The kinetics of the electrochemical reduction of cadmium on solid cadmium electrodes was examined and the kinetic parameters are presented, as well as the diffusion coefficient derived from the different techniques. Temperature has an important effect on the cadmium reduction kinetics, and the activation energy of the process was evaluated. The electrochemical deposition of cadmium is a complex process due to the coexistence of adsorption and nucleation processes; the adsorbed electroactive species appears to be Cd{sup +2}, and a mechanism for cadmium electrodeposition on solid cadmium electrodes is proposed.

  18. Murine strain differences and the effects of zinc on cadmium concentrations in tissues after acute cadmium exposure

    Energy Technology Data Exchange (ETDEWEB)

    King, L.M. [ARS USDA, Germplasm and Gamete Physiology Lab., Beltsville, MD (United States); Anderson, M.B. [Dept. of Anatomy, Tulane Univ. School of Medicine, New Orleans, LA (United States); Sikka, S.C. [Dept. of Urology, Tulane Univ. School of Medicine, New Orleans, LA (United States); George, W.J. [Dept. of Pharmacology, Tulane Univ. School of Medicine, New Orleans, LA (United States)


    The role of strain differences in cadmium tissue distribution was studied using sensitive (129/J) and resistant (A/J) mice. These murine strains have previously been shown to differ in their susceptibility to cadmium-induced testicular toxicity. Cadmium concentration was measured in testis, epididymis, seminal vesicle, liver, and kidney at 24 h after cadmium chloride exposure (4, 10, and 20 {mu}mol/kg CdCl{sub 2}). The 129/J mice exhibited a significant increase in cadmium concentration in testis, epididymis, and seminal vesicle at all cadmium doses used, compared to A/J mice. However, cadmium concentrations in liver and kidney were not different between the strains, at any dose, indicating that cadmium uptake is similar in these organs at 24 h. These murine strains demonstrate similar hepatic and renal cadmium uptake but significantly different cadmium accumulation in the reproductive organs at 24 h. The mechanism of the protective effect of zinc on cadmium toxicity was studied by assessing the impact of zinc acetate (ZnAc) treatment on cadmium concentrations in 129/J mice after 24 h. Zinc pretreatment (250 {mu}mol/kg ZnAc), given 24 h prior to 20 {mu}mol/kg CdCl{sub 2} administration, significantly decreased the amount of cadmium in the testis, epididymis, and seminal vesicle of 129/J mice, and significantly increased the cadmium content of the liver after 24 h. Cadmium levels in the kidney were unaffected at this time. Zinc pretreatment also prevented the cadmium-induced decrease in testicular sperm concentration and epididymal sperm motility seen in 129/J mice. These findings suggest that the differences in the two murine strains may be attributed partly to the differential accumulation of cadmium in murine gonads. This may be caused by strain differences in the specificity of cadmium transport mechanisms. The protective role of zinc in cadmium-induced testicular toxicity in the sensitive strain may be due to an interference in the cadmium uptake by susceptible

  19. Urinary cadmium and estimated dietary cadmium in the Women's Health Initiative. (United States)

    Quraishi, Sabah M; Adams, Scott V; Shafer, Martin; Meliker, Jaymie R; Li, Wenjun; Luo, Juhua; Neuhouser, Marian L; Newcomb, Polly A


    Cadmium, a heavy metal dispersed in the environment as a result of industrial and agricultural applications, has been implicated in several human diseases including renal disease, cancers, and compromised bone health. In the general population, the predominant sources of cadmium exposure are tobacco and diet. Urinary cadmium (uCd) reflects long-term exposure and has been frequently used to assess cadmium exposure in epidemiological studies; estimated dietary intake of cadmium (dCd) has also been used in several studies. The validity of dCd in comparison with uCd is unclear. This study aimed to compare dCd, estimated from food frequency questionnaires, to uCd measured in spot urine samples from 1,002 participants of the Women's Health Initiative. Using linear regression, we found that dCd was not statistically significantly associated with uCd (β=0.006, P-value=0.14). When stratified by smoking status, dCd was not significantly associated with uCd both in never smokers (β=0.006, P-value=0.09) and in ever smokers (β=0.003, P-value=0.67). Our results suggest that because of the lack of association between estimated dCd and measured uCd, dietary estimation of cadmium exposure should be used with caution in epidemiologic studies.

  20. MiR-122 Induces Radiosensitization in Non-Small Cell Lung Cancer Cell Line

    Directory of Open Access Journals (Sweden)

    Debin Ma


    Full Text Available MiR-122 is a novel tumor suppresser and its expression induces cell cycle arrest, or apoptosis, and inhibits cell proliferation in multiple cancer cells, including non-small cell lung cancer (NSCLC cells. Radioresistance of cancer cell leads to the major drawback of radiotherapy for NSCLC and the induction of radiosensitization could be a useful strategy to fix this problem. The present work investigates the function of miR-122 in inducing radiosensitization in A549 cell, a type of NSCLC cells. MiR-122 induces the radiosensitization of A549 cells. MiR-122 also boosts the inhibitory activity of ionizing radiation (IR on cancer cell anchor-independent growth and invasion. Moreover, miR-122 reduced the expression of its targeted genes related to tumor-survival or cellular stress response. These results indicate that miR-122 would be a novel strategy for NSCLC radiation-therapy.


    Cadmium induced renal tubular dysfunction occurred where subsistence rice farmers produced their lifetime dietary rice on Zn-mine waste contaminated soils in Japan and other Asian countries. Research has shown that polished rice Cd is greatly increased while grain Zn is not incre...

  2. Field scale behaviour of cadmium in soil.

    NARCIS (Netherlands)

    Boekhold, A.E.


    Although total heavy metal contents of soil are often used to express the degree of contamination, they are of little value to judge environmental effects. The main objective of this thesis was to develop and test methodologies with which environmental risks of cadmium pollution of field soils can b

  3. Koper, zink en cadmium in voeding

    NARCIS (Netherlands)

    Smolders, E.A.A.


    In een tabel is aangegeven hoeveel koper, zink en cadmium een rantsoen gemiddeld moet bevatten om de behoefte van melkvee te dekken. Daarbij is uitgegaan van een gemiddelde benutting. De vraag is of er bij een tekort aangevuld moet worden en of er bij een teveel weggelaten moet worden.

  4. Mobiliteit van cadmium in de bodem

    NARCIS (Netherlands)

    Chardon, W.J.


    The adsorption of cadmium by twelve Dutch soils was investigated under widely varying circumstances. The adsorption can be described with the Freundlich equation; the parameters of this equation can be predicted using the properties of the soil (pH, organic carbon and clay content).The adsorption ap

  5. Lead and cadmium in breast milk

    Energy Technology Data Exchange (ETDEWEB)

    Sternowsky, H.J.; Wessolowski, R.


    Breast milk from 10 women each from the city of Hamburg and from a rural area was analyzed by atomic absorption spectrometry for contamination with lead and cadmium. Samples were examined at regular intervals for 3 months after birth. On day 5 a diurnal profile was analyzed; on the other days milk was taken before and after the morning feed. For breast milk as the main source of nutrition in infants, this study shows values of 9.1 +- 2.5 (SD) for lead in the rural population, with a tendency to decrease towards the end of lactation. Urban mothers had 13.3 +- 5.5 (SD), with a tendency to increase. Mean cadmium content in rural mothers was 17.3 +- 4.9, with much higher values in the colostrum and a decrease after 15 days. Urban mothers had 24.6 +- 7.3, again with high colostrum values and a subsequent decrease. Calculated daily intake according to these values is presented, based on 840 ml breast milk for a 5.5 kg infant per day. Rural infants ingested 0.9-1.3 of lead, and in the city 1.5-2.3 Cadmium intake in rural infants amounted from 1.2-1.8; in Hamburg it was 1.6-2.2 Thus the daily ingestion of lead was just below the DPI, cadmium ingestion was higher than the DPI for adults. The rural population had lower values in breast milk for both heavy metals than the urban population, although not statistically significant. Compared to earlier reports there was a slight increase in lead concentration and a more significant increase for cadmium.

  6. Cadmium and Chrome Concentrations in Human Milk

    Directory of Open Access Journals (Sweden)

    Sima Nazarpour


    Full Text Available Introduction: Nutrition of children has the highest priority in any program aimed at children's health care. Milk contaminated with various toxic elements can have adverse effects on children's health. This study aimed to determine the concentration of heavy metals including cadmium(Cd and chromium (Cr of breast feeding women’s milk in Varamin. Methods: This is a cross sectional study. In the present study, chromium and cadmium levels in milk of 100 mothers attending clinics in the city of Varamin were measured in four to eight weeks after delivery, using atomic absorption spectrometry. Results: The mean values (±SD of Cd and Cr in human milk were 5±6.9 μg/ml and 3±2.7 μg/ml respectively. Result of Linear regression showed that cadmium levels were higher in breast milk of people living close to the factory or industrial center. Also, the chromium levels were higher in the breast milk of women in cases of: Smoking by spouses, consumption of imported rice, consumption of mineral water, and living close to the factory or an industrial center. Conclusion: This study showed that the relationship of some factors such as living near a factory or an industrial center, smoking by spouse, the type of consumed rice and water, with the level of cadmium and chromium. Cadmium and chromium levels of breast milk in this study were higher than the levels of these elements mentioned in the reviewed articles and international standard. Because some variables, such as living near a factory or an industrial center, smoking by spouse, the type of consumed rice and water can affect the amount of entering elements in breast milk. Actions can be taken to reduce or eliminate these variables in order to decrease the mentioned elements in human milk.

  7. Cadmium phytoextraction potential of different Alyssum species

    Energy Technology Data Exchange (ETDEWEB)

    Barzanti, R., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Colzi, I., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Arnetoli, M., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Gallo, A., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Pignattelli, S., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Gabbrielli, R., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Gonnelli, C., E-mail: [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy)


    Highlights: Black-Right-Pointing-Pointer The possibility of using serpentine plants for phytoextraction of Cd was investigated. Black-Right-Pointing-Pointer Variation in Cd tolerance, accumulation and translocation in three Alyssum plants with different phenotypes were found. Black-Right-Pointing-Pointer Alyssum montanum showed higher Cd tolerance and accumulation than the Ni hyperaccumulator Alyssum bertolonii. Black-Right-Pointing-Pointer As for the kinetic parameters of the Cd uptake system, A. montanum presented a low apparent K{sub m} value. Black-Right-Pointing-Pointer The V{sub max} values were not significantly different among the plants. - Abstract: This work was planned for providing useful information about the possibility of using serpentine adapted plants for phytoextraction of cadmium, element scarcely represented in such metalliferous environment. To this aim, we investigated variation in cadmium tolerance, accumulation and translocation in three Alyssum plants with different phenotypes: Alyssum bertolonii, that is a serpentine endemic nickel hyperaccumulator, and two populations of Alyssum montanum, one adapted and one not adapted to serpentine soils. Plants were hydroponically cultivated in presence of increasing concentrations of CdSO{sub 4} for two weeks. For the metal concentration used in the experiments, the three different Alyssum populations showed variation in cadmium tolerance, accumulation and content. The serpentine adapted population of A. montanum showed statistically higher cadmium tolerance and accumulation than A. bertolonii and the population of A. montanum not adapted to serpentine soil thus deserving to be investigated for phytoextraction purposes. Furthermore, as for the kinetic parameters of the cadmium uptake system, A. montanum serpentine population presented a low apparent K{sub m} value, suggesting a high affinity for this metal of its uptake system, whereas the V{sub max} values were not significantly different among the

  8. Modelling of Cadmium Transport in Soil-Crop System

    Institute of Scientific and Technical Information of China (English)


    A model for simulating cadmium transport in a soil-plant system was built using a commercial simu lating program named Powersim on the basis of input-output processes happening in the soil-plant system.Convective and dispersive transport processes of cadmium in soil profile are embedded. Simulations on a daily base have been done up to a total simulating time of 250 years. Results show that applications of sewage sludge and fertilizer at the simulated rates would only cause slight cadmium accumulations in each layer of the soil, and cadmium accumulation would be levelling off, reaching an equilibrium concentrations layer by layer downward after certain time. The time scale to reach an equilibrium concentration varies from 10 years for the top three layers to over 250 years for the bottom layers. Plant cadmium uptake would increase from 52 ug m-2 under initial soil cadmium concentrations to 65 μg m-2 under equilibrium soil cadmium concentrations, which would not exceed the maximum allowable cadmium concentration in wheat grains. Main parameters which influence cadmium accumulation and transport in soil are total cadmium input, rainfall, evaporation, plant uptake and soil properties.

  9. Accumulation of cadmium in livers and kidneys in Greenlanders

    Energy Technology Data Exchange (ETDEWEB)

    Johansen, Poul [National Environmental Research Institute, Frederiksborgvej 399, DK-4000 Roskilde (Denmark)]. E-mail:; Mulvad, Gert [Primary Health Care Center, DK-3900 Nuuk, Greenland (Denmark); Centre for Arctic Environmental Medicine, University of Aarhus, Universitetsparken, DK-8000 Aarhus C (Denmark); Pedersen, Henning Sloth [Primary Health Care Center, DK-3900 Nuuk, Greenland (Denmark); Centre for Arctic Environmental Medicine, University of Aarhus, Universitetsparken, DK-8000 Aarhus C (Denmark); Hansen, Jens C. [Centre for Arctic Environmental Medicine, University of Aarhus, Universitetsparken, DK-8000 Aarhus C (Denmark); Riget, Frank [National Environmental Research Institute, Frederiksborgvej 399, DK-4000 Roskilde (Denmark)


    In the Arctic, the traditional diet exposes its people to a very high intake of cadmium because it is highly concentrated in the liver and kidneys of commonly eaten marine mammals. In one study in Greenland, the cadmium intake was estimated to 182 {mu}g/day/person in the fall and 346 in the spring. To determine whether the cadmium is accumulated in humans, we analyzed autopsy samples of liver and kidneys from 95 ethnic Greenlanders (aged 19-89) who died from a wide range of causes. The cadmium concentration in liver (overall mean 1.97 {mu}g/g wet wt) appeared to be unrelated to any particular age group, whereas the concentrations in the kidneys peaked in Greenlanders between 40 and 50 years of age (peak concentration 22.3 {mu}g/g wet wt). Despite the high cadmium levels in the typical Greenlander diet, we found that the cadmium concentrations in livers and kidneys were comparable to those reported from Denmark, Sweden, Australia and Great Britain. Furthermore, even though the mean cadmium intake from the diet was estimated to be 13-25 times higher in Greenlanders than in Danes, we found similar cadmium levels in the kidneys of both. Seal livers and kidneys are the main source of cadmium in the diet of Greenlanders, but these tissues are not eaten in Denmark. Thus, our results suggest that the accumulation of cadmium from Greenlander's marine diet is very low.

  10. Hepatoprotective activity of Moringa oleifera against cadmium toxicity in rats

    Directory of Open Access Journals (Sweden)

    Reetu Toppo


    Full Text Available Aim: The present investigation has been conducted to evaluate the hepatoprotective activity of Moringa oleifera against cadmium-induced toxicity in rats. Materials and Methods: For this study, 18 Wistar albino rats were taken. Control group, Group I rats were given cadmium chloride @ 200 ppm per kg and Group II rats were treated with M. oleifera extract @ 500 mg/kg along with cadmium chloride @ 200 ppm per kg (daily oral for 28 days. On 29th day, animals were slaughtered and various parameters were determined. Serum biomarkers, oxidative stress parameters, histomorphological examination were carried out with estimation of cadmium concentration in liver tissues. Results: Oral administration of cadmium chloride @ 200 ppm/kg for 28 days resulted in a significant increase in aspartate aminotransferase (AST, alanine transaminase (ALT, alkaline phosphatase (ALP, significant (p≤0.01 increase of lipid peroxidation (LPO and decrease in superoxide dismutase (SOD, and increase in cadmium accumulation in liver. Treatment with M. oleifera @ 500 mg/kg significantly (p<0.01 decreased the elevated ALP, AST, ALT, LPO levels and increase in SOD levels, and as compared to cadmium chloride treated group. However, there was no significant difference in cadmium concentration in liver when compared with cadmium chloride treated group. Conclusion: The study conclude that supplementation of M. oleifera (500 mg/kg, daily oral for 28 days has shown protection against cadmium-induced hepatotoxicity.

  11. Validation and Verification of the Correct Operation of the Thermo Fisher Scientific’s Genesys 10S spectrometer used in ANC122 and NF-ANC122

    Energy Technology Data Exchange (ETDEWEB)

    Colletti, Lisa Michelle [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    In December of 2015, the old qualified Prim UV-Vis instrument used in the ANC122 and NFANC122 procedures failed its monthly calibration check. Attempts to get the system to pass by cleaning flow cells, replacing the light bulb and realigning the light path failed to get sustained reproducible results from the system. As it could no longer pass QA/QC requirements the decision to take it out of service was made. To replace the system, a previously purchased Thermo Fisher Scientific UV-VIS spectrometer (model Genesys 10S; Serial #: 2L5R059137) was retrieved from storage. This report shows that the system is performing as required and meeting all QC requirements listed in ANC122 and NF-ANC122

  12. Histopathological changes in relation to cadmium concentration in horse kidneys

    Energy Technology Data Exchange (ETDEWEB)

    Elinder, C.G.; Jonsson, L.; Piscator, M.; Rahnster, B.


    Histopathological changes in kidney cortex, as observed by light microscopy, are related to cadmium concentration in kidney cortex from 69 normal Swedish horses. Cadmium concentrations in kidney ranged from 11 to 186 Cd/g wet wt with an average of 60 Cd/g, which is considerably higher than those normally found in humans. The microscopical changes were rated and related to cadmium concentrations in kidneys by dose-response curves. A relationship existed between frequency of morphological changes and cadmium concentration in the renal cortex. There was no obvious relationship between age and frequency of histopathological changes. This indicates that in horse kidneys morphological changes occur at cadmium concentrations which are lower than the tentative critical level for humans of 200 Cd/g. It is concluded that horses constitute a population at risk for environmental cadmium contamination.

  13. Study on electrokinetic remediation of cadmium contaminated soils

    Institute of Scientific and Technical Information of China (English)

    SHI Wen-xin; CUI Chong-wei; YU Shui-li; FENG Wei-ming


    Kaolinite from a lead-zinc mining district, which was spiked with cadmium, has been treated by electrokinetics to investigate effects of treatment time and applied voltage gradient. The results showed that the increased test duration had induced a higher removal rate of cadmium. Being treated for 7 days, cadmium was removed from kaolinite dramatically. It was also found that higher removal rate happened when a higher voltage gradient was applied and cadmium accumulated near the cathode because pH increased. Increase of pH near the cathode caused accumulation of cadmium. Moreover, it was observed that cation exchange membrane which was placed between kaolinite and cathode could make pH lower than the initial value and avoid the higher pH near the cathode. As a result, the high concentration accumulation of cadmium near the cathode was avoided.

  14. Assessment and management of risk to wildlife from cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Burger, Joanna [Division of Life Sciences, Environmental and Occupational Health Sciences Institute, Consortium for Risk Evaluation with Stakeholder Participation, Rutgers University, Piscataway, New Jersey, 08854-8082 (United States)], E-mail:


    Cadmium, a nonessential heavy metal that comes from natural and anthropogenic sources, is a teratogen, carcinogen, and a possible mutagen. Assessment of potential risk from cadmium requires understanding environmental exposure, mainly from ingestion, although there is some local exposure through inhalation. Chronic exposure is more problematic than acute exposure for wildlife. There is evidence for bioaccumulation, particularly in freshwater organisms, but evidence for biomagnification up the food chain is inconsistent; in some bird studies, cadmium levels were higher in species that are higher on the food chain than those that are lower. Some freshwater and marine invertebrates are more adversely affected by cadmium exposure than are birds and mammals. There is very little experimental laboratory research on the effects of cadmium in amphibians, birds and reptiles, and almost no data from studies of wildlife in nature. Managing the risk from cadmium to wildlife involves assessment (including ecological risk assessment), biomonitoring, setting benchmarks of effects, regulations and enforcement, and source reduction.

  15. Urinary cadmium and mammographic density in premenopausal women. (United States)

    Adams, Scott V; Newcomb, Polly A; Shafer, Martin M; Atkinson, Charlotte; Bowles, Erin J Aiello; Newton, Katherine M; Lampe, Johanna W


    Mammographic density (MD), a strong marker of breast cancer risk, is influenced by genetic, environmental, and hormonal factors. Cadmium, a persistent and widespread environmental pollutant, has been associated with risk of breast cancer, and laboratory evidence suggests cadmium is a carcinogen in the breast. We investigated the hypothesis that cadmium exposure is associated with higher MD. In a cross-sectional study of MD and urinary cadmium concentration, percentage MD (MD%) and Breast Imaging-Reporting and Data Systems (BI-RADS®) density category were determined from screening mammograms of 190 premenopausal women ages 40-45 years. Women completed a health questionnaire, and the cadmium content of spot urine samples was measured with inductively coupled plasma mass spectrometry and corrected for urine creatinine. Urinary cadmium concentrations are thought to reflect exposure to cadmium during a period of 20-30 years. Multivariable linear regression and logistic regression were used to estimate the strength of association between urinary cadmium and mammographic breast density. Adjusted mean MD% among women in the upper tertile of creatinine-corrected urinary cadmium was 4.6% higher (95% CI: -2.3 to 11.6%) than in women in the lowest cadmium tertile. Each twofold increase in urinary cadmium was associated with higher odds of MD% in the upper tertile (OR: 1.29, 95% CI: 0.82-2.02) or a BI-RADS category rating of "extremely dense" (OR: 1.75, 95% CI: 1.14-2.70). Stronger associations were observed among nulliparous women, and current or former smokers. Exposure to cadmium may be associated with increased breast density in premenopausal women.

  16. Evolutionary history of chloridoid grasses estimated from 122 nuclear loci. (United States)

    Fisher, Amanda E; Hasenstab, Kristen M; Bell, Hester L; Blaine, Ellen; Ingram, Amanda L; Columbus, J Travis


    Chloridoideae (chloridoid grasses) are a subfamily of ca. 1700 species with high diversity in arid habitats. Until now, their evolutionary relationships have primarily been studied with DNA sequences from the chloroplast, a maternally inherited organelle. Next-generation sequencing is able to efficiently recover large numbers of nuclear loci that can then be used to estimate the species phylogeny based upon bi-parentally inherited data. We sought to test our chloroplast-based hypotheses of relationships among chloridoid species with 122 nuclear loci generated through targeted-enrichment next-generation sequencing, sometimes referred to as hyb-seq. We targeted putative single-copy housekeeping genes, as well as genes that have been implicated in traits characteristic of, or particularly labile in, chloridoids: e.g., drought and salt tolerance. We recovered ca. 70% of the targeted loci (122 of 177 loci) in all 47 species sequenced using hyb-seq. We then analyzed the nuclear loci with Bayesian and coalescent methods and the resulting phylogeny resolves relationships between the four chloridoid tribes. Several novel findings with this data were: the sister lineage to Chloridoideae is unresolved; Centropodia+Ellisochloa are excluded from Chloridoideae in phylogenetic estimates using a coalescent model; Sporobolus subtilis is more closely related to Eragrostis than to other species of Sporobolus; and Tragus is more closely related to Chloris and relatives than to a lineage of mainly New World species. Relationships in Cynodonteae in the nuclear phylogeny are quite different from chloroplast estimates, but were not robust to changes in the method of phylogenetic analysis. We tested the data signal with several partition schemes, a concatenation analysis, and tests of alternative hypotheses to assess our confidence in this new, nuclear estimate of evolutionary relationships. Our work provides markers and a framework for additional phylogenetic studies that sample more

  17. 29 CFR 794.122 - Ascertainment of “annual” gross sales volume. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Ascertainment of âannualâ gross sales volume. 794.122... Annual Gross Volume of Sales § 794.122 Ascertainment of “annual” gross sales volume. The annual gross volume of sales of an enterprise engaged in the wholesale or bulk distribution of petroleum...

  18. 34 CFR 668.122 - Determination of filing, receipt, and submission dates. (United States)


    ... 34 Education 3 2010-07-01 2010-07-01 false Determination of filing, receipt, and submission dates. 668.122 Section 668.122 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS...

  19. 19 CFR 122.78 - Entry or withdrawal for exportation or for transportation and exportation. (United States)


    ... for exportation or for transportation and exportation. If a shipment is exported under an entry or... 19 Customs Duties 1 2010-04-01 2010-04-01 false Entry or withdrawal for exportation or for transportation and exportation. 122.78 Section 122.78 Customs Duties U.S. CUSTOMS AND BORDER...

  20. 40 CFR 90.122 - Amending the application and certificate of conformity. (United States)


    ... certificate of conformity. 90.122 Section 90.122 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... of conformity. (a) The engine manufacturer must notify the Administrator when either an engine is to be added to a certificate of conformity, an FEL is to be changed, or changes are to be made to...

  1. 25 CFR 170.122 - Can a tribe close a cultural access road? (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Can a tribe close a cultural access road? 170.122 Section... ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Use of Irr and Cultural Access Roads § 170.122 Can a tribe close a cultural access road? (a) A tribe with jurisdiction over a...

  2. 19 CFR 122.186 - Presentation of Customs access seal by other person. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Presentation of Customs access seal by other person. 122.186 Section 122.186 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... Presentation of Customs access seal by other person. If an approved Customs access seal is presented by...

  3. 19 CFR 122.135 - When airline has in-bond liquor storeroom. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false When airline has in-bond liquor storeroom. 122.135...; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Liquor Kits § 122.135 When airline has in-bond... airline involved has an authorized in-bond liquor storeroom may be removed and restocked in the...

  4. 40 CFR 93.122 - Procedures for determining regional transportation-related emissions. (United States)


    ...-zone travel impedances used to distribute trips between origin and destination pairs must be in... transportation-related emissions. 93.122 Section 93.122 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY..., but vehicle miles traveled (VMT) from such projects must be estimated in accordance with...

  5. 41 CFR 102-42.105 - What special information must be included on the SF 122? (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What special information must be included on the SF 122? 102-42.105 Section 102-42.105 Public Contracts and Property Management... and Decorations § 102-42.105 What special information must be included on the SF 122?...

  6. 40 CFR 125.122 - Determination of unreasonable degradation of the marine environment. (United States)


    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Determination of unreasonable degradation of the marine environment. 125.122 Section 125.122 Protection of Environment ENVIRONMENTAL... environment. (a) The director shall determine whether a discharge will cause unreasonable degradation of...

  7. 46 CFR 122.230 - Report of accident to aid to navigation. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Report of accident to aid to navigation. 122.230 Section... Marine Casualties and Voyage Records § 122.230 Report of accident to aid to navigation. Whenever a vessel collides with a buoy, or other aid to navigation under the jurisdiction of the Coast Guard, or is...

  8. 47 CFR 15.122 - Closed caption decoder requirements for digital television receivers and converter boxes. (United States)


    ... television receivers and converter boxes. 15.122 Section 15.122 Telecommunication FEDERAL COMMUNICATIONS...). (i) Predefined window and pen styles. Predefined Window Style and Pen Style ID's may be provided in the DefineWindow command. At a minimum, decoders should implement Predefined Window Attribute Style...

  9. 25 CFR 122.5 - Selection/nomination process for committee members. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Selection/nomination process for committee members. 122.5... OF OSAGE JUDGMENT FUNDS FOR EDUCATION § 122.5 Selection/nomination process for committee members. (a... include a brief statement of interest and qualifications for serving on the committee. (b) Nominations...

  10. 19 CFR 122.23 - Certain aircraft arriving from areas south of the U.S. (United States)


    ... SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Private Aircraft § 122.23 Certain aircraft... from Puerto Rico, must furnish a notice of intended arrival. Private aircraft must transmit an advance notice of arrival as set forth in § 122.22 of this part. Other than private aircraft, all aircraft...

  11. 19 CFR 122.79 - Shipments to U.S. possessions. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Shipments to U.S. possessions. 122.79 Section 122.79 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF...; Electronic Manifest Requirements for Passengers, Crew Members, and Non-Crew Members Onboard...

  12. 19 CFR 122.49 - Correction of air cargo manifest or air waybill. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Correction of air cargo manifest or air waybill. 122.49 Section 122.49 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND...; Electronic Manifest Requirements for Passengers, Crew Members, and Non-Crew Members Onboard...

  13. 19 CFR 122.66 - Clearance or permission to depart denied. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Clearance or permission to depart denied. 122.66 Section 122.66 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... Clearance or permission to depart denied. If advance electronic air cargo information is not received...

  14. β—Correction Spectrophotometric Determination of Cadmium with Cadion

    Institute of Scientific and Technical Information of China (English)



    Cadmium has been determined by β-correction spectrophotometry with cadion,p-nitrobenzenediazoaminoaz-obenzone,and a non-ionic surfactant,tuiton X-100.The real absorbance of a Cd-cadion chelate in the colored solution can be accurately determined and the complex-ratio of cadion with Cd(II) has been worked out to be 2.Beer's law is obeyed over the concentration range of 0-0.20mg/1 cadmium and the detec-tion limit for cadmium is only 0.003mg/1.Satisfactory experimental results are presented with respect to the determination of trace cadmium in wastewaters.



  16. Phytosynthesis of Cadmium Oxide Nanoparticles from Achillea wilhelmsii Flowers

    Directory of Open Access Journals (Sweden)

    Javad Karimi Andeani


    Full Text Available The study here deals with the plant synthesis of cadmium oxide nanoparticles using flowers extract of Achillea wilhelmsii as the reducing agent. The photosynthesis is carried out at room temperature in the laboratory ambience. The aqueous cadmium ions when exposed to flower extract were reduced and resulted in their nanoparticles. The synthesized nanoparticles were characterized using techniques such as scanning electron microscope (SEM, Fourier transform infrared spectroscopy (FTIR, and UV-visible absorption spectroscopy. Stable cadmium oxide nanoparticles were formed by treating aqueous solution of cadmium chloride (CdCl2 with the plant flower extracts as reducing agent.

  17. Ellipsometric Analysis of Cadmium Telluride Films’ Structure

    Directory of Open Access Journals (Sweden)

    Anna Evmenova


    Full Text Available Ellipsometric analysis of CdTe films grown on Si and CdHgTe substrates at the “hot-wall” epitaxy vacuum setup has been performed. It has been found that ellipsometric data calculation carried out by using a simple one-layer film model leads to radical distortion of optical constants spectra: this fact authenticates the necessity to attract a more complicated model that should include heterogeneity of films. Ellipsometric data calculation within a two-layer film model permitted to conclude that cadmium telluride films have an outer layer that consists of the three-component mixture of CdTe, cavities, and basic matter oxide. Ratio of mixture components depends on the time of deposition, that is, on the film thickness. The inner layer consists of cadmium telluride.

  18. Lead, mercury, and cadmium in breast milk


    Kadriye Yurdakök


    Toxic heavy metals are the major source of environmental pollution in this new millennium. Lead, mercury, and cadmium are the most common toxic heavy metals in the environment. There is no known function of these toxic heavy metals in the human body. In females, toxic heavy metals can be accumulated in maternal body before pregnancy and may be transferred to fetus through placenta and later, via breast milk. Lead previously accumulated in maternal bones can be mobilized along with calcium in ...

  19. Mercury Cadmium Selenide for Infrared Detection (United States)


    were grown using elemental mercury (Hg), cadmium (Cd), and selenium (Se) sources. The beam equiva- lent pressure ( BEP ) emanating from all sources was...flux), the BEP measured for the cracker source was found to vary with the cracking zone temperature, tracking with the data found in Ref. 7. This sug...The Se BEP measured for the typical cracking zone temperature of 800 C was found to be close to a factor of two lower than at the typical effusion cell

  20. Electronic origin of structural transition in 122 Fe based superconductors (United States)

    Ghosh, Haranath; Sen, Smritijit; Ghosh, Abyay


    Direct quantitative correlations between the orbital order and orthorhombicity is achieved in a number of Fe-based superconductors of 122 family. The former (orbital order) is calculated from first principles simulations using experimentally determined doping and temperature dependent structural parameters while the latter (the orthorhombicity) is taken from already established experimental studies; when normalized, both the above quantities quantitatively corresponds to each other in terms of their doping as well as temperature variations. This proves that the structural transition in Fe-based materials is electronic in nature due to orbital ordering. An universal correlations among various structural parameters and electronic structure are also obtained. Most remarkable among them is the mapping of two Fe-Fe distances in the low temperature orthorhombic phase, with the band energies Edxz, Edyz of Fe at the high symmetry points of the Brillouin zone. The fractional co-ordinate zAs of As which essentially determines anion height is inversely (directly) proportional to Fe-As bond distances (with exceptions of K doped BaFe2As2) for hole (electron) doped materials as a function of doping. On the other hand, Fe-As bond-distance is found to be inversely (directly) proportional to the density of states at the Fermi level for hole (electron) doped systems. Implications of these results to current issues of Fe based superconductivity are discussed.

  1. Bioaugmentation with cadmium-resistant plant growth-promoting rhizobacteria to assist cadmium phytoextraction by Helianthus annuus. (United States)

    Prapagdee, Benjaphorn; Chanprasert, Maesinee; Mongkolsuk, Skorn


    Micrococcus sp. MU1 and Klebsiella sp. BAM1, the cadmium-resistant plant growth-promoting rhizobacteria (PGPR), produce high levels of indole-3-acetic acid (IAA) during the late stationary phase of their growth. The ability of PGPR to promote root elongation, plant growth and cadmium uptake in sunflowers (Helianthus annuus) was evaluated. Both species of bacteria were able to remove cadmium ions from an aqueous solution and enhanced cadmium mobilization in contaminated soil. Micrococcus sp. and Klebsiella sp. use aminocyclopropane carboxylic acid as a nitrogen source to support their growth, and the minimum inhibitory concentrations of cadmium for Micrococcus sp. and Klebsiella sp. were 1000 and 800mM, respectively. These bacteria promoted root elongation in H. annuus seedlings in both the absence and presence of cadmium compared to uninoculated seedlings. Inoculation with these bacteria was found to increase the root lengths of H. annuus that had been planted in cadmium-contaminated soil. An increase in dry weight was observed for H. annuus inoculated with Micrococcus sp. Moreover, Micrococcus sp. enhanced the accumulation of cadmium in the root and leaf of H. annuus compared to untreated plants. The highest cadmium accumulation in the whole plant was observed when the plants were treated with EDTA following the treatment with Micrococcus sp. In addition, the highest translocation of cadmium from root to the above-ground tissues of H. annuus was found after treatment with Klebsiella sp. in the fourth week after planting. Our results show that plant growth and cadmium accumulation in H. annuus was significantly enhanced by cadmium-resistant PGPRs, and these bacterial inoculants are excellent promoters of phytoextraction for the rehabilitation of heavy metal-polluted environments.

  2. miR-122 targets pyruvate kinase M2 and affects metabolism of hepatocellular carcinoma. (United States)

    Liu, Angela M; Xu, Zhi; Shek, Felix H; Wong, Kwong-Fai; Lee, Nikki P; Poon, Ronnie T; Chen, Jinfei; Luk, John M


    In contrast to normal differentiated cells that depend on mitochondrial oxidative phosphorylation for energy production, cancer cells have evolved to utilize aerobic glycolysis (Warburg's effect), with benefit of providing intermediates for biomass production. MicroRNA-122 (miR-122) is highly expressed in normal liver tissue regulating a wide variety of biological processes including cellular metabolism, but is reduced in hepatocellular carcinoma (HCC). Overexpression of miR-122 was shown to inhibit cancer cell proliferation, metastasis, and increase chemosensitivity, but its functions in cancer metabolism remains unknown. The present study aims to identify the miR-122 targeted genes and to investigate the associated regulatory mechanisms in HCC metabolism. We found the ectopic overexpression of miR-122 affected metabolic activities of HCC cells, evidenced by the reduced lactate production and increased oxygen consumption. Integrated gene expression analysis in a cohort of 94 HCC tissues revealed miR-122 level tightly associated with a battery of glycolytic genes, in which pyruvate kinase (PK) gene showed the strongest anti-correlation coefficient (Pearson r = -0.6938, p = <0.0001). In addition, reduced PK level was significantly associated with poor clinical outcomes of HCC patients. We found isoform M2 (PKM2) is the dominant form highly expressed in HCC and is a direct target of miR-122, as overexpression of miR-122 reduced both the mRNA and protein levels of PKM2, whereas PKM2 re-expression abrogated the miR-122-mediated glycolytic activities. The present study demonstrated the regulatory role of miR-122 on PKM2 in HCC, having an implication of therapeutic intervention targeting cancer metabolic pathways.

  3. miR-122 targets pyruvate kinase M2 and affects metabolism of hepatocellular carcinoma.

    Directory of Open Access Journals (Sweden)

    Angela M Liu

    Full Text Available In contrast to normal differentiated cells that depend on mitochondrial oxidative phosphorylation for energy production, cancer cells have evolved to utilize aerobic glycolysis (Warburg's effect, with benefit of providing intermediates for biomass production. MicroRNA-122 (miR-122 is highly expressed in normal liver tissue regulating a wide variety of biological processes including cellular metabolism, but is reduced in hepatocellular carcinoma (HCC. Overexpression of miR-122 was shown to inhibit cancer cell proliferation, metastasis, and increase chemosensitivity, but its functions in cancer metabolism remains unknown. The present study aims to identify the miR-122 targeted genes and to investigate the associated regulatory mechanisms in HCC metabolism. We found the ectopic overexpression of miR-122 affected metabolic activities of HCC cells, evidenced by the reduced lactate production and increased oxygen consumption. Integrated gene expression analysis in a cohort of 94 HCC tissues revealed miR-122 level tightly associated with a battery of glycolytic genes, in which pyruvate kinase (PK gene showed the strongest anti-correlation coefficient (Pearson r = -0.6938, p = <0.0001. In addition, reduced PK level was significantly associated with poor clinical outcomes of HCC patients. We found isoform M2 (PKM2 is the dominant form highly expressed in HCC and is a direct target of miR-122, as overexpression of miR-122 reduced both the mRNA and protein levels of PKM2, whereas PKM2 re-expression abrogated the miR-122-mediated glycolytic activities. The present study demonstrated the regulatory role of miR-122 on PKM2 in HCC, having an implication of therapeutic intervention targeting cancer metabolic pathways.

  4. Bioavailability of cadmium from linseed and cocoa

    DEFF Research Database (Denmark)

    Hansen, Max; Rasmussen, Rie Romme; Sloth, Jens Jørgen


    for the food authorities in order to give correct advises to the population. The aim of this study was to investigate the bioavailability of cadmium from whole linseed, crushed linseed, cocoa and cadmium chloride in rats. An experiment where 40 rats were divided into 4 groups and a control group and dosed...... with whole linseed, crushed linseed, cocoa and CdCl2 for 3 weeks was performed. Linseed or cocoa made up 10% of the feed (by weight) and was added as a replacement for carbohydrate source. The rats were dosed for 3 weeks and the cadmium content in the rats' kidneys was measured by ICPMS as a biomarker...... be measured in the kidney compared to the calculated total intake was as follows: Control 2.0 %, Crushed linseed 0.9 %, whole linseed, 1.5 %, cocoa 0.7 % and CdCl2 4.6 %. Based on this study it could not be concluded that the bioavailability in rats form whole linseed is lower that for crushed linseed...

  5. Occupation, cadmium exposure, and prostate cancer. (United States)

    Elghany, N A; Schumacher, M C; Slattery, M L; West, D W; Lee, J S


    A population-based case-control study was used to investigate associations between prostate cancer and cadmium exposure, longest industry held, and longest occupation held. The study included 358 men with newly diagnosed prostate cancer and 679 control men identified from the Utah population. Occupational exposures to cadmium were ascertained from self-reported data, through several a priori suspect industries and occupations, through an occupation-exposure linkage system, and through dietary food frequency questionnaires. Overall, cadmium exposure appeared to result in a small increased relative risk for prostate cancer, most apparent for aggressive tumors (OR = 1.7, CI = 1.0-3.1 for any occupational exposure, high dietary intake, or smoking cigarettes). Cases were more likely to have worked in the following industries: mining, paper and wood, medicine and science, and entertainment and recreation. Among men younger than 67, cases were also more likely to have worked in the food and tobacco industries (OR = 3.6, CI = 1.0-12.8). Cases were less likely to have worked in industries involved with glass, clay and stone, or rubber, plastics, and synthetics. Men employed as janitors and in other building service occupations showed increased relative risk for aggressive tumors (OR = 7.0, CI = 2.5-19.6). Agricultural occupations did not appear to be related to prostate cancer, although an increased relative risk for aggressive tumors was detected among younger men (OR = 2.6, CI = 0.6-12.1).

  6. Soil ecotoxicity assessment using cadmium sensitive plants

    Energy Technology Data Exchange (ETDEWEB)

    An, Youn-Joo


    The crop plants, sorghum and cucumber, can be used as indicator species to assess ecotoxicity of soils contaminated by cadmium. - Four crop plant species (sweet corn, Zea may; wheat, Triticum aestivum; cucumber, Cucumis sativus; and sorghum, Sorghum bicolor) were tested to assess an ecotoxicity in cadmium-amended soils. The measurement endpoints used were seed germination and seedling growth (shoot and root). The presence of cadmium decreased the seedling growth. The medium effective concentration values (EC50) for shoot or root growth were calculated by the Trimmed Spearman-Karber method. Due to the greater accumulation of Cd to the roots, root growth was a more sensitive endpoint than shoot growth. Bioavailability and transport of Cd within plant were related to concentration and species. The ratio of bioaccumulation factor (BAF) in the shoots to the roots indicated high immobilization of Cd in the roots. Seed germination was insensitive to Cd toxicity, and is not recommended for a suitable assay. Among the test plants and test endpoints, root growth of sorghum and cucumber appears to be a good protocol to assess ecotoxicity of soils contaminated by Cd.

