WorldWideScience

Sample records for cadmium 109 target

  1. Radiochemical separation of cadmium-109

    International Nuclear Information System (INIS)

    Egamediev, S.; Mukhtarov, A.; Nurbaeva, D.; Rakhmanov, A.

    2006-01-01

    Full text: Cadmium-109 has a half-life of 461.9 days and decays by electron capture to 109 Ag with the emission of 88 keV γ-ray (3.79%) along with the characteristic X-ray from the K level of Ag, with energy of 22.5 keV. This radionuclide has found widespread use as a photon source in x-ray fluorescence analysis devices employed in industry for numerous applications such as the direct determination of gold in ores, the analysis of metals and identification of steels. Other applications range from its use as an electron source for measurement of densities of air-pollution samples, to tracer studies in mushrooms and mice and rats. In the nuclear medicine field there is growing interest in employing 109 Cd in a 109 Cd/ 109mA g generator, as an alternative to other biomedical generators of ultra short-lived gamma emitters. There are several methods for the production of 109 Cd in literature: 1. Bombardment of silver cyclotron target via 109 Ag(d,2n) 109 Cd reaction with 16 MeV deuterons. 2. Bombardment of natural silver target via 109 Ag(p,n) 109 Cd reaction with 14 MeV protons. 3. Proton bombardment of natural indium target with 96 MeV protons. 4. Irradiation of enriched 107 Ag target in high-flux nuclear reactor at neutron flux 2x10 15 n·cm -2 ·s -1 via 107 Ag(n,γ) 108 Ag → 108 Cd (n,γ) 109 Cd reaction. 5. Irradiation of enriched 108 Cd target in nuclear reactor at neutron flux 1x10 14 n·cm -2 ·s -1 via 108 Cd (n,γ) 109 Cd reaction. The production of 109 Cd with proton beam via 109 Ag(p,n) 109 Cd reaction is ideal for the cyclotron U-150, since it is not required the change of the regime for the machine functioning. Because of its relatively long half-life the time required for separation is also not an important factor, but its use as an X-ray source requires a very high radiochemical purity. In the present work we studied two methods for separation of 109 Cd from model solution of silver targets. First method is based on precipitation of silver as

  2. Liquid scintillation counting analysis of cadmium-109

    International Nuclear Information System (INIS)

    Robinson, M.K.; Barfuss, D.W.

    1991-01-01

    Recently the authors have used radiolabled cadmium-109 to measure the transport of inorganic cadmium in renal proximal tubules. An anomaly discovered in the liquid scintillation counting analysis of Cd-109 which is not attributable to normal decay; it consists of a significant decrease in the measured count rate of small amounts of sample. The objective is to determine whether the buffer solution used in the membrane transport studies is causing precipitation of the cadmium or whether cadmium is being adsorbed by the glass. It was important to determine whether the procedure could be modified to correct this problem. The problem does not appear to be related to the use of the buffer or to adsorption of Cd onto glass. Correction based on using triated L-glucose in all of these experiments and calculating a correction factor for the concentration of cadmium

  3. Identification of the cadmium binding compounds in Agaricus arvensis hyphae using 109Cd

    International Nuclear Information System (INIS)

    Jackl, G.A.; Kollmer, W.E.; Reidel, G.

    1987-01-01

    Hyphae from the edible mushroom Agaricus arvensis were grown in a liquid medium supplemented with 1 mg cadmium per litre. The heavy metal had no influence on the growth of the fungus at this concentration. Cell extracts were labeled in vitro with radioactive 109 Cd. Cadmium was found in two main fractions having apparent molecular weights of about 500 and 1500 dalton. These fractions were identified by chemical analysis of cadmium as well as by radioactive labeling. The in vitro labeling procedure with radioactive cadmium is a more rapid procedure than analyzing the element in the original sample. (author)

  4. Effect of altered thyroid states on the distribution of intraperitoneally injected cadmium-109 in rats

    International Nuclear Information System (INIS)

    Mann, S.J.

    1975-01-01

    Metals bind to proteins in the blood and are transported in this bound state. The synthesis of proteins is altered in disease states. There may be an increase, a decrease, or a change in the protein fraction makeup, depending on the type and severity of the disease. Total protein synthesis is increased in hyperthyroidism; decreased in hypothyroidism. These changes alter the uptake and distribution of minerals and metals. This study was designed to determine the effect of altered thyroid states on the distribution of cadmium, a toxic environmental pollutant, in rats. The main experiment consisted of injecting rats with Cd-109 after 15 days of drug pretreatment for induction of hypothyroidism and hyperthyroidism. Cadmium levels in the samples were expressed as percentage of activity per organ (P) and percentage of activity per gram of tissue (A). The results showed that drug treatment affected organ weights. Hypothyroid livers weighed significantly less than hyperthyroid and euthyroid livers. Kidney and spleen weights of all three treatment groups were significantly different from each other. Those of hypothyroid rats weighed the least; those of hyperthyroid rats weighed the most. Expressed as P values, livers of the three treatment groups were not different, but hyperthyroid kidneys and spleens had significantly higher levels of cadmium. The A values of hypothyroid livers, kidneys, and spleens were higher than those of the other two treatment groups. Bone, muscle, testes, and blood samples showed extensive variability, and for this reason statistical analyses were not run. There were trends, but it was evident that the overall treatment effects on cadmium levels in these tissues were negligible

  5. Separation of no-carrier-added 107,109Cd from proton induced silver target. Classical chemistry still relevant

    International Nuclear Information System (INIS)

    Moumita Maiti; Susanta Lahiri; Tomar, B.S.

    2011-01-01

    The classical chemistry like precipitation technique is relevant even in modern days trans-disciplinary research from the view point of green chemistry. A definite demand of no-carrier-added (nca) cadmium tracers, namely, 107,109 Cd, has been realized for diverse applications. Development of efficient separation technique is therefore important to address the purity of the tracers for various applications. No-carrier-added 107,109 Cd radionuclides were produced by bombarding natural silver target matrix with 13 MeV protons, which gave ∼15 MBq/μA h yield for nca 107 Cd. The nca cadmium radionuclides were separated from the natural silver target matrix by precipitating Ag as AgCl. The developed method is an example wherein green chemistry is used in trans-disciplinary research. The method is also simple, fast, cost effective and environmentally benign. (author)

  6. Experimental study, in rat wistar, of cadmium distribution and elimination as a function of administration route. Cadmium 109 maximum permissible concentration

    International Nuclear Information System (INIS)

    Valero, Marc.