  7. Cadmium and zinc in pregnancy and lactation

    Energy Technology Data Exchange (ETDEWEB)

    Lucis, O.J.; Lucis, R.; Shaikh, Z.A.


    Radioactive cadmium (/sup 109/Cd) and zinc (/sup 65/Zn) were injected subcutaneously into pregnant rats. More cadmium than zinc was found in the placentae. After birth, newborns showed detectable /sup 109/Cd only in liver, gastrointestinal tract, and in the brain tissue. Zinc 65 was present in all newborns' tissues. During lactation, highest output of /sup 65/Zn was in colostrum and, on subsequent days, /sup 65/Zn in milk declined rapidly. Cadmium 109 in milk was present in low concentration throughout the lactation period. Rats injected with /sup 109/Cd and /sup 65/Zn after parturition excreted these isotopes in milk in a similiar pattern. Newborns nursed on radioactive milk showed rapid absorption of /sup 65/Zn, whereas /sup 109/Cd accumulated primarily in the intestinal tract; a lesser quantity of /sup 109/Cd was deposited in the liver. In other organs, only /sup 65/Zn was found. The lactating mammary gland contained more /sup 109/Cd than /sup 65/Zn; after lactation, /sup 65/Zn was depleted, whereas /sup 109/Cd remained in mammary tissue.

  8. Clinical analysis on 122 cases of placental abruption%胎盘早剥122例临床分析

    Institute of Scientific and Technical Information of China (English)

    陈娟; 崔世红; 孙俊燕; 杭中霞; 李园园; 高亚楠; 职云晓; 申琳娜


    Objective To investigate the causes of placental abruption and clinical manifestations,diagnosis and outcome. Methods A retrospective study of 122 cases of placental abruption in the third affiliated hospital of Zhengzhou university from Jan. 2014 to Nov. 2014 was conductded. Results Placental abruption occurred at a rate of 1. 5% ,among them typical placental abruption groups were 62 cases,the atypical groups were 60 cases;Tended to merge pregnancy-in-duced hypertension disease. The incidence rates of vaginal bleeding,uterine high,cardiac anomalies,bloody amniotic flu-id,asphyxia of newborn,postparbum hemorrhage,placental apoplexy,premature birth in typical groups of placental abrup-tion were higher than that in atypical placental abruption group(all P < 0. 05). Conclusions Clinical manifestation of pla-cental abruption is complex,great damage to the maternal and infant,we should attache great importance to the cause, combined with the auxiliary examination,find active treatment so as to improve outcome as early as possible.%目的:探讨胎盘早剥的主要病因以及胎盘早剥患者的临床表现和妊娠结局。方法对2014年1月至2014年11月郑州大学第三附属医院收治的122例胎盘早剥患者的临床资料进行回顾性分析。结果本研究胎盘早剥发生率为1.5%,其中典型胎盘早剥62例,不典型胎盘早剥60例;合并妊娠高血压疾病者居多。典型胎盘早剥组在阴道出血、子宫高张、胎心异常、血性羊水、新生儿窒息、产后出血、胎盘卒中、早产等方面比例明显高于不典型胎盘早剥组(P <0.05)。结论胎盘早剥临床表现复杂,对母婴危害大,应重视诱因,结合辅助检查,做到尽早发现积极治疗从而改善母婴结局。

  9. Influence of a high level of dietary cadmium on cadmium content in milk, excretion, and cow performance

    Energy Technology Data Exchange (ETDEWEB)

    Miller, W.J.; Lampp, B.; Powell, G.W.; Salotti, C.A.; Blackmon, D.M.


    Three Holstein cows were each given 3.0 g of cadmium daily (two equal doses) for two weeks by gelatin capsules. There was a sharp drop in concentrate consumption for the first few days of cadmium administration but, by the second week, consumption returned to normal. Milk production declined sharply for several days and then increased appreciably, but to a level still substantially lower than that of controls during the last five days cadmium was given. When cadmium treatments ceased, milk production increased by 50%. Fat content of milk was elevated considerably during the week when production was most reduced. Cows given cadmium lost considerable weight. There were no other clinical manifestations of toxicity. As determined by the chromic oxide indicator method and twice-daily grab samples, fecal excretion of cadmium for the second week averaged 82% of that given. The cadmium level in the urine was below the limits of detectability of the method (0.5 ppm of urine). The cadmium content of the milk was less than 0.1 ppm of the milk, which was the lower reliability limit of the procedure used. On this basis less than 0.22% of the amount administered appeared in the milk. In vitro studies demonstrated that cadmium combines with the casein and whey protein fractions of the milk readily, with the amount combined being linear when levels from 1.0 to 25.0 ppm are added to milk. Smaller amounts were present in the lactose and mineral fractions.

  10. Correlative characteristic of cadmium in soils of steppe Dnieper region

    Directory of Open Access Journals (Sweden)

    N. M. Tsvetkova


    Full Text Available Much attention is paid to searching for methods of establishing environmental standards for objective assessment of admissibility of anthropogenic load on the biosphere. The main pollutants of the environment are xenobiotics; heavy metals such as cadmium occupy hold a special place among them. Cadmium is one of the most dangerous environmental toxic agents, belonging to the 1stclass of hazard. Due to insufficient and fragmented information available on the distribution of cadmium in the city edaphotopes, it’s necessary to conduct additional research, taking into account the properties of soils and the biological characteristics of every element. The paper shows the ratio of cadmium in soils and soil-forming rocks of steppe Dnieper region. Environmental assessment of cadmium content in Dniprodzerzhinsk city soilsis made, and the problem of topsoil contamination of the city as a territory of high anthropogenic load is considered. It is found that the content of cadmium down the profile in natural soil increases. Enrichment of the topsoil with cadmium occurs due to contamination. The value of movable forms content, expressed as a percentage of the total content, varies from 12% to 70%, providing the evidence of the technogenic origin of cadmium in Dniprodzerzhinsk city topsoil. General and proximate correlation analyses of interrelation of soil cadmium and specifically selected characteristics of soil (pH, humus, sulfate ions, dry solid, chloride ions, total alkalinity, hygroscopic moisture were made. It is established that cadmium concentration in the movable forms of natural soils of the steppe Dnieper region depends primarily on pH value. With the increase in pH value, concentration of movable cadmium in soil increases.

  11. Cadmium induces transcription independently of intracellular calcium mobilization.

    Directory of Open Access Journals (Sweden)

    Brooke E Tvermoes

    Full Text Available BACKGROUND: Exposure to cadmium is associated with human pathologies and altered gene expression. The molecular mechanisms by which cadmium affects transcription remain unclear. It has been proposed that cadmium activates transcription by altering intracellular calcium concentration ([Ca(2+](i and disrupting calcium-mediated intracellular signaling processes. This hypothesis is based on several studies that may be technically problematic; including the use of BAPTA chelators, BAPTA-based fluorescent sensors, and cytotoxic concentrations of metal. METHODOLOGY/PRINCIPAL FINDING: In the present report, the effects of cadmium on [Ca(2+](i under non-cytotoxic and cytotoxic conditions was monitored using the protein-based calcium sensor yellow cameleon (YC3.60, which was stably expressed in HEK293 cells. In HEK293 constitutively expressing YC3.60, this calcium sensor was found to be insensitive to cadmium. Exposing HEK293::YC3.60 cells to non-cytotoxic cadmium concentrations was sufficient to induce transcription of cadmium-responsive genes but did not affect [Ca(2+](i mobilization or increase steady-state mRNA levels of calcium-responsive genes. In contrast, exposure to cytotoxic concentrations of cadmium significantly reduced intracellular calcium stores and altered calcium-responsive gene expression. CONCLUSIONS/SIGNIFICANCE: These data indicate that at low levels, cadmium induces transcription independently of intracellular calcium mobilization. The results also support a model whereby cytotoxic levels of cadmium activate calcium-responsive transcription as a general response to metal-induced intracellular damage and not via a specific mechanism. Thus, the modulation of intracellular calcium may not be a primary mechanism by which cadmium regulates transcription.

  12. Targeting microRNA-122 to Treat Hepatitis C Virus Infection

    Directory of Open Access Journals (Sweden)

    Catherine L. Jopling


    Full Text Available An important host factor for hepatitis C virus (HCV is microRNA-122 (miR-122. miR-122 is a liver-specific member of a family of small, non-coding RNA molecules known as microRNAs that play major roles in the regulation of gene expression by direct interaction with RNA targets. miR-122 binds directly to two sites in the 5′ untranslated region (UTR of HCV RNA and positively regulates the viral life cycle. The mechanism by which this regulation occurs is still not fully understood. There has been a great deal of interest in potential therapeutics based on small RNAs, and targeting miR-122 to combat HCV is one of the furthest advanced. Chemical inhibitors of miR-122 can be introduced into mammals intravenously and result in potent and specific knockdown of the microRNA, with no detectable adverse effects on liver physiology. This strategy was recently applied to chimpanzees chronically infected with HCV and resulted in a sustained reduction in viral load in the animals. Inhibition of miR-122 therefore presents a very attractive novel approach to treating HCV, a virus for which improved therapeutics are urgently needed.

  13. Cadmium in the environment: a toxicological and epidemiological appraisal

    Energy Technology Data Exchange (ETDEWEB)

    Friberg, L.; Piscator, M.; Nordberg, G.


    This book is a review of the toxicity of cadmium, and has focused on information considered important for understanding the toxic action of cadmium on animals and man. Dose-response relationships are discussed as are effects on specific organ systems and modes of uptake.

  14. Cadmium Removal from Aqueous Solutions by Ground Pine Cone

    Directory of Open Access Journals (Sweden)

    H Izanloo, S Nasseri


    Full Text Available A study on the removal of cadmium ions from aqueous solutions by pine cone was conducted in batch conditions. Kinetic data and equilibrium removal isotherms were obtained. The influence of different experimental parameters such as contact time, initial concentration of cadmium, pine cone mass and particle size, and temperature on the kinetics of cadmium removal was studied. Results showed that the main parameters that played an important role in removal phenomenon were initial cadmium concentration, particle size and pine cone mass. The necessary time to reach equilibrium was between 4 and 7 hours based on the initial concentration of cadmium. The capacity of cadmium adsorption at equilibrium increased with the decrease of pine cone particle size. The capacity of cadmium adsorption at equilibrium by pine cone increased with the quantity of pine cone introduced (1–4 g/L. Temperature in the range of 20-30°C showed a restricted effect on the removal kinetics (13.56 mg/g at 20°C and a low capacity of adsorption about 11.48 mg/g at 30°C. The process followed pseudo second-order kinetics. The cadmium uptake of pine cone was quantitatively evaluated using adsorption isotherms. Results indicated that the Langmuir model gave a better fit to the experimental data in comparison with the Freundlich equation.

  15. Drikkevands optagelse af cadmium og bly fra armaturer

    DEFF Research Database (Denmark)

    Nielsen, K.

    Notatet omfatter rapporter fra to forsøgsrækker vedr. brugsvands optagelse af bly og cadmium. Den første omhandler brugsvandsarmaturers afgivelse af bly og cadmium til syntetisk brugsvand med en sammensætning svarende til en sur, blød vandtype. Forsøgene omfatter 10 armaturer og armaturdele...

  16. Removing cadmium from electroplating wastewater by waste saccharomyces cerevisiae

    Institute of Scientific and Technical Information of China (English)

    DAI Shu-juan; WEI De-zhou; ZHOU Dong-qin; JIA Chun-yun; WANG Yu-juan; LIU Wen-gang


    The appropriate condition and scheme of removing cadmium from electroplating wastewater were investigated by adsorption-precipitation method using waste saccharomyces cerevisiae(WSC) as sorbent. Effect factors on biosorption of cadmium in cadmium-containing electroplating wastewater by waste saccharomyces cerevisiae and precipitation process of waste saccharomyces cerevisiae after adsorbing cadmium were studied. The results show that removal rate of cadmium is over 88% after 30 min adsorbing under the condition of cadmium concentration 26 mg/L, the dosage of waste saccharomyces cerevisiae 16.25 g/L, temperature 18 ℃, pH 6.0 and precipitation time 4 h. Biosorption-precipitation method is effective to remove cadmium in cadmium-containing electroplating wastewater by waste saccharomyces cerevisiae. The SEM, infrared spectroscopy and Zeta-potential of the cells show that chemical chelating is the main adsorption form; electrostatic attraction, hydrogen bonding and van der Waals force all function in adsorption process; and ―NH2―,―C=O―,―C=O―NH―,―CH3, ―OH are the main adsorption groups.

  17. Cadmium and zinc reversibly arrest development of Artemia larvae

    Energy Technology Data Exchange (ETDEWEB)

    Bagshaw, J.C.; Rafiee, P.; Matthews, C.O.; MacRae, T.H.


    Despite the widespread distribution of heavy metals such as cadmium and zinc in the environment and their well-known cytotoxicity and embryotoxicity in mammals, comparatively little is known about their effect on aquatic organisms, particularly invertebrates. Post-gastrula and early larval development of the brine shrimp, Artemia, present some useful advantages for studies of developmental aspects of environmental toxicology. Dormant encysted gastrulae, erroneously called brine shrimp eggs, can be obtained commercially and raised in the laboratory under completely defined conditions. Following a period of post-gastrula development within the cyst, pre-nauplius larvae emerge through a crack in the cyst shell. A few hours later, free-swimming nauplius larvae hatch. Cadmium is acutely toxic to both adults and nauplius larvae of Artemia, but the reported LC50s are as high as 10 mM, depending on larval age. In this paper the authors show that pre-nauplius larvae prior to hatching are much more sensitive to cadmium than are hatched nauplius larvae. At 0.1, cadmium retards development and hatching of larvae; higher concentrations block hatching almost completely and thus are lethal. However, the larvae arrested at the emergence stage survive for 24 hours or more before succumbing to the effects of cadmium, and during this period the potentially lethal effect is reversible if the larvae are placed in cadmium-free medium. The effects of zinc parallel those of cadmium, although zinc is somewhat less toxic than cadmium at equal concentrations.

  18. Epigenetic Effects of Cadmium [Abstract and Poster 2014 (United States)

    We have reviewed the literature on in vitro and in vivo experiments as well as human studies on cadmium to understand the epigenetic mechanisms involved in cadmium- induced toxicity and carcinogenicity. This presentation will identify gaps in our current understanding and suggest...

  19. Cadmium inhibits neurogenesis in zebrafish embryonic brain development

    Energy Technology Data Exchange (ETDEWEB)

    Chow, Elly Suk Hen [Division of Biology, California Institute of Technology, 1200 California Boulevard, Pasadena, CA 91125 (United States); Hui, Michelle Nga Yu; Lin Chunchi [Department of Biology and Chemistry, City University of Hong Kong, 83 Tat Chee Avenue, Kowloon, Hong Kong (China); Cheng Shukhan [Department of Biology and Chemistry, City University of Hong Kong, 83 Tat Chee Avenue, Kowloon, Hong Kong (China)], E-mail:


    Cadmium is a non-essential heavy metal found abundantly in the environment. Children of women exposed to cadmium during pregnancy display lower motor and perceptual abilities. High cadmium body burden in children is also related to impaired intelligence and lowered school achievement. However, little is known about the molecular and cellular basis of developmental neurotoxicity in the sensitive early life stages of animals. In this study, we explore neurological deficits caused by cadmium during early embryonic stages in zebrafish by examining regionalization of the neural tube, pattern formation and cell fate determination, commitment of proneural genes and induction of neurogenesis. We show that cadmium-treated embryos developed a smaller head with unclear boundaries between the brain subdivisions, particularly in the mid-hindbrain region. Embryos display normal anterior to posterior regionalization; however, the commitment of neural progenitor cells was affected by cadmium. We observe prominent reductions in the expression of several proneuronal genes including ngn1 in cell clusters, zash1a in the developing optic tectum, and zash1b in the telencephalon and tectum. Cadmium-treated embryos also have fewer differentiated neurons and glia in the facial sensory ganglia as indicated by decreased zn-12 expression. Also, a lower transcription level of neurogenic genes, ngn1 and neuroD, is observed in neurons. Our data suggest that cadmium-induced neurotoxicity can be caused by impaired neurogenesis, resulting in markedly reduced neuronal differentiation and axonogenesis.

  20. Cadmium-induced ectopic apoptosis in zebrafish embryos

    Energy Technology Data Exchange (ETDEWEB)

    Chan, Po Kwok; Cheng, Shuk Han [Department of Biology and Chemistry, City University of Hong Kong, 83 Tat Chee Avenue, Kowloon (Hong Kong)


    In this study, we tested the hypothesis that cadmium-induced developmental toxicity was mediated via ectopic occurrence of apoptosis during embryonic development. We employed confocal microscopy to acquire images of whole-mount staining of apoptotic cells in zebrafish embryo exposed to 100 {mu}M cadmium from 5 hours post fertilisation (hpf) to 28 hpf. Three-dimensional reconstruction of the images was performed and the spatial and temporal distributions of apoptotic cells in the embryos were compared. In cadmium-treated embryos with varying degrees of gross developmental malformations, significantly higher numbers of apoptotic cells were detected with this method. In order to detect the precise locations of apoptotic cells, we performed terminal deoxynucleotidyl transferase-mediated dUTP nick end labelling (TUNEL) assay in sectioned embryos. In the degenerating neural tube of cadmium-treated embryos apoptotic cells were detected, while in the healthy neural tube of the untreated controls no apoptotic cells were found. We then employed flow cytometry to investigate whether cadmium exposure would affect the dynamics of apoptosis or induce any abnormalities in cell-cycle progression. It appeared that cadmium did not induce cell-cycle arrest. The percentages of apoptotic cells did not differ in the two groups at 13, 16 or 19 hpf. At 28 hpf, however, a significantly higher percentage of apoptotic cells were found in the cadmium-treated group. Exposure to cadmium, therefore, induced ectopic apoptosis at 28 hpf without affecting the dynamics of apoptosis at earlier developmental stages. (orig.)

  1. Risk of overestimation of urinary cadmium concentrations: interference from molybdenum

    Directory of Open Access Journals (Sweden)

    Cañas A.I.


    Full Text Available We show here that the selection of analytical method is critical when measuring low levels of cadmium in human urine. Cadmium is today usually analyzed by Inductively Coupled Plasma Mass Spectrometry (ICP-MS, which has a higher sensitivity than Atomic Absorption Spectroscopy (AAS. ICP-MS cadmium measurements show interference from tin (114Sn and molybdenum oxides, which can result in an overestimation of cadmium levels. The 114Sn interference is stable and can be mathematically corrected. Molybdenum concentrations in urine are variable and different from individual to individual. We have estimated the degree of error which molybdenum interference introduces in the measurement of cadmium in urine by conventional ICP-MS. 268 urine samples from mothers and their children were measured. Removal of the molybdenum oxide interference (DRC-ICP-MS method reduced urinary cadmium concentrations significantly (47.8%. The urinary molybdenum concentration in children was higher than in their mothers, resulting in greater overestimation. Our results clearly show that the DRC method is essential for reliable measurements of urinary cadmium concentrations, particularly in children. Furthermore, care should be taken when comparing Human Biomonitoring data for cadmium in urine and attention should be paid to which analytical method has been used (e.g. AAS and ICP-Ms, and especially if the measurements have been corrected for molybdenum interference.

  2. Exposure-response analysis to assess concentration–QTc relationship of CC-122

    Directory of Open Access Journals (Sweden)

    Li Y


    Full Text Available Yan Li, Leonidas N Carayannopoulos, Michael Thomas, Maria Palmisano, Simon Zhou Translational Development and Clinical Pharmacology, Celgene Corporation, Summit, NJ, USA Abstract: CC-122 hydrochloride is a novel pleiotropic pathway modifier compound that binds cereblon, a substrate receptor of the Cullin 4 RING E3 ubiquitin ligase complex. CC-122 has multiple activities including modulation of immune cells, antiproliferative activity of multiple myeloma and lymphoma cells, and antiangiogenic activity. CC-122 is being developed as an oncology treatment for hematologic malignancies and advanced solid tumors. Cardiovascular and vital sign assessments of CC-122 have been conducted in hERG assays in vitro and in a 28-day good laboratory practice monkey study with negative signals. To assess the potential concentration–QTc relationship in humans and to ascertain or exclude a small QT effect by CC-122, a plasma concentration exposure- and ΔQTcF-response model of CC-122 was developed. Intensive CC-122 concentration and paired triplicate electrocardiogram data from a single ascending dose study were included in the analysis. The parameters included in the final linear exposure-response model are intercept, slope, and treatment effect. The slope estimate of 0.0201 with 90% CI of (0.009, 0.035 indicates a weak relationship between ΔQTcF and CC-122 concentration. The upper bounds of the 90% CI of the model-predicted ΔΔQTcF effect at Cmax from the 4 mg clinical dose and the supratherapeutic dose of 15 mg (1.18 ms and 8.76 ms, respectively are <10 ms threshold, suggesting that the risk of CC-122 QT prolongation effect at the relevant therapeutic dose range from 1 mg to 4 mg is low. Keywords: cardiovascular assessment, QT prolongation effect

  3. Cadmium chronic administration to lactating ewes. Reproductive performance, cadmium tissue accumulation and placental transfer

    Energy Technology Data Exchange (ETDEWEB)

    Floris, B.; Bomboi, G.; Sechi, P.; Marongiu, M. L. [Sassari Univ., Sassari (Italy). Dipt. di Biologia Animale; Pirino, S. [Sassari Univ., Sassari (Italy). Ist. di Patologia Generale, Anatomia Patologica e Clinica Ostetrico-chirurgica Veterinaria


    20 lactating ewes were allotted to two groups: 10 subjects received orally 100 mg/day of CdCl{sub 2} for 108 consecutive days, and the remaining 10 acted as control. Reproductive performance in ewes and cadmium tissue accumulation, both in ewes and their lambs, were investigated. The results showed that in ewes: 1) the regular cadmium intestinal intake negatively influences all reproductive parameters; 2) cadmium is particularly accumulated in kidney and liver, bur also in mammary gland, although at distinctly lower level; 3) chronic administration does not increase cadmium placental transfer in lactating pregnant subjects. [Italian] 20 pecore in lattazione sono state suddivise in 2 gruppi: 10 soggetti ricevettero per os 100 mg/giorno di CdCl{sub 2} per 108 giorni consecutivi, e i restanti 10 funsero da controllo. Sono stati studiati i parametri riproduttivi delle pecore e l'accumulo di cadmio nei tessuti, sia delle pecore che dei loro agnelli. I risultati hanno mostrato che negli ovini: 1) il regolare assorbimento intestinale di cadmio influenza negativamente tutti i parametri riproduttivi; 2) il cadmio viene accumulato principalmente nei reni e nel fegato, ma anche dalla ghiandola mammaria, sebbene in misura nettamente inferiore; 3) la somministrazione cronica di cadmio nei soggetti gravidi non incrementa il suo passaggio transplacentare.

  4. The effect of phosphate fertilizer cadmium on cadmium in soils and crops

    NARCIS (Netherlands)

    Smilde, K.W.; Luit, van B.


    Een van de oorzaken, waardoor bodemvervuiling met cadmium optreedt en dus een bevordering van cadmiumopname door het gewas, is toepassing van fosfaatkunstmest, waarin zich verschillende gehaltes van dit zware metaal bevinden. Dit rapport behandelt het onderzoek naar de stijging van het cadmiumgehalt


    Biosolids and Cd salt-amended soils were collected from a long-term field experiment established in 1976. Cadmium sorption experiments were conducted on different fractions of soils amended with biosolids, Cd salt, and unamended soils (control). The organic carbon (OC) of soils ...

  6. Comparison of toxicity and disposition of cadmium chloride and cadmium metallothionein in rats.

    NARCIS (Netherlands)

    Groten, J.P.


    In Chapter 1 of this thesis a general introduction is presented with a survey of the literature. It gives a brief overview of the factors involved in the absorption, metabolism and toxicity of Cd after oral intake.In short, the main source of environmental exposure to cadmium for no

  7. Duplication of the segment q12.2 leads to qter of chromosome 22 due to paternal inversion 22(p13q12.2). (United States)

    Fujimoto, A; Wilson, M G; Towner, J W


    A 1730-g male infant, born at 37 weeks gestation, had multiple congenital anomalies, consisting of microcephaly, hypertelorism, bilateral cleft lip and palate, micrognathia, low-set ears, and cryptorchidism. Chromosome analysis showed a recombinant 22 derived from the paternal inversion (22)(p13q12.2). The proband's karyotype is 46,XY,rec(22),dup q,inv(22)(p13q12.2)pat, which has a duplication of q12.2 leads to qter. An identical recombinant has been reported in a female infant in Mexico whose mother was a carrier of the inversion. Similar congenital anomalies present in these two patients demonstrate the phenotype of duplication of the distal long arm 22. This report also documents the occurrence of an identical inversion in two apparently unrelated Mexican families.

  8. Serum beta2-microglobulin in cadmium exposed workers. (United States)

    Piscator, M


    In cadmium exposed workers with renal tubular dysfunction the determination of beta2m in urine is an important diagnostic test. Cadmium exposure's influence on serum beta2m levels and its relationship to urinary excretion of beta2m were studied in 24 cadmium exposed workers with normal serum creatinine levels (less than 10 mg/l)) and no obvious tubular dysfunction. With increasing blood levels of cadmium beta2m was found to increase in serum. There was no concomitant increase in the urinary excretion of beta2m. Serum beta2m was not dependent on serum creatinine within the range studied. The results suggest that for evaluating renal glomerular function in cadmium exposed workers, it might be better to use the serum creatinine level, creatinine clearance or inulin clearance since beta2m might give some false positive results.

  9. Determination of the cadmium and copper content inherent to metallothionein

    Energy Technology Data Exchange (ETDEWEB)

    Raspor, B.; Kozar, S.; Pavicic, J.; Juric, D. [Ruder Boskovic Institute, Center for Marine Research Zagreb, P.O.B. 1016, HR-10 001 Zagreb (Croatia)


    The reliability of the voltammetric determination of the cadmium and copper content (at pH 1.0), inherent to metallothionein (MT) isolated from the digestive gland of Mytilus galloprovincialis, was investigated. An artifact signal enhancement of copper, caused by the cupric-thionein complex adsorption at the mercury electrode, was established. This artifact was removed by UV-digestion of the sample for 15-20 h prior to analysis. A similar artifact was not detected for cadmium, because at this pH the cadmium-thionein complex has dissociated, and cadmium exists in the ionic form. Therefore, the voltammetric analysis of the cadmium content can be performed directly at pH 1.0, without prior UV-digestion of the sample. (orig.) With 3 figs., 1 tab., 12 refs.

  10. Effect of pregnancy on cadmium-treated rats

    Energy Technology Data Exchange (ETDEWEB)

    Takizama, Y. (Akita Univ. School of Medicine, Japan); Nakamura, I.; Kurayama, R.; Hirasawa, F.; Kawai, K.


    It is well known that itai-itai disease with the osteopathy is broken out among multiparas, 40 years of age and up Japanese residents. In this paper we described an experimental study of effect of pregnancy on cadmium treated rats. Female mature rats were administered drinking water containing 50 and 200 ppm cadmium as CdCl/sub 2/. During 180 days of the experiment, three times of pregnancy were succesful, though slight depression of body weight gain was noticed in the 200 ppm group. The cadmium was accumulated in the kidneys, liver and bone proportionally to the amount of cadmium administered. No significant change was recognized in serum calcium, phosphorus and alkaline phosphatase levels after 180 days. Though cadmium 200 ppm treated rats showed slight histological lesions in the proximal convoluted tubules of the kidney, there appeared to be no osteomalacia including excess formation of osteoid tissue.

  11. Synthesis of cadmium chalcogenide nanotubes at room temperature

    KAUST Repository

    Pan, Jun


    Cadmium chalcogenide (CdE, E=S, Se, Te) polycrystalline nanotubes have been synthesized from precursor of CdS/cadmium thiolate complex at room temperature. The precursor was hydrothermally synthesized at 180 °C using thioglycolic acid (TGA) and cadmium acetate as starting materials. The transformation from the rod-like precursor of CdS/cadmium thiolate complex to CdS, CdSe and CdTe nanotubes were performed under constant stirring at room temperature in aqueous solution containing S 2-, Se 2- and Te 2-, respectively. The nanotube diameter can be controlled from 150 to 400 nm related to the dimension of templates. The XRD patterns show the cadmium chalcogenide nanotubes all corresponding to face-centered cubic structure. © 2012 Elsevier B.V. All rights reserved.

  12. Chronic cadmium poisoning in a pigment manufacturing plant

    Energy Technology Data Exchange (ETDEWEB)

    De Silva, P.E.; Donnan, M.B.


    When the working environment in a small cadmium-pigment manufacturing plant was investigated, cadmium concentrations in respirable dust were found to be considerably above the hygiene standard recommended by the British Occupational Hygiene Society. Cadmium concentrations in blood and urine of exposed workers, both present and past employees, were determined. The six men who had worked in the production plant for seven years or more all showed signs of renal tubular damage. On the basis of the results of the investigations on individuals in this study, it is suggested that urinary cadmium concentrations should be kept below 15 microgram/day to avoid the possibility of renal damage, and that the insoluble respirable fraction of cadmium dust should not be regarded as merely nuisance dust.

  13. Adsorption of cadmium from aqueous solutions by perlite. (United States)

    Mathialagan, T; Viraraghavan, T


    The present study examined the use of perlite for the removal of cadmium from aqueous solutions. The effects of pH and contact time on the adsorption process were examined. The optimum pH for adsorption was found to be 6.0. Residual cadmium concentration reached equilibrium in 6h and the rate of cadmium adsorption by perlite was rapid in the first hour of the reaction time. Ho's pseudo-second-order model best described the kinetics of the reaction. Batch adsorption experiments conducted at room temperature (22+/-1 degrees C) showed that the adsorption pattern followed the Freundlich isotherm model. The maximum removal of cadmium obtained from batch studies was 55%. Thomas model was used to describe the adsorption data from column studies. The results generally showed that perlite could be considered as a potential adsorbent for cadmium removal from aqueous solutions.

  14. Cadmium adsorption in montmorillonite as affected by glyphosate

    Institute of Scientific and Technical Information of China (English)

    WANG Yu-jun; ZHOU Dong-mei; LUO Xiao-san; SUN Rui-juan; CHEN Huai-man


    Behaviors of soil heavy metals are often affected by coexisting herbicides due to their physical and chemical interaction. Effect of glyphosate, an herbicide containing -PO32- and -COOH groups, on cadmium adsorption in montmorillonite was studied in detail. The results showed that cadmium adsorption quantity in montmorillonite increased with increasing soil solution pH and cadmium concentration as usual, but decreased with glyphosate, which is due to the formation of a low affinity complex of Cd and glyphosate and decreasing solution pH induced by glyphosate addition. When the equilibrium solution pH was below 6.7, glyphosate has little effect on cadmium adsorption, but when the equilibrium solution pH was above 6.7, glyphosate significantly decreased cadmium adsorption quantity in montmorillonite. In addition, the adding order of Cd and glyphosate also influenced Cd adsorption quantity in montmorillonite.

  15. File list: His.PSC.10.H3K122ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.10.H3K122ac.AllCell mm9 Histone H3K122ac Pluripotent stem cell ERX631826,ER...X631814 ...

  16. File list: His.PSC.05.H3K122ac.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.05.H3K122ac.AllCell mm9 Histone H3K122ac Pluripotent stem cell ERX631826,ER...X631814 ...

  17. Clinical Analysis of 122 Cases of Placental Abruption%胎盘早剥122例临床分析

    Institute of Scientific and Technical Information of China (English)

    倪琴; 孙彦华; 宣冬梅; 蒙占松


    Objective:To explore the causes of placental abruption and clinical manifestations and its effect on the mothers and their infants.Method:The clinical data of 122 patients with placental abruption in our hospital from January 2012 to December 2013 were analyzed retrospectively.Result:84 mild placental abruption patients and 38 severe placental abruption patients were included in this study.The main incentive of placental abruption was hypertensive disorders complicating pregnancy.Abdominal pain,abnormal fetal heart,uterus plate hard with tenderness in patients with severe placental abruption were significantly higher than those of mild placental abruption patients(P0.05).Prenatal ultrasound examination suggested 98 cases(80.33%) of placental abruption.The incidences of cesarean section,sever neonatalasphyxia,dead fetus,postpartum hemorrhage and uteroplacental apoplexy of sever placental abruption were higher than those of mild placental abruption,the differences were statistically significant(P0.05);产前行超声检查提示胎盘早剥98例(80.33%);重型胎盘早剥剖宫产、重度新生儿窒息、死胎、产后出血、子宫胎盘卒中发生率高于轻型胎盘早剥,差异均有统计学意义(P<0.05)。结论:提高对胎盘早剥的认识,及时发现胎盘早剥的诱因,及时产前诊断及处理,以降低孕产妇及围产儿患病率和死亡率。

  18. 40 CFR Appendix H to Part 122 - Counties With Unincorporated Urbanized Areas With a Population of 250,000 or More According to... (United States)


    ... Census H Appendix H to Part 122 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED.... 122, App. H Appendix H to Part 122—Counties With Unincorporated Urbanized Areas With a Population...

  19. Pulmonary and gastrointestinal exposure to cadmium oxide dust in a battery factory

    Energy Technology Data Exchange (ETDEWEB)

    Adamsson, E.; Piscator, M.; Nogawa, K.


    The elimination of cadmium in feces was studied in a group of 15 male workers exposed to cadmium oxide dust in a nickel-cadmium battery factory. The elimination of cadmium in feces was on the average 619 and 268 microgram/day in seven smokers and eight nonsmokers, respectively. The cadmium concentrations in blood were significantly higher in smokers than in nonsmokers, both before and after one month of vacation. Among the smokers there was a significant decrease in the cadmium concentrations during the vacation period, but not among the nonsmokers. It was estimated that cadmium naturally occurring in food and cigarettes, cadmium excreted from the gastrointestinal tract, and cadmium transported from the lungs by mucocillary clearance to the gastrointestinal tract only could explain up to 100 microgram of the cadmium in the feces.

  20. 40 CFR 49.122 - Partial delegation of administrative authority to a Tribe. (United States)


    ... Provisions General Rules for Application to Indian Reservations in Epa Region 10 § 49.122 Partial delegation... demonstrating that the applicant is currently carrying out substantial governmental duties and powers over...

  1. Constitutive Equation Models of Hot-Compressed T122 Heat Resistant Steel

    Institute of Scientific and Technical Information of China (English)

    CA0Jin-rong; LIUZheng—dong; CHENGShi—chang; YANGGang; XIEJian-xin


    Based on dislocation reaction theory and Avrami equation, a constitutive equation model was developed to describe dynamic recovery and dynamic recrystallization during hot deformation of T122 heat resistant steel, which have taken the effect of dynamic strain aging into account. Uniaxial hot compression test had been carried out over a wide range of strain rate (0.01 to 10 s-1 ) and temperature (900 to 1 200 ~C) with the help of Gleeble 3500. Obtained experimental data was applied to determine the material parameters in proposed constitutive equations of T122 steel, by using the non-linear least square regress optimization method. The calculated constitutive equations are quantita- tively in good agreement with experimentally measured curves and microstructure observation. It shows that propose constitutive equation T122 steel is able to be used to predict flow stress of T122 steel during hot deformation in aus- tenite temperature scope.

  2. Sources of cadmium exposure among healthy premenopausal women

    Energy Technology Data Exchange (ETDEWEB)

    Adams, Scott V., E-mail: [Fred Hutchinson Cancer Research Center, PO Box 19024, M4-B402, Seattle, WA 98109 (United States); Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States); Newcomb, Polly A. [Fred Hutchinson Cancer Research Center, PO Box 19024, M4-B402, Seattle, WA 98109 (United States); Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States); Shafer, Martin M. [Environmental Chemistry and Technology Program, University of Wisconsin and Wisconsin State Laboratory of Hygiene, Madison, WI (United States); Atkinson, Charlotte [Department of Oral and Dental Science, Bristol Dental School, Bristol (United Kingdom); Bowles, Erin J. Aiello [Group Health Research Institute, Seattle, WA (United States); Newton, Katherine M. [Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States); Group Health Research Institute, Seattle, WA (United States); Lampe, Johanna W. [Fred Hutchinson Cancer Research Center, PO Box 19024, M4-B402, Seattle, WA 98109 (United States); Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States)


    Background: Cadmium, a persistent and widespread environmental pollutant, has been associated with kidney function impairment and several diseases. Cigarettes are the dominant source of cadmium exposure among smokers; the primary source of cadmium in non-smokers is food. We investigated sources of cadmium exposure in a sample of healthy women. Methods: In a cross-sectional study, 191 premenopausal women completed a health questionnaire and a food frequency questionnaire. The cadmium content of spot urine samples was measured with inductively-coupled plasma mass spectrometry and normalized to urine creatinine content. Multivariable linear regression was used to estimate the strength of association between smoking habits and, among non-smokers, usual foods consumed and urinary cadmium, adjusted for age, race, multivitamin and supplement use, education, estimated total energy intake, and parity. Results: Geometric mean urine creatinine-normalized cadmium concentration (uCd) of women with any history of cigarette smoking was 0.43 {mu}g/g (95% confidence interval (CI): 0.38-0.48 {mu}g/g) and 0.30 {mu}g/g (0.27-0.33 {mu}g/g) among never-smokers, and increased with pack-years of smoking. Analysis of dietary data among women with no reported history of smoking suggested that regular consumption of eggs, hot cereals, organ meats, tofu, vegetable soups, leafy greens, green salad, and yams was associated with uCd. Consumption of tofu products showed the most robust association with uCd; each weekly serving of tofu was associated with a 22% (95% CI: 11-33%) increase in uCd. Thus, uCd was estimated to be 0.11 {mu}g/g (95% CI: 0.06-0.15 {mu}g/g) higher among women who consumed any tofu than among those who consumed none. Conclusions: Cigarette smoking is likely the most important source of cadmium exposure among smokers. Among non-smokers, consumption of specific foods, notably tofu, is associated with increased urine cadmium concentration. - Research highlights: {yields

  3. Micro-RNA-122 levels in acute liver failure and chronic hepatitis C. (United States)

    Dubin, Perry H; Yuan, Hejun; Devine, Robert K; Hynan, Linda S; Jain, Mamta K; Lee, William M


    MicroRNA-122 (miR-122) is the foremost liver-related micro-RNA, but its role in the hepatocyte is not fully understood. To evaluate whether circulating levels of miR-122 are elevated in chronic-HCV for a reason other than hepatic injury, we compared serum level in patients with chronic hepatitis C to other forms of liver injury including patients with acute liver failure and healthy controls. MiR-122 was quantitated using sera from 35 acute liver failure patients (20 acetaminophen-induced, 15 other etiologies), 39 chronic-HCV patients and 12 controls. In parallel, human genomic DNA (hgDNA) levels were measured to reflect quantitatively the extent of hepatic necrosis. Additionally, six HIV-HCV co-infected patients, who achieved viral clearance after undergoing therapy with interferon and ribavirin, had serial sera miR-122 and hgDNA levels measured before and throughout treatment. Serum miR-122 levels were elevated approximately 100-fold in both acute liver failure and chronic-HCV sera as compared to controls (P < 0.001), whereas hgDNA levels were only elevated in acute liver failure patients as compared to both chronic-HCV and controls (P < 0.001). Subgroup analysis showed that chronic-HCV sera with normal aminotransferase levels showed elevated miR-122 despite low levels of hepatocyte necrosis. All successfully treated HCV patients showed a significant Log10 decrease in miR-122 levels ranging from 0.16 to 1.46, after sustained viral response. Chronic-HCV patients have very elevated serum miR-122 levels in the range of most patients with severe hepatic injury leading to acute liver failure. Eradication of HCV was associated with decreased miR-122 but not hgDNA. An additional mechanism besides hepatic injury may be active in chronic-HCV to explain the exaggerated circulating levels of miR-122 observed.

  4. Increased hepatic expression of miRNA-122 in patients infected with HCV genotype 3. (United States)

    Oliveira, Ketti G; Malta, Fernanda M; Nastri, Ana C S S; Widman, Azzo; Faria, Paola L; Santana, Rúbia A F; Alves, Venâncio A F; Carrilho, Flair J; Pinho, João R R


    Hepatitis C virus (HCV) infection affects approximately 3 % of the world population. HCV targets hepatic tissue, and most infected patients develop a chronic infection. Currently, studies have demonstrated an association between HCV-RNA replication and miR-122, the most abundant microRNA in the liver. Our aim was to evaluate liver and serum expression of miR-122 in patients infected with HCV genotypes 1 and 3, and to identify possible associations between miR-122 expression and lipid profiles, HCV viral load, apolipoproteins and liver enzymes. MicroRNAs were isolated from blood and liver tissue, and miR-122 expression was quantified by real-time PCR. HCV viral load was quantified by real-time PCR and HCV genotype, and serum biomarkers were obtained from medical report. The levels of miR-122 were higher in liver than those in blood from individuals infected with HCV genotypes 1 and 3 (p HCV genotype 3 (6.22-fold, p HCV genotype 1 (r = 0.302, p = 0.026); in these patients, an inverse correlation was observed between serum apolipoprotein A-II (ApoA-II) levels and the blood (r = -0.330; p = 0.014) and hepatic (r = -0.311; p = 0.020) levels of miR-122. In patients infected with HCV genotype 3, there was a positive correlation between the hepatic miR-122 and the high-density lipoprotein-HDL (r = 0.412, p = 0.036) and insulin (r = 0.478, p = 0.044). Lipid metabolism proteins and miR-122 expression levels have different relations in HCV-3- and HCV-1-infected patients.