    1979-01-01

    The absorption and the elimination of cadmium have been investigated in rats wistar after oral administration or after inhalation. Before studying gastro-intestinal absorption, it appeared necessary to precise acute toxicity of orally administred cadmium. The distribution of cadmium within organes was determined following a single or multiple oral doses, and we specially studied retention of a Cd dose ingested after several weeks of treatment with Cd-Acetate. Pulmonary and gastro-intestinal absorption of cadmium after ihalation of Cd-microparticles were studied. Data obtained from these studies on rats and extrapolated to man were used to calculate mximum permissible concentration (M.P.C.) of Cd-109 in water and in air [fr

  7. Gut as a target for cadmium toxicity.

    Science.gov (United States)

    Tinkov, Alexey A; Gritsenko, Viktor A; Skalnaya, Margarita G; Cherkasov, Sergey V; Aaseth, Jan; Skalny, Anatoly V

    2018-04-01

    The primary objective of the present study was to review the impact of Cd exposure on gut microbiota and intestinal physiology, as well as to estimate whether gut may be considered as the target for Cd toxicity. The review is based on literature search in available databases. The existing data demonstrate that the impact of Cd on gut physiology is two-sided. First, Cd exposure induces a significant alteration of bacterial populations and their relative abundance in gut (increased Bacteroidetes-to-Firmicutes ratio), accompanied by increased lipopolysaccharide (LPS) production, reflecting changed metabolic activity of the intestinal microbiome. Second, in intestinal wall Cd exposure induces inflammatory response and cell damage including disruption of tight junctions, ultimately leading to increased gut permeability. Together with increased LPS production, impaired barrier function causes endotoxinemia and systemic inflammation. Hypothetically, Cd-induced increase gut permeability may also result in increased bacterial translocation. On the one hand, bacteriolysis may be associated with aggravation of endotoxemia. At the same time, together with Cd-induced impairment of macrophage inflammatory response, increased bacterial translocation may result in increased susceptibility to infections. Such a supposition is generally in agreement with the finding of higher susceptibility of Cd-exposed mice to infections. The changed microbiome metabolic activity and LPS-induced systemic inflammation may have a significant impact on target organs. The efficiency of probiotics in at least partial prevention of the local (intestinal) and systemic toxic effects of cadmium confirms the role of altered gut physiology in Cd toxicity. Therefore, probiotic treatment may be considered as the one of the strategies for prevention of Cd toxicity in parallel with chelation, antioxidant, and anti-inflammatory therapy. Copyright © 2018 Elsevier Ltd. All rights reserved.

  8. Early actions of cadmium in the rat and domestic fowl testis. II. Distribution of injected /sup 109/cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, A D; Miller, W J

    1970-01-01

    Male rats and domestic fowl were injected with /sup 109/Cd. After anaesthesia, blood was taken from the exposed heart and also various tissues were taken. The level of /sup 109/Cd was determined in each tissue. In rats injected subcutaneously, there was a steady increase in the level of /sup 109/Cd for 40 min, followed by a drop in the whole testis, seminal vesicles, epididymis, skeletal muscle, heart, spleen, pancreas and liver. In the blood, the maximum level of /sup 109/Cd was reached at 10 min and dropped rapidly. In the ileum, duodenum, and kidney there was an increase for 80 min. In most tissues of the intraperitoneally-injected rats, /sup 109/Cd reached the highest level at 2.5 min and tended to decrease thereafter. The amount of /sup 109/Cd in the blood reached a peak at 5 min and then dropped. Liver levels rose continually, while in the kidney, ileum and duodenum, levels rose for 40 min, then tended to drop. In most tissues of the fowl, including the blood, the level of /sup 109/Cd rose gradually and dropped gradually. Levels in the kidney and liver showed a continual increase. 17 references, 6 figures.

  9. Cadmium-109 uptake by tumors derived from Balb C/3T3 cell lines with varying degrees of the transformed phenotype

    International Nuclear Information System (INIS)

    Morton, K.; Alazraki, N.; Winge, D.; Lynch, R.E.

    1986-01-01

    To determine if tumors are rich in metallothionein, the authors measured the vivo uptake of subcutaneously-injected carrier-free cadmium-109 in tumors and in normal tissues of Balb/C mice. The tumors were grown in the mice from cultured Balb/3T3 cells transformed by the Moloney murine sarcoma virus. Uptake of cadmium-109 per gram of tissue was greatest for liver, kidney, and spleen. However, tumor uptake of cadmium-109 was markedly greater than that in blood, skeletal muscle, bones, intestine or adipose tissue. B Sephadex G-75 chromatography, the radioactivity in tumor and in liver lysates eluted with cytochrome-C, a molecule similar in molecular weight to metal-lothionein. To determine if metallothionein levels are related to the degree of malignancy of tumors, cadmium-109 uptake in the tumors from the virally-transformed cells was compared to that in tumors from non-transformed Balb/3T3 cells and two derivative chemically transformed cell lines. There was strong correlation between the substrate-independent growth in soft agarose of the four cell lines, the rate of growth of the corresponding tumors, and the amount of cadmium-109 uptake in the tumors. The authors conclude that metallothionein levels may be elevated in tumors as a function of the degree of expression of the transformed phenotype

  10. Bioaccumulation and partitioning of cadmium within the freshwater mussel Dreissena polymorpha Pallas. [Using /sup 109/Cd and /sup 115/Cd as tracers

    Energy Technology Data Exchange (ETDEWEB)

    Bias, R.; Karbe, L. (Hamburg Univ. (Germany, F.R.))

    1985-01-01

    Kinetics of uptake, partitioning and elimination of cadmium were investigated in experimental studies with the freshwater mussel, Dreissena polymorpha. /sup 109/Cd and /sup 115/Cd were used as tracers. Shells, soft parts and body fluid of the mussel exhibited considerable differences in accumulation and elimination. Accumulation factors up to more than 70,000 were calculated for the periostracum, whereas accumulation factors for the whole mussels ranging up to 3,000 were calculated. The shells bound a great deal of cadmium, but only loosely, and the metal could be readily eliminated after transfer to uncontaminated water. In contrast, no significant amounts of the cadmium incorporated in the soft parts were eliminated. The results indicate that the major portion of cadmium in the soft parts is strongly bound and cannot be eliminated by exchange processes.