  5. Cadmium, Mercury and Lead in Hypericum perforatum L. collected in Western Serbia

    Directory of Open Access Journals (Sweden)

    Đurović D.


    Full Text Available Wild population of Hypericum perforatum growing in Western Serbia was analyzed for the content of important environmental pollutants cadmium, mercury and lead. Metal contents were determined by inductively coupled plasma optical emission spectrometry. Obtained results showed that levels of mercury and lead were under while cadmium concentrations exceeded limits recommended for medicinal plants. High levels of cadmium in investigated plants can be the result of soil enriched with cadmium as well as the ability of Hypericum perforatum to accumulate cadmium.

  6. MiR-122 targets the vanin 1 gene to regulate its expression in chickens. (United States)

    Li, Yanyan; Wang, Xingguo; Yu, Jianfeng; Shao, Fang; Zhang, Yanping; Lu, Xiangyun; Gu, Zhiliang


    As the most abundant microRNA (miRNA) in the liver, miR-122 plays important roles in the growth and development of liver, lipid metabolism, and liver diseases. Vanin 1 (VNN1) plays an important role in hepatic lipid metabolism, and VNN1 may serve as a potential therapeutic target for the treatment of metabolic diseases caused by overactivated gluconeogenesis. In our previous RNA-seq study, we found the expression of VNN1 increased significantly when the expression of miR-122 (gga-miR-122-5p) was knocked down in primary chicken hepatocytes. In this study, we verified this result by real-time qRT-PCR, and we also found that the chicken VNN1 was highly expressed in the liver. By bioinformatics analyses, we found the 3'UTR of VNN1 contained sequences completely complementary to the nucleotides 1 to 8 of miR-122. Co-transfection and dual-luciferase reporter assays showed that overexpression of miR-122 decreased the expression of luciferase reporter gene linked to the 3'UTR of chicken VNN1 in the Chinese hamster ovary cells (Pchicken hepatocytes. Overall, this study suggests that miR-122 might play an important role in lipid metabolism in the chicken liver by negatively regulating the expression of the VNN1 gene.

  7. Expression of miRNA-122 Induced by Liver Toxicants in Zebrafish

    Directory of Open Access Journals (Sweden)

    Hyun-Sik Nam


    Full Text Available MicroRNA-122 (miRNA-122, also known as liver-specific miRNA, has recently been shown to be a potent biomarker in response to liver injury in mammals. The objective of this study was to examine its expression in response to toxicant treatment and acute liver damage, using the zebrafish system as an alternative model organism. For the hepatotoxicity assay, larval zebrafish were arrayed in 24-well plates. Adult zebrafish were also tested and arrayed in 200 mL cages. Animals were exposed to liver toxicants (tamoxifen or acetaminophen at various doses, and miRNA-122 expression levels were analyzed using qRT-PCR in dissected liver, brain, heart, and intestine, separately. Our results showed no significant changes in miRNA-122 expression level in tamoxifen-treated larvae; however, miRNA-122 expression was highly induced in tamoxifen-treated adults in a tissue-specific manner. In addition, we observed a histological change in adult liver (0.5 μM and cell death in larval liver (5 μM at different doses of tamoxifen. These results indicated that miRNA-122 may be utilized as a liver-specific biomarker for acute liver toxicity in zebrafish.

  8. Pulmonary and gastrointestinal exposure to cadmium oxide dust in a battery factory. (United States)

    Adamsson, E; Piscator, M; Nogawa, K


    The elimination of cadmium in feces was studied in a group of 15 male workers exposed to cadmium oxide dust in a nickel-cadmium battery factory. The elimination of cadmium in feces was on the average 619 and 268 microgram/day in seven smokers and eight nonsmokers, respectively. The corresponding ranges were 97-2577 and 31-1102 microgram/day. The cadmium concentrations in blood were significantly higher in smokers than in nonsmokers, both before and after one month of vacation. Among the smokers there was a significant decrease in the cadmium concentrations during the vacation period, but not among the nonsmokers. It was estimated that cadmium naturally occurring in food and cigarettes, cadmium excreted from the gastrointestinal tract, and cadmium transported from the lungs by mucocillary clearance to the gastrointestinal tract only could explain up to 100 microgram of the cadmium in the feces. Since even among some nonsmokers much higher values for fecal cadmium were recorded, this was interpreted as being the result of ingestion of cadmium from contaminated hands and other body surfaces. Among the smokers, direct oral contact with contaminated cigarettes or pipes is an additional factor; the smokers also inhale cadmium in the tobacco smoke from contaminated cigarettes. Part of that cadmium is transferred to the gastrointestinal tract by mucociliary clearance and also adds to the fecal cadmium.

  9. Blood cadmium concentration and lipid profile in Korean adults

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kisok, E-mail: [Department of Public Health, Keimyung University, 1000 Shindang-dong, Daegu 704-701 (Korea, Republic of)


    Although animal experiments have shown that cadmium exposure induces alterations in lipid profiles, no epidemiological study of this relationship has been performed. The objective of this study was to evaluate the association between blood cadmium concentration and blood lipid levels in Korean adults. A cross-sectional study comprising participants (n=3903) aged 20 years or older from the 2005, 2008, and 2009 Korea National Health and Nutrition Examination Surveys was conducted. Demographic characteristics and dietary intake were obtained from the participants by questionnaire, and cadmium and lipid levels were determined by analysis of blood samples. After adjusting for demographic and dietary factors, blood concentration of cadmium was positively associated with the risk of low high-density lipoprotein cholesterol (HDL-C) in a dose-dependent manner (p for trend <0.001). In addition, the odds ratios (ORs) of a high triglyceride to HDL-C ratio was significantly increased in the high blood cadmium groups [OR=1.36; 95% confidence interval (CI), 1.03-1.79 for fourth quintile and OR=1.41; 95% CI, 1.07-1.86 for fifth quintile] compared with the lowest quintile group. However, high blood cadmium was not associated with a risk of high total cholesterol, high low-density lipoprotein cholesterol, or high triglycerides. These data suggest that an increased cadmium body burden increases the risk of dyslipidemia, mainly due to the increased risk of low HDL-C and the high ratio of triglycerides to HDL-C.

  10. Protective effect of cannabidiol against cadmium hepatotoxicity in rats. (United States)

    Fouad, Amr A; Al-Mulhim, Abdulruhman S; Gomaa, Wafaey


    The protective effect of cannabidiol, the non-psychoactive component of Cannabis sativa, against liver toxicity induced by a single dose of cadmium chloride (6.5 mgkg(-1) i.p.) was investigated in rats. Cannabidiol treatment (5 mgkg(-1)/day, i.p.) was applied for five days starting three days before cadmium administration. Cannabidiol significantly reduced serum alanine aminotransferase, and suppressed hepatic lipid peroxidation, prevented the depletion of reduced glutathione and nitric oxide, and catalase activity, and attenuated the elevation of cadmium level in the liver tissue resulted from cadmium administration. Histopathological examination showed that cadmium-induced liver tissue injury was ameliorated by cannabidiol treatment. Immunohistochemical analysis revealed that cannabidiol significantly decreased the cadmium-induced expression of tumor necrosis factor-α, cyclooxygenase-2, nuclear factor-κB, caspase-3, and caspase-9, and increased the expression of endothelial nitric oxide synthase in liver tissue. It was concluded that cannabidiol may represent a potential option to protect the liver tissue from the detrimental effects of cadmium toxicity.

  11. Accumulation and distribution of arsenic and cadmium by tea plants

    Institute of Scientific and Technical Information of China (English)

    Yuan-zhi SHI; Jian-yun RUAN; Lifeng MA; Wen-yan HAN; Fang WANG


    It is important to research the rules about accumulation and distribution of arsenic and cadmium by tea plants, which will give us some scientific ideas about how to control the contents of arsenic and cadmium in tea. In this study, by field inves- tigation and pot trial, we found that mobility of arsenic and cadmium in tea plants was low. Most arsenic and cadmium absorbed were fixed in feeding roots and only small amount was transported to the above-ground parts. Distribution of arsenic and cadmium, based on their concentrations of unit dry matter, in tea plants grown on un-contaminated soil was in the order: feeding roots>stems≈main roots>old leaves>young leaves. When tea plants were grown on polluted soils simulated by adding salts of these two metals, feeding roots possibly acted as a buffer and defense, and arsenic and cadmium were transported less to the above- ground parts. The concentration of cadmium in soil significantly and negatively correlated with chlorophyll content, photosyn- thetic rate, transpiration rate and biomass production of tea plants.

  12. Gadolinium chloride pretreatment ameliorates acute cadmium-induced hepatotoxicity. (United States)

    Kyriakou, Loukas G; Tzirogiannis, Konstantinos N; Demonakou, Maria D; Kourentzi, Kalliopi T; Mykoniatis, Michael G; Panoutsopoulos, Georgios I


    Cadmium is a known industrial and environmental pollutant. It causes hepatotoxicity upon acute administration. Features of cadmium-induced acute hepatoxicity encompass necrosis, apoptosis, peliosis and inflammatory infiltration. Gadolinium chloride (GdCl3) may prevent cadmium-induced hepatotoxicity by suppressing Kupffer cells. The effect of GdCl3 pretreatment on a model of acute cadmium-induced liver injury was investigated. Male Wistar rats 4-5 months old were injected intraperitoneally with normal saline followed by cadmium chloride (CdCl2; 6.5 mg/kg) or GdCl3 (10 mg/kg) followed by CdCl2 (6.5 mg/kg; groups I and II, respectively). Rats of both the groups were killed at 9, 12, 16, 24, 48 and 60 h after cadmium intoxication. Liver sections were analyzed for necrosis, apoptosis, peliosis and mitoses. Liver regeneration was also evaluated by tritiated thymidine incorporation into hepatic DNA. Serum levels of aspartate aminotransferase (AST) and alanine aminotransferase (ALT) were also determined. Hepatic necrosis, hepatocyte and nonparenchymal cell apoptosis and macroscopic and microscopic types of peliosis hepatis were minimized by gadolinium pretreatment. Serum levels of AST and ALT were also greatly diminished in rats of group II. Tritiated thymidine incorporation into hepatic DNA was increased in gadolinium pretreatment rats. Kupffer cell activation was minimal in both the groups of rats. Gadolinium pretreatment attenuates acute cadmium-induced liver injury in young Wistar rats, with mechanisms other than Kupffer cell elimination.

  13. Screening of Amaranth Cultivars (Amaranthus mangostanus L.) for Cadmium Hyperaccumulation

    Institute of Scientific and Technical Information of China (English)

    FAN Hong-li; ZHOU Wei


    The potential harm of soil cadmium pollution to ecological environment and human health has been increasingly widely concerned. Phytoremediation, as a kind of new and effective technology, has become an important method for cleaning up cadmium in contaminated sites. The amaranth (Amaranthus mangostanus L.) is widely distributed and has abundant varieties in China, its rapid growth and large biomass can be served as candidate for cadmium hyperaccumulators for phytoremediation. To obtain cadmium hyper-accumulator, Cd uptake in 23 amaranth euitivars from different ecological region was investigated under hydroponic culture condition. Meanwhile, pot experiment was established to probe phytoremediation potentiality of Cd contaminated soil by amaranth. Three treatment (Cd 5, 10, and 25 mg kg-1) were imposed to red soil, yellow brown soil, and vegetable soil. The results showed that under hydroponic culture with Cd 3 mg L-1, the cadmium concentration in the shoots of the cultivar Tianxingmi reached 260 mg kg-1, and its total cadmium uptake was the highest among various cultivars. In the treatment Cd 25 mg kg-1, the cadmium concentration in the shoots of the cultivar Tianxingmi reached 212 mg kg-1, while bioaccumulation factor and shoot purification rate reached 8.50 and 3.8%, respectively. Further, the total biomass and shoot biomass were not decreased significantly under Cd exposure.These results suggested that eultivar Tianxingmi is a typical Cd hyperaccumulator, and can be expected to be used in phytoremediation of Cd contaminated soil.

  14. The role of lead and cadmium in psychiatry

    Directory of Open Access Journals (Sweden)

    Orish Ebere Orisakwe


    Full Text Available Psychiatric disorders are associated with long-term disability and huge social and economic costs. The possible influence of heavy metals exposure on public health remains a matter of concern. A recurring research question that persisted among researchers in neuropsychiatry has been "are psychiatric patients more likely to have a high body burden of lead or other heavy metals?" This is an update account on the role of lead and cadmium in psychiatry. This review, which has employed search words like "lead and cadmium in psychiatry" , "lead and cadmium in schizophrenia", "lead and cadmium in psychosis" in citation indices such as PubMed, Google Scholar, Scirus, and Scopus. A total of 415 articles were found; 60 fulfiled the inclusion criteria. Evidence-based information suggests that lead and cadmium may be involved in psychiatry. Should environmental lead and cadmium be implicated in the etiogenesis of psychiatry given the characteristic high environmental pollution in Sub Sahara Africa, it is worthwhile for toxicologists and scientists in Sub-Sahara Africa to investigate if lead and cadmium can become additional biomarkers in the diagnosis of psychiatric disorders.

  15. Cadmium determination in Lentinus edodes mushroom species

    Directory of Open Access Journals (Sweden)

    Vera Akiko Maihara


    Full Text Available Many studies have drawn attention to the occurrence and concentration of toxic elements found in the fruiting body of mushrooms. Some edible mushroom species are known to accumulate high levels of inorganic contaminants, mainly cadmium, mercury, and lead. There are about 2,000 known edible mushroom species, but only 25 of them are cultivated and used as food. In Brazil, the most marketed and consumed mushroom species are Agaricus bisporus, known as Paris champignon, Lentinus edodes, or Shitake and Pleurotus sp, also called Shimeji or Hiratake. In this study, the concentration of cadmium was determined in Lentinus edodes mushrooms from different cities in São Paulo state and some samples imported from Japan and China. The analyses were performed by graphite furnace atomic absorption spectrometry after HNO3-H2O2 digestion. The results showed a lower concentration of Cd in the mushrooms cultivated in São Paulo (0.0079 to 0.023 in natura than that of the mushrooms cultivated abroad (0.125 to 0.212 in natura. Although there is no tolerance limit for Cd in mushrooms in Brazil, the results show that Lentinus edodes mushrooms can be safely consumed.

  16. Cadmium minimization in wheat: A critical review. (United States)

    Rizwan, Muhammad; Ali, Shafaqat; Abbas, Tahir; Zia-Ur-Rehman, Muhammad; Hannan, Fakhir; Keller, Catherine; Al-Wabel, Mohammad I; Ok, Yong Sik


    Cadmium (Cd) accumulation in wheat (Triticum aestivum L.) and its subsequent transfer to food chain is a major environmental issue worldwide. Understanding wheat response to Cd stress and its management for aiming to reduce Cd uptake and accumulation in wheat may help to improve wheat growth and grain quality. This paper reviewed the toxic effects, tolerance mechanisms, and management of Cd stress in wheat. It was concluded that Cd decreased germination, growth, mineral nutrients, photosynthesis and grain yield of wheat and plant response to Cd toxicity varies with cultivars, growth conditions and duration of stress applied. Cadmium caused oxidative stress and genotoxicity in wheat plants. Stimulation of antioxidant defense system, osmoregulation, ion homeostasis and over production of signalling molecules are important adaptive strategies of wheat under Cd stress. Exogenous application of plant growth regulators, inorganic amendments, proper fertilization, silicon, and organic, manures and biochar, amendments are commonly used for the reduction of Cd uptake in wheat. Selection of low Cd-accumulating wheat cultivars, crop rotation, soil type, and exogenous application of microbes are among the other agronomic practices successfully employed in reducing Cd uptake by wheat. These management practices could enhance wheat tolerance to Cd stress and reduce the transfer of Cd to the food chain. However, their long-term sustainability in reducing Cd uptake by wheat needs further assessment.

  17. Alternative materials to cadmium for neutron absorbers in safeguards applications

    Energy Technology Data Exchange (ETDEWEB)

    Freeman, Corey R [Los Alamos National Laboratory; Geist, William H [Los Alamos National Laboratory; West, James D [Los Alamos National Laboratory


    Cadmium is increasingly difficult to use in safeguards applications because of rising cost and increased safety regulations. This work examines the properties of two materials produced by Ceradyne, inc. that present alternatives to cadmium for neutron shielding. The first is an aluminum metal doped with boron and the second is a boron carbide powder, compressed into a ceramic. Both are enriched in the {sup 10}B isotope. Two sheets of boron doped aluminum (1.1 mm and 5.2mm thick) and one sheet of boron carbide (8.5mm thick) were provided by Ceradyne for testing. An experiment was designed to test the neutron absorption capabilities of these three sheets against two different thicknesses of cadmium (0.6mm and 1.6mm thick). The thinner piece of aluminum boron alloy (1.1mm) performed as well as the cadmium pieces at absorbing neutrons. The thicker aluminum-boron plate provided more shielding than the cadmium sheets and the boron carbide performed best by a relatively large margin. Monte Carlo N-Particle eXtended (MCNPX) transport code modeling of the experiment was performed to provide validaLed computational tools for predicting the behavior of systems in which these materials may be incorporated as alternatives to cadmium. MCNPX calculations predict that approximately 0.17mm of the boron carbide is equivalent to 0.6mm of cadmium. There are drawbacks to these materials that need to be noted when considering using them as replacements for cadmium. Notably, they may need to be thicker than cadmium, and are not malleable, requiring machining to fit any curved forms.

  18. Cadmium in organs and tissues of horses slaughtered in Italy. (United States)

    Baldini, M; Stacchini, P; Cubadda, F; Miniero, R; Parodi, P; Facelli, P


    The cadmium content of muscle, liver, kidney and blood samples from 62 horses slaughtered in Italy was investigated. Cadmium was determined by graphite furnace atomic absorption spectrometry (GFAAS) after wet digestion of the samples. The mean and median contents of all samples were (on a fresh weight basis) 75 and 41 micrograms kg-1 for muscle, 2.46 and 2.10 mg kg-1 for liver, 20.0 and 13.5 mg kg-1 for kidney. The cadmium level in blood samples was always below 6 micrograms l-1. The cadmium concentrations in muscle, liver and kidney were found to be related to the life span of the specimens and increased with age. Females exhibited higher levels than males, but this difference was significant only in the case of muscle tissue. The geographical origin was recognized as the main factor influencing the cadmium content of the equine specimens analysed. The differences between horses coming from the three main breeding countries considered in this study (Poland, Lithuania, Hungary) were marked and statistically significant. The average intake of cadmium from equine meat was estimated for the general population and for population groups resident in areas with high consumption of this food item. While the cadmium intake from equine meat for the average consumer accounts for about 1% of the total cadmium intake estimated for Italy, in the latter case the enhanced consumption of equine muscle is often accompanied with the consumption of substantial quantities of equine liver and this may lead to high cadmium intakes.

  19. The phytoremediation potential of bioenergy crop Ricinus communis for DDTs and cadmium co-contaminated soil. (United States)

    Huang, Huagang; Yu, Ning; Wang, Lijun; Gupta, D K; He, Zhenli; Wang, Kai; Zhu, Zhiqiang; Yan, Xingchu; Li, Tingqiang; Yang, Xiao-e


    Cadmium (Cd) and dichlorodiphenyltrichloroethane (DDT) or its metabolite residues are frequently detected in agricultural soils and food, posing a threat to human health. The objective of this study was to compare the ability of 23 genotypes of Ricinus communis in mobilizing and uptake of Cd and DDTs (p,p'-DDT, o,p'-DDT, p,p'-DDD and p,p'-DDE) in the co-contaminated soil. The plant genotypes varied largely in the uptake and accumulation of DDTs and Cd, with mean concentrations of 0.37, 0.43 and 70.51 for DDTs, and 1.22, 2.27 and 37.63 mg kg(-1) dw for Cd in leaf, stem and root, respectively. The total uptake of DDTs and Cd varied from 83.1 to 267.8 and 66.0 to 155.1 μg per pot, respectively. These results indicate that R. communis has great potential for removing DDTs and Cd from contaminated soils attributed to its fast growth, high biomass, strong absorption and accumulation for both DDTs and Cd.

  20. Exposure dose response relationships of the freshwater bivalve Hyridella australis to cadmium spiked sediments

    Energy Technology Data Exchange (ETDEWEB)

    Marasinghe Wadige, Chamani P.M., E-mail:; Maher, William A.; Taylor, Anne M.; Krikowa, Frank


    Highlights: • The exposure–dose–response approach was used to assess cadmium exposure and toxicity. • Accumulated cadmium in H. australis reflected the sediment cadmium exposure. • Spill over of cadmium into the biologically active pool was observed. • Increased cadmium resulted in measurable biological effects. • H. australis has the potential to be a cadmium biomonitor in freshwater environments. - Abstract: To understand how benthic biota may respond to the additive or antagonistic effects of metal mixtures in the environment it is first necessary to examine their responses to the individual metals. In this context, laboratory controlled single metal-spiked sediment toxicity tests are useful to assess this. The exposure–dose–response relationships of Hyridella australis to cadmium-spiked sediments were, therefore, investigated in laboratory microcosms. H. australis was exposed to individual cadmium spiked sediments (<0.05 (control), 4 ± 0.3 (low) and 15 ± 1 (high) μg/g dry mass) for 28 days. Dose was measured as cadmium accumulation in whole soft body and individual tissues at weekly intervals over the exposure period. Dose was further examined as sub-cellular localisation of cadmium in hepatopancreas tissues. The biological responses in terms of enzymatic and cellular biomarkers were measured in hepatopancreas tissues at day 28. H. australis accumulated cadmium from spiked sediments with an 8-fold (low exposure organisms) and 16-fold (high exposure organisms) increase at day 28 compared to control organisms. The accumulated tissue cadmium concentrations reflected the sediment cadmium exposure at day 28. Cadmium accumulation in high exposure organisms was inversely related to the tissue calcium concentrations. Gills of H. australis showed significantly higher cadmium accumulation than the other tissues. Accumulated cadmium in biologically active and biologically detoxified metal pools was not significantly different in cadmium exposed

  1. Electrodialytic removal of cadmium from straw combustion fly ash

    DEFF Research Database (Denmark)

    Hansen, Henrik K.; Ottosen, Lisbeth M.; Villumsen, Arne


    Fly ash from straw combustion contains valuable nutrients when returned to agricultural soils. In many instances, however, this fly ash may contain heavy metals, such as cadmium, at levels which often exceed the limits given by the Danish legislation. Thus before utilizing the nutrients, cadmium...... must be removed from these ashes. The use of an electrodialytic remediation method to remove cadmium from fly ash arising from straw combustion and containing 11.2 mg Cd kg$+-1$/ DM (dry matter) was accessed. After 36 days of remediation at a constant current density of 5.6 mA cm$+-2$/ more than 97...

  2. Cadmium and zinc concentrations in fetal and maternal rat tissues after parenteral administration of cadmium during pregnancy

    Energy Technology Data Exchange (ETDEWEB)

    Hazelhoff Roelfzema, W.; Roelofsen, A.M.; Herber, R.F.M.; Copius Peereboom-Stegeman, J.H.J.


    Cadmium (Cd) and zinc (Zn) concentrations were determined by solid sampling atomic absorption spectrometry (AAS) in rat maternal and fetal tissues after exposure to cadmium. Cadmium was administered subcutaneously as CdCl/sub 2/ in saline daily during pregnancy. Two experiments were performed. In expt. I we investigated the tissue concentration at day 19 (gestational age) after addministration of several doses: 0, 1.1, 2.2, 4.4, and 8.8 Cd/kg/day. In expt. II the course of the Cd and Zn concentrations during pregnancy was investigated by collecting samples at days 14, 16, 18 and 20, after daily injections of 4.4 Cd/kg. Cadmium concentrations in blood, maternal liver, placenta and fetal liver increased with dose and duration of exposure. Cadmium was heavily accumulated in the liver and transferred to the fetus only in small amounts. The zinc concentration in the maternal liver was positively correlated with the cadmium concentration. In the placenta the zinc concentration was not affected. Zinc in fetal liver was decreased from day 18 onward. Despite relatively high cadmium levels and decreased zinc levels in the fetus, we observed no adverse effects on various reproduction parameters, such as birth weights and obvious malformations.

  3. An association between urinary cadmium and urinary stone disease in persons living in cadmium-contaminated villages in northwestern Thailand: A population study

    Energy Technology Data Exchange (ETDEWEB)

    Swaddiwudhipong, Witaya, E-mail: [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand); Mahasakpan, Pranee [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand); Limpatanachote, Pisit; Krintratun, Somyot [Department of Internal Medicine, Mae Sot General Hospital, Tak 63110 (Thailand)


    Excessive urinary calcium excretion is the major risk of urinary stone formation. Very few population studies have been performed to determine the relationship between environmental cadmium exposure and urinary stone disease. This population-based study examined an association between urinary cadmium excretion, a good biomarker of long-term cadmium exposure, and prevalence of urinary stones in persons aged 15 years and older, who lived in the 12 cadmium-contaminated villages in the Mae Sot District, Tak Province, northwestern Thailand. A total of 6748 persons were interviewed and screened for urinary cadmium and urinary stone disease in 2009. To test a correlation between urinary excretion of cadmium and calcium, we measured urinary calcium content in 1492 persons, who lived in 3 villages randomly selected from the 12 contaminated villages. The rate of urinary stones significantly increased from 4.3% among persons in the lowest quartile of urinary cadmium to 11.3% in the highest quartile. An increase in stone prevalence with increasing urinary cadmium levels was similarly observed in both genders. Multiple logistic regression analysis revealed a positive association between urinary cadmium levels and stone prevalence, after adjusting for other co-variables. The urinary calcium excretion significantly increased with increasing urinary cadmium levels in both genders, after adjusting for other co-variables. Elevated calciuria induced by cadmium might increase the risk of urinary stone formation in this environmentally exposed population. - Research highlights: {yields} Excessive calciuria is the major risk of urinary stone formation. {yields} We examine cadmium-exposed persons for urinary cadmium, calcium, and stones. {yields} The rate of urinary stones increases with increasing urinary cadmium. {yields} Urinary calcium excretion increases with increasing urinary cadmium. {yields} Elevated calciuria induced by cadmium may increase the risk of urinary stones.

  4. Disposal of beryllium and cadmium from research reactors; Entsorgung von Beryllium und Cadmium aus Forschungsreaktoren

    Energy Technology Data Exchange (ETDEWEB)

    Lierse von Gostomski, C.; Remmert, A.; Stoewer, W. [Inst. fuer Radiochemie, Technische Univ. Muenchen, Garching (Germany); Bach, F.W.; Wilk, P.; Kutlu, I. [Inst. fuer Werkstoffkunde, Univ. Hannover, Hannover (Germany); Blenski, H.J.; Berthold, M. [Gesellschaft fuer Nuklear-Service mbH, Essen (Germany); Nerlich, K.D.; Plank, W. [TUeV Sueddeutschland Bau und Betrieb GmbH, Muenchen (Germany)


    Beryllium and cadmium mostly occur in metal form as radioactive special materials during the deconstruction of research reactors. Beryllium is usually used in these reactors as a neutron reflector and moderator, while cadmium is used above all as a neutron absorber. Both metals together have a high chemotoxicity as well as an inventory of radionuclides which has not been more closely characterised up to now. A high tritium content is to be expected, particularly in the case of beryllium; this tritium is due to the reaction of the metal with thermal reactor neutrons in particular. However, other nuclides which may be formed by neutron capture from impurities also contribute to the activity inventory. Up to now there is no qualified process for proper treatment, conditioning and intermediate and final repository in Germany. (orig.)

  5. Inclusion free cadmium zinc tellurium and cadmium tellurium crystals and associated growth method (United States)

    Bolotnikov, Aleskey E.; James, Ralph B.


    The present disclosure provides systems and methods for crystal growth of cadmium zinc tellurium (CZT) and cadmium tellurium (CdTe) crystals with an inverted growth reactor chamber. The inverted growth reactor chamber enables growth of single, large, high purity CZT and CdTe crystals that can be used, for example, in X-ray and gamma detection, substrates for infrared detectors, or the like. The inverted growth reactor chamber enables reductions in the presence of Te inclusions, which are recognized as an important limiting factor in using CZT or CdTe as radiation detectors. The inverted growth reactor chamber can be utilized with existing crystal growth techniques such as the Bridgman crystal growth mechanism and the like. In an exemplary embodiment, the inverted growth reactor chamber is a U-shaped ampoule.

  6. Blood and urine cadmium and bioelements profile in nickel-cadmium battery workers in Serbia. (United States)

    Bulat, Z Plamenac; Dukic-Cosic, D; Dokic, M; Bulat, P; Matovic, V


    Although cadmium (Cd) is extensively used for nickel-cadmium battery production, few recent reports are available on the effect of this toxic metal on the imbalance of biometals in occupational exposure. The current study was carried out to determine the Cd level and its effect on the content of bioelements: zinc, cooper, magnesium, and iron in blood and urine of workers exposed to Cd during nickel-cadmium battery production. beta(2)-microglobulins (beta(2)-MG), as indicators of kidney damage, were determined in urine.The study group comprised 32 male nickel-cadmium battery workers, and the control group had 15 male construction workers with no history of Cd exposure. Levels of Cd and bioelements were determined in blood and urine by atomic absorption spectrophotometry.Cd concentration in blood of exposed workers was around 10 microg/L and in urine ranged from 1.93 to 8.76 microg/g creatinine (cr). Urine Cd concentration was significantly higher in exposed workers than in the controls, although no statistical difference in beta(2)-MG content was observed in urine between the two groups. Blood Zn and Mg level were significantly reduced and urine Zn level was increased in Cd-exposed group when compared with controls.The mean Cd concentrations in blood and urine did not exceed the recommended reference values of 10 microg/L in blood and 10 microg/g cr in urine. Cd exposure resulted in disturbances of Zn in blood and urine and Mg in blood but had no effect on Cu and Fe content in biological fluids.

  7. Enhanced p122RhoGAP/DLC-1 Expression Can Be a Cause of Coronary Spasm.

    Directory of Open Access Journals (Sweden)

    Takahiko Kinjo

    Full Text Available We previously showed that phospholipase C (PLC-δ1 activity was enhanced by 3-fold in patients with coronary spastic angina (CSA. We also reported that p122Rho GTPase-activating protein/deleted in liver cancer-1 (p122RhoGAP/DLC-1 protein, which was discovered as a PLC-δ1 stimulator, was upregulated in CSA patients. We tested the hypothesis that p122RhoGAP/DLC-1 overexpression causes coronary spasm.We generated transgenic (TG mice with vascular smooth muscle (VSM-specific overexpression of p122RhoGAP/DLC-1. The gene and protein expressions of p122RhoGAP/DLC-1 were markedly increased in the aorta of homozygous TG mice. Stronger staining with anti-p122RhoGAP/DLC-1 in the coronary artery was found in TG than in WT mice. PLC activities in the plasma membrane fraction and the whole cell were enhanced by 1.43 and 2.38 times, respectively, in cultured aortic vascular smooth muscle cells from homozygous TG compared with those from WT mice. Immediately after ergometrine injection, ST-segment elevation was observed in 1 of 7 WT (14%, 6 of 7 heterozygous TG (84%, and 7 of 7 homozygous TG mice (100% (p<0.05, WT versus TGs. In the isolated Langendorff hearts, coronary perfusion pressure was increased after ergometrine in TG, but not in WT mice, despite of the similar response to prostaglandin F2α between TG and WT mice (n = 5. Focal narrowing of the coronary artery after ergometrine was documented only in TG mice.VSM-specific overexpression of p122RhoGAP/DLC-1 enhanced coronary vasomotility after ergometrine injection in mice, which is relevant to human CSA.

  8. Electrochemical removal of cadmium from bio-ash; Elektrokemisk fjernelse af cadmium fra bioasker

    Energy Technology Data Exchange (ETDEWEB)

    Juul Pedersen, Anne; Ottosen, Lisbeth M.; Simonsen, Peter; Christensen, Terkel C.


    The potential of using the method electrodialytic remediation for removal of cadmium from bioashes has been investigated. Five different types of fly ash from biomass combustion were included in the study: 1) A straw combustion fly ash from grate-firing at Avedoere power plant. 2) A fly ash from co-firing of wood and fuel oil at Avedoere power plant. 3) A suspended, grain size fractionated straw fly ash, obtained from PSO project FU 2201, fine and coarse size fraction. The ash was originally produced at Avedoere power plant. 4) A straw pellet fly ash from dust-firing at Amager power plant. Thr five ashes were characterised, and a series of preliminary elekctrodialytic remediation experiments were conducted on each ash. In spite a significant differences between the five ashes with respect to parameters such as pH and content of cadmium, all ashes showed promising remediation potential. For all ashes cadmium concentrations below the regulatory limits for recycling were reached in one or more of the preliminary remediation experiements. The best results were obtained with the suspended straw ash from PSO FU 2201, whereas the results with the wood chips ash, due to a high initial pH value, were less sucessful, meaning that the remediation process was progressing more slowly. (BA)

  9. Soil biogeochemistry, plant physiology and phytoremediation of cadmium contaminated soils (United States)

    Cadmium (Cd) loading in soil and the environment has been accelerated worldwide due to enhanced industrialization and intensified agricultural production, particularly in the developing countries. Soil Cd pollution, resulting from both anthropogenic and geogenic sources, has posed an increasing chal...

  10. Study of thermal effects on nickel-cadmium batteries (United States)

    Foley, R. T.; Webster, W. H.


    Isothermal continuous flow calorimeter is designed to test a nickel-cadmium battery under numerous orbital conditions. This sensitive calorimeter collects cell data such as oxygen pressure and rate of heat generation, and calculates changes in enthalpy.


    Cadmium (Cd) is a ubquitous element and a significant inorganic pollutant that has previously been found to bioaccumulate in reproductive organs of fish and disrupt important endocrine processes, especially those involved in synthesis, release and metabolism of hormones. Clearly,...

  12. Polycrystalline Thin-Film Research: Cadmium Telluride (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)


    This National Center for Photovoltaics sheet describes the capabilities of its polycrystalline thin-film research in the area of cadmium telluride. The scope and core competencies and capabilities are discussed.

  13. Polycrystalline Thin-Film Research: Cadmium Telluride (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)


    Capabilities fact sheet that includes scope, core competencies and capabilities, and contact/web information for Polycrystalline Thin-Film Research: Cadmium Telluride at the National Center for Photovoltaics.

  14. Electronic-structure calculations of large cadmium chalcogenide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Frenzel, Johannes [Lehrstuhl fuer Theoretische Chemie, Ruhr-Universitaet Bochum (Germany); Joswig, Jan-Ole [Physikalische Chemie, Technische Universitaet Dresden (Germany)


    In this paper, we will review our studies of large cadmium chalcogenide nanoparticles and present some new results on cadmium telluride systems. All calculations have been performed using density-functional based methods. The studies deal with the structural properties of saturated and unsaturated nanoparticles where the surfactants generally are hydrogen atoms or thiol groups. We have focused on the investigation of the density of states, the Mulliken charges, the eigenvalue spectra, and the spatial distributions of the frontier orbitals. Optical excitation spectra of pure CdS and CdSe/CdS core-shell systems have been calculated using a linear-response formalism. The reviewed studies are compared to the state of the art of modeling large cadmium chalcogenide particles. Optical excitations in large saturated cadmium chalcogenide nanoparticles with several thousand atoms. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)



    Z. O. Lipatova; E. V. Kolobkova; V. A. Aseev


    Cadmium sulfide quantum dots are perspective materials in optics, medicine, biology and optoelectronics. Fluorophosphate glasses, doped with cadmium sulfide quantum dots, were examined in the paper. Heat treatment led to the formation of quantum dots with diameters equal to 2.8 nm, 3.0 nm and 3.8 nm. In view of such changes in the quantum dots size the fundamental absorption edge shift and the luminescence band are being displaced to the long wavelengths. Luminescence lifetime has been fou...

  16. Analysis Of The Underpotential Deposition Of Cadmium On Copper


    Kowalik R.


    In this study the process of deposition of cadmium on polycrystalline copper electrode in sulfate solution was investigated. The process of underpotential and bulk deposition was analyzed by classical electrochemical method: cyclic voltammetry(CV), anodic stripping voltammetry(ASV) and electrochemical quartz crystal microbalance(EQCM). The obtained results were compared with electrochemical impedance spectroscopy(EIS) measurements. CV, EQCM and EIS results suggest that the UPD of cadmium star...

  17. Investigation of cadmium resistance in an Alcaligenes sp

    Energy Technology Data Exchange (ETDEWEB)

    McEntee, J.D.; Woodrow, J.R.; Quirk, A.V.


    The mechanisms of metal resistance of a cadmium-resistant Alcaligenes sp. were studied. Growth in a defined medium was unaffected by cadmium at concentrations up to 0.1 mM, while at concentrations up to 2.5 mM, growth occurred after an extended lag phase. The increase in length of the lag phase was abolished by repeated subculturing at these higher concentrations. However, subculture in the absence of cadmium reversed the adaptation process. Plasmid DNA was not detected in adapted cells, suggesting that adaptation is not plasmid mediated. Increased sulfide production in response to cadmium was observed, although the levels were too low to account fully for cadmium resistance. Adaptation of cells to cadmium resulted in the appearance of a major new membrane preparation. This protein was induced at cadmium concentrations of 0.1 mM and above, but below this level the protein was absent. The onset of growth at concentrations above 0.1 mM was coincident with the appearance of this protein, which was also induced by zinc (0.4 mM) but not by manganese or nickel. The protein was only solubilized by a sodium dodecyl sulfate-2-mercaptoethanol mixture. Similar solubility properties were shown by a second major membrane protein (molecular weight, 33,000). These two proteins proved to be similar by peptide-mapping experiments and amino acid analysis. The appearance of the 34,500-molecular-weight protein and its possible role in cadmium resistance are discussed.

  18. Study on Systemic Separation of Palladium, Silver, Cadmium and Tin

    Institute of Scientific and Technical Information of China (English)

    YU; Zhen-hua; HUANG; Kun


    To accurately measure the yields of palladium,silver,cadmium and tin that generated from the fission of plutonium,radiochemical method is needed because there is much interference in using directγ-spectroscopy measurements.Usually,we want to get as much as possible the experiment data from one target,so it is required systemic separation of palladium,silver,cadmium and tin.Considering the

  19. Harmful effects of cadmium on olfactory system in mice. (United States)

    Bondier, Jean-Robert; Michel, Germaine; Propper, Alain; Badot, Pierre-Marie


    The inhalation of certain metals can result in olfactory epithelial injury, an altered sense of smell, and direct delivery of the metal from the olfactory epithelium to the olfactory bulbs and other parts of the central nervous system. The purpose of this study was to examine whether mice given an intranasal instillation of cadmium would develop altered olfactory function and to assess whether cadmium may be transported directly from the olfactory epithelium to the central nervous system. To evaluate cadmium's ability to induce anosmia and on the basis of olfactory epithelium sensitivity to metals, the aim of this study was first to study cadmium effects on the olfactory function and secondly to check whether cadmium may be transported from the nasal area to the central nervous system. After an intranasal instillation of a solution containing CdCl2 at 136 mM, we observed in treated mice: (1) a partial destruction of the olfactory epithelium, which is reduced to three or four basal cell layers followed by a progressive regeneration; (2) a loss of odor discrimination with a subsequent recovery; and (3) a cadmium uptake by olfactory bulbs demonstrated using atomic absorption spectrophotometry, but not by other parts of the central nervous system. Cadmium was delivered to the olfactory bulbs, most likely along the olfactory nerve, thereby bypassing the intact blood-brain barrier. We consider that cadmium can penetrate olfactory epithelium and hence be transported to olfactory bulbs. The olfactory route could therefore be a likely way to reach the brain and should be taken into account for occupational risk assessments for this metal.

  20. Update on Alternatives for Cadmium Coatings on Military Electrical Connectors (United States)


    deposi- tion (PVD) process in which a part is placed in a vacuum chamber and glow discharge cleaned. Pure alu- minum is then melted in heated ceramic...alloys, beryllium , magne- sium, and aluminum alloys are gen- erally the most active metals in cor- rosive environments and, therefore, are the only...materials that can pro- vide sacrificial corrosion protection similar to cadmium in this applica- tion. However, beryllium is more hazardous than cadmium

  1. Synthesis and Electroluminescence Characterization of Cadmium Complex

    Directory of Open Access Journals (Sweden)



    Full Text Available We have synthesized and characterized a new electroluminescence material,Cadmium [(2-(2-hydroxyphenylbenzoxazole(8-hydoxyquinoline] Cd(HPBq. The absorption spectra of this material show maxima at 378 nm. It may be attributed due to π° – π* transition. The photoluminescence showed peak at 520 nm. TGA data of the material shows stability up to 370 °C .Organic light emitting diode have been fabricated with this material and the fundamental structures of the device is ITO/α-NPD/ Cd(HPBq/BCP/Alq3/LiF/Al exhibited a luminescence peak at 550 nm. The maximum luminescence of the device was 295 cd/m2 with current density of 6687 A/m2 at 20 V. The maximum current efficiency of OLED was 1.01 cd/A at 17 V and power efficiency was 1.01 lm/w at 17 V.