  11. DNA repair systems as targets of cadmium toxicity

    International Nuclear Information System (INIS)

    Giaginis, Constantinos; Gatzidou, Elisavet; Theocharis, Stamatios

    2006-01-01

    Cadmium (Cd) is a heavy metal and a potent carcinogen implicated in tumor development through occupational and environmental exposure. Recent evidence suggests that proteins participating in the DNA repair systems, especially in excision and mismatch repair, are sensitive targets of Cd toxicity. Cd by interfering and inhibiting these DNA repair processes might contribute to increased risk for tumor formation in humans. In the present review, the information available on the interference of Cd with DNA repair systems and their inhibition is summarized. These actions could possibly explain the indirect contribution of Cd to mutagenic effects and/or carcinogenicity

  12. EDXRF analysis of Straits Chinese porcelains for zirconium and niobium using a cadmium-109 source

    International Nuclear Information System (INIS)

    Yap, C.T.

    1986-01-01

    An annular Cd-109 source was used to induce fluorescent X-rays from 37 pieces of Straits Chinese porcelain of which four were modern pieces and the rest were produced from the nineteenth century up to the Republic period (1912-1939). Experimental data show that for zirconium and niobium infinite thickness is reached for a thickness of about 1.5 mm. A plot of the intensity of the K/sub α/ 1 line of Zr against that of Nb shows that all Ch'ing and Republic pieces cluster together and are quite distinct from the modern pieces, allowing easy nondestructive identification of modern fakes

  13. Microphthalmia-associated transcription factor as the molecular target of cadmium toxicity in human melanocytes

    International Nuclear Information System (INIS)

    Chantarawong, Wipa; Takeda, Kazuhisa; Sangartit, Weerapon; Yoshizawa, Miki; Pradermwong, Kantimanee; Shibahara, Shigeki

    2014-01-01

    Highlights: • In human melanocytes, cadmium decreases the expression of MITF-M and tyrosinase and their mRNAs. • In human melanoma cells, cadmium decreases the expression of MITF-M protein and tyrosinase mRNA. • Expression of MITF-H is less sensitive to cadmium toxicity in melanocyte-linage cells. • Cadmium does not decrease the expression of MITF-H in retinal pigment epithelial cells. • MITF-M is the molecular target of cadmium toxicity in melanocytes. - Abstract: Dietary intake of cadmium is inevitable, causing age-related increase in cadmium accumulation in many organs, including hair, choroid and retinal pigment epithelium (RPE). Cadmium has been implicated in the pathogenesis of hearing loss and macular degeneration. The functions of cochlea and retina are maintained by melanocytes and RPE, respectively, and the differentiation of these pigment cells is regulated by microphthalmia-associated transcription factor (MITF). In the present study, we explored the potential toxicity of cadmium in the cochlea and retina by using cultured human melanocytes and human RPE cell lines. MITF consists of multiple isoforms, including melanocyte-specific MITF-M and widely expressed MITF-H. Levels of MITF-M protein and its mRNA in human epidermal melanocytes and HMV-II melanoma cells were decreased significantly by cadmium. In parallel with the MITF reduction, mRNA levels of tyrosinase, the key enzyme of melanin biosynthesis that is regulated by MITF-M, were also decreased. In RPE cells, however, the levels of total MITF protein, constituting mainly MITF-H, were not decreased by cadmium. We thus identify MITF-M as the molecular target of cadmium toxicity in melanocytes, thereby accounting for the increased risk of disability from melanocyte malfunction, such as hearing and vision loss among people with elevated cadmium exposure

  14. Microphthalmia-associated transcription factor as the molecular target of cadmium toxicity in human melanocytes

    Energy Technology Data Exchange (ETDEWEB)

    Chantarawong, Wipa [Department of Molecular Biology and Applied Physiology, Tohoku University School of Medicine, Sendai (Japan); Inter Departmental Multidisciplinary Graduate Program in Bioscience, Faculty of Science, Kasetsart University, Bangkok (Thailand); Takeda, Kazuhisa; Sangartit, Weerapon; Yoshizawa, Miki [Department of Molecular Biology and Applied Physiology, Tohoku University School of Medicine, Sendai (Japan); Pradermwong, Kantimanee [Department of Zoology, Faculty of Science, Kasetsart University, Bangkok (Thailand); Shibahara, Shigeki, E-mail: shibahar@med.tohoku.ac.jp [Department of Molecular Biology and Applied Physiology, Tohoku University School of Medicine, Sendai (Japan)

    2014-11-28

    Highlights: • In human melanocytes, cadmium decreases the expression of MITF-M and tyrosinase and their mRNAs. • In human melanoma cells, cadmium decreases the expression of MITF-M protein and tyrosinase mRNA. • Expression of MITF-H is less sensitive to cadmium toxicity in melanocyte-linage cells. • Cadmium does not decrease the expression of MITF-H in retinal pigment epithelial cells. • MITF-M is the molecular target of cadmium toxicity in melanocytes. - Abstract: Dietary intake of cadmium is inevitable, causing age-related increase in cadmium accumulation in many organs, including hair, choroid and retinal pigment epithelium (RPE). Cadmium has been implicated in the pathogenesis of hearing loss and macular degeneration. The functions of cochlea and retina are maintained by melanocytes and RPE, respectively, and the differentiation of these pigment cells is regulated by microphthalmia-associated transcription factor (MITF). In the present study, we explored the potential toxicity of cadmium in the cochlea and retina by using cultured human melanocytes and human RPE cell lines. MITF consists of multiple isoforms, including melanocyte-specific MITF-M and widely expressed MITF-H. Levels of MITF-M protein and its mRNA in human epidermal melanocytes and HMV-II melanoma cells were decreased significantly by cadmium. In parallel with the MITF reduction, mRNA levels of tyrosinase, the key enzyme of melanin biosynthesis that is regulated by MITF-M, were also decreased. In RPE cells, however, the levels of total MITF protein, constituting mainly MITF-H, were not decreased by cadmium. We thus identify MITF-M as the molecular target of cadmium toxicity in melanocytes, thereby accounting for the increased risk of disability from melanocyte malfunction, such as hearing and vision loss among people with elevated cadmium exposure.