  2. Soil Cadmium Regulates Antioxidases in Sorghum

    Institute of Scientific and Technical Information of China (English)

    LIU Da-lin; ZHANG Shu-pan; CHEN Zheng; QIU Wei-wei


    The regulatory mechanism of soil cadmium(Cd)on antioxidases in sorghum was studied using 3 sorghum species viz.,sweet sorghum[Sorghum bicolor(L.)],sorghum hybrid sudangrass(Sorghum bicolor × S.sudanense,cv.Everlush)and sudangrass[Sorghum sudanense(Piper)Stapf cv.Xinjiang].The results showed that low concentrations of Cd2+(≤10 mg kg-1)induced the activities of 4 antioxidases in leaves of the 3 species of sorghum,but high Cd2+concentrations(≥50 mg kg-1)significantly reduced the activities of all the four antioxidases.The glutathione(GSH)contents in leaves of the 3 species of sorghum correlated positively with the Cd2+concentrations.The maximum antioxidase activities were observed at the elongation stage of sorghum during the whole growth period.

  3. Cadmium substituted high permeability lithium ferrite

    Indian Academy of Sciences (India)

    S S Bellad; S C Watawe; A M Shaikh; B K Chougule


    Polycrystalline Li0.5–/2 Cd Fe2.5–/2O4 ferrites where = 0, 0.1, 0.2, 0.3, 0.4, 0.5 and 0.6 were prepared by a double sintering ceramic technique and characterized by X-ray diffraction and scanning electron microscopy (SEM). The lattice parameter is found to increase monotonically with the cadmium content. It is explained in terms of the sizes of component ions. The grain size of the samples increases up to = 0.3 and then it decreases for higher values of . A similar trend is observed in the variation of Ms with Cd2+ content. The initial permeability () is however found to increase continuously with . The increase in is attributed to decrease of anisotropy constant K1 and higher grain size of the samples.

  4. Nickel-cadmium cell residual charge analyser

    Energy Technology Data Exchange (ETDEWEB)

    Marshall, W.G.; Leek, R.; Hampson, N.A.; Lovelock, G.R.


    This paper describes a portable unit for measuring the charge remaining in nickel-cadmium secondary cells. Exhaustive frequency response tests have confirmed that cell impedance varies very little with charge state, with the possible exception of that at very low frequencies (< 50 mHz). In the interim before further work in this area is carried out, a microprocessor-based test unit has been built which uses a current pulse discharge method to arrive at a residual charge reading. When the cell is discharged according to a particular regime, the unit produces results accurate to within 10-15% over the entire range of charge. Further development involving the inclusion of cell history parameters promises to make the unit useful for military and other applications.

  5. Aspects of the biochemical toxicology of cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Singhal, R.L.; Merali, Z.; Hrdina, P.D.


    Cadmium, in addition to producing a variety of toxic manifestations, is known to accumulate in certain ''target'' organs which include liver and kidney where histological and functional damage becomes apparent. The daily intraperitoneal injection of cadmium chloride for 21 or 45 days stimulated the activities of hepatic pyruvate carboxylase, phosphoenolpyruvate carboxykinase, fructose-1,6-diphosphatase and glucose-6-phosphatase, elevated blood glucose and urea, and lowered hepatic glycogen in rats. Whereas chronic Cd treatment failed to alter adenosine-3',5'-monophosphate phosphodiesterase (PDE) activity, cyclic AMP (cAMP) and the activity of basal and fluoride-stimulated forms of hepatic adenylate cyclase (AC) were markedly increased. However, the cAMP binding to hepatic protein kinase was decreased as was the kinase activity ratio. An acute dose of Cd decreased hepatic glycogen content and increased blood glucose, serum urea, and hepatic cAMP. Chronic exposure to Cd induced adrenal hypertrophy and augmented adrenal norepinephrine and epinephrine as well as the activity of adrenal tyrosine hydroxylase. In most cases, the observed metabolic alterations persisted up to 28 days on cessation of Cd administration. Subacute Cd treatment suppressed pancreatic function as evidenced by lowered serum immunoreactive insulin in presence of hyperglycemia, as well as by partial inhibition of phentolamine-stimulated increases in serum IRI. Although chronic Cd treatment failed to alter the concentration of brain stem norepinephrine and cerebrocortical acetylcholine esterase activity, serotonin levels of brain stem were depressed and the concentration of striatal dopamine and cerebrocortical acetylcholine were significantly elevated when compared with the values seen in control nonexposed animals.

  6. Cadmium in goods - contribution to environmental exposure

    Energy Technology Data Exchange (ETDEWEB)

    Bergbaeck, B.; Jonsson, Arne [Kalmar Univ. (Sweden). Dept. of Natural Science


    The total amount of Cd used in Sweden since 1940 is approximately 5000 tonnes, including alloys, fertilizers and impurities in zinc. The stock of Cd in goods in the Swedish anthroposphere is dominated by NiCd-batteries. However, when one considers the degree of exposure to corrosion, Cd stabilizers are dominant. Emissions of Cd from industrial plants and other point sources have been historically important. However, these point source emissions must be seen in relation to the increasingly significant fugitive `consumption emissions`, from the use and/or end-use of various goods. In this study, methods of reconstructing the flows of cadmium (Cd) and estimating the emissions over time are discussed. This is done through studies of the development of production, technology, trade and the longevity of metals in Swedish society. This last part in the chain will form the `consumption emissions` calculated from emission factors giving the proportion of the cadmium content in goods that eventually will reach the environment. The main accumulation of metals in the anthroposphere occurs in urban areas where the influx of metals is greatest. Urban areas probably represent `hot spots` as far as this type of environmental impact is concerned. Extreme Cd concentrations in surface sediments in central Stockholm indicate an ongoing release of Cd from the anthroposphere. The sources are so far unknown, i.e. this Cd flow to the biosphere cannot be explained in terms of deposition or emissions from point sources. Approximately 40 tonnes of Cd in goods are exposed to corrosion in varying degrees. This stock is dominated by Cd in stabilizers and pigments, and as impurities in Zn 15 refs, 2 figs, 8 tabs

  7. Statolith formation in Cnidaria: effects of cadmium on Aurelia statoliths (United States)

    Spangenberg, D. B.


    Statolith formation in Cnidaria was reviewed with an emphasis on Aurelia statoliths. The review provides information on the chemical composition, mechanisms of initiation of mineralization, and effects of environmental factors on Cnidarian statolith formation. Environmental factors discussed included modified sea water ingredients, X-irradiation, clinostat rotation, and petroleum oil ingredients. A detailed account of the effects of cadmium on mineralization and demineralization of Aurelia statoliths is given. Cadmium at dosages of 2 to 4 micromoles significantly reduces statolith numbers in developing ephyrae. At a dosage of 3 micromoles, cadmium accelerates statolith loss in unfed ephyrae studied at 4 and 8 days following ephyrae release from strobilae. Cadmium, therefore, is shown to reduce statolith numbers in developing ephyrae and to cause greater reduction of statolith numbers in unfed ephyrae after 4 and 8 days than occurred in controls. Supplementation of Cd(2+)-containing artificial sea water (ASW) with calcium (3X and 5X ASW calcium content) results in higher numbers of statoliths at day 4 as compared with cadmium-treated ephyrae. At 8 days only the 5X calcium supplemented ASW is effective in enhancing statolith numbers in Cd(2+)-treated ephyrae. These results suggest that cadmium competes in some manner with calcium at the mineralizing sites of Aurelia.

  8. Gastrointestinal absorption of cadmium in mice during gestation and lactation

    Energy Technology Data Exchange (ETDEWEB)

    Bhattacharyya, M.H. (Argonne National Lab., IL); Whelton, B.D.; Peterson, D.P.


    The effect on cadmium retention of continuous exposure to drinking water containing low levels of cadmium during pregnancy and lactation was studied in mice. Female mice were provided drinking water ad libitum containing /sup 109/CdCl/sub 2/ (0.03 /sup 109/Cd/ml, 0.11 ppb total cadmium) throughout either gestation, lactation, or a combined period of pregnancy and lactation. Nonpregnant control mice were exposed to the same cadmium solution for similar time periods. Dams in all three experimental groups retained two to three times cadmium (expressed as percentage of ingested dose) than did nonpregnant controls. The /sup 109/Cd contents of liver, kidney, mammary tissue, and duodenum increased strikingly in all three groups. Increases in kidney and mammary tissue were particularly apparent during lactation, with increases of fivefold for kidney and at least ninefold for mammary tissue, compared to levels in nonpregnant controls. Increases in /sup 109/Cd retention by the duodenum were fivefold during gestation and three- to fourfold during lactation. The kidneys of dams exposed during lactation retained 53% of the whole body /sup 109/Cd, while kidneys of nonpregnant controls retained only 27%. Results indicate that pregnant and lactating mice absorb and subsequently retain substantially more cadmium from their diets than do nonpregnant mice.

  9. Formation and Characterization of Mixed Crystals Based on Bis (Thiourea)Cadmium Chloride and Bis (Thiourea)Cadmium Iodide



    Bis(thiourea)cadmium chloride(BTCC) and bis(thiourea)cadmium iodide (BTCI) are metal complexes of thiourea having better nonlinear optical properties than KH2PO4. An attempt has been made in the present study to form mixed crystals based on BTCC and BTCI (even though their crystal lattices mismatch) from aqueous solutions, the precursors mixed in proper proportions. A total of seven (including the end members) crystals were formed by the free evaporation method and characteriz...

  10. Correlations of urinary cadmium with hypertension and diabetes in persons living in cadmium-contaminated villages in northwestern Thailand: A population study

    Energy Technology Data Exchange (ETDEWEB)

    Swaddiwudhipong, Witaya, E-mail: [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand); Mahasakpan, Pranee [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand); Limpatanachote, Pisit; Krintratun, Somyot [Department of Internal Medicine, Mae Sot General Hospital, Tak (Thailand)


    Risk for hypertension and diabetes has not been conclusively found to be a result of cadmium exposure. A population-based study was conducted in 2009 to examine the correlations of urinary cadmium, a good biomarker of long-term cadmium exposure, with hypertension and diabetes in persons aged 35 years and older who lived in the 12 cadmium-contaminated rural villages in northwestern Thailand. A total of 5273 persons were interviewed and screened for urinary cadmium, hypertension, and diabetes. The geometric mean level of urinary cadmium for women (2.4{+-}2.3 {mu}g/g creatinine) was significantly greater than that for men (2.0{+-}2.2 {mu}g/g creatinine). Hypertension was presented in 29.8% of the study population and diabetes was detected in 6.6%. The prevalence of hypertension significantly increased from 25.0% among persons in the lowest tertile of urinary cadmium to 35.0% in the highest tertile. In women, the rate of hypertension significantly increased with increasing urinary cadmium levels in both ever and never smokers, after adjusting for age, alcohol consumption, body mass index, and diabetes. In men, such association was less significantly found in never smokers. The study revealed no significant association between urinary cadmium and diabetes in either gender. Our study supports the hypothesis that environmental exposure to cadmium may increase the risk of hypertension. Risk for diabetes in relation to cadmium exposure remains uncertain in this exposed population.

  11. Effects of Soil pH,Texture,Moisture,Organic Matter and Cadmium Content on Cadmium Diffusion Coefficient

    Institute of Scientific and Technical Information of China (English)



    The supply of cadmium from soil to plant roots mainly depends on the diffusion prooess.This work was conducted to study the effects of some soil properties on cadmium diffusion coefficient (D) in soil. Measurements were made using the Shofield and Graham-Bryce's isotopic labelling method.Cadmium diffusion coefficients varied from 10-7to 10-9 cms2-1.Higher values were observed in acid sandy soils and lower values in calcareous clay soils.Liming an acid soil resulted in a substantial decrease of D.Addition of cadmium as nitrate salt generally increased D,while addition of sewage sludge and organic matter resulted in a significant decrease of cadmium diffusion.The rhizospheric activity also induced a moderate reduction in D.The relationships between D(10-9cms2-1)on the on hand and soil pH.moisture(Mc,g kg-1) ,organic matter(OM,g kg-1),clay(Cy,gkg-1)and cadmium content(Cd,mgkg-1) on the other were obtained by the multiple regression:D=182.1-29.91pH+0.210Mc-0.303OM+0.011Cy+1.64Cd(R2=0.859,n=22).

  12. Validity and reliability of the Horiba C-122 compact sodium analyzer in sweat samples of athletes. (United States)

    Goulet, Eric D B; Dion, Tommy; Myette-Côté, Étienne


    Accurate sodium replacement during prolonged exercise is possible when sweat rate and sweat sodium content are directly measured. Few athletes have access to sweat sodium content measurement, as the equipment needed to perform such analyzes is costly, laboratory-based or requires technical skills. Using 70 sweat samples collected in 24 athletes from 3 anatomical sites, this study determined the reliability [single-trial and inter-day (7 samples over 3 days)] and validity (instrument error) of a pocket-sized, easy-to-use and low cost sodium analyzer (Horiba C-122, Kyoto, Japan) against reference values of an ion chromatograph, the 883 Basic IC plus (Metrohm AG, Herisau, Switzerland). The Horiba C-122 showed high single-trial reliability with an intraclass correlation coefficient (ICC) of 0.997, a typical error of measurement (EM) of 1.77 mmol/L and a coefficient of variation (CV) of 3.73%. As expected, the reliability of the 883 Basic IC plus was superior to that of the Horiba C-122 (ICC: 0.999; typical EM: 0.70 mmol/L; CV: 1.52%). The Horiba’s C-122 inter-day reliability was high (ICC: 1.00; typical EM: 0.35 mmol/L). An ICC of 0.975 indicates there was a strong relationship between results provided by both analyzers. Compared with reference values, the Horiba C-122 demonstrated a mean bias of 1.71 mmol/L, a pure EM of 7.52 mmol/L and 68% limits of agreement ranging from -5.81 to 9.23 mmol/L. We propose that the Horiba C-122 is sufficiently reliable to be used under field conditions where some degree of imprecision is acceptable, but not for research purposes where high accuracy is required.

  13. Effects of cadmium accumulation from suspended sediments and phytoplankton on the Oyster Saccostrea glomerata

    Energy Technology Data Exchange (ETDEWEB)

    Schmitz, Helena A.; Maher, William A., E-mail:; Taylor, Anne M.; Krikowa, Frank


    Highlights: • Saccostrea glomerata accumulated cadmium from sediments and phytoplankton. • Effects were similar for both pathways. • Antioxidant capacity, lipid peroxidation and lysosomal destabilisation were affected. • Clear exposure–dose–response relationships were demonstrated. - Abstract: Metals are accumulated by filter feeding organisms via water, ingestion of suspended sediments or food. The uptake pathway can affect metal toxicity. Saccostrea glomerata were exposed to cadmium through cadmium-spiked suspended sediments (19 and 93 μg/g dry mass) and cadmium-enriched phytoplankton (1.6–3 μg/g dry mass) and cadmium uptake and effects measured. Oysters accumulated appreciable amounts of cadmium from both low and high cadmium spiked suspended sediment treatments (5.9 ± 0.4 μg/g and 23 ± 2 μg/g respectively compared to controls 0.97 ± 0.05 μg/g dry mass). Only a small amount of cadmium was accumulated by ingestion of cadmium-enriched phytoplankton (1.9 ± 0.1 μg/g compared to controls 1.2 ± 0.1 μg/g). In the cadmium spiked suspended sediment experiments, most cadmium was desorbed from sediments and cadmium concentrations in S. glomerata were significantly related to dissolved cadmium concentrations (4–21 μg/L) in the overlying water. In the phytoplankton feeding experiment cadmium concentrations in overlying water were <0.01 μg/L. In both exposure experiments, cadmium-exposed oysters showed a significant reduction in total antioxidant capacity and significantly increased lipid peroxidation and percentage of destabilised lysosomes. Destabilised lysosomes in the suspended sediments experiments also resulted from stress of exposure to the suspended sediments. The study demonstrated that exposure to cadmium via suspended sediments and to low concentrations of cadmium through the ingestion of phytoplankton, can cause sublethal stress to S. glomerata.

  14. Therapeutic silencing of microRNA-122 in primates with chronic hepatitis C virus infection

    DEFF Research Database (Denmark)

    Lanford, Robert E; Hildebrandt-Eriksen, Elisabeth S; Petri, Andreas;


    )-modified oligonucleotide (SPC3649) complementary to miR-122 leads to long-lasting suppression of HCV viremia, with no evidence of viral resistance or side effects in the treated animals. Furthermore, transcriptome and histological analyses of liver biopsies demonstrated derepression of target mRNAs with miR-122 seed sites......, down-regulation of interferon-regulated genes, and improvement of HCV-induced liver pathology. The prolonged virological response to SPC3649 treatment without HCV rebound holds promise of a new antiviral therapy with a high barrier to resistance....

  15. Effect of Chlorella vulgaris intake on cadmium detoxification in rats fed cadmium. (United States)

    Kim, You Jin; Kwon, Sanghee; Kim, Mi Kyung


    The aim of this study was to investigate if dietary Chlorella vulgaris (chlorella) intake would be effective on cadmium (Cd) detoxification in rats fed dietary Cd. Fourteen-week old male Sprague-Dawley (SD) rats weighing 415.0 +/- 1.6 g were randomly divided into two groups and fed slightly modified American Institute of Nutrition-93 Growing (AIN-93G) diet without (n=10) or with (n=40) dietary Cd (200 ppm) for 8 weeks. To confirm alteration by dietary Cd intake, twenty rats fed AIN-93G diet without (n=10) and with (n=10) dietary Cd were sacrificed and compared. Other thirty rats were randomly blocked into three groups and fed slightly modified AIN-93G diets replacing 0 (n=10), 5 (n=10) or 10% (n=10) chlorella of total kg diet for 4 weeks. Daily food intake, body weight change, body weight gain/calorie intake, organ weight (liver, spleen, and kidney), perirenal fat pad and epididymal fat pad weights were measured. To examine Cd detoxification, urinary Cd excretion and metallothonein (MT) concentrations in kidney and intestine were measured. Food intake, calorie intake, body weight change, body weight gain/calorie intake, organ weight and fat pad weights were decreased by dietary Cd intake. Urinary Cd excretion and MT concentrations in kidney and small intestine were increased by dietary Cd. After given Cd containing diet, food intake, calorie intake, body weight change, body weight gain/calorie intake, organ weights and fat pad weights were not influenced by dietary chlorella intake. Renal MT synthesis tended to be higher in a dose-dependent manner, but not significantly. And chlorella intake did not significantly facilitate renal and intestinal MT synthesis and urinary Cd excretion. These findings suggest that, after stopping cadmium supply, chlorella supplementation, regardless of its percentage, might not improve cadmium detoxification from the body in growing rats.

  16. Cadmium removal from contaminated soil by tunable biopolymers. (United States)

    Prabhukumar, Giridhar; Matsumoto, Mark; Mulchandani, Ashok; Chen, Wilfred


    An elastin-like polypeptide (ELP) composed of a polyhistidine tail (ELPH12) was exploited as a tunable, metal-binding biopolymer with high affinity toward cadmium. By taking advantage of the property of ELPH12 to undergo a reversible thermal precipitation, easy recovery of the sequestered cadmium from contaminated water was demonstrated as the result of a simple temperature change. In this study, batch soil washing experiments were performed to evaluate the feasibility of using ELPH12 as an environmentally benign strategy for removing cadmium from contaminated soil. The stability constant (log KL) for the cadmium-ELPH12 complex was determined to be 6.8, a value similar to that reported for the biosurfactant rhamnolipid. Two washings with 1.25 mg/mL of ELPH12 were able to remove more than 55% of the bound cadmium as compared to only 8% removal with ELP containing no histidine tail or 21% removal using the same concentration of EDTA. Unlike rhamnolipid from Pseudomonas aeruginosa ATCC 9027, which adsorbs extensively to soil, less than 10% of ELPH12 was adsorbed under all soil washing conditions. As a result, a significantly lower concentration of ELPH12 (0.036 mM as compared to 5-10 mM of biosurfactants) was required to achieve similar extraction efficiencies. However, cadmium recovery by simple precipitation was incomplete due to the displacement of bound cadmium by zinc ions present in soil. Owing to its benign nature, ease of production, and selective tailoring of the metal binding domain toward any target metals of interest, ELP biopolymers may find utility as an effective extractant for heavy metal removal from contaminated soil or ore processing.

  17. Predictors of urinary cadmium levels in adult females

    Energy Technology Data Exchange (ETDEWEB)

    McElroy, Jane A. [University of Wisconsin Paul P. Carbone Comprehensive Cancer Center, 610 Walnut Street, 370 WARF, Madison, WI 53726 (United States)]. E-mail:; Shafer, Martin M. [University of Wisconsin, Environmental Chemistry and Technology Program, 600 N Park Street, Madison, WI 53706 (United States); Hampton, John M. [University of Wisconsin Paul P. Carbone Comprehensive Cancer Center, 610 Walnut Street, 370 WARF, Madison, WI 53726 (United States); Newcomb, Polly A. [University of Wisconsin Paul P. Carbone Comprehensive Cancer Center, 610 Walnut Street, 370 WARF, Madison, WI 53726 (United States); Fred Hutchinson Cancer Research Center, Cancer Prevention Program, 1100 Fairview Ave N, M4-B402 PO Box 19024, Seattle, WA 98109 (United States)


    Ubiquitous exposure to low levels of cadmium has raised concern about adverse health effects. The aim of this study was to identify characteristics of non-occupationally exposed adult females that correlated with creatinine-adjusted urinary cadmium levels. In our population-based study, trained interviewers collected information from 254 female Wisconsin residents aged 20-69 years on tobacco use, limited dietary consumption patterns, reproductive history, demographics, and residential history. Participants provided spot-urine specimens collected at home. Urine cadmium concentrations were quantified using inductively-coupled plasma mass spectrometry and creatinine levels were also determined. Least square means and 95% confidence intervals for the natural log of the creatinine-adjusted urinary cadmium levels were calculated for each characteristic using multivariate analysis of variance adjusting for age and smoking status. Results were calculated on the log scale and then transformed to the original scale by taking the exponent of each of the values. We observed statistically significant increasing creatinine-adjusted urinary cadmium mean levels relative to smoking status, older age, parity, lower body surface area, mineral zinc supplement consumption, and high income. We did not observe a difference relative to consumption of organ meats, crustaceans, alcohol, multivitamins, multiminerals or homegrown vegetables, age of menopause, menarche of participant or oldest daughter, menopausal status or urban-rural residential location. Approximately 40% of the variance in creatinine-adjusted urinary cadmium levels in adult women was explained by several characteristics. Similar to other studies, age and smoking were the strongest determinants of creatinine-adjusted urinary cadmium concentration.

  18. Effect of Biochar on Relieving Cadmium Stress and Reducing Accumulation in Super japonica Rice

    Institute of Scientific and Technical Information of China (English)

    ZHANG Zhen-yu; MENG Jun; DANG Shu; CHEN Wen-fu


    It is of great importance to solve the threats induced by cadmium pollution on crops. This paper examined the effect of biochar on cadmium accumulation in japonica rice and revealed the mechanism underlying the response of protective enzyme system to cadmium stress. Biochar derived from rice straw was applied at two application rates under three cadmium concentrations. Shennong 265, super japonica rice variety, was selected as the test crop. The results indicated that cadmium content in above-ground biomass of rice increased with increasing soil cadmium concentrations, but the biochar application could suppress the accumulation of cadmium to some extent. Under high concentrations of cadmium, content of free proline and MDA (malondialdehyde) were high, so did the SOD (superoxide dismutase), POD (peroxidase) and CAT (catalase) activity in the lfag leaf of rice. However, the protective enzyme activities remained at low level when biochar was added.

  19. A cross-sectional survey of cadmium biomarkers and cigarette smoking. (United States)

    Hecht, Eric M; Arheart, Kris; Lee, David J; Hennekens, Charles H; Hlaing, WayWay M


    Cadmium contamination of tobacco may contribute to the health hazards of cigarette smoking. The 2005-2012 United States National Health and Nutrition Examination Survey data provided a unique opportunity to conduct a cross-sectional survey of cadmium biomarkers and cigarette smoking. Among a sample of 6761 participants, we evaluated mean differences and correlations between cadmium biomarkers in the blood and urine and characteristics of never, former and current smokers. We found statistically significant differences in mean cadmium biomarker levels between never and former smokers as well as between never and current smokers. In current smokers, duration in years had a higher correlation coefficient with urinary than blood cadmium levels. In contrast, number of cigarettes smoked per day had a higher correlation coefficient with blood than urinary cadmium levels. These data suggest that blood and urine cadmium biomarker levels differ by duration and dose. These findings should be considered in evaluating any association between cadmium and smoking related diseases, especially cardiovascular disease.

  20. Distribution of Cadmium, Iron, and Zinc in Millstreams of Hard Winter Wheat (Triticum aestivum L.). (United States)

    Guttieri, Mary J; Seabourn, Bradford W; Liu, Caixia; Baenziger, P Stephen; Waters, Brian M


    Hard winter wheat (Triticum aestivum L.) is a major crop in the Great Plains of the United States, and our previous work demonstrated that wheat genotypes vary for grain cadmium accumulation with some exceeding the CODEX standard (0.2 mg kg(-1)). Previous reports of cadmium distribution in flour milling fractions have not included high cadmium grain. This study measured the distribution of cadmium, zinc, and iron in flour and bran streams from high cadmium (0.352 mg kg(-1)) grain on a pilot mill that produced 12 flour and four bran streams. Recovery in flour was substantially greater for cadmium (50%) than for zinc (31%) or iron (22%). Cadmium, zinc, and iron in the lowest mineral concentration flour stream, representing the purest endosperm fraction, were 52, 22, and 11%, respectively, of initial grain concentration. Our results indicate that, relative to zinc and iron, a greater proportion of cadmium is stored in the endosperm, the source of white flour.

  1. Accumulation and effects of cadmium on guppy (Poecilia reticulata) fed cadmium-dosed cladocera (Moina macrocopa)

    Energy Technology Data Exchange (ETDEWEB)

    Hatakeyama, S.; Yasuno, M.


    The study examines the rate of cadmium uptake and body burdens which cause adverse effects on the survival and growth of guppies when they are exposed to Cd dosed in zooplankton (Moina macrocopa) and Cd dissolved in water. Eight guppies fed Moina dosed at 20 Cd/L water died before 10 days. Growth of the remainder of the guppies exposed at this rate was impaired initially but was returned to control level around the 10th day of the study. (JMT)

  2. Chronic Cadmium Exposure Stimulates SDF-1 Expression in an ERα Dependent Manner



    Cadmium is an omnipotent environmental contaminant associated with the development of breast cancer. Studies suggest that cadmium functions as an endocrine disruptor, mimicking the actions of estrogen in breast cancer cells and activating the receptor to promote cell growth. Although acute cadmium exposure is known to promote estrogen receptor-mediated gene expression associated with growth, the consequence of chronic cadmium exposure is unclear. Since heavy metals are known to bioaccumulate,...

  3. Cadmium Promotes Breast Cancer Cell Proliferation by Potentiating the Interaction between ERα and c-Jun



    Cadmium is an environmental contaminant that enters the body through diet or cigarette smoke. It affects multiple cellular processes, including cell proliferation, differentiation, and apoptosis. Recently, cadmium has been shown to function as an endocrine disruptor, to stimulate estrogen receptor α (ERα) activity and promote uterine and mammary gland growth in mice. Although cadmium exposure has been associated with the development of breast cancer, the mechanism of action of cadmium remains...

  4. Potentiometric stripping analysis of lead and cadmium leaching from dental prosthetic materials and teeth




    Potentiometric stipping analysis (PSA) was applied for the determination of lead and cadmium leaching from dental prosthetic materials and teeth. The soluble lead content in finished dental implants was found to be much lower than that of the individual components used for their preparation. Cadmium was not detected in dental implants and materials under the defined conditions. The soluble lead and cadmium content of teeth was slightly lower than the lead and cadmium content in whole teeth (w...

  5. Effect of Herbal Preparation on Heavy Metal (Cadmium) Induced Antioxidant System in Female Wistar Rats



    Cadmium is one of the elements found to damage antioxidant systems in mammals. To ameliorate cadmium toxicity and to prevent oxidative stress, natural products may be useful. In Indian ethnobotanical practice, a mixture of 17 herbal products is used to fortify the reproductive system of women after parturition and to reverse ovarian oxidative stress. Oral administration of this extract to rats exposed to cadmium was useful in reversing oxidative stress. Two different doses of cadmium (50 ppm ...

  6. A method for making a cadmium anode for a hermetically sealed alkaline storage battery

    Energy Technology Data Exchange (ETDEWEB)

    Morioka, Y.; Yosikhira, Y.


    Metallic cadmium powder and a glue solution are added to CdO powder. The compound is applied to a current tap and dried. The powder form metallic cadmium is prepared from a mixture of zinc and nickel powder which is dispersed in a solution of cadmium salts. As a result of the replacement reaction, a spongy metallic cadmium is produced which contains nickel. The sponge is ground. The obtained powder is used as an additive for the CdO.

  7. 血浆中micro RNA-122表达量与肝癌手术前后肝损伤的相关性%Correlation between micro RNA-122 expression and liver injury before and after hepatectomy of cancer

    Institute of Scientific and Technical Information of China (English)



    目的 研究血浆中micro RNA-122(miR-122)的表达量与肝癌手术前后肝损伤的相关性.方法 利用荧光定量检测30名健康人与30例肝癌患者的术前miR-122及丙氨酸氨基转移酶(ALT)的表达量,并进行比较,且检测30例肝癌患者的术前,术后第1、3、7天的血浆中miR-122及ALT,探讨miR-122与ALT的相关性.结果 术前肝癌患者血浆中miR-122以及ALT的表达量均显著高于健康人群(P < 0.05).患者术前,术后第1、3、7天血浆中的miR-122均与ALT呈正相关.结论 血浆miR-122与肝切除术肝功能损伤相关,有望成为肝癌肝切除术前后肝功能损伤的检测指标.

  8. 19 CFR 122.117 - Requirements for transit air cargo transport. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Requirements for transit air cargo transport. 122... Requirements for transit air cargo transport. (a) Transportation—(1) Port to port. Transit air cargo may be... cargo, a receipt shall be given. The receipt shall be made by the airline responsible for transport...

  9. 7 CFR 917.122 - Qualification requirements and nominiation procedure for public members of Commodity Committees. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Qualification requirements and nominiation procedure... Regulations Administrative Bodies § 917.122 Qualification requirements and nominiation procedure for public... regulated under this part. (b) Public members should be able to devote sufficient time and express...

  10. 9 CFR 354.122 - Condemnation on ante-mortem inspection. (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Condemnation on ante-mortem inspection... Procedures; Ante-Mortem Inspections § 354.122 Condemnation on ante-mortem inspection. Rabbits found in a... showing, on ante-mortem inspection, any disease or condition, that under §§ 354.129 to 354.131,...

  11. 47 CFR 80.122 - Public coast stations using facsimile and data. (United States)


    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Public coast stations using facsimile and data... Procedures-Public Coast Stations § 80.122 Public coast stations using facsimile and data. Facsimile... and ship stations. Facsimile and data techniques may be implemented in accordance with the...

  12. 31 CFR 103.122 - Customer identification programs for broker-dealers. (United States)


    ... Finance FINANCIAL RECORDKEEPING AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Anti-Money Laundering Programs Anti-Money Laundering Programs § 103.122 Customer identification programs for broker-dealers. (a... anti-money laundering compliance program required under 31 U.S.C. 5318(h). (2) Identity...

  13. 42 CFR 424.122 - Conditions for payment for emergency inpatient hospital services. (United States)


    ... Conditions: Services Furnished in a Foreign Country § 424.122 Conditions for payment for emergency inpatient hospital services. Medicare Part A pays for emergency inpatient hospital services furnished by a foreign... conditions for payment for emergency services set forth in § 424.103 are met. (d) The hospital is a...

  14. 19 CFR 122.134 - When airline does not have in-bond liquor storeroom. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false When airline does not have in-bond liquor... SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Liquor Kits § 122.134 When airline... where the airline involved does not have an authorized in-bond liquor storeroom. When this occurs,...

  15. 42 CFR 436.122 - Pregnant women eligible for extended coverage. (United States)


    ... 42 Public Health 4 2010-10-01 2010-10-01 false Pregnant women eligible for extended coverage. 436... ISLANDS Mandatory Coverage of the Categorically Needy § 436.122 Pregnant women eligible for extended... period following termination of pregnancy to women who, while pregnant, applied for, were eligible...

  16. Complete Genome Sequence of Bradyrhizobium diazoefficiens USDA 122, a Nitrogen-Fixing Soybean Symbiont (United States)

    Sugawara, Masayuki; Tsukui, Takahiro; Kaneko, Takakazu; Ohtsubo, Yoshiyuki; Sato, Shusei; Nagata, Yuji; Tsuda, Masataka; Mitsui, Hisayuki


    ABSTRACT We report the complete genome sequence of Bradyrhizobium diazoefficiens USDA 122, a nitrogen-fixing soybean symbiont. The genome consists of a 9.1 Mb circular chromosome, and 8,551 coding sequences (CDSs) were predicted on the genome. The sequence will provide insight into the evolution of rhizobial genome, and the symbiotic compatibility with host plants. PMID:28254989

  17. 48 CFR 731.770 - OMB Circular A-122, cost principles for nonprofit organizations; USAID implementation. (United States)


    ... principles for nonprofit organizations; USAID implementation. 731.770 Section 731.770 Federal Acquisition... PRINCIPLES AND PROCEDURES Contracts With Nonprofit Organizations 731.770 OMB Circular A-122, cost principles for nonprofit organizations; USAID implementation. (a) Paragraph 6 of the transmittal letter for...

  18. 7 CFR 58.122 - Approved plants under USDA inspection and grading service. (United States)


    ...) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS... and Grading Service 1 Purpose § 58.122 Approved plants under USDA inspection and grading service....

  19. 17 CFR 248.122 - Scope and duration of opt out. (United States)


    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.122 Scope and... information received from another affiliate as described in the notice to make marketing solicitations to the... the expectation of engaging in other transactions. (4) Menu of alternatives. A consumer may be...

  20. Nrf2 activation prevents cadmium-induced acute liver injury

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Kai C. [Department of Pharmacology, Toxicology, and Therapeutics, University of Kansas Medical Center, Kansas City, KS (United States); Liu, Jie J. [Department of Internal Medicine, University of Kansas Medical Center, Kansas City, KS (United States); Klaassen, Curtis D., E-mail: [Department of Internal Medicine, University of Kansas Medical Center, Kansas City, KS (United States)


    Oxidative stress plays an important role in cadmium-induced liver injury. Nuclear factor erythroid 2-related factor 2 (Nrf2) is a transcription factor that up-regulates cytoprotective genes in response to oxidative stress. To investigate the role of Nrf2 in cadmium-induced hepatotoxicity, Nrf2-null mice, wild-type mice, kelch-like ECH-associated protein 1-knockdown (Keap1-KD) mice with enhanced Nrf2, and Keap1-hepatocyte knockout (Keap1-HKO) mice with maximum Nrf2 activation were treated with cadmium chloride (3.5 mg Cd/kg, i.p.). Blood and liver samples were collected 8 h thereafter. Cadmium increased serum alanine aminotransferase (ALT) and lactate dehydrogenase (LDH) activities, and caused extensive hepatic hemorrhage and necrosis in the Nrf2-null mice. In contrast, Nrf2-enhanced mice had lower serum ALT and LDH activities and less morphological alternations in the livers than wild-type mice. H{sub 2}DCFDA (2′,7′-dichlorodihydrofluoresein diacetate) staining of primary hepatocytes isolated from the four genotypes of mice indicated that oxidative stress was higher in Nrf2-null cells, and lower in Nrf2-enhanced cells than in wild-type cells. To further investigate the mechanism of the protective effect of Nrf2, mRNA of metallothionein (MT) and other cytoprotective genes were determined. Cadmium markedly induced MT-1 and MT-2 in livers of all four genotypes of mice. In contrast, genes involved in glutathione synthesis and reducing reactive oxygen species, including glutamate-cysteine ligase (Gclc), glutathione peroxidase-2 (Gpx2), and sulfiredoxin-1 (Srxn-1) were only induced in Nrf2-enhanced mice, but not in Nrf2-null mice. In conclusion, the present study shows that Nrf2 activation prevents cadmium-induced oxidative stress and liver injury through induction of genes involved in antioxidant defense rather than genes that scavenge Cd. -- Highlights: ► Cadmium caused extensive hepatic hemorrhage and necrosis in Nrf2-null mice. ► Keap1-KD and Keap1-HKO mice

  1. Subcellular Localization of Cadmium in Chlorella vulgaris Beijerinck Strain Bt-09

    Directory of Open Access Journals (Sweden)

    P.B. Lintongan


    Full Text Available Growth response curves of Chlorella vulgaris Beijerinck strain Bt-09 to sublethal concentrations of cadmium were evaluated. The growth responses of this microalgal isolate was determined through analysis of chlorophyll a levels. Cadmium was effectively taken up by the cells as determined by Flame Atomic Absorption Spectrophotometry (F-AAS. Subcellular fractionation was undertaken to locate sites that accumulate cadmium.

  2. Effects of chronic alternating cadmium exposure on the episodic secretion of prolactin in male rats

    Energy Technology Data Exchange (ETDEWEB)

    Esquifino, A.I. [Madrid Univ. (Spain). Facultad de Medicina Complutense; Marquez, N.; Alvarez-Demanuel, E.; Lafuente, A. [Vigo Univ., Orense (Spain). Lab. de Toxicologia


    Cadmium increases or decreases prolactin secretion depending on the dose and duration of the exposure to the metal. However, whether there are cadmium effects on the episodic prolactin secretion is less well known. This study was undertaken to address whether chronic alternating exposure to two different doses of cadmium affects the episodic pattern of prolactin and to what extent the effects of cadmium are age-dependent. Male rats were treated s.c. with cadmium chloride (0.5 or 1.0 mg/kg) from day 30 to 60, or from day 60 to 90 of age, with alteration of the doses every 4 days, starting with the smaller dose. Controls received vehicle every 4 days. The last dose of cadmium was given 48 h prior to the pulsatility study. Prolactin secretion in the 4 experimental groups studied was episodic and changed significantly after cadmium exposure. Cadmium administration from day 30 to 60 of life significantly decreased the mean half-life of prolactin. On the other hand, when administered from day 60 to 90 cadmium significantly decreased the mean as well as serum prolactin levels and the absolute amplitude of the prolactin pulses, their duration, the relative amplitude or the mean half-life of the hormone. The frequency of prolactin peaks was not changed by cadmium administration. The results indicate that low intermittent doses of cadmium chronically administered change the episodic secretion pattern of prolactin in rats. The effects of cadmium on prolactin secretion were age dependent. (orig.)

  3. Effects of diethyldithiocarbamate on the toxicokinetics of cadmium chloride in mice

    DEFF Research Database (Denmark)

    Andersen, O; Nielsen, J B


    in the toxicokinetics of cadmium induced by DDC are mainly due to the high cadmium doses employed and the intraperitoneal administration of DDC. At lower doses and more realistic administration routes for cadmium and DDC, the effect of DDC is less. However, still DDC does not seem to have any potential as an antidote...

  4. SNF1-related protein kinases type 2 are involved in plant responses to cadmium stress.

    NARCIS (Netherlands)

    A. Kulik; A. Anielska-Mazur; M. Bucholc; E. Koen; E. Szymańska; A. Żmieńko; E. Krzywińska; I. Wawer; F. McLoughlin; D. Ruszkowski; M. Figlerowicz; C. Testerink; A. Sklodowska; D. Wendehenne; G. Dobrowolska


    Cadmium ions are notorious environmental pollutants. To adapt to cadmium-induced deleterious effects plants have developed sophisticated defense mechanisms. However, the signaling pathways underlying the plant response to cadmium are still elusive. Our data demonstrate that SnRK2s (for SNF1-related

  5. Critical organ concentration of cadmium in occupationally-exposed workers

    Energy Technology Data Exchange (ETDEWEB)

    Ellis, K.J.; Morgan, W.D.; Yasumura, S.; Vartsky, D.; Zanzi, I.; Cohn, S.H.


    This report describes the present Brookhaven facility for in vivo measurements of cadmium in man and provides a comparison with other portable systems. The cadmium detection limits are 2.2 mg in the kidney and 1.5 ppM in the liver for the Brookhaven system. In a recent field study, the cadmium content of the left kidney and concentration in the liver were measured in 82 occupationally exposed workers and 10 control subjects. Organ content ranged up to 57 mg in the kidney and up to 120 ppM in the liver for the industrial group. By contrast, the values for the control group ranged from 0.4 to 11.8 mg for the kidney and 0.7 to 7.9 ppM for the liver. The geometric means were 3.7 mg for the kidney and 2.7 ppM for the liver in the control group. When the data were analyzed to provide an estimate of the critical concentration for the kidney, a range of 300 to 400 for the renal cortex was calculated. The corresponding cadmium concentrations in the liver and urine were 30 to 42 ppM (liver) and 22 to 28 creatinine (urine), respectively. Blood and urine levels of cadmium and ..beta../sub 2/-microgloubin were also evaluated as possible biological indicators of organ content.

  6. Cadmium toxicity in the thyroid gland of pregnant rats

    Energy Technology Data Exchange (ETDEWEB)

    Yoshizuka, M.; Mori, N.; Hamasaki, K.; Tanaka, I.; Yokoyama, M.; Hara, K.; Doi, Y.; Umezu, Y.; Araki, H.; Sakamoto, Y. (Department of Anatomy, School of Medicine, University of Occupational and Environmental Health, Kitakyushu (Japan))


    The toxic effects of cadmium on the thyroid gland of pregnant rats were studied with an electron microscope and an X-ray microanalyzer. Serum levels of thyroid hormones (T3 and T4) were also analyzed. Deterioration of the rough-surfaced endoplasmic reticulum occurred in the thyroid follicular epithelium on the fifth day of cadmium treatment. Large intracellular vacuoles, which arose from dilated cisternae of the rough-surfaced endoplasmic reticulum, were fused together, and marked swelling of the mitochondria was also noted. Thyroglobulin-secreting granules at the apical cytoplasm were decreased in number. By energy dispersive X-ray microanalysis, cadmium peaks were preferentially obtained from swollen mitochondria in the follicular epithelial cells. Serum levels of T3 and T4 were significantly decreased in cadmium-treated rats dams when compared to those of controls. In the present experiment, cycloheximide also caused degenerative changes in the rough-surfaced endoplasmic reticulum and the disappearance of thyroglobulin-secreting granules. Cycloheximide is a known inhibitor of protein synthesis on cytosolic ribosomes. These results indicated that accumulated cadmium in the mitochondria of thyroid follicular epithelial cells might disturb the oxidative phosphorylation of this organelle and the loss of energy supply possibly caused the inhibition of the synthesis and release of thyroid hormones.

  7. Lead and cadmium in indoor air and the urban environment

    Energy Technology Data Exchange (ETDEWEB)

    Komarnicki, Guenter J.K. [Department of Ecotoxicology, Center of Public Health, Medical University of Vienna, Waehringer Str. 10, A-1090 Vienna (Austria)]. E-mail:


    The present study was conducted to find potential terrestrial biomonitors for heavy metals in indoor air in an urban environment. TSP, PM{sub 10}, and PM{sub 2.5} were collected in three retirement facilities in the urban area of Vienna. In addition, particulate matter and soil, vegetation, and isopods (Porcellio scaber L.) were collected in the adjacent garden areas. Aerosols were sampled with a low-volume air sampler. The sampled materials were wet ashed and total lead and cadmium contents were determined. Water-soluble heavy metal concentrations were measured in aqueous extracts from air exposed filters, soil, and vegetation. Lead and cadmium were analyzed by graphite furnace AAS. Lead contents in the vegetation were inferred from water-soluble lead in soils. Lead in isopods generally reflected the contents in vegetation. Cadmium in plants probably derived from soil solutions as well as from atmospheric input. Isopods reflected the total cadmium contents in soils. Particulate matter was dominated by PM{sub 2.5}, both with respect to mass concentrations and to heavy metal contents. The indoor aerosol was found to be influenced by human activity, indoor sources, and outdoor particles. Relationships between indoor airborne heavy metals and the contents in vegetation (lead and cadmium: positive) and isopods (lead: negative) were identified to have the potential for biomonitoring indoor air quality. - Urban vegetation and isopods are potential indicators for indoor aerial heavy metals.

  8. Cadmium block of isometric contractions of isolated bullfrog atrial cells. (United States)

    Shepherd, N; Kavaler, F; Spielman, W


    We studied the effect of cadmium, verapamil, and quinacrine on the force of contraction (Fp) of isolated, single, field-stimulated bullfrog atrial cells. All agents were applied or removed rapidly (t1/2 approximately 15 ms) to minimize intracellular concentration changes other than intracellular calcium concentration. Two components of twitch force were observed, one blocked by micromolar Cd2+ and the other by millimolar Cd2+. The two contributed about equally to the activation of the twitch. The "cadmium-sensitive" portion of force (that affected by [Cd] less than or equal to 100 microM) had a K1/2 approximately 1 microM, was identical in magnitude to, and not additive with, a "verapamil-sensitive" (10 microM) component of force, was most strongly affected by 50-ms pulses of Cd2+ when they were applied in the mechanical latent period, and was potentiated by catecholamines. The cadmium-insensitive portion of force was abolished by the removal of extracellular calcium and was greatly potentiated by quinacrine (3 or 10 microM), a blocker of Na-Ca exchange. The results are consistent with the idea that activating calcium enters the cell via both an inactivating cadmium-sensitive L-type channel and a noninactivating cadmium-insensitive mechanism that is not Na-Ca exchange and leaves the cell via Na-Ca exchange.

  9. Lead and cadmium in indoor air and the urban environment. (United States)

    Komarnicki, Günter J K


    The present study was conducted to find potential terrestrial biomonitors for heavy metals in indoor air in an urban environment. TSP, PM(10), and PM(2.5) were collected in three retirement facilities in the urban area of Vienna. In addition, particulate matter and soil, vegetation, and isopods (Porcellio scaber L.) were collected in the adjacent garden areas. Aerosols were sampled with a low-volume air sampler. The sampled materials were wet ashed and total lead and cadmium contents were determined. Water-soluble heavy metal concentrations were measured in aqueous extracts from air exposed filters, soil, and vegetation. Lead and cadmium were analyzed by graphite furnace AAS. Lead contents in the vegetation were inferred from water-soluble lead in soils. Lead in isopods generally reflected the contents in vegetation. Cadmium in plants probably derived from soil solutions as well as from atmospheric input. Isopods reflected the total cadmium contents in soils. Particulate matter was dominated by PM(2.5), both with respect to mass concentrations and to heavy metal contents. The indoor aerosol was found to be influenced by human activity, indoor sources, and outdoor particles. Relationships between indoor airborne heavy metals and the contents in vegetation (lead and cadmium: positive) and isopods (lead: negative) were identified to have the potential for biomonitoring indoor air quality.

  10. Cadmium in insects after ash fertilization

    Institute of Scientific and Technical Information of China (English)

    Martin Lodenius; Jussi Josefsson; Kari Heli(o)vaara; Esa Tulisalo; Matti Nummelin


    Ash fertilization of forests returns nutrients to forest ecosystems and has a positive effect on soil pH.but it also may elevate Cd concentrations of forest biota.Cadmium concentrations of some forest insects(Formica ants.carabids and Coleopteran larvac from decaying wood)were investigated in southern Finland where two plots were fertilized with wood ash,while two other plots represented anfertilized control plots.In ants,mean Cd concentration was 3.6±1.4 mg/kg.with nest workers having significantly higher concen-trations than workers trapped in pitfall traps.Concentrations at fertilized and unfertilized plots were similar.In carabid beetles,the average Cd concentration of Carabus glabratus was 0.44±0.36 mg/kg.with no significant difference between control plots and fertilized plots.In another carabid beetle,Pterostichus niger,mean Cd concentration was higher at fertilized plots compared to control plots.We conclude that the variation of Cd concentra-tions in the insects studied is more efficiently controlled by species-specific differences than fertilization history of the forest floor.

  11. Cadmium potentiates toxicity of cypermethrin in zebrafish. (United States)

    Yang, Ye; Ye, Xiaoqing; He, Buyuan; Liu, Jing


    Co-occurrence of pesticides such as synthetic pyrethroids and metals in aquatic ecosystems raises concerns over their combined ecological effects. Cypermethrin, 1 of the top 5 synthetic pyrethroids in use, has been extensively detected in surface water. Cadmium (Cd) has been recognized as 1 of the most toxic metals and is a common contaminant in the aquatic system. However, little information is available regarding their joint toxicity. In the present study, combined toxicity of cypermethrin and Cd and the underlying mechanisms were investigated. Zebrafish embryos and adults were exposed to the individual contaminant or binary mixtures. Co-exposure to cypermethrin and Cd produced synergistic effects on the occurrence of crooked body, pericardial edema, and noninflation of swim bladder. The addition of Cd significantly potentiated cypermethrin-induced spasms and caused more oxidative stress in zebrafish larvae. Cypermethrin-mediated induction of transcription levels and catalytic activities of cytochrome P450 (CYP) enzyme were significantly down-regulated by Cd in both zebrafish larvae and adults. Chemical analytical data showed that in vitro elimination of cypermethrin by CYP1A1 was inhibited by Cd. The addition of Cd caused an elevation of in vivo cypermethrin residue levels in the mixture-exposed adult zebrafish. These results suggest that the enhanced toxicity of cypermethrin in the presence of Cd results from the inhibitory effects of Cd on CYP-mediated biotransformation of this pesticide. The authors' findings provide a deeper understanding of the mechanistic basis accounting for the joint toxicity of cypermethrin and Cd.

  12. Optical Constants of Cadmium Telluride Thin Film (United States)

    Nithyakalyani, P.; Pandiaraman, M.; Pannir, P.; Sanjeeviraja, C.; Soundararajan, N.


    Cadmium Telluride (CdTe) is II-VI direct band gap semiconductor compound with potential application in Solar Energy conversion process. CdTe thin film of thickness 220 mn was prepared by thermal evaporation technique at a high vacuum better than 10-5 on well cleaned glass substrates of dimensions (l cm×3 cm). The transmittance spectrum and the reflectance spectrum of the prepared CdTc thin film was recorded using UV-Vis Spectrophotometer in the wavelength range between 300 nm and 900 nm. These spectral data were analyzed and the optical band and optical constants of CdTe Thin film have been determined by adopting suitable relations. The optical band gap of CdTe thin film is found to be 1.56 eV and this value is also agreeing with the published works of CdTe thin film prepared by various techniques. The absorption coefficient (α) has been higher than 106 cm-1. The Refractive index (n) and the Extinction Coefficient (k) are found to be varying from 3.0 to 4.0 and 0.1 Cm-1 to 0.5 Cm-1 respectively by varying the energy from l.0 eV to 4.0 eV. These results are also compared with the literature.

  13. Collinear laser spectroscopy of atomic cadmium

    CERN Document Server

    Frömmgen, Nadja; Bissell, Mark L; Bieroń, Jacek; Blaum, Klaus; Cheal, Bradley; Flanagan, Kieran; Fritzsche, Stephan; Geppert, Christopher; Hammen, Michael; Kowalska, Magdalena; Kreim, Kim; Krieger, Andreas; Neugart, Rainer; Neyens, Gerda; Rajabali, Mustafa M; Nörtershäuser, Wilfried; Papuga, Jasna; Yordanov, Deyan T


    Hyperfine structure $A$ and $B$ factors of the atomic $5s\\,5p\\,\\; ^3\\rm{P}_2 \\rightarrow 5s\\,6s\\,\\; ^3\\rm{S}_1$ transition are determined from collinear laser spectroscopy data of $^{107-123}$Cd and $^{111m-123m}$Cd. Nuclear magnetic moments and electric quadrupole moments are extracted using reference dipole moments and calculated electric field gradients, respectively. The hyperfine structure anomaly for isotopes with $s_{1/2}$ and $d_{5/2}$ nuclear ground states and isomeric $h_{11/2}$ states is evaluated and a linear relationship is observed for all nuclear states except $s_{1/2}$. This corresponds to the Moskowitz-Lombardi rule that was established in the mercury region of the nuclear chart but in the case of cadmium the slope is distinctively smaller than for mercury. In total four atomic and ionic levels were analyzed and all of them exhibit a similar behaviour. The electric field gradient for the atomic $5s\\,5p\\,\\; ^3\\mathrm{P}_2$ level is derived from multi-configuration Dirac-Hartree-Fock calculatio...


    Energy Technology Data Exchange (ETDEWEB)



    Separating the metals from the glass is the first step in recycling end-of-life cadmium telluride photovoltaic modules and manufacturing scrap. We accomplished this by leaching the metals in solutions of various concentrations of acids and hydrogen peroxide. A relatively dilute solution of sulfuric acid and hydrogen peroxide was found to be most effective for leaching cadmium and tellurium from broken pieces of CdTe PV modules. A solution comprising 5 mL of hydrogen peroxide per kg of PV scrap in 1 M sulfuric acid, gave better results than the 12 mL H{sub 2}O{sub 2}/kg, 3.2 M H{sub 2}SO{sub 4} solution currently used in the industry. Our study also showed that this dilute solution is more effective than hydrochloric-acid solutions and it can be reused after adding a small amount of hydrogen peroxide. These findings, when implemented in large-scale operation, would result in significant savings due to reductions in volume of the concentrated leaching agents (H{sub 2}SO{sub 4} and H{sub 2}O{sub 2}) and of the alkaline reagents required to neutralize the residuals of leaching.

  15. Determination of presence and quantification of cadmium, lead and copper in Nile tilapia (Oreochromis niloticus fillets obtained from three cold storage plants in the state of Parana, Brazil

    Directory of Open Access Journals (Sweden)

    Alexandre Nobuhiro Tajiri


    Full Text Available Pisciculture is an economic activity that is steadily growing in the state of Parana, Brazil, and Nile tilapia (Oreochromis niloticus is one of the widely cultivated species in this state. Tilapia is not only a very nutritious food, but also an important indicator of environmental contamination. This study aimed to verify contamination by cadmium, copper and lead in tilapia fillets, and to compare the found values to international legislations. Were collected 135 samples of tilapia fillets, between July 2006 and May 2007, in three fish stores located in regions west and north of Paraná State. Samples of tilapia fillet were analyzed in relation to the presence of cadmiun, lead and copper, using atomic absorption spectrophotometry. Lead has not been detected in the analyses. Cadmium has been detected in three samples, on concentrations of 0.012 µg.g-1, 0.011 µg.g-1 and 0.014 µg.g-1. Copper has been detected in all fillets, and the average concentration of each cold storage plant was of 0.122 µg.g-1, 0.106 µg.g-1 and 0.153 µg.g-1. The concentrations found in this study are within the limits allowed by both the European and the Australian legislations.

  16. 40 CFR 122.30 - What are the objectives of the storm water regulations for small MS4s? (United States)


    ... water regulations for small MS4s? 122.30 Section 122.30 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS EPA ADMINISTERED PERMIT PROGRAMS: THE NATIONAL POLLUTANT... solids, nutrients, heavy metals, pathogens, toxins, oxygen-demanding substances, and floatables. (d)...

  17. Cadmium accumulation characteristics and removal potentials of high cadmium accumulating rice line grown in cadmium-contaminated soils. (United States)

    Tang, Hao; Li, Tingxuan; Yu, Haiying; Zhang, Xizhou


    Phytoextraction is a promising technique to remove cadmium (Cd) from contaminated soils. In this research, the two different Cd accumulation rice lines of Lu527-8 (the high Cd accumulating rice line) and Lu527-4 (the normal rice line) were grown in soils with different Cd treatments (0, 5, 10, and 20 mg kg(-1) soil) to evaluate Cd accumulation characteristics and Cd removal potentials. When the concentration of Cd in soil increased, Lu527-8 showed less symptoms of phytotoxicity when compared to Lu527-4. Furthermore, Lu527-8 demonstrated greater shoot Cd accumulation (321.17-964.95 mg plant(-1)) than Lu527-4 (50.37-201.66 μg plant(-1)) at the jointing and filling stages. The soil available Cd content of Lu527-8 significantly decreased by 26.92-38.97 and 27.77-63.44 % at the jointing and filling stages, respectively. Meanwhile, the total Cd content in soil also reduced by 11.64-46.75 and 21.41-54.11 % at jointing and filling stages, respectively. When the Cd concentration in soil was 20 mg kg(-1), the Cd extraction rate in shoots of Lu527-8 reached 2.12 and 2.85 % which increased 10.60 and 6.48 times compared with that of Lu527-4 at the jointing and filling stages, respectively. In conclusion, this study demonstrates that Lu527-8 shows great abilities of Cd accumulation and Cd removal potential from contaminated soils with different Cd treatments and it is a promising species for phytoextraction of Cd-contaminated soils.

  18. Analysis Of The Underpotential Deposition Of Cadmium On Copper

    Directory of Open Access Journals (Sweden)

    Kowalik R.


    Full Text Available In this study the process of deposition of cadmium on polycrystalline copper electrode in sulfate solution was investigated. The process of underpotential and bulk deposition was analyzed by classical electrochemical method: cyclic voltammetry(CV, anodic stripping voltammetry(ASV and electrochemical quartz crystal microbalance(EQCM. The obtained results were compared with electrochemical impedance spectroscopy(EIS measurements. CV, EQCM and EIS results suggest that the UPD of cadmium starts below potential −0.4 V vs Ag/AgCl. Additionally the stripping analysis indicates the formation of cadmium monolayer with different density of deposited atoms depending on the applied potential. The transition from UPD to bulk deposition occurs below potential −0,7 V.

  19. Cadmium extraction from phosphate ore. Effect of microwave

    Directory of Open Access Journals (Sweden)

    Zahia Benredjem


    Full Text Available This study discusses the operating variables for removal of cadmium from phosphate ore using Na2EDTA. These variables include the reaction time, Na2EDTA concentration, liquid/phosphate ore ratio, number of extractions and microwave extraction. Na2EDTA induced a two-step extraction process including a rapid extraction within the first hour, and a subsequent gradual release that occurred over the following hours. The cadmium extraction efficiency increased progressively with the increasing of Na2EDTA concentration. The extraction efficiency of cadmium increased with increasing liquid/phosphate ratio in the 5–200 range. Consecutive extractions using low concentrations were more effective than a single soil extraction with concentrated Na2EDTA. Microwave was beneficial to improve the removal in soil washing, and using microwave could partly substitute for agitation.

  20. Cadmium levels in Europe: implications for human health. (United States)

    Pan, Jilang; Plant, Jane A; Voulvoulis, Nikolaos; Oates, Christopher J; Ihlenfeld, Christian


    In this study we used the Forum of European Geological Surveys geochemical baseline data to examine the distribution of cadmium (Cd) in Europe, with a particular reference to the international soil and water guideline values. The highest cadmium levels were found to occur in topsoil and to follow closely the distribution of P(2)O(5), suggesting that the contamination was from the use of rock phosphate fertilizer in intensive arable agriculture. In terms of human health impacts, food (up to several hundred microg/day) was found as the only major route of exposure to Cd for the non-smoking general population. It appeared that low levels of chronic exposure to Cd resulted in completely different human health impacts than those high levels that had caused the 'itai-itai' disease. Some correlations were suggested between cadmium levels and the age-adjusted prostate or breast cancer rates distributed in the European countries under study.

  1. Biosorption of Cadmium by Fungal Biomass of Aspergillus niger

    Institute of Scientific and Technical Information of China (English)



    Objective To investigate the removal of cadmium from aqueous solution by waste fungal biomass of Aspergillus niger, originated from citric acid fermentation industry. Methods Batch adsorption test was used to study the biosorption equilibrium and isotherm. The Cd2+ concentration was measured with atomic adsorption spectrophotometer (AAS) HITACHI 180-80. Results The biosorption achieved equilibrium within 30 min. The adsorption isotherm could be described by Freundlich adsorption model, and the constants KF and 1/n were determined to be 2.07 and 0.18, respectively, and the correlation efficiency was 0.97. The optimal pH for Cd adsorption was 6.0. The cadmium-laden biomass could be effectively regenerated using 0.1 N HCl. Conclusion The waste biomass of Aspergillus niger, a by-product of fermentation industry, is a potential biosorbent for the removal of cadmium from aqueous solution.

  2. Renal and blood pressure effects from environmental cadmium exposure in Thai children

    Energy Technology Data Exchange (ETDEWEB)

    Swaddiwudhipong, Witaya, E-mail: [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand); Mahasakpan, Pranee [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand); Jeekeeree, Wanpen [Department of Medical Technology, Mae Sot General Hospital, Tak 63110 (Thailand); Funkhiew, Thippawan [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand); Sanjum, Rungaroon; Apiwatpaiboon, Thitikarn [Department of Medical Technology, Mae Sot General Hospital, Tak 63110 (Thailand); Phopueng, Ittipol [Department of Community and Social Medicine, Mae Sot General Hospital, Tak 63110 (Thailand)


    Very few studies have shown renal and blood pressure effects from environmental cadmium exposure in children. This population study examined associations between urinary cadmium excretion, a good biomarker of long-term cadmium exposure, and renal dysfunctions and blood pressure in environmentally exposed Thai children. Renal functions including urinary excretion of β{sub 2}-microglobulin, calcium (early renal effects), and total protein (late renal effect), and blood pressure were measured in 594 primary school children. Of the children studied, 19.0% had urinary cadmium ≥1 μg/g creatinine. The prevalence of urinary cadmium ≥1 μg/g creatinine was significantly higher in girls and in those consuming rice grown in cadmium-contaminated areas. The geometric mean levels of urinary β{sub 2}-microglobulin, calcium, and total protein significantly increased with increasing tertiles of urinary cadmium. The analysis did not show increased blood pressure with increasing tertiles of urinary cadmium. After adjusting for age, sex, and blood lead levels, the analysis showed significant positive associations between urinary cadmium and urinary β{sub 2}-microglobulin and urinary calcium, but not urinary total protein nor blood pressure. Our findings provide evidence that environmental cadmium exposure can affect renal functions in children. A follow-up study is essential to assess the clinical significance and progress of renal effects in these children. - Highlights: • Few studies show renal effects from environmental cadmium exposure in children. • We report renal and blood pressure effects from cadmium exposure in Thai children. • Urinary β{sub 2}-microglobulin and calcium increased with increasing urinary cadmium. • The study found no association between urinary cadmium levels and blood pressure. • Environmental cadmium exposure can affect renal functions in children.

  3. Cadmium effects and accumulation in cultures of Prorocentrum micans (dinophyta) (United States)

    Kayser, H.; Sperling, K.-R.


    Effects and accumulation of cadmium were studied in unialgal 10-1 batch-culture experiments with the dinoflagellate Prorocentrum micans Ehrenberg. Tests were made using sterile filtered North Sea water enriched with nitrate and phosphate only in order to avoid disturbances by complex formation. Cadmium was added to the cultures in amounts of 100 to 0.13 µg l-1. In one series it was added at the start of the experiments and in a second one after a growth period of 1 week. Addition of only 1.2 µg Cd l-1 reduces multiplication rates and maximum cell densities of the algae. Not until 0.4 µg Cd-1 does growth correspond to that of the controls. Cadmium concentrations were measured, after filtration, in the culture medium and in the biomass by means of flameless AAS. The cadmium content in algae increased from 2.7 µg g-1 (dry weight) in controls to 500 µg g-1 (dry weight) in media containing 100 µg Cd l-1. Uptake occurred rapidly during the first few days of the experiments, slowed down somewhat during exponential growth stage, and increased during decay of the cultures. Cadmium content of culture media remained nearly constant (Series 1) or decreased only slowly during experimental time (Series 2). The highest concentration factor was measured in the controls. It decreased with increasing metal concentration in the medium and increased with experimental time. Structural modifications of the cells were visible after Lugol fixation only, indicating brittleness of the cell walls. P. micans has shown to be extremely sensitive to cadmium and to accumulate this metal.

  4. Cadmium toxicity to ringed seals (Phoca hispida): an epidemiological study of possible cadmium-induced nephropathy and osteodystrophy in ringed seals (Phoca hispida) from Qaanaaq in Northwest Greenland

    DEFF Research Database (Denmark)

    Sonne-Hansen, C; Dietz, R; Leifsson, P S;


    . Experience from cadmium-poisoned humans and laboratory mammals indicates that concentrations above 50-200 microg/g wet wt. may induce histopathological changes. Overall, 31 of the ringed seals had cadmium concentrations in the kidney cortex above 50 microg/g wet wt., 11 had concentrations above 100 and one......The Greenland marine food chains contain high levels of cadmium, mercury and selenium. Concentrations of cadmium in the kidney of ringed seals (Phoca hispida) from the municipalities of Qaanaaq and Upernavik (Northwest Greenland) are among the highest recorded in the Arctic. The purpose...... of the study was to determine whether cadmium-induced damage in the kidneys and the skeletal system could be detected among 100 ringed seals from Northwest Greenland. The cadmium concentrations in the kidney cortex ranged from 0 to 248 microg/g wet weight (mean=44.5, N=100) in the 99 kidneys examined...

  5. [Principle for strategic decision based on population health risk in emergence environmental cadmium pollution control]. (United States)

    Shang, Qi


    The principles for strategic decision in emergence environmental pollution control was summarized based on population health risk and features of emergence events of environmental cadmium pollution. Main task and strategies for the events control was suggested in emergency treatment and post-event for water and soil cadmium pollution respectively. The work, monitoring method, key problems for both environment cadmium pollution and human health risk, and main content of health education for cadmium exposure people was proposed in follow-up action, at meanwhile, achievements of study on human health effects caused by environmental cadmium pollution was introduced briefly over recent years.

  6. Zinc-Nickel Codeposition in Sulfate Solution Combined Effect of Cadmium and Boric Acid

    Directory of Open Access Journals (Sweden)

    Y. Addi


    Full Text Available The combined effect of cadmium and boric acid on the electrodeposition of zinc-nickel from a sulfate has been investigated. The presence of cadmium ion decreases zinc in the deposit. In solution, cadmium inhibits the zinc ion deposition and suppresses it when deposition potential value is more negative than −1.2 V. Low concentration of CdSO4 reduces the anomalous nature of Zn-Ni deposit. Boric acid decreases current density and shifts potential discharge of nickel and hydrogen to more negative potential. The combination of boric acid and cadmium increases the percentage of nickel in the deposit. Boric acid and cadmium.

  7. Contribution of an Auxin to the Uptake of Nickel and Cadmium in Maize Seedlings

    Institute of Scientific and Technical Information of China (English)



    Maize seedlings were cultured in nickel or cadmium contaminated sand treated with α-naphthylacetic acid (NAA). The effects of NAA on nickel and cadmium uptake in roots, shoots, and subcellular fractions (cell wall, nuclei and remained parts of seedling cells) were determined. The data showed growth promotion when NAA was applied at low concentrations and inhibition at high concentrations. Uptake of nickel and cadmium content increased concurrently in roots and shoots. In the subcellular fraction, nickel and cadmium was greatest in the cell wall. The changes in growth had greatest correlation with nickel and cadmium content in the subcellular fraction.

  8. Purification and characterization of a cadmium-induced metallothionein from the shore crab Carcinus maenas (L.)

    DEFF Research Database (Denmark)

    Pedersen, K L; Pedersen, S N; Højrup, P;


    Two metallothionein variants were purified from the midgut gland of crabs (Carcinus maenas) exposed to a high cadmium concentration (2 p.p.m.). One of the variants was purified from crabs exposed to a low cadmium concentration (0.5 p.p.m.). The purification method involved acetone precipitation...... from crabs exposed to the high cadmium concentration differed only by a single residue of methionine at the N-terminus. The single variant isolated from crabs exposed to the low cadmium concentration was the one without the N-terminal methionine, indicating that high cadmium concentrations either...

  9. Synthesis and characterization of cadmium doped lead–borate glasses

    Indian Academy of Sciences (India)

    A A Alemi; H Sedghi; A R Mirmohseni; V Golsanamlu


    Cadmium doped lead–borate glasses were prepared from the melts in appropriate proportions of PbO2, H3BO3 and (15–40 mol%) CdO mixture in the temperature range 700–950°C. The infrared spectra of the glasses in the range 400–4000 cm-1 show their structures. No boroxol ring formation was observed in the structure of these glasses. Furthermore, doped cadmium atoms were not seen in tetrahedral coordination. But the conversion of three-fold to four-fold coordination of boron atoms in the structure of glasses was observed.

  10. Study on class flipping Applied in 122 Teaching model%翻转课堂在“122”模式的运用

    Institute of Scientific and Technical Information of China (English)



    Classroom Flipping as a new teaching concept first appears in the United States and gains popularity afterwards all around the world.This thesis combines “classroom flipping”and “122”teaching model in West Anhui University,discussing the application of this method in intensive read-ing class,viewing speaking listening class and network class.This new teaching method has changed traditional College English teaching,thus improving the students’self-study ability,initiative and comprehensive linguistic ability.%“翻转课堂”这一教学理念最早在美国出现,随后在全世界范围内推广。通过将“翻转课堂”和皖西学院的“122”模式相结合,探讨了这一教学方法在读写、视听说和网络课程教学中的应用。“翻转课堂”的教学方法改变了传统的大学英语教学,有利于提高学生的自主性和能动性,增强了学生的综合语言应用能力。

  11. Concentration of cadmium in cacao beans and its relationship with soil cadmium in southern Ecuador

    Energy Technology Data Exchange (ETDEWEB)

    Chavez, E. [University of Florida, Institute of Food and Agricultural Science, Indian River Research and Education Center, Fort Pierce, FL 34945 (United States); Escuela Superior Politecnica del Litoral, Centro de Investigaciones Biotecnologicas del Ecuador, Guayaquil, Guayas (Ecuador); He, Z.L., E-mail: [University of Florida, Institute of Food and Agricultural Science, Indian River Research and Education Center, Fort Pierce, FL 34945 (United States); Stoffella, P.J. [University of Florida, Institute of Food and Agricultural Science, Indian River Research and Education Center, Fort Pierce, FL 34945 (United States); Mylavarapu, R.S. [University of Florida, Institute of Food and Agricultural Science, Soil and Water Science Department, Gainesville, FL 33611 (United States); Li, Y.C. [University of Florida, Institute of Food and Agricultural Science, Tropical Research and Education Center, Homestead, FL 33031 (United States); Moyano, B. [Escuela Superior Politecnica del Litoral, Centro de Investigaciones Biotecnologicas del Ecuador, Guayaquil, Guayas (Ecuador); Baligar, V.C. [United State Department of Agriculture, ARS, Beltsville, MD 20705 (United States)


    Cadmium (Cd) content in cacao beans above a critical level (0.6 mg kg{sup −1}) has raised concerns in the consumption of cacao-based chocolate. Little is available regarding Cd concentration in soil and cacao in Ecuador. The aim of this study was to determine the status of Cd in both, soils and cacao plants, in southern Ecuador. Soil samples were collected from 19 farms at 0–5, 5–15, 15–30, and 30–50 cm depths, whereas plant samples were taken from four nearby trees. Total recoverable and extractable Cd were measured at the different soil depths. Total recoverable Cd ranged from 0.88 to 2.45 and 0.06 to 2.59, averaged 1.54 and 0.85 mg kg{sup −1}, respectively in the surface and subsurface soils whereas the corresponding values for M3-extractable Cd were 0.08 to 1.27 and 0.02 to 0.33 with mean values of 0.40 and 0.10 mg kg{sup −1}. Surface soil in all sampling sites had total recoverable Cd above the USEPA critical level for agricultural soils (0.43 mg kg{sup −1}), indicating that Cd pollution occurs. Since both total recoverable and M3-extractable Cd significantly decreased depth wise, anthropogenic activities are more likely the source of contamination. Cadmium in cacao tissues decreased in the order of beans > shell > > leaves. Cadmium content in cacao beans ranged from 0.02 to 3.00, averaged 0.94 mg kg{sup −1}, and 12 out of 19 sites had bean Cd content above the critical level. Bean Cd concentration was highly correlated with M3- or HCl-extractable Cd at both the 0–5 and 5–15 cm depths (r = 0.80 and 0.82 for M3, and r = 0.78 and 0.82 for HCl; P < 0.01). These results indicate that accumulation of Cd in surface layers results in excessive Cd in cacao beans and M3- or HCl-extractable Cd are suitable methods for predicting available Cd in the studied soils. - Highlights: • > 60% of the studied sites had a Cd content in cacao beans above the critical level. • Bean Cd concentration was closely correlated with available Cd in soil. • Soil

  12. Concentration of cadmium in cacao beans and its relationship with soil cadmium in southern Ecuador. (United States)

    Chavez, E; He, Z L; Stoffella, P J; Mylavarapu, R S; Li, Y C; Moyano, B; Baligar, V C


    Cadmium (Cd) content in cacao beans above a critical level (0.6 mg kg(-1)) has raised concerns in the consumption of cacao-based chocolate. Little is available regarding Cd concentration in soil and cacao in Ecuador. The aim of this study was to determine the status of Cd in both, soils and cacao plants, in southern Ecuador. Soil samples were collected from 19 farms at 0-5, 5-15, 15-30, and 30-50 cm depths, whereas plant samples were taken from four nearby trees. Total recoverable and extractable Cd were measured at the different soil depths. Total recoverable Cd ranged from 0.88 to 2.45 and 0.06 to 2.59, averaged 1.54 and 0.85 mg kg(-1), respectively in the surface and subsurface soils whereas the corresponding values for M3-extractable Cd were 0.08 to 1.27 and 0.02 to 0.33 with mean values of 0.40 and 0.10 mg kg(-1). Surface soil in all sampling sites had total recoverable Cd above the USEPA critical level for agricultural soils (0.43 mg kg(-1)), indicating that Cd pollution occurs. Since both total recoverable and M3-extractable Cd significantly decreased depth wise, anthropogenic activities are more likely the source of contamination. Cadmium in cacao tissues decreased in the order of beans>shell>leaves. Cadmium content in cacao beans ranged from 0.02 to 3.00, averaged 0.94 mg kg(-1), and 12 out of 19 sites had bean Cd content above the critical level. Bean Cd concentration was highly correlated with M3- or HCl-extractable Cd at both the 0-5 and 5-15 cm depths (r=0.80 and 0.82 for M3, and r=0.78 and 0.82 for HCl; Pcacao beans and M3- or HCl-extractable Cd are suitable methods for predicting available Cd in the studied soils.

  13. Potentiation of cadmium nephrotoxicity by acetaminophen

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, A.M.; Russis, R. de; Ouled Amor, A.; Lauwerys, R.R.


    The possible interactions between acetaminophen and cadmium (Cd) on the kidney were investigated in female Sprague-Dawley rats. Acetaminophen was administered in the food at an average dose of 900 mg/kg and Cd in drinking water at the concentration of 200 ppm. The treatment with acetaminophen and Cd lasted 2 and 10 months, respectively. No interaction between Cd and acetaminophen was observed during the period of their concomitant administration: the increase in albuminuria caused by Cd and acetaminophen was additive, while the tubular impairment caused by acetaminophen (increased ..beta../sub 2/-microglobulinuria and decreased kidney concentrating ability) was not exacerbated by Cd. None of these treatments affected the glomerular filtration rate. Four months after the end of acetaminophen treatment, the renal changes had almost completely disappeared in the rats which had received the analgesic alone. Those continously exposed to Cd had developed slight tubular damage, as evidenced by an increased urinary excretion of ..beta../sub 2/-microglobulin and ..beta..-N-acetylglucosaminidase. By contrast, rats pretreated with acetaminophen for 2 months and exposed to Cd showed a marked increase in urinary excretion of albumin and ..beta../sub 2/-microglobulin, suggesting an interaction between both treatments. At the end of the study, only the interaction with ..beta../sub 2/-microglobulin excretion was still evident; that with the urinary excretion of ..beta..-N-acetylglucosaminidase and albumin having been masked by the chronic progessive nephrosis affecting most animals at that stage. As acetaminophen had no effect on the renal accumulation of Cd, it may be concluded that pretreatment with this analygesic at a dose causing slight tubular dysfunction renders rat kidney more sensitive to the nephrotoxic action of Cd. This observation may be of clinical relevance for population groups occupationally or environmentally exposed to Cd.

  14. Cadmium concentration in sea bottom sediment and its potential risk in the upper Gulf of Thailand. (United States)

    Ei Tun, Zin Hnin; Parkpian, Preeda; Delaune, R D; Gambrell, R P; Jugsujinda, Aroon


    Untreated or partially treated waste water discharge from industrial and domestic sources entering the Upper Gulf of Thailand have been reported to increase cadmium concentration in bottom sediment. This study was directed at providing a better understanding of cadmium transformation in the sediment from the area. Sediment samples collected from Chao Phraya River mouth (CPY), Bang Pakong River mouth (BPK) and Klong Dan estuary (KD) located in the Upper Gulf of Thailand were analyzed for cadmium concentration in various sediment particle size fractions. Using laboratory microcosms, cadmium release from sediment as affected by salinity and sediment redox condition was studied. A higher concentration of cadmium (0.2-0.6 microg/g dry weight) was measured in finer sediment particle size fractions (<0.075 mm) as compared to courser fractions at all sampling stations. Cadmium release from the sediment to water was influenced by both salinity and redox condition. Sediment was spiked with 10 ppm cadmium which is the cadmium level in sediment adopted by the Australia and New Zealand sediment quality guidelines which can cause adverse environmental impacts. Experiments conducted showed soluble cadmium concentration at sediment oxidation reduction conditions representative of bottom sediment were at levels that can adversely impact aquatic organisms, according to the PCADMIUM water quality guideline. In Thailand, there is no sediment quality guideline. Based on these experiments, 10 ppm of cadmium in sediment was recommended as a regulatory guidelines for allowable levels of cadmium in sediment in the study area.

  15. Dietary intake and urinary level of cadmium and breast cancer risk: A meta-analysis. (United States)

    Lin, Jinbo; Zhang, Fang; Lei, Yixiong


    Cadmium, a human carcinogenic heavy metal, has been reported to be associated with breast cancer risk; however, the results from the epidemiological studies are not always consistent. The objective of this study was to quantitatively summarize the current evidence for the relationship between cadmium exposure and breast cancer risk using meta-analysis methods. Six studies determining the dietary cadmium intake level and five studies evaluating the urinary cadmium level were identified in a systematic search of MEDLINE and PubMed databases, and the associations between these levels and breast cancer risk were analysed. The pooled estimates under the random-effects model suggested that higher urinary cadmium levels were associated with an increased risk for breast cancer (highest versus lowest quantile, pooled odds ratio [OR]=2.24, 95% confidence interval [95%CI]=1.49-3.35) and a 1μg/g creatinine increase in urinary cadmium led to a 1.02-fold increment of breast cancer (pooled OR=2.02, 95%CI=1.34-3.03); however, pooled estimates for dietary cadmium intake found no significant association between cadmium exposure and breast cancer risk (highest versus lowest quantile, pooled relative risk [RR]=1.01, 95%CI=0.89-1.15). These results suggest that cadmium exposure may lead to an increased risk of breast cancer, and urinary cadmium levels can serve as a reliable biomarker for long-term cadmium exposure and may predict the breast cancer risk.

  16. [Physiological response and bioaccumulation of Panax notoginseng to cadmium under hydroponic]. (United States)

    Li, Zi-wei; Yang, Ye; Cui, Xiu-ming; Liao, Pei-ran; Ge, Jin; Wang, Cheng-xiao; Yang, Xiao-yan; Liu, Da-hui


    The physiological response and bioaccumulation of 2-year-old Panax notoginseng to cadmium stress was investigated under a hydroponic experiment with different cadmium concentrations (0, 2.5, 5, 10 μmol · L(-1)). Result showed that low concentration (2.5 μmol · L(-1)) of cadmium could stimulate the activities of SOD, POD, APX in P. notoginseng, while high concentration (10 μmol · L(-1)) treatment made activities of antioxidant enzyme descended obviously. But, no matter how high the concentration of cadmium was, the activities of CAT were inhibited. The Pn, Tr, Gs in P. notoginseng decreased gradually with the increase of cadmium concentration, however Ci showed a trend from rise to decline. The enrichment coefficients of different parts in P. notoginseng ranked in the order of hair root > root > rhizome > leaf > stem, and all enrichment coefficients decreased with the increase of concentration of cadmium treatments; while the cadmium content in different parts of P. notoginseng and the transport coefficients rose. To sum up, cadmium could affect antioxidant enzyme system and photosynthetic system of P. notoginseng; P. notoginseng had the ability of cadmium enrichment, so we should plant it in suitable place reduce for reducing the absorption of cadmium; and choose medicinal parts properly to lessen cadmium intake.

  17. Ecological toxicity of reactive X-3B red dye and cadmium acting on wheat (Triticum aestivum)

    Institute of Scientific and Technical Information of China (English)


    Ecological toxicity of reactive X-3B red dye and cadmium in both their single form and their combined form on wheat was studied using the experimental method of seed and root exposure. The single-factor exposure indicated that the inhibitory rate of wheat root elongation was significantly increased with the increase in the concentration of the dye in the cultural solution, although seed germination of wheat was not sensitive to the dye. The toxicity of cadmium was greatly higher than that of the dye, but low concentration cadmium (< 40 mg/L) could promote the germination of wheat seed. Interactive effects of the dye and cadmium on wheat were complicated. There was no significant correlation between the inhibitory rate of seed germination and the concentrations of the dye and cadmium. Low concentration cadmium could strengthen the toxicity of the dye acting on root elongation. On the contrary, high concentration cadmium could weaken the toxicity of the dye acting on root elongation.

  18. Cadmium causes delayed effects on renal function in the offspring of cadmium-contaminated pregnant female rats. (United States)

    Jacquillet, G; Barbier, O; Rubera, I; Tauc, M; Borderie, A; Namorado, M C; Martin, D; Sierra, G; Reyes, J L; Poujeol, P; Cougnon, M


    In the adult rat, chronic cadmium intoxication induces nephropathy with Fanconi-like features. This result raises the question of whether intoxication of pregnant rats has any deleterious effects on renal function in their offspring. To test this hypothesis, we measured the renal function of 2- to 60-day-old postnatal offspring from female rats administered cadmium chloride by the oral route (0.5 throughout their entire gestation. Investigations of rat offspring from contaminated pregnant rats showed the presence of cadmium in the kidney at gestational day 20. After birth, the cadmium kidney concentration increased from postnatal day 2 to day 60 (PND2 to PND60), presumably because of 1) milk contamination and 2) neonatal liver cadmium content release. Although the renal parameters (glomerular filtration, U/P inulin, and urinary excretion rate) were not significantly affected until PND45, renal failure appeared at PND60, as demonstrated by a dramatic decrease of the glomerular filtration rate associated with increased excretion of the main ions. In parallel, an immunofluorescence study of tight-junction protein expression of PND60 offspring from contaminated rats showed a disorganization of the tight-junction proteins claudin-2 and claudin-5, specifically expressed in the proximal tubule and glomerulus, respectively. In contrast, expression of a distal claudin protein, claudin-3, was not affected. In conclusion, in utero exposure of cadmium leads to toxic renal effects in adult offspring. These results suggest that contamination of pregnant rats is a serious and critical hazard for renal function of their offspring.