  15. Cadmium

    NARCIS (Netherlands)

    Meulenbelt, Jan

    2017-01-01

    Together with zinc and mercury, cadmium belongs to group IIb of the periodic table. It can be found in rocks, soil, water, coal, zinc ore, lead ore, and copper ore. In the environment, cadmium is present predominantly as the oxide or as the chloride, sulfide, or sulfate salt. It has no recognizable

  16. Virtual Screening of Phytochemicals to Novel Target (HAT) Rtt109 in Pneumocystis Jirovecii using Bioinformatics Tools.

    Science.gov (United States)

    Sugumar, Ramya; Adithavarman, Abhinand Ponneri; Dakshinamoorthi, Anusha; David, Darling Chellathai; Ragunath, Padmavathi Kannan

    2016-03-01

    Pneumocystis jirovecii is a fungus that causes Pneumocystis pneumonia in HIV and other immunosuppressed patients. Treatment of Pneumocystis pneumonia with the currently available antifungals is challenging and associated with considerable adverse effects. There is a need to develop drugs against novel targets with minimal human toxicities. Histone Acetyl Transferase (HAT) Rtt109 is a potential therapeutic target in Pneumocystis jirovecii species. HAT is linked to transcription and is required to acetylate conserved lysine residues on histone proteins by transferring an acetyl group from acetyl CoA to form e-N-acetyl lysine. Therefore, inhibitors of HAT can be useful therapeutic options in Pneumocystis pneumonia. To screen phytochemicals against (HAT) Rtt109 using bioinformatics tool. The tertiary structure of Pneumocystis jirovecii (HAT) Rtt109 was modeled by Homology Modeling. The ideal template for modeling was obtained by performing Psi BLAST of the protein sequence. Rtt109-AcCoA/Vps75 protein from Saccharomyces cerevisiae (PDB structure 3Q35) was chosen as the template. The target protein was modeled using Swiss Modeler and validated using Ramachandran plot and Errat 2. Comprehensive text mining was performed to identify phytochemical compounds with antipneumonia and fungicidal properties and these compounds were filtered based on Lipinski's Rule of 5. The chosen compounds were subjected to virtual screening against the target protein (HAT) Rtt109 using Molegro Virtual Docker 4.5. Osiris Property Explorer and Open Tox Server were used to predict ADME-T properties of the chosen phytochemicals. Tertiary structure model of HAT Rtt 109 had a ProSA score of -6.57 and Errat 2 score of 87.34. Structure validation analysis by Ramachandran plot for the model revealed 97% of amino acids were in the favoured region. Of all the phytochemicals subjected to virtual screening against the target protein (HAT) Rtt109, baicalin exhibited highest binding affinity towards the

  17. The production of 103Pd and 109Cd from a proton irradiated tandem natAg/natAg targets

    International Nuclear Information System (INIS)

    Ineza, C.; Mphahlele, J.

    2014-01-01

    This paper describes a new method for the production of 103 Pd and 109 Cd using the 66 MeV proton beam of iThemba LABS on a tandem natural silver target (Ag/Ag). The radiochemical separation of the Pd radionuclides ( 103 Pd, 100 Pd) from the bulk nat Ag was done using a Chelex-100 chelating resin column. The recovery of 103 Pd from the irradiated nat Ag target was found to be >98 % without any Ag or Rh impurities detected. The radiochemical separation of 109 Cd from the bulk nat Ag target was done by the precipitation of Ag ions by Cu followed by the separation of 109 Cd, traces of Ag, Cu 2+ and Rh using a AG1-X10 anion exchange resin column. The recovery yield of 109 Cd was >99 % without any Ag or Rh impurities detected. (author)

  18. Cadmium carcinogenesis

    International Nuclear Information System (INIS)

    Waalkes, Michael P.

    2003-01-01

    Cadmium is a heavy metal of considerable environmental and occupational concern. Cadmium compounds are classified as human carcinogens by several regulatory agencies. The most convincing data that cadmium is carcinogenic in humans comes from studies indicating occupational cadmium exposure is associated with lung cancer. Cadmium exposure has also been linked to human prostate and renal cancer, although this linkage is weaker than for lung cancer. Other target sites of cadmium carcinogenesis in humans, such as liver, pancreas and stomach, are considered equivocal. In animals, cadmium effectively induces cancers at multiple sites and by various routes. Cadmium inhalation in rats induces pulmonary adenocarcinomas, in accord with its role in human lung cancer. Cadmium can induce tumors and/or preneoplastic lesions within the rat prostate after ingestion or injection. At relatively high doses, cadmium induces benign testicular tumors in rats, but these appear to be due to early toxic lesions and loss of testicular function, rather than from a specific carcinogenic effect of cadmium. Like many other metals, cadmium salts will induce mesenchymal tumors at the site of subcutaneous (s.c.) or intramuscular (i.m.) injections, but the human relevance of these is dubious. Other targets of cadmium in rodents include the liver, adrenal, pancreas, pituitary, and hematopoietic system. With the exception of testicular tumors in rodents, the mechanisms of cadmium carcinogenesis are poorly defined. Cadmium can cause any number of molecular lesions that would be relevant to oncogenesis in various cellular model systems. Most studies indicate cadmium is poorly mutagenic and probably acts through indirect or epigenetic mechanisms, potentially including aberrant activation of oncogenes and suppression of apoptosis

  19. Cadmium carcinogenesis

    Energy Technology Data Exchange (ETDEWEB)