  19. Dietary Cadmium Intake and Risk of Breast, Endometrial and Ovarian Cancer in Danish Postmenopausal Women: A Prospective Cohort Study



    Purpose Cadmium is a human lung carcinogen and possesses estrogen-like activity. This combination of carcinogenic and estrogenic activity makes cadmium a contaminant of high concern for hormone-related cancers. Diet and smoking are the main sources of cadmium exposure. The aim of this study was to investigate the association between dietary cadmium intake and risk of breast, endometrial and ovarian cancer in Danish postmenopausal woman. Methods We estimated dietary cadmium intake in the Diet,...

  20. A122

    Directory of Open Access Journals (Sweden)

    S. Kolubaeva


    Conclusion: Expression of CD79b, CD22, CD38 is the main feature of cells with recurrent genetic injuries. Immunophenotype without expression of CD79b, CD22, CD38 in most cases differentiates CLL patients with del(13(q14.3, del (13(q34, (13q(34 trisomy and with normal karyotype. Coexpression in the most of the cells of the three antigens CD79b, CD22, CD38 and more bright expression of CD20 proposes trisomy 12 or del(6q. Partial expression of CD79b and CD38 may correlate with del(11(q23.

  1. Changes in Tissue Metals After Cadmium Intoxication and Intervention With Chlorpromazine in Male Rats 

    Institute of Scientific and Technical Information of China (English)



    Cadmium(Cd),one of the most dangerous heavy metals,has a very similar ionic radius to calcium(Ca),The interference of cadmium in calcium homeostasis may play an important role in cadmium toxicity.Recent reports indicate that calmodulin(CaM) inhibitors such as trifluoperazine and chlorpromazine(CPZ) could protect rodents against cadmium toxicity,It was also reported that pretreatment of mice with zine(Zn)could reduce the adverse effects induced by cadmium.The aim of this study is to determine whether Cd changes the balance of other essential metals such as Zn and copper(Cu) in rat tissues,and whether CPZ can reverse these changes which are induced by cadmium intoxication.Adult male Sprague-Dawley(SD) rats were injected intraperitoneally(ip) with cadmium chloride(CdCl2)(0.2,0.4,0.8mg Cd/kg body wight) alone and 0.4mg Cd/kg in association with CPZ(5mg/kg) daily for a week.The control animals were injected with normal saline only.The results showed that the cadmium content in the liver,kidney,and testis increased significantly with a dose-response relationship.Cadmium treatment markedly increased the Zn and Ca content in some of the tissues,Hepatic and renal metallothionein(MT) increased significantly after cadmium intoxication,CPZ treatment,howerver,reduced cadmium content in liver,but not blood and kidney.CPZ seemed to decrease the content of MT in liver and significantly increase the amounts of MT in kidney.These data suggest that the intervention of cadmium with tissue essential metals may play a role in cadium toxicity in rats,and calmodulin inhibitors to some extent can reduce the adverse effect of cadmium by decreasing the cadmium load in tissues and reversing the unbalance of essetial metals.

  2. Cadmium and zinc accumulation in soybean: A threat to food safety?

    Energy Technology Data Exchange (ETDEWEB)

    Shute, Tracy [Department of Biology, University of Western Ontario, London, ON N6A 5B7 (Canada); Macfie, Sheila M. [Department of Biology, University of Western Ontario, London, ON N6A 5B7 (Canada)]. E-mail:


    A greenhouse study was conducted to quantify cadmium and zinc accumulated by soybean (Glycine max (L.) Merr.) when the metals were supplied separately and together. The highest dose of cadmium (100 mg/kg) reduced plant height and dry weight (down to 40% and 34% of control, respectively); the highest dose of zinc (2000 mg/kg) reduced plant height to 55% of control and dry weight to 70% of control. With both metals present, the plants were approximately the same size as those treated with cadmium only. The concentration of cadmium in the roots was unaffected by zinc. In other tissues, the effect of zinc on the accumulation of cadmium depended on the doses provided. At low doses, the addition of zinc reduced the concentration of cadmium in aboveground tissues to 40-50% of that found in plants exposed to cadmium only. However, when applied in high doses, the presence of zinc in cadmium-contaminated soils increased the uptake and accumulation of cadmium in aboveground tissues by up to 42%. In contrast, at high doses, the presence of cadmium in zinc-contaminated soil resulted in approximately 35% lower concentrations of zinc in all tissues. At a lower dose, cadmium had no effect on concentration of zinc in the plant tissues. The effects of high doses of one metal on the uptake of the other metal can be partially explained by the effects of one metal on the bioavailability of the other metal. In soils to which only one metal was added, bioavailable cadmium was 70-80% of the total cadmium, and bioavailable zinc was 50-70% of the total zinc. When both metals were added to the soil, 80-100% of the cadmium and 46-60% of the zinc were bioavailable. Concentrations of both metals were highest in root tissues (10-fold higher for cadmium, and up to 2-fold higher for zinc). Although relatively little cadmium was translocated to pods and seeds, the seeds of all plants (including those from control and zinc-treated plants) had concentrations of cadmium 3-4 times above the limit of 0

  3. Future trends in soil cadmium concentration under current cadmium fluxes to European agricultural soils. (United States)

    Six, L; Smolders, E


    The gradual increase of soil cadmium concentrations in European soils during the 20th century has prompted environmental legislation to limit soil cadmium (Cd) accumulation. Mass balances (input-output) reflecting the period 1980-1995 predicted larger Cd inputs via phosphate (P) fertilizers and atmospheric deposition than outputs via crop uptake and leaching. This study updates the Cd mass balance for the agricultural top soils of EU-27+Norway (EU-27+1). Over the past 15 years, the use of P fertilizers in the EU-27+1 has decreased by 40%. The current mean atmospheric deposition of Cd in EU is 0.35 g Cd ha(-1) yr(-1), this is strikingly smaller than values used in the previous EU mass balances (~3 g Cd ha(-1) yr(-1)). Leaching of Cd was estimated with most recent data of soil solution Cd concentrations in 151 soils, which cover the range of European soil properties. No significant time trends were found in the data of net applications of Cd via manure, compost, sludge and lime, all being small sources of Cd at a large scale. Modelling of the future long-term changes in soil Cd concentrations in agricultural top soils under cereal or potato culture predicts soil Cd concentrations to decrease by 15% over the next 100 years in an average scenario, with decreasing trends in some scenarios being more prevalent than increasing trends in other scenarios. These Cd balances have reverted from the general positive balances estimated 10 or more years ago. Uncertainty analysis suggests that leaching is the most uncertain relative to other fluxes.

  4. Analysis of dynamical behavior of reactions associated with 118,120,122Xe* isotopes (United States)

    Grover, Neha; Sharma, Ishita; Kaur, Gurvinder; Sharma, Manoj K.


    In reference to recent experiment, the dynamical aspects of reactions forming even mass isotopes of 118,120,122Xe* nuclei are examined using the collective clusterization approach and the ℓ-summed Wong model. The role of excitation energy (or temperature), deformations, orientations and angular momentum etc. has been investigated for the 28Si + 90,92,94Zr reactions. In order to account for the role of deformations, the evaporation residue (ER) cross sections of 122Xe* nucleus have been studied in reference to the available experimental data by using spherical as well as deformed fragmentation approach. We have used optimum and compact orientations respectively for β2 alone and for β4 included, which inturn provide nice agreement with the available experimental cross-sections. Also, the effect of isospin (N/Z ratio) of decay fragments has been explored in view of the fragmentation analysis and preformation probability of 118,120,122Xe* nuclei. Additionally, the role of projectile nucleus is also explored by studying the fragmentation path of 118Xe* nucleus in comparison to 123Ba* system. Further, the ER cross-sections have been predicted for various even mass isotopes of 116,118,120,124Xe. In addition to this, to explore the fusion characteristics of 28Si + 90,92,94Zr reactions, the Wong model as well as the ℓ-summed Wong model has also been employed. Here also, the role of deformation in formation of 122Xe* nucleus has been examined and the calculated cross-sections find decent agreement with the experimental data.

  5. Role of Extracellular miR-122 in Breast Cancer Metastasis (United States)


    Hope Beckman Research Institute, Duarte, California 91010, USA. 2Department of Biotherapy and Key Laboratory of Cancer Immunology , Tianjin Medical...1 AWARD NUMBER: W81XWH-14-1-0029 TITLE: “Role of Extracellular miR-122 in Breast Cancer Metastasis” PRINCIPAL INVESTIGATOR: Miranda Fong...the time for reviewing instructions, searching existing data sources, gathering and maintaining the data needed, and completing and reviewing this

  6. Metabolic Studies on WR-158,122 in Bile Duct Cannulated Rats and Monkeys. (United States)


    usually be counted directly, but some highly- colored samples may require bleaching. 5. Feces. Feces are digested in appropriately sized jars with 10 volumes...sulfate, niacin supplement, calcium O. pantothenate, copper sulfate, vitamin B12 supplement, vitamin D3 supplement, manganese sulfate, riboflavin ...after recording color and volume of each phase and salt, if any. 0 47 Table 3.2 Extraction of Control Monkey Urine Spiked with WR-158,122 14C Solvent

  7. MicroRNAs and hepatitis C virus: Toward the end of miR-122 supremacy

    Directory of Open Access Journals (Sweden)

    Hoffmann Thomas


    Full Text Available Abstract The most common etiologic agents causing chronic hepatitis are hepatitis C and B viruses (HCV and HBV, respectively. Chronic infection caused by HCV is considered one of the major causative agents of liver cirrhosis and hepatocellular carcinoma worldwide. In combination with the increasing rate of new HCV infections, the lack of a current vaccine and/or an effective treatment for this virus continues to be a major public health challenge. The development of new treatments requires a better understanding of the virus and its interaction with the different components of the host cell. MicroRNAs (miRNAs are small non-coding RNAs functioning as negative regulators of gene expression and represent an interesting lead to study HCV infection and to identify new therapeutic targets. Until now, microRNA-122 (miR-122 and its implication in HCV infection have been the focus of different published studies and reviews. Here we will review recent advances in the relationship between HCV infection and miRNAs, showing that some of them emerge in publications as challengers against the supremacy of miR-122.

  8. CC-122, a pleiotropic pathway modifier, mimics an interferon response and has antitumor activity in DLBCL. (United States)

    Hagner, Patrick R; Man, Hon-Wah; Fontanillo, Celia; Wang, Maria; Couto, Suzana; Breider, Mike; Bjorklund, Chad; Havens, Courtney G; Lu, Gang; Rychak, Emily; Raymon, Heather; Narla, Rama Krishna; Barnes, Leo; Khambatta, Gody; Chiu, Hsiling; Kosek, Jolanta; Kang, Jian; Amantangelo, Michael D; Waldman, Michelle; Lopez-Girona, Antonia; Cai, Ti; Pourdehnad, Michael; Trotter, Matthew; Daniel, Thomas O; Schafer, Peter H; Klippel, Anke; Thakurta, Anjan; Chopra, Rajesh; Gandhi, Anita K


    Cereblon (CRBN), a substrate receptor of the Cullin 4 RING E3 ubiquitin ligase complex, is the target of the immunomodulatory drugs lenalidomide and pomalidomide. Recently, it was demonstrated that binding of these drugs to CRBN promotes the ubiquitination and subsequent degradation of 2 common substrates, transcription factors Aiolos and Ikaros. Here we report that CC-122, a new chemical entity termed pleiotropic pathway modifier, binds CRBN and promotes degradation of Aiolos and Ikaros in diffuse large B-cell lymphoma (DLBCL) and T cells in vitro, in vivo, and in patients, resulting in both cell autonomous as well as immunostimulatory effects. In DLBCL cell lines, CC-122-induced degradation or short hairpin RNA-mediated knockdown of Aiolos and Ikaros correlates with increased transcription of interferon (IFN)-stimulated genes independent of IFN-α, -β, and -γ production and/or secretion and results in apoptosis in both activated B-cell (ABC) and germinal center B-cell DLBCL cell lines. Our results provide mechanistic insight into the cell-of-origin independent antilymphoma activity of CC-122, in contrast to the ABC subtype selective activity of lenalidomide.

  9. Effects of cadmium on the health of the population

    Energy Technology Data Exchange (ETDEWEB)

    Piscator, M.


    Investigations on workers who have been exposed to cadmium dust or fumes in the breathing air have shown that lung damage, special emphysema and damage to the renal tubuli are the most frequently occurring symptoms for exposed industrial workers. The main characteristic of kidney damage is tubular proteinuria. An increased excretion of amino acids, glucose, calcium and phosphorus is likewise possible. Finally, disorders in the calcium and phosphorus metabolism can have demineralization of the bones for a consequence. According to estimates, the critical concentration in the cortex of the kidneys is ca 200 Cd/g wet weight. At this concentration, functional disorders of the kidneys can appear for the most sensitive individuals of a particular population. This estimate is based on results of investigations on humans and animals, although these were conducted with relatively imprecise methods; accordingly, the value may even lie below 200 ppm. From the toxicological viewpoint there is not too great a safety margin between the present cadmium level in adults and the critical value. It can be expected that this margin will become smaller in the future when additional cadmium loading of the environment occurs, since the retention of cadmium is practically equal to the uptake on account of the small excretion rate.

  10. Cadmium and zinc relationships in kidney cortex, liver, and pancreas

    Energy Technology Data Exchange (ETDEWEB)

    Elinder, C.G.; Piscator, M.; Linnman, L.


    Zinc and cadmium have been determined in kidney cortex, liver, and pancreas from 292 subjects autopsied in Stockholm, Sweden. In the liver and pancreas zinc was found to have a normal frequency distribution, average 45.3 and 26.9 wet wt, respectively. The concentrations of zinc in these two organs were constant regardless of age at death. Zinc was shown to accumulate with age in the kidney cortex in a way similar to cadmium, and had a log-normal distribution. The calculation of the regression line between individual cadmium concentrations below 60 and zinc concentrations gave a slope constant of 0.61 (Y/sub Zn/ = 0.61 X/sub Cd/ + 24.4), which corresponds to a nearly equimolar increase of zinc. The concentrations of ''physiological zinc,'' i.e., total zinc minus the zinc related to cadmium, were normally distributed (anti x = 24.6 Zn/g) and did not change with age. Furthermore, data on dry weight/wet weight ratios and ash weight/dry weight ratios in relation to age are presented.

  11. Plant science: the key to preventing slow cadmium poisoning

    NARCIS (Netherlands)

    Clemens, S.; Aarts, M.G.M.; Thomine, S.; Verbruggen, N.


    Practically all human populations are environmentally exposed to cadmium (Cd), mostly through plant-derived food. A growing body of epidemiological evidence suggests that there is no margin of safety between current Cd exposure levels and the threshold for adverse health effects and, hence, there is

  12. On the existence of ‘L-alanine cadmium bromide' (United States)

    Srinivasan, Bikshandarkoil R.


    It is argued that the recently reported nonlinear optical crystal L-alanine cadmium bromide, grown by slow solvent evaporation method at room temperature [P. Ilayabarathi, J. Chandrasekaran, Spectrochim. Acta 96A (2012) 684-689] is the well-known L-alanine crystal. The isolation of L-alanine crystal is explained due to fractional crystallization.

  13. On the existence of 'L-alanine cadmium bromide'. (United States)

    Srinivasan, Bikshandarkoil R


    It is argued that the recently reported nonlinear optical crystal L-alanine cadmium bromide, grown by slow solvent evaporation method at room temperature [P. Ilayabarathi, J. Chandrasekaran, Spectrochim. Acta 96A (2012) 684-689] is the well-known L-alanine crystal. The isolation of L-alanine crystal is explained due to fractional crystallization.

  14. Uitwisselingsonderzoek voor de bepaling van cadmium in schuimaarde

    NARCIS (Netherlands)

    Veen, van der N.G.; Berghmans-van Megen, E.H.J.; Betteray-Kortekaas, van A.M.G.; Hovens, J.P.C.; Werdmuller, G.A.


    In het kader van een uitwisselingsonderzoek tussen het RIKILT en het IRS nagaan of verschillende methoden van onderzoek voor de bepaling van cadmium in schuimaarde vergelijkbare resultaten opleveren. In een uitwisselingsonderzoek tussen het RIKILT en het IRS (Instituut voor Rationele Suikerproduktie

  15. Lead and cadmium in wild birds in southeastern Spain

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Fernandez, A.J.; Sanchez-Garcia, J.A.; Luna, A. [Univ. of Murcia (Spain); Jimenez-Montalban, P. [Regional Environmental Agency, Murcia (Spain). Centro de Recuperacion de Fauna Silvestre El Valle


    The main purpose of this study was to monitor exposure to lead and cadmium in wild birds in Murcia, a southeastern region of Spain on the Mediterranean coast. This region lies on one of the African-European flyways. Samples of liver, kidney, brain, bone, and whole blood from several species of wild birds were obtained during 1993. The authors found a clear relationship between cadmium and lead concentrations in birds and their feedings habits. Vultures (Gyps fulvus) had the highest concentrations of lead (mean 40 {micro}g/dl in blood), and seagulls (Larus argentatus and Larus ridibundus) the highest concentrations of cadmium (mean 4.43 {micro}g/g in kidney). Insectivores had high concentrations of both metals, and diurnal and nocturnal raptors showed the lowest tissue concentrations. The findings that tissue and blood concentrations were generally not elevated suggests environmental (rather than acute) exposure. Birds from more industrialized areas of the region studied here had higher concentrations of both lead and cadmium.

  16. A method for partitioning cadmium bioaccumulated in small aquatic organisms

    Energy Technology Data Exchange (ETDEWEB)

    Siriwardena, S.N.; Rana, K.J.; Baird, D.J. [Univ. of Stirling (United Kingdom). Institute of Aquaculture


    A series of laboratory experiments was conducted to evaluate bioaccumulation and surface adsorption of aqueous cadmium (Cd) by sac-fry of the African tilapia Oreochromis niloticus. In the first experiment, the design consisted of two cadmium treatments: 15 {micro}g Cd{center_dot}L{sup {minus}1} in dilution water and a Cd-ethylenediaminetetraacetic acid (Cd-EDTA) complex at 15 {micro}m{center_dot}L{sup {minus}1}, and a water-only control. There were five replicates per treatment and 40 fish per replicate. It was found that EDTA significantly reduced the bioaccumulation of cadmium by tilapia sac-fry by 34%. Based on the results, a second experiment was conducted to evaluate four procedures: a no-rinse control; rinsing in EDTA; rinsing in distilled water; and rinsing in 5% nitric acid, for removing surface-bound Cd from exposed sac-fry. In this experiment, 30 fish in each of five replicates were exposed to 15 {micro}g Cd{center_dot}L{sup {minus}1} for 72 h, processed through the rinse procedures, and analyzed for total Cd. The EDTA rinse treatment significantly reduced (p<0.05) Cd concentrations of the exposed fish relative to those receiving no rinse. It was concluded that the EDTA rinse technique may be useful in studies evaluating the partitioning of surface-bound and accumulated cadmium in small aquatic organisms.

  17. Nickel cadmium batteries. Citations from the NTIS data base (United States)

    Cavagnaro, D. M.


    The design, fabrication, components, testing, and assembly of nickel cadmium batteries are covered in the bibliography. The majority of these citations deal with the development of power supplies for aircraft and spacecraft. This updated bibliography contains 135 abstracts, 19 of which are new entries to the previous edition.

  18. Thermoelectric material comprising scandium doped zinc cadmium oxide

    DEFF Research Database (Denmark)


    There is presented a composition of scandium doped Zinc Cadmium Oxide with the general formula ZnzCdxScyO which the inventors have prepared, and for which material the inventors have made the insight that it is particularly advantageous as an n-type oxide material, such as particularly advantageous...

  19. Cadmium plated steel caps seal anodized aluminum fittings (United States)

    Padden, J.


    Cadmium prevents fracturing of hard anodic coating under torquing to system specification requirements, prevents galvanic coupling, and eliminates need for crush washers, which, though commonly used in industry, do not correct leakage problem experienced when anodized aluminum fittings and anodized aluminum cap assemblies are joined.

  20. Gender differences in cadmium and cotinine levels in prepubertal children

    DEFF Research Database (Denmark)

    Fucic, A; Plavec, D; Casteleyn, L;


    and exposure data are scarce. In the current study levels of cadmium (Cd), cotinine and creatinine in urine were analyzed in a subsample 216 children from 12 European countries within the DEMOCOPHES project. The children were divided into six age-sex groups: boys (6-8 years, 9-10 years and 11 years old......), and girls (6-7 years, 8-9 years, 10-11 years). The number of subjects per group was between 23 and 53. The cut off values were set at 0.1µg/L for Cd, and 0.8µg/L for cotinine defined according to the highest limit of quantification. The levels of Cd and cotinine were adjusted for creatinine level...... between levels of cadmium and creatinine in all children of both genders. This shows that even at such low levels the possible effect of cadmium on kidney function was present and measurable. An increase in Cd levels was evident with age. Cadmium levels were significantly different between 6-7 year old...

  1. in situ immobilization of Cadmium and zinc in contaminated soils

    NARCIS (Netherlands)

    Osté, L.A.


    Keywords: beringite, cadmium, DOC, DOM, earthworms, immobilization, leaching, lime, manganese oxides, metal binding, metal uptake, organic matter partitioning, pH, soil contamination, remediation, sorption, Swiss chard, zeolites, zinc.It is generally assumed that a decrease in metal c

  2. Tribological performance of organic cadmium compound as lubricant additive

    Institute of Scientific and Technical Information of China (English)

    HU Jian-qiang; XIE Feng; ZHU Huan-qin; ZHEN Fa-zheng; YAO Jun-bing


    The oil-soluble cadmium dipropyldithiophosphate additive was synthesized. A four-ball tester was used to evaluate the tribological performance of the additive in a mineral oil under different loads and lubricant grease synthesized compared with some commercial additives. The results show that it exhibits excellent antiwear and load-carrying capacities and is better than other additives. The surface analytical tools such as scanning electron microscope (SEM) with energy dispersive X-ray (EDX), X-ray photoelectron spectrometer (XPS) were used to investigate the topography, the compositions, and chemical states of some typical elements on the rubbing surface of worn scar.Smooth and light topography of worn scar further confirms that the additive shows good antiwear capacities. The results of EDX and XPS analyses indicate that tribochemical mixed protective films consisting of atomic cadmium, sulphides, sulphates and phosphates are formed on the rubbing surface, which contribute to improving the tribological properties of lubricant and grease. Particularly, the soft cadmium film formed plays an important role in improving antiwear properties of oils. Finally, antiwear mechanism of the additive and formation scheme of atomic cadmium was proposed.

  3. The Karyopherin Kap122p/Pdr6p Imports Both Subunits of the Transcription Factor Iia into the Nucleus


    Titov, Anton A.; Blobel, Günter


    We discovered a nuclear import pathway mediated by the product of the previously identified Saccharomyces cerevisiae gene PDR6 (pleiotropic drug resistance). This gene product functions as a karyopherin (Kap) for nuclear import. Consistent with previously proposed nomenclature, we have renamed this gene KAP122. Kap122p was localized both to the cytoplasm and the nucleus. As a prominent import substrate of Kap122p, we identified the complex of the large and small subunit (Toa1p and Toa2p, resp...

  4. Lead, mercury, and cadmium in breast milk

    Directory of Open Access Journals (Sweden)

    Kadriye Yurdakök


    Full Text Available Toxic heavy metals are the major source of environmental pollution in this new millennium. Lead, mercury, and cadmium are the most common toxic heavy metals in the environment. There is no known function of these toxic heavy metals in the human body. In females, toxic heavy metals can be accumulated in maternal body before pregnancy and may be transferred to fetus through placenta and later, via breast milk. Lead previously accumulated in maternal bones can be mobilized along with calcium in order to meet increased calcium needs of the fetus in pregnant women and for the calcium needs in human milk during lactation. Human fetus and infants are susceptible to heavy metal toxicity passing through placenta and breastmilk due to rapid growth and development of organs and tissues, especially central nervous system. However most of the damage is already done by the time the infant is born. Intrauterine lead exposure can cause growth retardation, cognitive dysfunction, low IQ scores on ability tests, and low performance in school. Biological samples, such as umbilical cord blood and breast milk, and less commonly infant hair, are used for biomonitoring of intra-uterine exposure to these toxic chemicals. Although toxic metals and other pollutants may be excreted into breast milk, their effects are unknown and this topic is subject of a growing body of research. Despite the possibility of harm from environmental contaminants in breast milk, breastfeeding is still recommended as the best infant feeding method. In fact, the species-specific components present in breast milk protect infants against infections; promote immune and neurologic system development; and may decrease the risk of disease, including allergies, obesity, insulin-dependent diabetes mellitus, inflammatory bowel disease, and sudden infant death syndrome. Breastfeeding also facilitates maternal-infant attachment. The potential risk of environmental contaminants that can be transferred from

  5. Induction of cytoprotective autophagy in PC-12 cells by cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Qiwen [College of Veterinary Medicine, Yangzhou University, Yangzhou 225009 (China); Jiangsu Co-innovation Center for Prevention and Control of Important Animal Infectious Diseases and Zoonoses, Yangzhou 225009 (China); Bijie Pilot Area Research Institute of Bijie University, Bijie 551700 (China); Zhu, Jiaqiao; Zhang, Kangbao; Jiang, Chenyang; Wang, Yi; Yuan, Yan; Bian, Jianchun; Liu, Xuezhong; Gu, Jianhong [College of Veterinary Medicine, Yangzhou University, Yangzhou 225009 (China); Jiangsu Co-innovation Center for Prevention and Control of Important Animal Infectious Diseases and Zoonoses, Yangzhou 225009 (China); Liu, Zongping, E-mail: [College of Veterinary Medicine, Yangzhou University, Yangzhou 225009 (China); Jiangsu Co-innovation Center for Prevention and Control of Important Animal Infectious Diseases and Zoonoses, Yangzhou 225009 (China)


    Highlights: •Cadmium can promote early upregulation of autophagy in PC-12 cells. •Autophagy precedes apoptosis in cadmium-treated PC-12 cells. •Cadmium-induced autophagy is cytoprotective in PC-12 cells. •Class III PI3K/beclin-1/Bcl-2 signaling pathway plays a positive role in cadmium-triggered autophagy. -- Abstract: Laboratory data have demonstrated that cadmium (Cd) may induce neuronal apoptosis. However, little is known about the role of autophagy in neurons. In this study, cell viability decreased in a dose- and time-dependent manner after treatment with Cd in PC-12 cells. As cells were exposed to Cd, the levels of LC3-II proteins became elevated, specific punctate distribution of endogenous LC3-II increased, and numerous autophagosomes appeared, which suggest that Cd induced a high level of autophagy. In the late stages of autophagy, an increase in the apoptosis ratio was observed. Likewise, pre-treatment with chloroquine (an autophagic inhibitor) and rapamycin (an autophagic inducer) resulted in an increased and decreased percentage of apoptosis in contrast to other Cd-treated groups, respectively. The results indicate that autophagy delayed apoptosis in Cd-treated PC-12 cells. Furthermore, co-treatment of cells with chloroquine reduced autophagy and cell activity. However, rapamycin had an opposite effect on autophagy and cell activity. Moreover, class III PI3 K/beclin-1/Bcl-2 signaling pathways served a function in Cd-induced autophagy. The findings suggest that Cd can induce cytoprotective autophagy by activating class III PI3 K/beclin-1/Bcl-2 signaling pathways. In sum, this study strongly suggests that autophagy may serve a positive function in the reduction of Cd-induced cytotoxicity.

  6. Cadmium burden and the risk and phenotype of prostate cancer

    Directory of Open Access Journals (Sweden)

    Wu Tony T


    Full Text Available Abstract Background Studies on the association between prostate cancer and cadmium exposure have yielded conflicting results. This study explored cadmium burden on the risk and phenotype of prostate cancer in men with no evident environmental exposure. Methods Hospital-based 261 prostate cancer cases and 267 controls with benign diseases were recruited from four hospitals in Taiwan. Demographic, dietary and lifestyle data were collected by standardized questionnaires. Blood cadmium (BCd and creatinine-adjusted urine cadmium (CAUCd levels were measured for each participant. Statistical analyses measured the prostate cancer risk associated with BCd and CAUCd separately, controlling for age, smoking and institution. BCd and CAUCd levels within cases were compared in relation to the disease stage and the Gleason score. Results High family income, low beef intake, low dairy product consumption and positive family history were independently associated with the prostate carcinogenesis. There was no difference in BCd levels between cases and controls (median, 0.88 versus 0.87 μg/l, p = 0.45. Cases had lower CAUCd levels than controls (median, 0.94 versus 1.40 μg/g creatinine, p = 0.001. However, cases with higher BCd and CAUCd levels tended to be at more advanced stages and to have higher Gleason scores. The prostate cancer cases with Gleason scores of ≥ 8 had an odds ratio of 2.89 (95% confidence interval 1.25-6.70, compared with patients with scores of 2-6. Conclusion Higher CAUCd and BCd levels may be associated with advanced cancer phenotypes, but there was only a tenuous association between cadmium and prostate cancer.

  7. Physiological characterization of cadmium-exposed Chlamydomonas reinhardtii. (United States)

    Bräutigam, Anja; Schaumlöffel, Dirk; Preud'homme, Hugues; Thondorf, Iris; Wesenberg, Dirk


    Chlamydomonas reinhardtii is a common model organism for investigation of metal stress. This green alga produces phytochelatins in the presence of metal ions. The influence of cadmium is of main interest, because it is a strong activator of phytochelatin synthase. Cell wall bound and intracellular cadmium content was determined after exposition to 70 µm CdCl(2), showing the main portion of the metal outside the cell. Nevertheless, imported cadmium was sufficient to cause significant changes in thiolpeptide metabolism and its transcriptional regulation. Modern analytical approaches enable new insights into phytochelatin (PC) distribution. A new rapid and precise UPLC-MS method allowed high-throughput PC quantification in algal samples after 1, 4, 24 and 48 h cadmium stress. Initially, canonic PCs were synthesized in C. reinhardtii during cadmium exposition, but afterwards CysPCs became the major thiolpeptides. Thus, after 48 h the concentration of the PC-isoforms CysPC(2-3) and CysGSH attained between 105 and 199 nmol g(-1) fresh weight (FW), whereas the PC(2-3) concentrations were only 15 nmol g(-1) FW. The relative quantification of γ-glutamyl transpeptidase (γ-GT) mRNA suggests the generation of CysPCs by glutamate cleavage from canonic PCs by γ-GT. Furthermore, a homology model of C. reinhardtii phytochelatin synthase was constructed to verify the use of crystal structures from Anabaena sp. phytochelatin synthase (PCS) for docking studies with canonical PCs and CysPCs. From the difference in energy scores, we hypothesize that CysPC may prevent the synthesis of canonical PCs by blocking the binding pocket. Finally, possible physiological reasons for the high abundance of CysPC compared with their canonic precursors are discussed.

  8. Limnothrix sp. KO05: A newly characterized cyanobacterial biosorbent for cadmium removal: the enzymatic and non-enzymatic antioxidant reactions to cadmium toxicity. (United States)

    Haghighi, Omid; Shahryari, Shahab; Ebadi, Mojgan; Modiri, Sima; Zahiri, Hossein Shahbani; Maleki, Hadi; Noghabi, Kambiz Akbari


    In this study, we isolated five indigenous cyanobacterial strains from different aqueous environments, with heavy metals contamination, in East Azerbaijan Province (northwest portion of Iran). A strain was identified by morphological and 16S rRNA sequence analysis as Limnothrix sp. KO05 and selected for further studies as having the greatest potential for cadmium uptake. Scanning electron microscopy (SEM) demonstrated cyanobacterium Limnothrix sp. KO05 forms filamentous structures and is straight or curved to some extent. The utmost biosorption capacity was found to be 82.18±1.22mgg(-1) at a Cd (II) concentration level of 150mgL(-1). Langmuir adsorption isotherm indicated a better fit to the experimental data. Response surface methodology (RSM) on the basis of four independent variables and the predicted maximum biosorption efficiency was 98.7% under the optimum condition. FT-IR spectroscopy profile of the Cd treated sample as demonstrated in confirmation of the benefits of various functional groups of proteins and polysaccharides of cyanobacterial biomass, involved in surface binding of Cd. The determination of catalase (CAT) activity in strain KO05 exposed to Cd (II) concentrations of 2, 5 and 10mgL(-1) showed an increase in enzyme activity after 24h exposure compared to unexposed cells. Correspondingly, CAT activity showed a significant decrease after 48h of treatment with Cd (II) concentrations of 5 and 10mgL(-1). CAT activity was decreased significantly at all concentrations within 72h after exposure to Cd. On the contrary, while ascorbate peroxidase (APX) gave the expected lower activity compared to the CAT within 24h after Cd treatment, its activity lasted up to 72h. Limnothrix sp. KO05 cells treated with 5 and 10mgL(-1) Cd (II) over 72h exposure showed a reduction in chlorophyll a contents compared to the controls. However, following exposure to Cd, chlorophyll a and carotenoid contents is reduced and after overcoming stress and deployment of an adaptation

  9. Analysis of aerospace nickel-cadmium battery cells. [cadmium migration as seen by scanning electron microscopy and metallographic analysis (United States)

    Eliason, R. R.


    Various steps followed in analyzing the electrolyte, separator, and electrodes are reviewed. Specific emphasis is given to scanning electron microscopic and metallographic analysis of the plates. Cadmium migration is defined, its effects and causes are examined, and methods for its reduction in cells are suggested.

  10. Chemical speciation of cadmium: an approach to evaluate plant-available cadmium in Ecuadorian soils under cacao production (United States)

    Elevated concentration of cadmium (Cd) in cacao beans has raised serious concerns about the safety of chocolate consumption. Accumulation of Cd cacao bean in southern Ecuador has been reported to relate soil contamination. In this study, soil fractionation was conducted to identify available Cd poo...

  11. Cadmium, zinc, and copper in horse liver and in horse liver metallothionein: comparisons with kidney cortex

    Energy Technology Data Exchange (ETDEWEB)

    Elinder, C.G.; Nordberg, M.; Palm, B.; Piscator, M.


    Cadmium, zinc, and copper were determined in liver and in kidney cortex samples obtained from 33 normal Swedish horses. Cadmium concentrations in liver ranged from 0.002 to 0.165 mmole/kg and in kidney from 0.01 to 2.15 mmole/kg. There was a significant correlation between liver and kidney concentrations of cadmium. The average kidney concentration of cadmium was about 15 times that of liver. Zinc concentrations increased with increasing cadmium concentrations in both liver and kidney. The relative increase of zinc with cadmium was more pronounced in liver than in kidney. However, the absolute increase of zinc was larger in kidney due to the much higher concentration of cadmium in kidney compared to liver. Any significant correlation between copper and cadmium, or copper and zinc, could not be revealed. Sephadex gel filtration was performed on supernatants from homogenates of kidney and liver from 19 of the horses. In both organs the major part of cadmium was recovered in protein fractions corresponding to metallothionein (MT), in which the increase of zinc also took place. The molar ratio between zinc and cadmium was higher in MT fractions obtained from liver than in MT fractions obtained from kidney.

  12. Effects of Humic Acid on the Germination Traits of Pumpkin Seeds under Cadmium Stress

    Directory of Open Access Journals (Sweden)

    Maasoumeh ASADI


    Full Text Available The study tackled the effect of humic acid and cadmium concentrations on the pumpkin seed germination characteristics throughout were studied. Treatments were cadmium concentrations on three levels: 0, 100 and 200 ppm and humic acid concentration of 0, 100, 200, 300 and 400 mg lit-1. Results showed that interaction of humic acid and cadmium was not significant on germination traits, but there was a significant effect on seedling growth indexes. Radicle and plumule length increased by 86 and 192% in comparison with control, of the mixture of 200 ppm cadmium and 300 mg lit-1 of humic acid. Cadmium had stimulatory effect on radicle and cotyledon dry weight and the highest values obtained with 200 ppm in mixture with 200 mg lit-1 of humic acid. Also, maximum plumule dry weight was recorded in 200 ppm cadmium and 300 mg lit-1 of humic acid. The highest of indexes were observed of 200 ppm cadmium and 400 mg lit-1 humic acid. In conclusion, the humic acid had detoxifying effect on cadmium stress in the culture and responded antagonistically against cadmium, but it seems that these concentrations of cadmium are low for the pumpkin seed and can be increased in order to reach the toxicity level.

  13. Chronic cadmium exposure stimulates SDF-1 expression in an ERα dependent manner. (United States)

    Ponce, Esmeralda; Aquino, Natalie B; Louie, Maggie C


    Cadmium is an omnipotent environmental contaminant associated with the development of breast cancer. Studies suggest that cadmium functions as an endocrine disruptor, mimicking the actions of estrogen in breast cancer cells and activating the receptor to promote cell growth. Although acute cadmium exposure is known to promote estrogen receptor-mediated gene expression associated with growth, the consequence of chronic cadmium exposure is unclear. Since heavy metals are known to bioaccumulate, it is necessary to understand the effects of prolonged cadmium exposure. This study aims to investigate the effects of chronic cadmium exposure on breast cancer progression. A MCF7 breast cancer cell line chronically exposed to 10(-7) M CdCl2 serves as our model system. Data suggest that prolonged cadmium exposures result in the development of more aggressive cancer phenotypes - increased cell growth, migration and invasion. The results from this study show for the first time that chronic cadmium exposure stimulates the expression of SDF-1 by altering the molecular interactions between ERα, c-jun and c-fos. This study provides a mechanistic link between chronic cadmium exposure and ERα and demonstrates that prolonged, low-level cadmium exposure contributes to breast cancer progression.

  14. Cadmium promotes breast cancer cell proliferation by potentiating the interaction between ERalpha and c-Jun. (United States)

    Siewit, Christina L; Gengler, Bridget; Vegas, Esera; Puckett, Rachel; Louie, Maggie C


    Cadmium is an environmental contaminant that enters the body through diet or cigarette smoke. It affects multiple cellular processes, including cell proliferation, differentiation, and apoptosis. Recently, cadmium has been shown to function as an endocrine disruptor, to stimulate estrogen receptor alpha (ERalpha) activity and promote uterine and mammary gland growth in mice. Although cadmium exposure has been associated with the development of breast cancer, the mechanism of action of cadmium remains unclear. To address this deficit, we examined the effects of cadmium treatment on breast cancer cells. We found that ERalpha is required for both cadmium-induced cell growth and modulation of gene expression. We also determined that ERalpha translocates to the nucleus in response to cadmium exposure. Additionally, we provide evidence that cadmium potentiates the interaction between ERalpha and c-Jun and enhances recruitment of this transcription factor complex to the proximal promoters of cyclin D1 and c-myc, thus increasing their expression. This study provides a mechanistic link between cadmium exposure and ERalpha and demonstrates that cadmium plays an important role in the promotion of breast cancer.

  15. Chronic cadmium exposure stimulates SDF-1 expression in an ERα dependent manner.

    Directory of Open Access Journals (Sweden)

    Esmeralda Ponce

    Full Text Available Cadmium is an omnipotent environmental contaminant associated with the development of breast cancer. Studies suggest that cadmium functions as an endocrine disruptor, mimicking the actions of estrogen in breast cancer cells and activating the receptor to promote cell growth. Although acute cadmium exposure is known to promote estrogen receptor-mediated gene expression associated with growth, the consequence of chronic cadmium exposure is unclear. Since heavy metals are known to bioaccumulate, it is necessary to understand the effects of prolonged cadmium exposure. This study aims to investigate the effects of chronic cadmium exposure on breast cancer progression. A MCF7 breast cancer cell line chronically exposed to 10(-7 M CdCl2 serves as our model system. Data suggest that prolonged cadmium exposures result in the development of more aggressive cancer phenotypes - increased cell growth, migration and invasion. The results from this study show for the first time that chronic cadmium exposure stimulates the expression of SDF-1 by altering the molecular interactions between ERα, c-jun and c-fos. This study provides a mechanistic link between chronic cadmium exposure and ERα and demonstrates that prolonged, low-level cadmium exposure contributes to breast cancer progression.

  16. Microphthalmia-associated transcription factor as the molecular target of cadmium toxicity in human melanocytes

    Energy Technology Data Exchange (ETDEWEB)

    Chantarawong, Wipa [Department of Molecular Biology and Applied Physiology, Tohoku University School of Medicine, Sendai (Japan); Inter Departmental Multidisciplinary Graduate Program in Bioscience, Faculty of Science, Kasetsart University, Bangkok (Thailand); Takeda, Kazuhisa; Sangartit, Weerapon; Yoshizawa, Miki [Department of Molecular Biology and Applied Physiology, Tohoku University School of Medicine, Sendai (Japan); Pradermwong, Kantimanee [Department of Zoology, Faculty of Science, Kasetsart University, Bangkok (Thailand); Shibahara, Shigeki, E-mail: [Department of Molecular Biology and Applied Physiology, Tohoku University School of Medicine, Sendai (Japan)


    Highlights: • In human melanocytes, cadmium decreases the expression of MITF-M and tyrosinase and their mRNAs. • In human melanoma cells, cadmium decreases the expression of MITF-M protein and tyrosinase mRNA. • Expression of MITF-H is less sensitive to cadmium toxicity in melanocyte-linage cells. • Cadmium does not decrease the expression of MITF-H in retinal pigment epithelial cells. • MITF-M is the molecular target of cadmium toxicity in melanocytes. - Abstract: Dietary intake of cadmium is inevitable, causing age-related increase in cadmium accumulation in many organs, including hair, choroid and retinal pigment epithelium (RPE). Cadmium has been implicated in the pathogenesis of hearing loss and macular degeneration. The functions of cochlea and retina are maintained by melanocytes and RPE, respectively, and the differentiation of these pigment cells is regulated by microphthalmia-associated transcription factor (MITF). In the present study, we explored the potential toxicity of cadmium in the cochlea and retina by using cultured human melanocytes and human RPE cell lines. MITF consists of multiple isoforms, including melanocyte-specific MITF-M and widely expressed MITF-H. Levels of MITF-M protein and its mRNA in human epidermal melanocytes and HMV-II melanoma cells were decreased significantly by cadmium. In parallel with the MITF reduction, mRNA levels of tyrosinase, the key enzyme of melanin biosynthesis that is regulated by MITF-M, were also decreased. In RPE cells, however, the levels of total MITF protein, constituting mainly MITF-H, were not decreased by cadmium. We thus identify MITF-M as the molecular target of cadmium toxicity in melanocytes, thereby accounting for the increased risk of disability from melanocyte malfunction, such as hearing and vision loss among people with elevated cadmium exposure.

  17. Extraction procedure may not be feasible for cadmium analysis of tissues, such as horse kidney cortex, having a very high cadmium content

    Energy Technology Data Exchange (ETDEWEB)

    Elinder, C.G. (The Karenlinska Inst., Stockholm, Sweden); Lind, B.; Piscator, M.; Sundstedt, K.; Akerberg, S.


    In the light of the discrepancy between data on cadmium in horse kidney in the U.S. and what has been reported in Europe the present authors have tested the analytical procedure used by Penumarthy et al. (1980). Cadmium in reference pig kidney and horse kidney cortex was determined by flame atomic absorption spectrophotometry after wet digestion, dissolving of the residue in water, complexing with APDC and extraction into MIBK. The ratio between the measured amount (minus blank) and the calculated amount of cadmium in the samples was 86% for blank with addition of 0.5 cadmium and 91% for low-level pig kidney cortex with or without the addition of 0.5 cadmium. The ratio was unacceptably low for horse kidney cortex having a concentration of greater than or equal to 117 dry wt. Concentrations of this magnitude are also found in human kidney and in human and horse liver. Data of Penumarthy et al. (1980) are also unusual in that the average cadmium concentration was 3.4 wet wt in horse liver and 2.5 in horse kidney. As a rule, cadmium concentration in kidney exceeds that in liver by a factor of 2-15. The capacity of the extraction procedure appears to be insufficient at high and intermediate cadmium levels. 1 table (JMT)

  18. A home-brew real-time PCR assay for reliable detection and quantification of mature miR-122. (United States)

    Naderi, Mahmood; Abdul Tehrani, Hossein; Soleimani, Masoud; Shabani, Iman; Hashemi, Seyed Mahmoud


    miR-122 is a liver-specific miRNA that has significant gene expression alterations in response to specific pathophysiological circumstances of liver such as drug-induced liver injury, hepatocellular carcinoma, and hepatitis B and C virus infections. Therefore, accurate and precise quantification of miR-122 is very important for clinical diagnostics. However, because of the lack of in vitro diagnostics assays for miR-122 detection and quantification of the existence of an open-source assay could inevitably provide external evaluation by other researchers and the chance of promoting the assay when required. The aim of this study was to develop a Taqman real-time polymerase chain reaction assay, which is capable of robust and reliable quantification of miR-122 in different sample types. We used stem loop methodology to design a specific Taqman real-time polymerase chain reaction assay for miR-122. This technique enabled us to reliably and reproducibly quantify short-length oligonucleotides such as miR-122. The specificity, sensitivity, interassay and intra-assay, and the dynamic range of the assay were experimentally determined by their respective methodology. The assay had a linear dynamic range of 3E to 4.8E miR-122 copies/reaction and the limit of detection was determined to be between 960 and 192 copies/reaction with 95% confidence interval. The assay gave a coefficient of variation for the Ct values of 50,000 copies per hepatocyte, this assay is able to suffice the need for reliable detection and quantification of this miRNA. Therefore, this study can be considered as a start point for standardizing miR-122 quantification.

  19. Thin films and solar cells of cadmium telluride and cadmium zinc telluride (United States)

    Ferekides, Christos Savva

    The objectives of this dissertation are to investigate (1) the metalorganic chemical vapor deposition (MOCVD) and properties of cadmium telluride (CdTe) and cadmium zinc telluride (Cd(1-x)Zn(z)Te) films and junctions, and their potential application to solar cells, and (2) the fabrication and characterization of CdTe solar cells by the close spaced sublimation (CSS) technique. CdTe and Cd(1-x)Zn(x)Te films have been deposited by MOCVD on a variety of substrates at 300-400 C. The effect of the deposition parameters and post deposition heat treatments on the electrical, optical, and structural properties have been investigated. Heterojunctions of the configuration CdTe/transparent conducting semiconductor (TCS) and Cd(1-x)Zn(x)Te/TCS have been prepared and characterized. CdTe(MOCVD)/CdS and Cd(1-x)Zn(x)Te(E sub g = 1.65eV)/Cd(1-x)Zn(x)S solar cells with efficiencies of 9.9 percent and 2.4 percent, respectively have been fabricated. The as-deposited CdTe(MOCVD)/CdS junctions exhibited high dark current densities due to deflects at the interface associated with small grain size. Their characteristics of the Cd(1-x)Zn(x)Te junctions degraded with increasing Zn concentration due to the crystalline quality and very small grain size (0.3 microns) in films with high ZnTe contents (greater than 25 percent). No effective post-deposition heat treatment has been developed. CdTe/CdS solar cells have also been fabricated by the close spaced sublimation (CSS). Significant improvements in material and processing have been made, and in collaboration with fellow researchers an AM1.5 conversion efficiency of 13.4 percent has been demonstrated, the highest efficiency ever measured for such devices. The highest conversion efficiency for the CdTe(CSS)/CdS solar cell was achieved by reaching high open-circuit voltages and fill factors, while the short-circuit current densities were moderate. These results indicate that further improvements to increase the short-circuit current densities

  20. Upregulation of MiR-122 via Trichostatin A Treatments in Hepatocyte-like Cells Derived from Mesenchymal Stem Cells. (United States)

    Alizadeh, Effat; Eslaminejad, MohamadReza Baghaban; Akbarzadeh, Abolfazl; Sadeghi, Zohre; Abasi, Mozghan; Herizchi, Roya; Zarghami, Nosratollah


    The miR-122 is a tissue-specific miRNA; its expression is abundant in liver. MiR-122 upregulation is crucial for differentiation, functionality, and maintenance of differentiated phenotype in hepatocytes. The improving effects of trichostatin A (TSA) on hepatic differentiation have been reported previously. The aim of this study was to determine whether TSA can affect the expression of miR-122 in hepatocyte-like cells (HLCs) generated from human adipose tissue-derived mesenchymal stem cells (hAT-MSCs). The hepatic differentiation of hAT-MSCs induced by a mixture of growth factors and cytokines either with or without TSA treatments. The functionality of HLCs generated with or without TSA and the expression levels of miR-122 were studied. The expression levels of miR-122 in TSA-treated HLCs was significantly (p < 0.05) higher than those generated by growth factors and cytokines, only. The downregulation of a-fetoprotein (AFP) levels but enhanced albumin synthesis (p < 0.05) and upregulation of liver-enriched transcription factors (LETFs) HNF4α (hepatocyte nuclear factor 4α) and HNF6 (hepatocyte nuclear factor 6) were observed in TSA-treated HLCs (p < 0.05). In conclusion, administration of TSA in hepatogenic differentiation of hAT-MSCs resulted in higher expression levels of miR-122, facilitation of differentiation, and subsequently attenuation of AFP levels.

  1. Lead, Cadmium and Nickel Contents of Some Medicinal Agents (United States)

    Nessa, Fazilatun; Khan, S. A.; Abu Shawish, K.Y.I.


    Thirty nine brands of pharmaceutical dosage forms (28 tablets, 4 syrups, 6 suspensions and one chewing gum) that are available in United Arab Emirates pharmaceutical markets were investigated for the presence of three heavy metals; lead, cadmium and nickel. Amongst the samples, 13 products were manufactured locally in United Arab Emirates and 26 products were imported from around the world. The samples were prepared by acid digestion procedure and the resultant solutions were analyzed for heavy metals by using a validated graphite furnace atomic absorption spectrometric method. Calibration curves were achieved using different concentration of lead, nickel and cadmium ranged from 0.001 to 0.05 μg/ml. The mean recoveries of metals from the samples were 86.4 to 97%. The %relative standard deviation for the intraassay and interday precision for the metals were <5%. Amongst the 39 samples of pharmaceutical dosage form all exhibited a positive response for lead, cadmium and nickel except three products whose Ni levels were below quantification level. The products contained variable amounts of heavy metals as of 0.0017 to 11.88 μg lead; 0.0011 to 0.5559 μg cadmium and 0.0011 to 2.6428 μg nickel, respectively. Based on maximum recommended daily dose (g) of these products, maximum daily ingested mass of lead was 0.0034 to 11.88 μg/d, 0.0013 to 0.56 μg/d for cadmium and 0.0011 to 2.64 μg/d for nickel, respectively. The results were compared with those of oral permitted daily exposure levels of United State Pharmacopeial National Formulary 2013. All the products were safe to consume and contained lower level of lead, cadmium and nickel than Oral Permitted Daily Exposure levels, except three products which showed higher level of lead than oral permitted daily exposure levels. Hence the raw materials used in manufacturing of these medicinal agents might be responsible for the presence of higher level of lead. PMID:27168689

  2. Cadmium exposure from smoking cigarettes: variations with time and country where purchased. (United States)

    Elinder, C G; Kjellström, T; Lind, B; Linnman, L; Piscator, M; Sundstedt, K


    Cadmium has been determined in 26 brands of cigarettes purchased in eight different countries throughout the world and in 16 different samples of cigarettes produced in Sweden between 1918 and 1968. In addition the amount of cadmium released from smoking one cigarette to the particulate phase collected from a smoking simulation machine, corresponding to the amount actually inhaled by a smoker, has been determined. The cadmium concentration in different brands of cigarettes ranged from 0.19 to 3.0 micrograms Cd/g dry wt, with a general tendency toward lower values in cigarettes from developing countries. No systematic change in the cadmium concentration of cigarettes with time could be revealed. The amount of cadmium inhaled from smoking one cigarette containing about 1.7 microgram Cd was estimated to be 0.14 to 0.19 microgram, corresponding to about 10% of the total cadmium content in the cigarette.

  3. Pubertal dependent effects of cadmium on episodic prolactin secretion in male rats

    Energy Technology Data Exchange (ETDEWEB)

    Lafuente, A.; Alvarez-Demanuel, E.; Marquez, N. [Fac. de Cienicas, Orense (Spain). Lab. de Toxicologia; Esquifino, A.I. [Dept. Bioquimica, Facultad de Medicina, Universidad Complutense, 28040-Madrid (Spain)


    This work was undertaken to assess if exposure to cadmium related to puberty may affect the episodic pattern of prolactin. Male rats were submitted to cadmium exposure, from day 30 to 60 or from day 60 to 90 of life respectively, at a dose of 50 ppm in the drinking water. Control age-matched rats received cadmium-free water. Prepubertal cadmium administration decreased mean serum prolactin levels and the absolute amplitude of the prolactin pulses. Subchronic exposure to cadmium of adult rats decreased mean serum prolactin levels, the absolute amplitude of the prolactin pulses and their duration, and the mean half-life of the hormone. These results suggest that subchronic cadmium exposure changes the secretory pattern of prolactin in adult male rats in a puberty-dependent way. (orig.) With 1 fig., 1 tab., 37 refs.

  4. Isolation, identification, characterization, and evaluation of cadmium removal capacity of Enterobacter species. (United States)

    Abbas, Syed Zaghum; Rafatullah, Mohd; Ismail, Norli; Lalung, Japareng


    This study focused on the isolation and characterization of high cadmium-resistant bacterial strains, possible exploitation of its cadmium-accumulation and cadmium-induced proteins. Cadmium-resistant bacterial strains designated as RZ1 and RZ2 were isolated from industrial wastewater of Penang, Malaysia. These isolates were identified as Enterobacter mori and Enterobacter sp. WS12 on the basis of phenotypic, biochemical and 16S rDNA sequence based molecular phylogenetic characteristics. Both isolates were Gram negative, cocci, and growing well in Lauria-Bertani broth medium at 35 °C temperature and pH 7.0. Results also indicated that Enterobacter mori and Enterobacter sp. WS12are capable to remove 87.75 and 85.11% of the cadmium from 100 µg ml(-1) concentration, respectively. This study indicates that these strains can be useful as an inexpensive and efficient bioremediation technology to remove and recover the cadmium from wastewater.

  5. Digital gene expression profiling (DGE) of cadmium-treated Drosophila melanogaster. (United States)

    Guan, Delong; Mo, Fei; Han, Yan; Gu, Wei; Zhang, Min


    Cadmium is highly toxic and can cause oxidative damage, metabolic disorders, and reduced lifespan and fertility in animals. In this study, we investigated the effects of cadmium in Drosophila melanogaster, performing transcriptome analysis by using tag-based digital gene expression (DGE) profiling. Among 1970 candidate genes, 1443 were up-regulated and 527 were down-regulated following cadmium exposure. Using Gene Ontology analysis, we found that cadmium stress affects three processes: transferase activity, stress response, and the cell cycle. Furthermore, we identified five differentially expressed genes (confirmed by real-time PCR) involved in all three processes: Ald, Cdc2, skpA, tefu, and Pvr. Pathway analysis revealed that these genes were involved in the cell cycle pathway and fat digestion and absorption pathway. This study reveals the gene expression response to cadmium stress in Drosophila, it provides insights into the mechanisms of this response, and it could contribute to our understanding of cadmium toxicity in humans.

  6. Assessment of Cadmium Contamination of Soils in Sewage Disposal Areasof Coimbatore District, Tamil Nadu, India

    Directory of Open Access Journals (Sweden)

    R. Vinu Radha


    Full Text Available Cadmium is a naturally occurring minor element, one of the metallic components in the earth’s crust and oceans and present everywhere. Agricultural soils may also be enriched by cadmium which causes it’s accumulation in plants and pose a potential threat to human health. Also high concentrations of cadmium in soil have detrimental effects on ecosystem as it enters the food chain. Soil samples were collected from different places near sewage disposal areas in Coimbatore where the source of cadmium is likely to be threatening the public. Twenty six samples were collected, their physiochemical properties and total cadmium content were determined. Five soil samples that showed high levels of more than 3 mg kg-1of cadmium were identified as hotspots and their Arbuscularmycorrhizal spore count were assessed.

  7. Cadmium induces reactive oxygen species generation and lipid peroxidation in cortical neurons in culture. (United States)

    López, E; Arce, C; Oset-Gasque, M J; Cañadas, S; González, M P


    Cadmium is a toxic agent that it is also an environmental contaminant. Cadmium exposure may be implicated in some humans disorders related to hyperactivity and increased aggressiveness. This study presents data indicating that cadmium induces cellular death in cortical neurons in culture. This death could be mediated by an apoptotic and a necrotic mechanism. The apoptotic death may be mediated by oxidative stress with reactive oxygen species (ROS) formation which could be induced by mitochondrial membrane dysfunction since this cation produces: (a) depletion of mitochondrial membrane potential and (b) diminution of ATP levels with ATP release. Necrotic death could be mediated by lipid peroxidation induced by cadmium through an indirect mechanism (ROS formation). On the other hand, 40% of the cells survive cadmium action. This survival seems to be mediated by the ability of these cells to activate antioxidant defense systems, since cadmium reduced the intracellular glutathione levels and induced catalase and SOD activation in these cells.

  8. Simultaneous removal of phenanthrene and cadmium from contaminated soils by saponin, a plant-derived biosurfactant. (United States)

    Song, Saisai; Zhu, Lizhong; Zhou, Wenjun


    Batch experiments were conducted to evaluate the performance of saponin, a plant-derived biosurfactant, for simultaneously removing phenanthrene and cadmium from the combined contaminated soils. Results showed that phenanthrene was desorbed from the contaminated soils by saponin with the partition of phenanthrene into surfactant micelle, meanwhile cadmium was effectively removed from the contaminated soils by the complexation of cadmium with the external carboxyl groups of saponin micelle. The efficiencies of saponin for the removal of phenanthrene and cadmium from the contaminated soils were greater than that of Triton X100 and citric acid, respectively. At concentration of 3750 mg/L, saponin has a removal rate of 87.7% and 76.2% of cadmium and phenanthrene, respectively, from the combined contaminated soil. The removals of cadmium and phenanthrene from the soils were not obviously constrained each other. Thus, saponin has the potential for the removal of heavy metal and PAHs from the combined contaminated soils.

  9. Soluble Moringa oleifera leaf extract reduces intracellular cadmium accumulation and oxidative stress in Saccharomyces cerevisiae. (United States)

    Kerdsomboon, Kittikhun; Tatip, Supinda; Kosasih, Sattawat; Auesukaree, Choowong


    Moringa oleifera leaves are a well-known source of antioxidants and traditionally used for medicinal applications. In the present study, the protective action of soluble M. oleifera leaf extract (MOLE) against cadmium toxicity was investigated in the model eukaryote Saccharomyces cerevisiae. The results showed that this extract exhibited a protective effect against oxidative stress induced by cadmium and H2O2 through the reduction of intracellular reactive oxygen species. Interestingly, not only the co-exposure of soluble MOLE with cadmium but also pretreatment of this extract prior to cadmium exposure significantly reduced the cadmium uptake through an inhibition of Fet4p, a low-affinity iron(II) transporter. In addition, the supplementation of soluble MOLE significantly reduced intracellular iron accumulation in a Fet4p-independent manner. Our findings suggest the potential use of soluble extract from M. oleifera leaves as a dietary supplement for protection against cadmium accumulation and oxidative stress.

  10. Dunaliella salina as marine microalga highly tolerant to but a poor remover of cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Folgar, S. [Departamento de Biologia Celular y Molecular, Laboratorio de Microbiologia, Facultad de Ciencias, Universidade da Coruna, Alejandro de la Sota no 1, 15008 La Coruna (Spain); Torres, E., E-mail: [Departamento de Biologia Celular y Molecular, Laboratorio de Microbiologia, Facultad de Ciencias, Universidade da Coruna, Alejandro de la Sota no 1, 15008 La Coruna (Spain); Perez-Rama, M.; Cid, A.; Herrero, C.; Abalde, J. [Departamento de Biologia Celular y Molecular, Laboratorio de Microbiologia, Facultad de Ciencias, Universidade da Coruna, Alejandro de la Sota no 1, 15008 La Coruna (Spain)


    Cadmium tolerance and removal in the marine microalga Dunaliella salina were studied in cultures exposed to different metal concentrations (5-120 mg Cd l{sup -1}) for 96 h. This microalga can be included in the group of microalgal species most tolerant to cadmium due to the high value of EC50 that it possesses (48.9 mg Cd l{sup -1} at 96 h of culture). The greater percentage of cadmium removed was obtained in cultures exposed to 5 mg Cd l{sup -1} at 96 h, but removing only 11.3% of the added cadmium. In all cultures, the quantity of cadmium removed intracellularly was much lower than the bioadsorbed quantity and it was proportional to the sulfhydryl group levels. Both the Freundlich and Langmuir adsorption models were suitable for describing the short-term biosorption of cadmium by living cells of D. salina.

  11. MicroRNA-122 antagonism against hepatitis C virus genotypes 1-6 and reduced efficacy by host RNA insertion or mutations in the HCV 5' UTR

    DEFF Research Database (Denmark)

    Li, Yiping; Gottwein, Judith; Scheel, Troels Kasper Høyer;


    MicroRNA-122 (miR-122) is believed to stimulate hepatitis C virus (HCV) replication through interaction with two adjacent sites downstream of stem loop I (SLI) within the HCV 5' untranslated region (5' UTR). Recently, it was demonstrated that locked nucleic acid SPC3649-induced miR-122 antagonism...... nucleolar RNA. We demonstrated that SPC3649-induced miR-122 antagonism had a potent antiviral effect against HCV genotypes 1-6 5' UTR-NS2 viruses. Strikingly, HCV recombinant virus with substitution of SLI and miR-122 binding site 1 (S1) by the U3 RNA sequence was not affected by miR-122 antagonism...... reduced the efficacy of SPC3649 treatment, indicating that escape variants to miR-122 antagonism-based HCV therapy could potentially occur....

  12. Chronic cadmium treatment promotes oxidative stress and endothelial damage in isolated rat aorta.

    Directory of Open Access Journals (Sweden)

    Camila C P Almenara

    Full Text Available Cadmium is a highly toxic metal that is present in phosphate fertilizers, and the incidence of cadmium poisoning in the general population has increased, mainly due to cigarette smoking. Once absorbed, cadmium accumulates in the tissues, causing harmful effects including high blood pressure, endothelial damage and oxidative stress. Oxidative stress is known to efficiently produce oxidized low-density lipoprotein and consequently atherosclerosis, mainly in the aorta. However, the mechanisms through which endothelial damage is induced by cadmium have not been elucidated. Thus, the aim of this study was to investigate the effects of this metal in the isolated aorta and the possible role of oxidative stress. Rats received 100 mg.L(-1 cadmium chloride (CdCl2 in the drinking water or distilled water alone for four weeks. The pressor effect of cadmium was followed throughout the exposure period by tail plethysmography. At the end of the fourth week, the blood cadmium content was established, and the vascular reactivity of the isolated aorta to phenylephrine, acetylcholine and sodium nitroprusside was analyzed in the context of endothelium denudation and incubation with L-NAME, apocynin, losartan, enalapril, superoxide dismutase (SOD or catalase. We observed an increased response to phenylephrine in cadmium-treated rats. This increase was abolished by catalase and SOD incubation. Apocynin treatment reduced the phenylephrine response in both treatment groups, but its effect was greater in cadmium-treated rats, and NOX2 expression was greater in the cadmium group. These results suggested that cadmium in blood concentrations similar to those found in occupationally exposed populations is able to stimulate NOX2 expression, contributing to oxidative stress and reducing NO bioavailability, despite enhanced eNOS expression. These findings suggest that cadmium exposure promotes endothelial damage that might contribute to inflammation, vascular injury and the

  13. Consumption guideline concerning cadmium in moose meat in northern British Columbia, Canada


    Jin, Andrew; Joseph-Quinn, Kelly M.


    Introduction. Disturbed by reports of high concentrations of cadmium in large land mammals in Arctic Canada, community members wondered if they should eat less moose (Alces alces). Study design. Risk assessment modelling. Methods. We measured cadmium concentrations in moose tissues donated by food hunters. As a conservative assumption, we took the upper limits of the 95% confidence intervals for the means. Cadmium intake from other sources we estimated using risk assessment models. Assuming a...

  14. Dietary cadmium exposure and the risk of hormone-related cancers



    The toxic metal cadmium has been widely dispersed into the environment mainly through anthropogenic activities. Even in industrially non-polluted areas, farmland and consequently foods are, to a varying degree, contaminated. Food is the main source of exposure besides tobacco smoking. Cadmium accumulates in the body, particularly in the kidney where it may cause renal tubular damage. Recently, cadmium was discovered to possess endocrine disrupting properties, mainly mimicking the in vivo- eff...

  15. Bioaccumulation and retention kinetics of cadmium in the freshwater decapod Macrobrachium australiense

    Energy Technology Data Exchange (ETDEWEB)

    Cresswell, Tom, E-mail: [Centre for Environmental Contaminants Research, CSIRO Land and Water, Locked Bag 2007, Kirrawee, NSW 2232 (Australia); School of Applied Sciences, RMIT University, Plenty Road, Bundoora, VIC 3083 (Australia); Simpson, Stuart L. [School of Applied Sciences, RMIT University, Plenty Road, Bundoora, VIC 3083 (Australia); Smith, Ross E.W. [Hydrobiology, Lang Parade, Auchenflower, QLD 4066 (Australia); Nugegoda, Dayanthi [School of Applied Sciences, RMIT University, Plenty Road, Bundoora, VIC 3083 (Australia); Mazumder, Debashish [Institute for Environmental Research, ANSTO, Locked Bag 2001, Kirrawee, NSW 2232 (Australia); Twining, John [Austral Radioecology, Oyster Bay, NSW, 2225 (Australia)


    Highlights: • Sources and mechanisms of Cd bioaccumulation were examined using radiotracers. • Macrobrachium australiense readily accumulated cadmium from the dissolved phase. • Assimilation efficiencies were comparable for sediment and algae. • A biokinetic model predicted ingestion accounted for majority of bioaccumulated Cd. - Abstract: The potential sources and mechanisms of cadmium bioaccumulation by the native freshwater decapods Macrobrachium species in the waters of the highly turbid Strickland River in Papua New Guinea were examined using {sup 109}Cd-labelled water and food sources and the Australian species Macrobrachium australiense as a surrogate. Synthetic river water was spiked with environmentally relevant concentrations of cadmium and animals were exposed for 7 days with daily renewal of test solutions. Dietary assimilation of cadmium was assessed through pulse-chase experiments where prawns were fed separately {sup 109}Cd-labelled fine sediment, filamentous algae and carrion (represented by cephalothorax tissue of water-exposed prawns). M. australiense readily accumulated cadmium from the dissolved phase and the uptake rate increased linearly with increasing exposure concentration. A cadmium uptake rate constant of 0.10 ± 0.05 L/g/d was determined in synthetic river water. During depuration following exposure to dissolved cadmium, efflux rates were low (0.9 ± 5%/d) and were not dependent on exposure concentration. Assimilation efficiencies of dietary sources were comparable for sediment and algae (48–51%), but lower for carrion (28 ± 5%) and efflux rates were low (0.2–2.6%/d) demonstrating that cadmium was well retained by M. australiense. A biokinetic model of cadmium accumulation by M. australiense predicted that for exposures to environmentally relevant cadmium concentrations in the Strickland River, uptake from ingestion of fine sediment and carrion would be the predominant sources of cadmium to the organism. The model predicted

  16. Plasticity in offspring contaminant tolerance traits: developmental cadmium exposure trumps parental effects. (United States)

    Plautz, Stephanie C; Salice, Christopher J


    Parental effects are non-genotypic influences on offspring phenotype that occur via parental phenotypes or environments, while developmental plasticity is phenotypic variation that arises during development in response to environmental cues. We evaluated the relative contribution of these two sources of phenotypic variation on offspring toxicant tolerance in Physa pomilia snails exposed to cadmium. We exposed adult snails to 0, 2, or 20 μg/L cadmium for 7 days, then exposed egg masses collected from these adults to 0 or 2 μg/L cadmium in a factorial design (adult cadmium exposure × egg mass cadmium exposure). Starting at 2 days old, we recorded time to death for hatchlings exposed to 150 μg/L cadmium for 72 h at 8 h intervals. Juveniles hatched from cadmium-exposed egg masses displayed higher cadmium tolerance than juveniles from unexposed egg masses. Among juveniles from egg masses not exposed to cadmium, offspring of parents exposed to 20 μg/L cadmium had higher cadmium tolerance than offspring of parents exposed to 0 or 2 μg/L cadmium. Our results show that both parental effects and developmental plasticity can impact offspring toxicant tolerance and point to the potential importance of both processes in understanding how offspring respond to chemical contaminants. When both parents and offspring are exposed to a toxicant, our results showed that the effects of parental exposure on offspring toxicant tolerance may be eclipsed by the effects of offspring exposure during development.

  17. Near-infrared luminescence of cadmium pigments: in situ identification and mapping in paintings. (United States)

    Thoury, Mathieu; Delaney, John K; Rie, E René de la; Palmer, Michael; Morales, Kathryn; Krueger, Jay


    A comprehensive study of the luminescence properties of cadmium pigments was undertaken to determine whether these properties could be used for in situ identification and mapping of the pigments in paintings. Cadmium pigments are semiconductors that show band edge luminescence in the visible range and deep trap luminescence in the red/infrared range. Emission maxima, quantum yields, and excitation spectra from the band edge and deep trap emissions were studied for sixty commercial cadmium pigments that span the color range from yellow to red (reflectance transition 470 to 660 nm). For paints containing cadmium pigments, luminescence from deep traps was more readily observable than that from the band edge, although the yield varied widely from zero to around 4.5%. Optimal excitation for emission is found to be in the visible for both pigments in powder form and mixed with a medium. The maxima of the deep trap emission shift with the band gap energy, providing a potentially useful way to assign pigment type even when used in pigment mixtures. The usefulness of the results of the study on mockups was demonstrated by the mapping of cadmium pigments of different hues with the aid of calibrated luminescence imaging spectroscopy in a painting by Edward Steichen, entitled Study for 'Le Tournesol' (1920). Analysis of the luminescence image cube reveals at least six unique spectral components, associated with emission from white pigments, paint binder, and cadmium red and yellow pigments. The results were compared with those from X-ray fluorescence spectrometry (XRF) and fiber-optic reflection spectroscopy (FORS) and the results obtained on paint samples containing cadmium pigments. These results show that, when present, the emission from traps can be used as an analytical tool to identify cadmium pigments, to distinguish among cadmium sulfide, cadmium zinc sulfide, and cadmium sulfoselenide, and to map cadmium pigments, even in mixtures.

  18. Role of dissolved and particulate cadmium in the accumulation of cadmium in cultured oysters (Crassostrea gigas)

    Energy Technology Data Exchange (ETDEWEB)

    Lekhi, Priyanka [Department of Chemistry, University of British Columbia, Vancouver, BC V6T 1Z4 (Canada)], E-mail:; Cassis, D. [Department of Earth and Ocean Sciences, University of British Columbia, Vancouver, BC V6T 1Z4 (Canada); Pearce, C.M. [Pacific Biological Station, Fisheries and Oceans Canada, Nanaimo, BC V9T 6N7 (Canada); Ebell, N. [Odyssey Shellfish Ltd., Nanoose Bay, BC V0R 9G0 (Canada); Maldonado, M.T. [Department of Earth and Ocean Sciences, University of British Columbia, Vancouver, BC V6T 1Z4 (Canada); Orians, K.J. [Department of Chemistry, University of British Columbia, Vancouver, BC V6T 1Z4 (Canada); Department of Earth and Ocean Sciences, University of British Columbia, Vancouver, BC V6T 1Z4 (Canada)


    Pacific oysters (Crassostrea gigas) collected on the coast of British Columbia, Canada have occasionally shown cadmium (Cd) concentrations at or above 2 {mu}g g{sup -1} (wet weight), which has resulted in the loss of some international markets. This study investigated the source and transfer of Cd to oysters by focusing on the role of dissolved and particulate Cd in seawater. Parameters monitored for 1 year at two oyster farm sites on Vancouver Island included: oyster tissue mass and shell length, Cd in oysters, dissolved Cd, particulate Cd, temperature and salinity. Results show that dissolved Cd was the main source of Cd to the oysters and that Cd was mainly concentrated in the gut tissues. A seasonal trend was observed in Cd in oysters, in which levels were lowest during periods of higher temperatures. Results also indicate that the local oceanographic inputs and sediment diagenesis directly affect dissolved Cd and thereby influence the Cd levels in oysters. Particulate matter was not found to be a source of Cd in oysters, and was actually negatively correlated. This was likely due to the uptake of dissolved Cd by phytoplankton and the effect of phytoplankton on oyster tissue mass.

  19. Curcumin Protects against Cadmium-Induced Vascular Dysfunction, Hypertension and Tissue Cadmium Accumulation in Mice

    Directory of Open Access Journals (Sweden)

    Upa Kukongviriyapan


    Full Text Available Curcumin from turmeric is commonly used worldwide as a spice and has been demonstrated to possess various biological activities. This study investigated the protective effect of curcumin on a mouse model of cadmium (Cd—induced hypertension, vascular dysfunction and oxidative stress. Male ICR mice were exposed to Cd (100 mg/L in drinking water for eight weeks. Curcumin (50 or 100 mg/kg was intragastrically administered in mice every other day concurrently with Cd. Cd induced hypertension and impaired vascular responses to phenylephrine, acetylcholine and sodium nitroprusside. Curcumin reduced the toxic effects of Cd and protected vascular dysfunction by increasing vascular responsiveness and normalizing the blood pressure levels. The vascular protective effect of curcumin in Cd exposed mice is associated with up-regulation of endothelial nitric oxide synthase (eNOS protein, restoration of glutathione redox ratio and alleviation of oxidative stress as indicated by decreasing superoxide production in the aortic tissues and reducing plasma malondialdehyde, plasma protein carbonyls, and urinary nitrate/nitrite levels. Curcumin also decreased Cd accumulation in the blood and various organs of Cd-intoxicated mice. These findings suggest that curcumin, due to its antioxidant and chelating properties, is a promising protective agent against hypertension and vascular dysfunction induced by Cd.

  20. Low cadmium (LCD), a novel gene related to cadmium tolerance and accumulation in rice. (United States)

    Shimo, Hugo; Ishimaru, Yasuhiro; An, Gynheung; Yamakawa, Takashi; Nakanishi, Hiromi; Nishizawa, Naoko K


    The contamination of food crops by cadmium (Cd) is a major concern in food production because it can reduce crop yields and threaten human health. In this study, knockout rice plants (Oryza sativa) tagged with the gene trap vector pGA2707 were screened for Cd tolerance, and the tolerant line lcd was obtained. The lcd mutant showed tolerance to Cd on agar plates and in hydroponic culture during early plant development. Metal concentration measurements in hydroponically grown plants revealed significantly less Cd in the shoots of lcd plants compared with wild-type (WT) shoots. When cultured in the field in soil artificially contaminated with low levels of Cd, lcd showed no significant difference in the Cd content of its leaf blades; however, the Cd concentration in the grains was 55% lower in 2009 and 43% lower in 2010. There were no significant differences in plant dry weight or seed yield between lcd and wild-type plants. LCD, a novel gene, is not homologous to any other known gene. LCD localized to the cytoplasm and nucleus, and was expressed mainly in the vascular tissues in the roots and phloem companion cells in the leaves. These data indicate that lcd may be useful for understanding Cd transport mechanisms and is a promising candidate rice line for use in combating the threat of Cd to human health.

  1. Fractionation of Stable Cadmium Isotopes in the Cadmium Tolerant Ricinus communis and Hyperaccumulator Solanum nigrum (United States)

    Wei, Rongfei; Guo, Qingjun; Wen, Hanjie; Liu, Congqiang; Yang, Junxing; Peters, Marc; Hu, Jian; Zhu, Guangxu; Zhang, Hanzhi; Tian, Liyan; Han, Xiaokun; Ma, Jie; Zhu, Chuanwei; Wan, Yingxin


    Cadmium (Cd) isotopes provide new insights into Cd uptake, transport and storage mechanisms in plants. Therefore, the present study adopted the Cd-tolerant Ricinus communis and Cd-hyperaccumulator Solanum nigrum, which were cultured under controlled conditions in a nutrient solution with variable Cd supply, to test the isotopic fractionation of Cd during plant uptake. The Cd isotope compositions of nutrient solutions and organs of the plants were measured by multiple collector inductively coupled plasma mass spectrometry (MC-ICPMS). The mass balance of Cd isotope yields isotope fractionations between plant and Cd source (δ114/110Cdorgans-solution) of ‑0.70‰ to ‑0.22‰ in Ricinus communis and ‑0.51‰ to ‑0.33‰ in Solanum nigrum. Moreover, Cd isotope fractionation during Cd transport from stem to leaf differs between the Cd-tolerant and -hyperaccumulator species. Based on these results, the processes (diffusion, adsorption, uptake or complexation), which may induce Cd isotope fractionation in plants, have been discussed. Overall, the present study indicates potential applications of Cd isotopes for investigating plant physiology.

  2. Fractionation of Stable Cadmium Isotopes in the Cadmium Tolerant Ricinus communis and Hyperaccumulator Solanum nigrum (United States)

    Wei, Rongfei; Guo, Qingjun; Wen, Hanjie; Liu, Congqiang; Yang, Junxing; Peters, Marc; Hu, Jian; Zhu, Guangxu; Zhang, Hanzhi; Tian, Liyan; Han, Xiaokun; Ma, Jie; Zhu, Chuanwei; Wan, Yingxin


    Cadmium (Cd) isotopes provide new insights into Cd uptake, transport and storage mechanisms in plants. Therefore, the present study adopted the Cd-tolerant Ricinus communis and Cd-hyperaccumulator Solanum nigrum, which were cultured under controlled conditions in a nutrient solution with variable Cd supply, to test the isotopic fractionation of Cd during plant uptake. The Cd isotope compositions of nutrient solutions and organs of the plants were measured by multiple collector inductively coupled plasma mass spectrometry (MC-ICPMS). The mass balance of Cd isotope yields isotope fractionations between plant and Cd source (δ114/110Cdorgans-solution) of −0.70‰ to −0.22‰ in Ricinus communis and −0.51‰ to −0.33‰ in Solanum nigrum. Moreover, Cd isotope fractionation during Cd transport from stem to leaf differs between the Cd-tolerant and -hyperaccumulator species. Based on these results, the processes (diffusion, adsorption, uptake or complexation), which may induce Cd isotope fractionation in plants, have been discussed. Overall, the present study indicates potential applications of Cd isotopes for investigating plant physiology. PMID:27076359

  3. miR-122 targets NOD2 to decrease intestinal epithelial cell injury in Crohn’s disease

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Yu; Wang, Chengxiao; Liu, Ying; Tang, Liwei; Zheng, Mingxia [Department of Pediatrics, Jiangwan Hospital of Shanghai, Shanghai 200434 (China); Xu, Chundi [Department of Pediatrics, Ruijin affiliated to Shanghai Jiaotong University School of Medicine, Shanghai, 200025 (China); Song, Jian, E-mail: [Department of Gastroenterology, Jiangwan Hospital of Shanghai, Shanghai 200434 (China); Meng, Xiaochun [Department of Pediatrics, Jiangwan Hospital of Shanghai, Shanghai 200434 (China)


    Highlights: •NOD2 is a target gene of miR-122. •miR-122 inhibits LPS-induced apoptosis by suppressing NOD2 in HT-29 cells. •miR-122 reduces the expression of pro-inflammatory cytokines (TNF-α and IFN-γ). •miR-122 promotes the release of anti-inflammatory cytokines (IL-4 and IL-10). •NF-κB signaling pathway is involved in inflammatory response induced by LPS. -- Abstract: Crohn’s disease (CD) is one of the two major types of inflammatory bowel disease (IBD) thought to be caused by genetic and environmental factors. Recently, miR-122 was found to be deregulated in association with CD progression. However, the underlying molecular mechanisms remain unclear. In the present study, the gene nucleotide-binding oligomerization domain 2 (NOD2/CARD15), which is strongly associated with susceptibility to CD, was identified as a functional target of miR-122. MiR-122 inhibited LPS-induced apoptosis by suppressing NOD2 in HT-29 cells. NOD2 interaction with LPS initiates signal transduction mechanisms resulting in the activation of nuclear factor κB (NF-κB) and the stimulation of downstream pro-inflammatory events. The activation of NF-κB was inhibited in LPS-stimulated HT-29 cells pretreated with miR-122 precursor or NOD2 shRNA. The expression of the pro-inflammatory cytokines TNF-α and IFN-γ was significantly decreased, whereas therelease of the anti-inflammatory cytokines IL-4 and IL-10 was increased in LPS-stimulated HT-29 cells pretreated with miR-122 precursor, NOD2 shRNA or the NF-κB inhibitor QNZ. Taken together, these results indicate that miR-122 and its target gene NOD2 may play an important role in the injury of intestinal epithelial cells induced by LPS.

  4. Evaluation of ATC as an Orally Administered Drug in Treatment of Cadmium Toxicity of Rat Organs

    Directory of Open Access Journals (Sweden)

    S. Nabilaldine Fatemi


    Full Text Available The effect of N-tetramethylene dithiocarbamate (ATC as a chelating agent on the excretion of cadmium was evaluated in cadmium-poisoned Wistar rats following administration through food and drink. The present research aimed to characterize the potential efficiency of ATC as an orally administered chelator drug after cadmium administration for 60 days. This chelator significantly enhanced the urinary and biliary excretion of cadmium and restored the altered levels of iron. Cadmium and iron concentrations in different tissues were determined by graphite furnace and flame atomic absorption spectrometry (GF AAS and F AAS methods, respectively. The chelation therapy results show that ATC is able to remove cadmium ions from different tissues while iron concentration returned to the normal level and the clinical symptoms were also reduced. In summary, we conclude that ATC is able to mobilize and promote the excretion of cadmium in rat organs and reduce the side effects and general symptoms of toxicity caused by cadmium and might be useful for preliminary testing of the efficacy of chelating agents in human body. However, these results should be confirmed in different experimental models before extrapolation to other systems. This testing procedure of course does not provide all the relevant answers for evaluating the efficiency of chelating agents in cadmium toxicity.