    Waalkes, Michael P

    2003-12-10

    Cadmium is a heavy metal of considerable environmental and occupational concern. Cadmium compounds are classified as human carcinogens by several regulatory agencies. The most convincing data that cadmium is carcinogenic in humans comes from studies indicating occupational cadmium exposure is associated with lung cancer. Cadmium exposure has also been linked to human prostate and renal cancer, although this linkage is weaker than for lung cancer. Other target sites of cadmium carcinogenesis in humans, such as liver, pancreas and stomach, are considered equivocal. In animals, cadmium effectively induces cancers at multiple sites and by various routes. Cadmium inhalation in rats induces pulmonary adenocarcinomas, in accord with its role in human lung cancer. Cadmium can induce tumors and/or preneoplastic lesions within the rat prostate after ingestion or injection. At relatively high doses, cadmium induces benign testicular tumors in rats, but these appear to be due to early toxic lesions and loss of testicular function, rather than from a specific carcinogenic effect of cadmium. Like many other metals, cadmium salts will induce mesenchymal tumors at the site of subcutaneous (s.c.) or intramuscular (i.m.) injections, but the human relevance of these is dubious. Other targets of cadmium in rodents include the liver, adrenal, pancreas, pituitary, and hematopoietic system. With the exception of testicular tumors in rodents, the mechanisms of cadmium carcinogenesis are poorly defined. Cadmium can cause any number of molecular lesions that would be relevant to oncogenesis in various cellular model systems. Most studies indicate cadmium is poorly mutagenic and probably acts through indirect or epigenetic mechanisms, potentially including aberrant activation of oncogenes and suppression of apoptosis.

  20. Solvent extraction studies on cadmium Part 3

    International Nuclear Information System (INIS)

    Alian, A.; El-Kot, A.

    1976-01-01

    An extraction study was performed on various concentrations of cadmium, zinc and cobalt halides in the presence of sulphuric acid. A long chain amine (Amberlite LA-2) and an organophosphorus solvent (TBP) were used. In most cases the value of the distribution ratio decreases with the increase of metal concentration in the aqueous phase. The various possibilities of chemical and radiochemical separations of cadmium from accompanying metal species are reported: separation of (sup109m)Ag from irradiated Cd targets, separation of (sup115m)In using HDEHP, separation of Cd and Zn from their mixtures. (T.G.)

  1. Inhaled Cadmium Oxide Nanoparticles: Their in Vivo Fate and Effect on Target Organs

    Directory of Open Access Journals (Sweden)

    Jana Dumkova

    2016-06-01

    Full Text Available The increasing amount of heavy metals used in manufacturing equivalently increases hazards of environmental pollution by industrial products such as cadmium oxide (CdO nanoparticles. Here, we aimed to unravel the CdO nanoparticle destiny upon their entry into lungs by inhalations, with the main focus on the ultrastructural changes that the nanoparticles may cause to tissues of the primary and secondary target organs. We indeed found the CdO nanoparticles to be transported from the lungs into secondary target organs by blood. In lungs, inhaled CdO nanoparticles caused significant alterations in parenchyma tissue including hyperemia, enlarged pulmonary septa, congested capillaries, alveolar emphysema and small areas of atelectasis. Nanoparticles were observed in the cytoplasm of cells lining bronchioles, in the alveolar spaces as well as inside the membranous pneumocytes and in phagosomes of lung macrophages. Nanoparticles even penetrated through the membrane into some organelles including mitochondria and they also accumulated in the cytoplasmic vesicles. In livers, inhalation caused periportal inflammation and local hepatic necrosis. Only minor changes such as diffusely thickened filtration membrane with intramembranous electron dense deposits were observed in kidney. Taken together, inhaled CdO nanoparticles not only accumulated in lungs but they were also transported to other organs causing serious damage at tissue as well as cellular level.

  2. Inhaled Cadmium Oxide Nanoparticles: Their in Vivo Fate and Effect on Target Organs.

    Science.gov (United States)

    Dumkova, Jana; Vrlikova, Lucie; Vecera, Zbynek; Putnova, Barbora; Docekal, Bohumil; Mikuska, Pavel; Fictum, Petr; Hampl, Ales; Buchtova, Marcela

    2016-06-03

    The increasing amount of heavy metals used in manufacturing equivalently increases hazards of environmental pollution by industrial products such as cadmium oxide (CdO) nanoparticles. Here, we aimed to unravel the CdO nanoparticle destiny upon their entry into lungs by inhalations, with the main focus on the ultrastructural changes that the nanoparticles may cause to tissues of the primary and secondary target organs. We indeed found the CdO nanoparticles to be transported from the lungs into secondary target organs by blood. In lungs, inhaled CdO nanoparticles caused significant alterations in parenchyma tissue including hyperemia, enlarged pulmonary septa, congested capillaries, alveolar emphysema and small areas of atelectasis. Nanoparticles were observed in the cytoplasm of cells lining bronchioles, in the alveolar spaces as well as inside the membranous pneumocytes and in phagosomes of lung macrophages. Nanoparticles even penetrated through the membrane into some organelles including mitochondria and they also accumulated in the cytoplasmic vesicles. In livers, inhalation caused periportal inflammation and local hepatic necrosis. Only minor changes such as diffusely thickened filtration membrane with intramembranous electron dense deposits were observed in kidney. Taken together, inhaled CdO nanoparticles not only accumulated in lungs but they were also transported to other organs causing serious damage at tissue as well as cellular level.

  3. Target or barrier? The cell wall of early- and later- diverging plants vs cadmium toxicity: differences in the response mechanisms

    Directory of Open Access Journals (Sweden)

    Luigi eParrotta

    2015-03-01

    Full Text Available Increasing industrialization and urbanization result in emission of pollutants in the environment including toxic heavy metals, as cadmium and lead. Among the different heavy metals contaminating the environment, cadmium raises great concern, as it is ecotoxic and as such can heavily impact ecosystems. The cell wall is the first structure of plant cells to come in contact with heavy metals. Its composition, characterized by proteins, polysaccharides and in some instances lignin and other phenolic compounds, confers the ability to bind non-covalently and/or covalently heavy metals via functional groups. A strong body of evidence in the literature has shown the role of the cell wall in heavy metal response: it sequesters heavy metals, but at the same time its synthesis and composition can be severely affected. The present review analyzes the dual property of plant cell walls, i.e. barrier and target of heavy metals, by taking Cd toxicity as example. Following a summary of the known physiological and biochemical responses of plants to Cd, the review compares the wall-related mechanisms in early- and later-diverging land plants, by considering the diversity in cell wall composition. By doing so, common as well as unique response mechanisms to metal/cadmium toxicity are identified among plant phyla and discussed. After discussing the role of hyperaccumulators’ cell walls as a particular case, the review concludes by considering important aspects for plant engineering.

  4. Ribosomal genes as early targets of cadmium-induced toxicity in Chironomus riparius larvae

    International Nuclear Information System (INIS)

    Planello, R.; Martinez-Guitarte, J.L.; Morcillo, G.

    2007-01-01

    Cadmium is a widespread environmental pollutant that causes severe impacts in organisms. Although the effects of cadmium on aquatic insects have been studied in terms of their toxicity and changes in developmental parameters, little is known about its molecular and genetic effects. We have investigated the alterations in the pattern of gene expression provoked by acute exposure to cadmium in Chironomus riparius Mg. (Diptera, Chironomidae), a sentinel organism widely used in aquatic toxicity testing. The early cytotoxic effects were evaluated using immunocytochemistry and specific fluorescent probes in fourth instar larvae after 12 h of 10 mM cadmium treatments; under these conditions no significant effect on larvae mortality was detected until after 36 h of exposure. The changes in the pattern of gene expression were analysed by means of DNA/RNA hybrid antibodies in the polytene chromosomes from salivary gland cells. A decrease in the activity of the nucleolus is especially remarkable, accompanied by a significant reduction in size and the modification in nucleolar architecture, as shown by FISH. The inhibition of rDNA transcription was further evaluated by Northern blot analysis, which showed a marked decrease in the level of preribosomal rRNA (54% 45S 12 h). However, the BR genes, whose products are the giant polypeptides that constitute the silk-like secretion for constructing housing tubes, remain active. Simultaneously, decondensation and activation take place at some chromosomal regions, especially at the centromeres. The changes observed in the pattern of gene expression do not resemble those found after heat shock or other cell stressors. These data provide the first evidence that cadmium interacts with ribosomal genes and results in a drastic impairment of the functional activity of the nucleolus, an essential organelle for cellular survival. Therefore, the depletion of ribosomes would be a long-term effect of Cd-induced cellular damage. These findings may

  5. Ribosomal genes as early targets of cadmium-induced toxicity in Chironomus riparius larvae

    Energy Technology Data Exchange (ETDEWEB)

    Planello, R. [Biologia Ambiental, Facultad de Ciencias, Universidad Nacional de Educacion a Distancia, Senda del Rey 9, 28040, Madrid (Spain); Martinez-Guitarte, J.L. [Biologia Ambiental, Facultad de Ciencias, Universidad Nacional de Educacion a Distancia, Senda del Rey 9, 28040, Madrid (Spain); Morcillo, G. [Biologia Ambiental, Facultad de Ciencias, Universidad Nacional de Educacion a Distancia, Senda del Rey 9, 28040, Madrid (Spain)]. E-mail: gmorcillo@ccia.uned.es

    2007-02-01

    Cadmium is a widespread environmental pollutant that causes severe impacts in organisms. Although the effects of cadmium on aquatic insects have been studied in terms of their toxicity and changes in developmental parameters, little is known about its molecular and genetic effects. We have investigated the alterations in the pattern of gene expression provoked by acute exposure to cadmium in Chironomus riparius Mg. (Diptera, Chironomidae), a sentinel organism widely used in aquatic toxicity testing. The early cytotoxic effects were evaluated using immunocytochemistry and specific fluorescent probes in fourth instar larvae after 12 h of 10 mM cadmium treatments; under these conditions no significant effect on larvae mortality was detected until after 36 h of exposure. The changes in the pattern of gene expression were analysed by means of DNA/RNA hybrid antibodies in the polytene chromosomes from salivary gland cells. A decrease in the activity of the nucleolus is especially remarkable, accompanied by a significant reduction in size and the modification in nucleolar architecture, as shown by FISH. The inhibition of rDNA transcription was further evaluated by Northern blot analysis, which showed a marked decrease in the level of preribosomal rRNA (54% 45S 12 h). However, the BR genes, whose products are the giant polypeptides that constitute the silk-like secretion for constructing housing tubes, remain active. Simultaneously, decondensation and activation take place at some chromosomal regions, especially at the centromeres. The changes observed in the pattern of gene expression do not resemble those found after heat shock or other cell stressors. These data provide the first evidence that cadmium interacts with ribosomal genes and results in a drastic impairment of the functional activity of the nucleolus, an essential organelle for cellular survival. Therefore, the depletion of ribosomes would be a long-term effect of Cd-induced cellular damage. These findings may

  6. Inhaled Cadmium Oxide Nanoparticles: Their in Vivo Fate and Effect on Target Organs

    Czech Academy of Sciences Publication Activity Database

    Dumková, J.; Vrlíková, Lucie; Večeřa, Zbyněk; Putnová, Barbora; Dočekal, Bohumil; Mikuška, Pavel; Fictum, P.; Hampl, A.; Buchtová, Marcela

    2016-01-01

    Roč. 17, č. 6 (2016), s. 874-893 E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GAP503/11/2315; GA ČR(CZ) GBP503/12/G147 Institutional support: RVO:67985904 ; RVO:68081715 Keywords : nanoparticles * cadmium oxide * electron microscopy Subject RIV: EB - Genetics ; Molecular Biology; CB - Analytical Chemistry , Separation (UIACH-O) Impact factor: 3.226, year: 2016

  7. Cadmium Handling, Toxicity and Molecular Targets Involved during Pregnancy: Lessons from Experimental Models

    Directory of Open Access Journals (Sweden)

    Tania Jacobo-Estrada

    2017-07-01

    Full Text Available Even decades after the discovery of Cadmium (Cd toxicity, research on this heavy metal is still a hot topic in scientific literature: as we wrote this review, more than 1440 scientific articles had been published and listed by the PubMed.gov website during 2017. Cadmium is one of the most common and harmful heavy metals present in our environment. Since pregnancy is a very particular physiological condition that could impact and modify essential pathways involved in the handling of Cd, the prenatal life is a critical stage for exposure to this non-essential element. To give the reader an overview of the possible mechanisms involved in the multiple organ toxic effects in fetuses after the exposure to Cd during pregnancy, we decided to compile some of the most relevant experimental studies performed in experimental models and to summarize the advances in this field such as the Cd distribution and the factors that could alter it (diet, binding-proteins and membrane transporters, the Cd-induced toxicity in dams (preeclampsia, fertility, kidney injury, alteration in essential element homeostasis and bone mineralization, in placenta and in fetus (teratogenicity, central nervous system, liver and kidney.