  5. Prostatic cellular changes after injection of cadmium and lead into rat prostate

    Energy Technology Data Exchange (ETDEWEB)

    Khare, N.; Der, R.; Ross, G.; Fahim, M.


    Forty male rats were divided into four groups. Group I served as control. Group II received 1 mg lead injected into the prostate; Group III received 1 mg cadmium chloride; and Group IV received 0.5 mg lead acetate and 0.5 mg cadmium chloride. The lead caused stone formation in the bladder and calcification of both bladder and prostate; cadmium caused reduction in size and weight of prostate, and histological observation showed marked atrophy of the gland, cuboidal epithelium, and squamous metaplasia in the acini of the prostate; there was no synergistic effect of lead acetate and cadmium chloride when combined at the level administered to Group IV.

  6. Prostatic cellular changes after injection of cadmium and lead into rat prostate. (United States)

    Khare, N; Der, R; Ross, G; Fahim, M


    Forty male rats were divided into four groups. Group I served as control. Group II received 1 mg. lead injected into the prostate; Group III received 1 mg. cadmium chloride; and Group IV received 0.5 mg. lead acetate and 0.5 mg. cadmium chloride. Results indicated that lead caused stone formation in the bladder and calcification of both bladder and prostate; cadmium caused reduction in size and weight of prostate, and histological observation showed marked atrophy of the gland, cuboidal epithelium, and squamous metaplasia in the acini of the prostate; there was no synergistic effect of lead acetate and cadmium chloride when combined at the level administered to Group IV.

  7. Cadmium regulates the expression of the CFTR chloride channel in human airway epithelial cells. (United States)

    Rennolds, Jessica; Butler, Susie; Maloney, Kevin; Boyaka, Prosper N; Davis, Ian C; Knoell, Daren L; Parinandi, Narasimham L; Cormet-Boyaka, Estelle


    Cadmium is a toxic heavy metal ranked seventh on the Priority List of Hazardous Substances. As a byproduct of smelters, cadmium is a prevalent environmental contaminant. It is also a major component of cigarette smoke, and its inhalation is associated with decreased pulmonary function, lung cancer, and chronic obstructive pulmonary disease. Ion channels, including the cystic fibrosis transmembrane conductance regulator (CFTR), play a central role in maintaining fluid homeostasis and lung functions. CFTR is mostly expressed in epithelial cells, and little is known about the effect of cadmium exposure on lung epithelial cell function. We show that exposure to cadmium decreases the expression of the CFTR protein and subsequent chloride transport in human airway epithelial cells in vitro. Impairment of CFTR protein expression was also observed in vivo in the lung of mice after intranasal instillation of cadmium. We established that the inhibitory effect of cadmium was not a nonspecific effect of heavy metals, as nickel had no effect on CFTR protein levels. Finally, we show that selected antioxidants, including alpha-tocopherol (vitamin E), but not N-acetylcysteine, can prevent the cadmium-induced suppression of CFTR. In summary, we have identified cadmium as a regulator of the CFTR chloride channel present in lung epithelial cells. Future strategies to prevent the deleterious effect of cadmium on epithelial cells and lung functions may benefit from the finding that alpha-tocopherol protects CFTR expression and function.

  8. Differences in cadmium transfer from tobacco to cigarette smoke, compared to arsenic or lead

    Directory of Open Access Journals (Sweden)

    J.-J. Piadé


    Full Text Available Arsenic, cadmium and lead levels in tobacco filler and cigarette smoke were determined in a 568-sample worldwide survey. Median tobacco levels for arsenic, cadmium and lead were 237, 769 and 397 ng/g respectively, comparable to those previously reported albeit somewhat lower for lead and cadmium. Median mainstream smoke yields for arsenic, cadmium and lead were <3.75, 18.2, and <12.8 ng/cig. under ISO, and <8.71, 75.1 and <45.7 ng/cig. under Health Canada Intense (HCI smoking regime respectively. In the case of cigarettes with activated carbon, a selective retention of cadmium but not lead or arsenic was observed. This effect was more pronounced under ISO than under HCI smoking regimes. Cadmium selective retention by activated carbon was confirmed by testing specially designed prototype cigarettes and the causes for this selective filtration were investigated. The differences between cadmium, arsenic and lead in terms of their speciation in tobaccos and in cigarette smoke could be related to their distribution in the ash, butt, mainstream (in gas-phase and particulate-phase and sidestream smoke of a smoked cigarette. The possible formation of organometallic cadmium derivatives in the smoke gas-phase is discussed, the presence of which could adequately explain the observed cadmium selective filtration.

  9. Cadmium Increases the Sensitivity of Adolescent Female Mice to Nicotine-Related Behavioral Deficits

    Directory of Open Access Journals (Sweden)

    Philip Adeyemi Adeniyi


    Full Text Available This study investigates spatial and nonspatial working memory, anxiety related behavior, and motor activities in cadmium and/or nicotine exposed female adolescent mice. P28 female adolescent mice (albino strain were divided into four groups of five (n=5 mice each. A set of mice (Nic received subcutaneous nicotine (2.0 mg/kg while a separate set (Cd was treated with 2.0 mg/kg cadmium (subcutaneous. For the combined treatments of cadmium and nicotine, we administered 2.0 mg/kg Nicotine and 2.0 mg/kg of Cd. Subsequently, a separate group of animals (n=5; control received normal saline. The total duration of treatment for all groups was 28 days (P28–P56. At P56, the treatment was discontinued, after which the animals were examined in behavioural tests. Nicotine and cadmium increased the metabolism and food intake in the female adolescent mice. This also corresponded to an increase in weight when compared with the control. However, a combined nicotine-cadmium treatment induced a decline in weight of the animals versus the control. Also, nicotine administration increased the motor function, while cadmium and nicotine-cadmium treatment caused a decline in motor activity. Both nicotine and cadmium induced a reduction in memory index; however, nicotine-cadmium treatment induced the most significant decrease in nonspatial working memory.

  10. Cadmium Malignantly Transforms Normal Human Breast Epithelial Cells into a Basal-like Phenotype



    Background Breast cancer has recently been linked to cadmium exposure. Although not uniformly supported, it is hypothesized that cadmium acts as a metalloestrogenic carcinogen via the estrogen receptor (ER). Thus, we studied the effects of chronic exposure to cadmium on the normal human breast epithelial cell line MCF-10A, which is ER-negative but can convert to ER-positive during malignant transformation. Methods Cells were continuously exposed to low-level cadmium (2.5 μM) and checked in vi...

  11. Cadmium and lead in vegetable and fruit produce selected from specific regional areas of the UK

    Energy Technology Data Exchange (ETDEWEB)

    Norton, Gareth J., E-mail: [School of Biological and Environmental Sciences, University of Aberdeen, Cruickshank Building, St Machar Drive, Aberdeen AB24 3UU (United Kingdom); Deacon, Claire M. [School of Biological and Environmental Sciences, University of Aberdeen, Cruickshank Building, St Machar Drive, Aberdeen AB24 3UU (United Kingdom); Mestrot, Adrien [Soil Science Group, Institute of Geography, Universität Bern, Hallerstrasse 12, 3012 Bern (Switzerland); Feldmann, Joerg [Department of Chemistry, School of Physical Sciences, University of Aberdeen, Meston Building, AB24 3UE (United Kingdom); Jenkins, Paul; Baskaran, Christina [Food Standards Agency, Aviation House, Kingsway, London WC2B 6NH (United Kingdom); Meharg, Andrew A. [Institute for Global Food Security, Queen' s University Belfast, David Keir Building, Malone Road, Belfast BT9 5BN (United Kingdom)


    Cadmium and lead were determined in fruit and vegetable produce (~ 1300 samples) collected from a field and market basket study of locally grown produce from the South-West of Britain (Devon and Cornwall). These were compared with similarly locally grown produce from the North-East of Britain (Aberdeenshire). The concentrations of cadmium and lead in the market basket produce were compared to the maximum levels (ML) set by the European Union (EU). For cadmium 0.2% of the samples exceeded the ML, and 0.6% of the samples exceeded the ML for lead. The location of cadmium and lead in potatoes was performed using laser ablation ICP-MS. All tested samples exhibited higher lead concentrations, and most exhibited increased concentrations of cadmium in the potato skin compared to the flesh. The concentrations of cadmium and lead found in fruits and vegetables sampled during this study do not increase concern about risk to human health. - Highlights: • Cadmium and lead concentrations determined in fruit and vegetable produce • 0.2% of the samples exceeded guideline values for cadmium. • 0.6% of the samples exceeded guideline values for lead. • Higher concentrations of cadmium and lead were found in the skins of potatoes.

  12. Effect of herbal preparation on heavy metal (cadmium) induced antioxidant system in female Wistar rats. (United States)

    Dailiah Roopha, P; Padmalatha, C


    Cadmium is one of the elements found to damage antioxidant systems in mammals. To ameliorate cadmium toxicity and to prevent oxidative stress, natural products may be useful. In Indian ethnobotanical practice, a mixture of 17 herbal products is used to fortify the reproductive system of women after parturition and to reverse ovarian oxidative stress. Oral administration of this extract to rats exposed to cadmium was useful in reversing oxidative stress. Two different doses of cadmium (50 ppm and 200 ppm) were given to Wistar rats aged 45 and 65 days. An herbal extract derived from 17 plants was administered orally every day at a dose level of 200 mg/kg of body weight to the rats exposed to cadmium. A battery of enzymes involved in antioxidant activity in the ovary, including superoxide dismutase (SOD), catalase, glutathione peroxidase (GPx) and glutathione-s-transferase (GST) were measured in the control, cadmium-exposed rats without treatment and in the cadmium-exposed rats treated with herbal extract. The reduction in SOD, catalase, GPx and GST activity after cadmium exposure improved significantly in the rats treated with the herbal extract (p antioxidant enzymes due to cadmium exposure was reversed significantly with herbal extract administration. The synergistic effect of each bioactive compound in different herbal extracts requires further study.

  13. Effects of cadmium on aneuploidy and hemocyte parameters in the Pacific oyster, Crassostrea gigas

    Energy Technology Data Exchange (ETDEWEB)

    Bouilly, Karine [IFREMER, Laboratoire de Genetique et Pathologie, La Tremblade 17390 (France); Gagnaire, Beatrice [IFREMER, Laboratoire de Genetique et Pathologie, La Tremblade 17390 (France); Bonnard, Marc [IFREMER, Laboratoire de Genetique et Pathologie, La Tremblade 17390 (France); Thomas-Guyon, Helene [Laboratoire de Biologie et Environnement Marins, FRE-CNRS, 2727, Universite de La Rochelle, 22 Avenue Michel Crepeau, La Rochelle 17042 (France); Renault, Tristan [IFREMER, Laboratoire de Genetique et Pathologie, La Tremblade 17390 (France); Miramand, Pierre [Laboratoire de Biologie et Environnement Marins, FRE-CNRS, 2727, Universite de La Rochelle, 22 Avenue Michel Crepeau, La Rochelle 17042 (France); Lapegue, Sylvie [IFREMER, Laboratoire de Genetique et Pathologie, La Tremblade 17390 (France)]. E-mail:


    Pacific oysters, Crassostrea gigas, are commonly reared in estuaries where they are exposed to anthropogenic pollution. Much research has been made on the toxicity of cadmium to aquatic organisms because the compound recurrently contaminates their environment. Our study examined the influence of cadmium on aneuploidy level (lowered chromosome number in a percentage of somatic cells) and hemocyte parameters in C. gigas at different stages of life. Adults and juveniles were exposed to two different concentrations of cadmium. The first concentration applied was equivalent to a peak value found in Marennes-Oleron bay (Charente-Maritime, France; 50 ng L{sup -1}) and the second was 10 times higher (500 ng L{sup -1}). Exposure to 50 ng L{sup -1} cadmium caused a significant decrease in the survival time of C. gigas, but exposure to 500 ng L{sup -1} surprisingly affected the survival time positively. Significant differences in aneuploidy level were observed between the cadmium treatments and the control in adults but not in juveniles or the offspring of the adult groups. The effects of cadmium on hemocyte parameters were analyzed by flow cytometry. Several hemocyte parameters increased significantly after 21 days of cadmium exposure and subsequently decreased. Phenoloxidase-like activity, evaluated by spectrophotometry, varied over the time of the experiment and increased after 66 days of contact with 500 ng L{sup -1} cadmium. Taken together, cadmium at environmentally relevant concentrations seems to have only moderate effects on aneuploidy and hemocyte parameters.

  14. Cadmium concentration in three species of freshwater fishes from Keuretoe River, Northern Aceh, Indonesia

    Directory of Open Access Journals (Sweden)

    Muhammad A. Sarong


    Full Text Available The objectives of present study was to evaluate cadmium (Cd concentration in some freshwater fishes found in Keuretoe Rivers and to determine the most effective freshwater fishes (Osphronemus goramy, Anguilla marmorata and Hemibagrus nemurus in accumulating of cadmium. A total of three sampling locations were determined using the purposive of random sampling. A total of three individual fishes at every sampling location were collected, the tissues were processed for Atomic Absorption Spectrophotometry (AAS and data were analyzed by Anova followed by Duncan multiple range test. The result revealed that the cadmium concentration ranges between 0.0064 ppm and 0.0260 ppm. Anova test showed that the sampling locations did not significantly affect the cadmium accumulation in fishes, but the fish species gave significantly effect on the cadmium accumulation in their tissue. The Duncan test showed that high cadmium accumulation was found in gourami at Station 2 and in mottled eel at Station 1, the concentrations were significantly different from Cd content in bagrid catfish at all sampling locations. The higher of cadmium pollution was recorded in Station 3 and gourami accumulated higher cadmium than other fishes studied. Keuretoe River is contaminated with cadmium and the fishes should not be consumed.

  15. Phytoremediation of cadmium by the facultative halophyte plant Bolboschoenus maritimus (L.) Palla, at different salinities. (United States)

    Santos, Márcia S S; Pedro, Carmen A; Gonçalves, Sílvia C; Ferreira, Susana M F


    The cadmium phytoremediation capacity of the halophyte plant Bolboschoenus maritimus (L.) Palla and the influence of water salinity were assessed in a greenhouse experiment, in order to better understand the bioremediation capacity of this plant. Three concentrations of cadmium (0, 50 and 100 μg l(-1)) and four salinity conditions (0, 5, 10 and 20) were chosen to evaluate the cadmium accumulation, in order to test these plants as a potential phytoremediation tool in brackish environments. The cadmium content in water and plants (underground organs, stems and leaves) was analysed with graphite furnace atomic absorption spectrometry. All the plants submitted to salinity 20 and in the three cadmium treatments died. The plants' survival was highest in the lowest salinities, where highest growth and biomasses were also obtained. The plants presented more cadmium content in the rhizomes, followed by stems and even less in leaves. The salt stress of the plants interfered with their cadmium accumulation capacity. The highest cadmium accumulation in the rhizomes occurred at salinity 0, while the salinities 0 and 5 were the most adequate for stems and leaves. The experiment pointed out that B. maritimus represents a good possible intervenient for cadmium bioremediation in freshwater and low salinity brackish water environments, but its use is limited in the habitats of higher salinity.

  16. Structural properties of oxygenated amorphous cadmium telluride thin films

    Energy Technology Data Exchange (ETDEWEB)

    El Azhari, M.Y. [Laboratoire de Physique des Solides et des Couches Minces, Marakech (Morocco). Dept. de Physique; Azizan, M. [Laboratoire de Physique des Solides et des Couches Minces, Marakech (Morocco). Dept. de Physique; Bennouna, A. [Laboratoire de Physique des Solides et des Couches Minces, Marakech (Morocco). Dept. de Physique; Outzourhit, A. [Laboratoire de Physique des Solides et des Couches Minces, Marakech (Morocco). Dept. de Physique; Ameziane, E.L. [Laboratoire de Physique des Solides et des Couches Minces, Marakech (Morocco). Dept. de Physique; Brunel, M. [Laboratoire de Cristallographie, CNRS, Grenoble (France)


    Cadmium telluride (CdTe) thin films were prepared by diode radio-frequency sputtering from polycrystalline CdTe targets in an atmosphere of argon, nitrogen and oxygen. The layers prepared in the presence of nitrogen gas were amorphous and their oxygen contents increased with the partial pressure of nitrogen. The evolution of the composition of the layers as a function of the nitrogen partial pressure during deposition was followed by X-ray photoelectron spectroscopy. It is found that the oxygen is bound to both tellurium and cadmium atoms. The surface of the CdTe thin films was also studied as a function of their exposure time to a plasma containing a mixture of nitrogen and oxygen. It is found that the oxygen contents of the surface increases with increased exposure time. Also, this exposure resulted in an increase of the oxide thickness and a net decrease in the surface roughness of the films. (orig.)


    Directory of Open Access Journals (Sweden)

    Z. O. Lipatova


    Full Text Available Cadmium sulfide quantum dots are perspective materials in optics, medicine, biology and optoelectronics. Fluorophosphate glasses, doped with cadmium sulfide quantum dots, were examined in the paper. Heat treatment led to the formation of quantum dots with diameters equal to 2.8 nm, 3.0 nm and 3.8 nm. In view of such changes in the quantum dots size the fundamental absorption edge shift and the luminescence band are being displaced to the long wavelengths. Luminescence lifetime has been found to be dependent on the registration wavelength in the range from 450 to 700 nm. Obtained fluorophosphate glasses with CdS quantum dots can find their application as fluorescent materials with intensive luminescence band and long excited-state natural lifetime.

  18. Purification of cadmium up to 5N+ by vacuum distillation

    Indian Academy of Sciences (India)

    S T Ali; J V Rao; K S Varma; T L Prakash


    Cadmium was refined by vacuum distillation, a technique suitable for low boiling and melting point materials, to remove the heavy and low vapour pressure impurities at ppm level. The detailed analysis of the purified Cd as well as raw Cd was done by ICP–OES techniques for 27 impurity elements. Purification was carried out in an efficient high-yield vacuum distillation system designed and fabricated for purifying 3N+ purity indigenous cadmium to 5N+ (99.999%). Analysis confirmed the reduction of total impurity content from 134 ppm (3N7) for raw Cd to 3 ppm (5N7) upon vacuum distilled Cd. The present study shows that the analysis of impurities such as Fe, Mg and Ca are contributed from environmental effect, whereas impurities such as Pb, Bi, Ag, Ni, Cu, Zn and Tl require adaptation of elemental analysing technique to counter dilution effect. The Hg trace analysis can however be carried out by hydride generation techniques.

  19. The Cadmium Zinc Telluride Imager on AstroSat

    CERN Document Server

    Bhalerao, V; Vibhute, A; Pawar, P; Rao, A R; Hingar, M K; Khanna, Rakesh; Kutty, A P K; Malkar, J P; Patil, M H; Arora, Y K; Sinha, S; Priya, P; Samuel, Essy; Sreekumar, S; Vinod, P; Mithun, N P S; Vadawale, S V; Vagshette, N; Navalgund, K H; Sarma, K S; Pandiyan, R; Seetha, S; Subbarao, K


    The Cadmium Zinc Telluride Imager (CZTI) is a high energy, wide-field imaging instrument on AstroSat. CZT's namesake Cadmium Zinc Telluride detectors cover an energy range from 20 keV to > 200 keV, with 11% energy resolution at 60 keV. The coded aperture mask attains an angular resolution of 17' over a 4.6 deg x 4.6 deg (FWHM) field of view. CZTI functions as an open detector above 100 keV, continuously sensitive to GRBs and other transients in about 30% of the sky. The pixellated detectors are sensitive to polarisation above ~100 keV, with exciting possibilities for polarisation studies of transients and bright persistent sources. In this paper, we provide details of the complete CZTI instrument, detectors, coded aperture mask, mechanical and electronic configuration, as well as data and products.

  20. Remote sensing applications in evaluation of cadmium pollution effects (United States)

    Kozma-Bognar, Veronika; Martin, Gizella; Berke, Jozsef


    According to the 21st century developments in information technology the remote sensing applications open new perspectives to the data collection of our environment. Using the images in different spectral bands we get more reliable and accurate information about the condition, process and phenomena of the earth surface compared to the traditional aircraft image technologies (RGB images). The effects of particulate pollution originated from road traffic were analysed by the research team of Department of Meteorology and Water Management (University of Pannonia, Georgikon Faculty) with the application of visible, near infrared and thermal infrared remote sensing aircraft images. In the scope of our research was to detect and monitor the effects of heavy metal contamination in plant-atmosphere system under field experiments. The testing area was situated at Agro-meteorological Research Station in Keszthely (Hungary), where maize crops were polluted once a week (0,5 M concentration) by cadmium. In our study we simulated the effects of cadmium pollution because this element is one of the most common toxic heavy metals in our environment. During two growing seasons (2011, 2012) time-series analyses were carried out based on the remote sensing data and parallel collected variables of field measurement. In each phenological phases of plant we took aerial images, in order to follow the changes of the structure and intensity values of plots images. The spatial resolution of these images were under 10x10 cm, which allowed to use a plot-level evaluation. The structural and intensity based measurement evaluation methods were applied to examine cadmium polluted and control maize canopy after data pre-processing. Research activities also focused on the examination of the influence of the irrigation and the comparison of aerial and terrain parameters. As conclusion, it could be determined the quantification of cadmium pollution effects is possible on maize plants by using remote

  1. Microbially Mediated-Precipitation of Cadmium Carbonate Nanoparticles. (United States)

    Kang, Serku; Kim, Yumi; Lee, Youngjae; Rohl, Yul


    The objectives of this study were to investigate the microbially mediated precipitation of cadmium using microorganisms enriched from rhodoliths and to characterize the mineralogical properties of the precipitates. A 16S rRNA sequence analysis showed the enriched microorganisms contained carbonate forming microorganisms such as Proteus mirabilis. The microorganisms mediated Cd-precipitation with Cd-acetate, but no precipitates were formed without the microbes in D-1 medium. XRD analysis showed the precipitates were poorly crystalline Cd-carbonates (CdCO3). SEM and TEM-EDS analyses showed that the Cd-carbonate minerals were irregular in shape, 20-30 nm in size, and composed of C, O, and Cd. Therefore, microbially mediated precipitation of cadmium carbonates could be used as a precursor of CdO nanoparticles and could play an important role in Cd immobilization in Cd-contaminated water as well as CO2 fixation in natural environments.

  2. Synthesis and Structure of Bis(4-nitrobenzaldehyde thiosemicarbazone) Cadmium Iodide

    Institute of Scientific and Technical Information of China (English)


    The title complex, bis(4-nitrobenzaldehyde thiosemicarbazone) cadmium iodide (C16H16CdI2N8O4S2) crystallizes in the triclinic system, space group P1 with a=9.632(2), b=11.227(2), c=14.031(3), α= 67.50(3), β= 86.99(3), γ= 66.64(3)°, V=1278.13, Z = 2, Dc = 2.117gcm-3, F(000) = 772, μ =3.472mm-1 MoKα radiation (λ=0.71073), R = 0.0443, wR= 0.1425 for 4529 observed reflections [I>2σ(I)] of 4731 independent reflections. The result shows that the structure contains CdL2I2 (where L = 4-nitrobenzaldehyde thiosemicarbazone) distorted tetrahedral units in which the two ligands are S-bonded as monodentate to cadmium ion; the two iodide ions are also coordinated to Cd(II).

  3. The Substitution of IVD (Ion Vapor Deposition) Aluminum for Cadmium (United States)


    Additional information on the usage of IVU aluminum in contact with fuels , oils, and other fluids is found in Section VIF). Cadmium coatings are also...RESTRICTIVE MARKINGS UNCLASSIFIED 2a. SECUR :7Y CLASSIFICATION AU7-77RI7 3 DiSTRIBUTION , AVAILABILTY OF REPORT Approved for public release. 2b...FiUURES (CUNTINULD) Figure Pa’te 37 IVO Aluminum-Coated Aluminum Alloy Fuel and Pneumatic Line Fittings ............ ............................ 7b 38

  4. Cadmium in fertilizers, soil, crops and foods - the Swedish situation

    Energy Technology Data Exchange (ETDEWEB)

    Hellstrand, S.; Landner, L. [Swedish Environmental Research Group (MFG)


    The aim of this report is to review available information on the fluxes of cadmium (Cd) to agricultural soils and crops in Sweden from phosphorus fertilizers (P-fertilizer) and other sources, and to discuss how the content of Cd in soil, crops and human food may be influenced by the specific environmental conditions in Sweden, as well as by the agricultural practices used in the country 62 refs, 15 figs, 18 tabs. With 5 page summary in Swedish

  5. Capacity fade in nickel cadmium and nickel hydrogen cells (United States)

    Edgar, Tim; Hayden, Jeff; Pickett, David F.; Abrams-Blakemore, Bruce; Liptak, ED


    Research and operational experience with capacity fade in nickel cadmium and nickel hydrogen cells are summarized in outline form. The theoretical causes of capacity fade are reviewed and the role of cell storage, positive electrodes, and cobalt additives are addressed. Three examples of observed capacity fade are discussed: INTELSAT 5, INTELSAT 6, and an Explorer platform. Finally, prevention and recovery methods are addressed and the current status of Eagle Picher/Hughes research is discussed.

  6. Gamma-ray peak shapes from cadmium zinc telluride detectors

    Energy Technology Data Exchange (ETDEWEB)

    Namboodiri, M.N.; Lavietes, A.D.; McQuaid, J.H.


    We report the results of a study of the peak shapes in the gamma spectra measured using several 5 x 5 x 5 mm{sup 3} cadmium zinc telluride (CZT) detectors. A simple parameterization involving a Gaussian and an exponential low energy tail describes the peak shapes sell. We present the variation of the parameters with gamma energy. This type of information is very useful in the analysis of complex gamma spectra consisting of many peaks.

  7. Remediation of lead and cadmium-contaminated soils. (United States)

    Salama, Ahmed K; Osman, Khaled A; Gouda, Neama Abdel-Razeek


    The research was designated to study the ability of plants to bio-accumulate, translocate and remove the heavy metals, lead and cadmium from contaminated soil. The herbal plant ryegrass, Lolium multiflorum was investigated as a bio-accumulator plant for these metals. The translocation of these heavy metals in the herbal plant was compared considering root to shoot transport and redistribution of metals in the root and shoot system. The trace metal contents from root and shoot parts were determined using atomic absorption spectrometer. The results showed that the percent of lead and cadmium transferred to ryegrass plant were averaged as 51.39, and 74.57%, respectively, while those remained in the soil were averaged as 48.61 and 25.43% following 60 days of treatment. The soil-plant transfer index in root and shoot system of ryegrass was found to be 0.32 and 0.20 for lead, and 0.50 and 0.25 for cadmium. These findings indicated that the herbal plant ryegrass, Lolium multiflorum is a good accumulator for cadmium than lead. The soil-plant transfer factor (the conc. of heavy metal in plant to the conc. in soil) indicated that the mechanism of soil remedy using the investigated plant is phytoextraction where the amounts of heavy metals transferred by plant roots into the above ground portions were higher than that remained in the soil. The method offers green technology solution for the contamination problem since it is effective technology with minimal impact on the environment and can be easily used for soil remedy.

  8. Towards Reduced Nickel-Cadmium Battery Cost for Micro Satellites



    This paper presents the two Nickel-Cadmium technologies offered by Saft for satellites applications: the space-qualified VOS prismatic cells designed for long term LEO and GEO missions, and the VRE cylindrical cell devoted to launcher activities and to short life LEO missions for mini and micro satellites. It also details Saft's effort to minimize the cost for these cells - in strict compliance with customer's specification and without any changes to the existing product manufacturing process.

  9. Cadmium-induced nephrotoxicity: from defense strategy to acclimation




    Cadmium (Cd) indirectly induces reactive oxygen species (ROS) by (1) a displacement of redox-active metals, (2) depletion of redox scavengers, (3) inhibition of anti-oxidant enzymes and (4) inhibition of the electron transport chain. This ultimately results in mitochondrial damage leading to loss of function or cell death in multiple organs. A disturbance of the redox balance by Cd at the cellular level has been studied repeatedly in different experimental set-ups including differentiated cel...

  10. Effect of Cadmium on the growth of Spirulina maxima (Arthrospira)

    Energy Technology Data Exchange (ETDEWEB)

    Torres-Munoz, J. A.; Aguilar-Lopez, R.; Hernandez-Villagran, D.; Neria-Gonzalez, M. I.; Rios-Leal, E.; Dominguez-Bocanegra, A. R.


    The removal of heavy metal by microorganisms can occur through several mechanisms, such as simple adsorption, absorption, enzymatic synthesis or through the production of extracellular polymers. Cadmium (CD), a metal released in most mining and metallurgical processes, is one of the main agents responsible for water pollution. In spite of the increasing amount of research published on the interaction of microorganisms with heavy metals, few work describe this interaction with cyanobacteria. (Author)

  11. Role of oxidative stress in cadmium toxicity and carcinogenesis



    Cadmium (Cd) is a toxic metal, targeting the lung, liver, kidney, and testes following acute intoxication, and causing nephrotoxicity, immunotoxicity, osteotoxicity and tumors after prolonged exposures. Reactive oxygen species (ROS) are often implicated in Cd toxicology. This minireview focused on direct evidence for the generation of free radicals in intact animals following acute Cd overload and discussed the association of ROS in chronic Cd toxicity and carcinogenesis. Cd-generated superox...

  12. Protein synthesis in cadmium- and pentachlorophenol-tolerant Euglena gracilis

    Energy Technology Data Exchange (ETDEWEB)

    Barque, J.P.; Abahamid, A.; Chacun, H. [Laboratoire de Metabolism Cellulaire et Xenobiotiques, Chatenay-Malabry (France)] [and others


    This work is a preliminary characterization of two adapted Euglena gracilis cell lines, one to cadmium and the other to pentachlorophenol. Growth curve analysis indicate that tolerance to one pollutant did not protect against the second pollutant. These suggest that metabolic pathways that are induced by one pollutant are specific for this pollutant. This specificity is detectable at the level of gene expression. 16 refs., 6 figs.

  13. 122例急性布鲁菌病患者血培养临床分析%Clinical analysis of 122 acute brucellosis patients' blood culture

    Institute of Scientific and Technical Information of China (English)

    刘卫华; 李福兴; 陈哲; 刘长民


    目的 分析急性布鲁菌病(简称布病)患者血培养结果和菌种分型,确定感染种型,进一步探讨布病患者临床表现及治疗效果.方法 选取2012、2013年在黑龙江省农垦总局总医院住院的122例(男性83例、女性39例)急性布病患者,年龄在6 ~ 73岁,平均年龄36.5岁.所有患者行血培养、血清学检查,并给予氨基糖苷类、喹诺酮类、头孢类抗生素治疗.结果 122例布病患者血培养均为羊种布鲁菌,其中羊种3型104例,羊种1型18例.所有受试者的血清学虎红平板凝集试验(rose bengal plate agglutination test,RBPT)均为阳性;血清试管凝集试验(serum tube agglutination test,SAT)各个效价在羊种1型和3型均匀分布,羊种1型主要集中在1∶800效价区,羊种3型主要集中在1∶400效价区;羊种1型与羊种3型的抗人球蛋白及半胱氨酸分布趋势相似,抗人球蛋白主要集中在1∶800效价区,半胱氨酸主要集中在1∶40效价区.所有患者均有典型的布病症状,并发症多(如脊柱炎、中毒性肝炎等).122例急性布病患者经治疗112例痊愈,10例好转.结论 黑龙江省人间布病由羊种菌1、3型引起,临床症状重且并发症多,早期诊断、早期治疗才能得到显著治疗效果.%Objective By studying the acute brucellosis patients' blood culture and the bacteria strains,we tried to confirm the bacteria strains,and to further explore the symptoms and the results of the treatment.Methods Totally 122 acute brucellosis patients were selected,who were in hospital in Heilongjiang Provincial Nongken General Hospital from 2012 to 2013.The patients aged 6-73 years old,whose average age was 36.5(including 83 males and 39 females).All of the subjects were detected in the aspects of blood culture and brucellosis serology,all of whom were treated with aminoglycoside,4-quinolones and cephalosporins.Results All the subjects were Brucella melitensis biovar,of which 104 were Brucella melitensis biovar

  14. Cytogenetic effects of cadmium accumulation on water hyacinth (Eichhornia crassipes)

    Energy Technology Data Exchange (ETDEWEB)

    Rosas, I.; Carbajal, M.E.; Gomez-Arroyo, S.; Belmont, R.; Villalobos-Pietrini, R.


    Cadmium was bioassayed to observe cytogenetic effects in the water hyacinth (Eichhornia crassipes). Plants were exposed for 96 hr to freshwater containing 0.01, 0.05, 0.10, 1, 5, and 10 mg/liter of cadmium. Metal concentrations in tissues were determined by atomic absorption spectrophotometry. The highest level was found in roots, thus root-tip cells were used for cytogenetic studies; after 24 hr of exposure, micronuclei, c-mitotic effects, and pycnosis were detected and after 48 hr polyploidy was observed. A linear relationship between frequencies of micronuclei and cadmium concentrations was found; at 1, 5, and 10 mg/liter micronuclei numbers were always the lowest. The inhibition of cell proliferation, shown by the low mitotic index, was proportional to the concentration and time of exposure. From the results presented in this paper it may be concluded that water hyacinth is a good sensor, due to its fast rate of metal accumulation, which allows an easy way to determine the presence of potential mutagenic compounds in water. 63 references.

  15. Variation in electrical properties of gamma irradiated cadmium selenate nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Chauhan, R.P., E-mail:; Rana, Pallavi, E-mail:; Narula, Chetna; Panchal, Suresh; Choudhary, Ritika


    Preparation of low-dimensional materials attracts more and more interest in the last few years, mainly due to the wide field of potential commercial applications ranging from life sciences, medicine and biotechnology to communication and electronics. One-dimensional systems are the smallest dimension structures that can be used for efficient transport of electrons and thus expected to be critical to the function and integration of nanoscale devices. Nanowires with well controlled morphology and extremely high aspect ratio can be obtained by replicating a nanoporous polymer ion-track membrane with cylindrical pores of controlled dimensions. With this technique, materials can be deposited within the pores of the membrane by electrochemical reduction of the desired ion. In the present study, cadmium selenate nanowires were synthesized potentiostatically via template method. These synthesized nanowires were then exposed to gamma rays by using a {sup 60}Co source at the Inter University Accelerator Centre, New Delhi, India. Structural, morphological, electrical and elemental characterizations were made in order to analyze the effect of gamma irradiation on the synthesized nanowires. I–V measurements of cadmium selenate nanowires, before and after irradiation were made with the help of Keithley 2400 source meter and Ecopia probe station. A significant change in the electrical conductivity of cadmium selenate nanowires was found after gamma irradiation. The crystallography of the synthesized nanowires was also studied using a Rigaku X-ray diffractrometer equipped with Cu-Kα radiation. XRD patterns of irradiated samples showed no variation in the peak positions or phase change.

  16. Adsorption of cadmium(II) on waste biomaterial. (United States)

    Baláž, M; Bujňáková, Z; Baláž, P; Zorkovská, A; Danková, Z; Briančin, J


    Significant increase of the adsorption ability of the eggshell biomaterial toward cadmium was observed upon milling, as is evidenced by the value of maximum monolayer adsorption capacity of 329mgg(-1), which is markedly higher than in the case of most "green" sorbents. The main driving force of the adsorption was proven to be the presence of aragonite phase as a consequence of phase transformation from calcite occurring during milling. Cadmium is adsorbed in a non-reversible way, as documented by different techniques (desorption tests, XRD and EDX measurements). The optimum pH for cadmium adsorption was 7. The adsorption process was accompanied by the increase of the value of specific surface area. The course of adsorption has been described by Langmuir, Freundlich and Dubinin-Radushkevich isotherms. The adsorption kinetics was evaluated using three models, among which the best correlation coefficients and the best normalized standard deviation values were achieved for the pseudo-second order model and the intraparticle diffusion model, respectively.

  17. Variation in electrical properties of gamma irradiated cadmium selenate nanowires (United States)

    Chauhan, R. P.; Rana, Pallavi; Narula, Chetna; Panchal, Suresh; Choudhary, Ritika


    Preparation of low-dimensional materials attracts more and more interest in the last few years, mainly due to the wide field of potential commercial applications ranging from life sciences, medicine and biotechnology to communication and electronics. One-dimensional systems are the smallest dimension structures that can be used for efficient transport of electrons and thus expected to be critical to the function and integration of nanoscale devices. Nanowires with well controlled morphology and extremely high aspect ratio can be obtained by replicating a nanoporous polymer ion-track membrane with cylindrical pores of controlled dimensions. With this technique, materials can be deposited within the pores of the membrane by electrochemical reduction of the desired ion. In the present study, cadmium selenate nanowires were synthesized potentiostatically via template method. These synthesized nanowires were then exposed to gamma rays by using a 60Co source at the Inter University Accelerator Centre, New Delhi, India. Structural, morphological, electrical and elemental characterizations were made in order to analyze the effect of gamma irradiation on the synthesized nanowires. I-V measurements of cadmium selenate nanowires, before and after irradiation were made with the help of Keithley 2400 source meter and Ecopia probe station. A significant change in the electrical conductivity of cadmium selenate nanowires was found after gamma irradiation. The crystallography of the synthesized nanowires was also studied using a Rigaku X-ray diffractrometer equipped with Cu-Kα radiation. XRD patterns of irradiated samples showed no variation in the peak positions or phase change.

  18. Environmental renal disease: Lead, cadmium and Balkan endemic nephropathy

    Energy Technology Data Exchange (ETDEWEB)

    Wedeen, R.P. (VA Medical Center, East Orange, NJ (United States))


    The similarity of lead and cadmium nephropathy to Balkan endemic nephropathy warrants careful reevaluation of the possibility that these nephrotoxic metals contribute to the production of the endemic renal disease. Low-level environmental exposure may result in a relationship between the concentration of the metals in tissue storage sites and biological fluids that differs from that encountered after occupational exposure. Urine and blood concentrations may therefore be inadequate measures of exposure. Lead is accumulated in the skeleton and cadmium in the liver and kidneys with biological half lives approximating a decade. Non-invasive in vivo x-ray fluorescence or neutron activation analysis can therefore be used to measure cumulative tissue stores. Multiple regression analysis of epidemiologic data could reveal the relative contribution of causal factors, including lead and cadmium, and help to distinguish Balkan endemic nephropathy from other renal diseases using rigorous diagnostic criteria. As long as Balkan endemic nephropathy remains a diagnosis of exclusion, the accuracy of the diagnosis of other renal disease determines the reliability of identification of the endemic disease.31 references.

  19. Cadmium concentration in biological media of breast cancer patients. (United States)

    Strumylaite, Loreta; Bogusevicius, Algirdas; Abdrachmanovas, Olegas; Baranauskiene, Dale; Kregzdyte, Rima; Pranys, Darius; Poskiene, Lina


    The study aimed to determine and compare cadmium (Cd) concentration in different biological media of breast cancer and benign breast tumor patients. Concentration of Cd was determined in breast tissue, urine, and blood of 57 breast cancer and 51 benign tumor patients. Two samples of breast tissue from each patient, i.e., tumor and healthy tissue were taken for the analysis. Cd in biological media was determined by atomic absorption spectrometry (Perkin-Elmer, Zeeman 3030). The mean Cd concentration in breast cancer patients was 0.053 μg/g (95% confidence intervals, CI 0.042-0.065) for tumor sample and 0.02 μg/g (95% CI 0.014-0.026) for healthy breast tissue sample (P 0.05). Cd content in malignant tumor significantly differed from that in benign tumor (P Cancer patients with positive estrogen receptors (ERs) had significantly greater concentration of breast tissue Cd compared to patients with negative ERs (P = 0.035). Adjusted for creatinine, Cd in urine was significantly higher in cancer patients than in controls (P cancer patients, a positive Spearman's correlation was found between Cd in tumor and healthy breast tissue, blood (r = 0.44 and r = 0.39, respectively, P cancer patients and number of cigarettes smoked during lifetime was suggestive (r = 0.59, P = 0.075). The data obtained show higher concentration of cadmium in breast tumor and urine of cancer patients and support a possible relationship between cadmium and breast cancer.

  20. Thyrotoxicity of the Chlorides of Cadmium and Mercury in Rabbit

    Institute of Scientific and Technical Information of China (English)



    Exposure to heavy metals such as cadmium and mercury is of immediate environmental concern.The present study was aimed at establishing a direct relationship between heavy metal poisoning and thyroid dysfunction.Cadmium and mercury treatment at LD50 levels resulted in severe thyrotoxicosis in the rabbit.Within 24h of intramuscular administration of cadmium chloride 15 mg·kg-1 body weight(bw)and mercury chloride20mg·kg-1 bw,thyroid peroxidase activity increased significantly over the control with a concomitant rise in the triiodothyronie(T3)titre.On the other hand,there was a remarkable fall in the thyroxine(T4)level,and the T3,T4 ratio was high as compared with the control.Evidence indicates that acute heavy metal lethality will induce immediate hyperthyroidism.It is suggested that T3-toxicosis may be produced by a preferential synthesis of T3 and/or preferential deiodination of T4 to T3.Measurement of T3 and T4 levels may thus e utilized as a reliable indicator of heavy metal lethality.