  8. Electron-impact excitation-autoionization in the cadmium isoelectronic sequence: A case of target term dependence in scattering theory

    International Nuclear Information System (INIS)

    Pindzola, M.S.; Griffin, D.C.; Bottcher, C.

    1983-01-01

    Excitation-autoionization contributions to electron-impact ionization are calculated for several atomic ions in the cadmium isoelectronic sequence. We calculate excitation cross sections in the distorted-wave approximation and compare them in one case to a calculation in the close-coupling approximation. We focus attention on the 4d 10 5s 2 →4d 9 5s 2 nf inner-shell excitations in In + , Sb 3+ , and Xe 6+ . Hartree-Fock atomic structure calculations for the 4d 9 5s 2 nf configurations are found to be highly term dependent. Thus our predictions for the total ionization cross section from the 5s subshell for these ions exhibit strong target term dependence. Our Xe 6+ results are found to be in excellent agreement with the recent experimental crossed-beam measurements of Gregory and Crandall

  9. Developments of 207Pb, 208Pb and 209Bi target wheels in the synthesis of 107Ns, 108Hs and 109Mt

    International Nuclear Information System (INIS)

    Folger, H.; Hartmann, W.; Hessberger, F.P.; Hofmann, S.; Klemm, J.; Muenzenberg, G.; Ninov, V.; Schmidt, K.H.; Schoett, H.J.; Thalheimer, W.; Armbruster, P.

    1993-05-01

    The developments of 207 Pb, 208 Pb and 209 Bi target wheels and their applications in heavy-ion fusion reactions are reviewed. In both, fabrication and use, the centers of the evaporator or accelerator beams are focussed at wheel radii of 155 mm to specially shaped frames which generate very homogeneous target layers and very constant reaction and counting rates in the experiment. Target areas of up to ∼98% of a wheel's circumference of 974 mm can be provided. The preparation procedures for necessary C backings and protecting layers of C are described, and details are given for the developments of high-vacuum evaporations of 207 Pb, 208 Pb and 209 Bi with deposition yields of 35-55% from tantalum crucibles. The applications of the target wheels in heavy-ion fusion reactions with beams of 54 Cr and 58 Fe at energies near the Coulomb barrier and intensities of ∼10 12 particles/s are mentioned. The target parameters for the production runs of the new chemical elements 107 Ns, 108 Hs and 109 Mt are included. (orig.)

  10. Evolving transpeptidase and hydrolytic variants of γ-glutamyl transpeptidase from Bacillus licheniformis by targeted mutations of conserved residue Arg109 and their biotechnological relevance.

    Science.gov (United States)

    Bindal, Shruti; Sharma, Sujata; Singh, Tej P; Gupta, Rani

    2017-05-10

    γ-Glutamyl transpeptidase (GGT) catalyzes the transfer of the γ-glutamyl moiety from donor compounds such as l-glutamine (Gln) and glutathione (GSH) to an acceptor. During the biosynthesis of various γ-glutamyl-containing compounds using GGT enzyme, auto-transpeptidation reaction leads to the formation of unwanted byproducts. Therefore, in order to alter the auto-transpeptidase activity of the GGT enzyme, the binding affinity of Gln should be modified. Structural studies of the Bacillus licheniformis GGT (BlGT) complexed with the glutamic acid has shown that glutamic acid has strong ionic interactions through its α-carboxlic group with the guanidine moiety of Arg109. This interaction appears to be an important contributor for the binding affinity of Gln. In view of this, six mutants of Bacillus licheniformis ER15 GGT (BlGGT) viz. Arg109Lys, Arg109Ser, Arg109Met, Arg109Leu, Arg109Glu and Arg109Phe were prepared. As seen from the structure of BlGT, the mutation of Arg109 to Lys109 may reduce the affinity for Gln to some extent, whereas the other mutations are expected to lower the affinity much more. Biophysical characterization and functional studies revealed that Arg109Lys mutant has increased transpeptidation activity and catalytic efficiency than the other mutants. The Arg109Lys mutant showed high conversion rates for l-theanine synthesis as well. Moreover, the Arg109Met mutant showed increased hydrolytic activity as it completely altered the binding of Gln at the active site. Also, the salt stability of the enzyme was significantly improved on replacing Arg109 by Met109 which is required for hydrolytic applications of GGTs in food industries. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. Molecular basis of cadmium toxicity

    Energy Technology Data Exchange (ETDEWEB)

    Nath, R; Prasad, R; Palinal, V K; Chopra, R K

    1984-01-01

    Cadmium has been shown to manifest its toxicity in human and animals by mainly accumulating in almost all of the organs. The kidney is the main target organ where it is concentrated mainly in the cortex. Environmental exposure of cadmium occurs via food, occupational industries, terrestrial and aquatic ecosystem. At molecular level, cadmium interferes with the utilization of essential metals e.g. Ca, Zn, Se, Cr and Fe and deficiencies of these essential metals including protein and vitamins, exaggerate cadmium toxicity, due to its increased absorption through the gut and greater retention in different organs as metallothionein (Cd-Mt). Cadmium transport, across the intestinal and renal brush border membrane vesicles, is carrier mediated and it competes with zinc and calcium. It has been postulated that cadmium shares the same transport system. Cadmium inhibits protein synthesis, carbohydrate metabolism and drug metabolizing enzymes in liver of animals. Chronic environmental exposure of cadmium produces hypertension in experimental animals. Functional changes accompanying cadmium nephropathy include low molecular weight proteinuria which is of tubular origin associated with excess excretion of proteins such as beta 2 microglobulin, metallothionein and high molecular weight proteinuria of glomerular origin (excretion of proteins such as albumin IgG, transferrin etc.). Recent data has shown that metallothionein is more nephrotoxic to animals. Cadmium is also toxic to central nervous system. It causes an alterations of cellular functions in lungs. Cadmium affects both humoral and cell mediated immune response in animals. Cadmium induces metallothionein in liver and kidney but under certain nutritional deficiencies like protein-calorie malnutrition and calcium deficiency, enhanced induction and greater accumulation of cadmium metallothionein has been observed.

  12. Radiochemical studies of the separation of some chloro-complexes of tin, antimony, cadmium and indium

    International Nuclear Information System (INIS)

    Ramamoorthy, N.; Mani, R.S.

    1976-01-01

    Radioisotopes of tin, antimony, cadmium and indium such as tin-113, antimony-124, antimony-125, cadmium-109, cadmium-115, indium-113m and indium-111 find extensive applications as tracers in various fields. These isotopes are produced by irradiation of targets in a reactor or a cyclotron. It is usually observed that in addition to the nuclear reactions giving rise to the desired isotopes, side reactions also take place giving rise to radionuclidic contaminants. Thus, antimony-125, indium-114m and indium-114 will be present in the cyclotron produced indium-111. The authors have studied column chromatography over hydrous zirconia for the separation of antimony from tin and indium, and cadmium from indium. These studies have thrown light on the role and behaviour of antimony-125 present as an impurity in tin-113 during the preparation of tin-113-indium-113m generators and have indicated methods for the preparation of 115 Cd-sup(115m)In generators and for separation of 111 In from proton irradiated cadmium targets. (Authors)

  13. Cadmium action in synapses in the brain

    Energy Technology Data Exchange (ETDEWEB)

    Minami, Akira; Takeda, Atsushi; Nishibaba, Daisuke; Tekefuta, Sachiyo; Oku, Naoto [Department of Radiobiochemistry, School of Pharmaceutical Sciences, University of Shizuoka, Shizuoka (Japan)

    2001-05-01

    Chronic exposure to cadmium causes central nervous system disorders, e.g., olfactory dysfunction. To clarify cadmium toxicity in synaptic neurotransmission in the brain, the movement and action of cadmium in the synapses was examined using in vivo microdialysis. One and 24 h after injection of {sup 109}CdCl{sub 2} into the amygdala of rats, {sup 109}Cd release into the extracellular space was facilitated by stimulation with high K{sup +}, suggesting that cadmium taken up in amygdalar neurons is released into the synaptic clefts in a calcium- and impulse-dependent manner. To examine the action of cadmium in the synapses, the amygdala was perfused with artificial cerebrospinal fluid containing 10-30 {mu}M CdCl{sub 2}. The release of excitatory neurotransmitters, i.e., glutamate and aspartate, into the extracellular space was decreased during perfusion with cadmium, while the release of inhibitory neurotransmitters, i.e., glycine and {gamma}-amino butyric acid (GABA), into the extracellular space was increased during the period. These results suggest that cadmium released from the amygdalar neuron terminals affects the degree and balance of excitation-inhibition in synaptic neurotransmission. (author)

  14. Cadmium action in synapses in the brain

    International Nuclear Information System (INIS)

    Minami, Akira; Takeda, Atsushi; Nishibaba, Daisuke; Tekefuta, Sachiyo; Oku, Naoto

    2001-01-01

    Chronic exposure to cadmium causes central nervous system disorders, e.g., olfactory dysfunction. To clarify cadmium toxicity in synaptic neurotransmission in the brain, the movement and action of cadmium in the synapses was examined using in vivo microdialysis. One and 24 h after injection of 109 CdCl 2 into the amygdala of rats, 109 Cd release into the extracellular space was facilitated by stimulation with high K + , suggesting that cadmium taken up in amygdalar neurons is released into the synaptic clefts in a calcium- and impulse-dependent manner. To examine the action of cadmium in the synapses, the amygdala was perfused with artificial cerebrospinal fluid containing 10-30 μM CdCl 2 . The release of excitatory neurotransmitters, i.e., glutamate and aspartate, into the extracellular space was decreased during perfusion with cadmium, while the release of inhibitory neurotransmitters, i.e., glycine and γ-amino butyric acid (GABA), into the extracellular space was increased during the period. These results suggest that cadmium released from the amygdalar neuron terminals affects the degree and balance of excitation-inhibition in synaptic neurotransmission. (author)

  15. Cadmium Alternatives

    Science.gov (United States)

    2012-08-01

    carcinogenic, leachable Trivalent and non- chrome passivates generally struggle with conductivity Major Differences in Trivalent vs. Hexavalent Passivates...for Change Cadmium passivated with hexavalent chromium has been in use for many decades Cadmium is toxic, and is classified as a priority...Executive Orders 13514 & 13423 DoD initiatives – Young memo (April 2009) DFAR restricting use of hexavalent chromium Allows the use of hexavalent

  16. Postlactational changes in cadmium retention in mice orally exposed to cadmium during pregnancy and lactation

    International Nuclear Information System (INIS)

    Bhattacharyya, M.H.; Sellers, D.A.; Peterson, D.P.

    1986-01-01

    Mice were continuously exposed to 109Cd in drinking water (0.03 microCi/ml; 0.11 ppb total cadmium) during pregnancy and lactation. After cessation of exposure, 109 Cd retention and distribution were examined during a 4-week postlactational period. At the start of the postlactational period (0 time), the fraction of oral 109 Cd retained by the dams was 2.4 times greater than that retained by similarly exposed nonpregnant mice. 109 Cd concentrations at 0 time were greater in the dams than in the nonpregnant mice in kidney (5-fold), liver (2.6-fold), mammary tissue (greater than 28-fold), and duodenum (13-fold). No changes in 109 Cd content of the whole body (minus gastrointestinal tract) occurred during the 4 weeks after cessation of exposure in either the dams or the nonpregnant mice; i.e., pregnancy-dependent increases in 109 Cd contents of individual organs were maintained during the 4 weeks of observation. An indication of translocation of 109 Cd from liver to kidney was observed in the dams but not in the nonpregnant mice. 109 Cd concentrations in the mammary tissue of the dams increased 2-fold during the postlactational period concomitant with a 3-fold decrease in mammary tissue mass. 109 Cd in the duodenum of the pregnant/lactating mice decreased, with a half-life of 14 days. Results indicate that multiparous women exposed to environmental levels of cadmium may takeup and retain in their kidneys, livers, and mammary tissue a greater fraction of their dietary cadmium than women with few or no children. Such results may bear on the etiology of Itai-Itai disease, a disease of the skeleton potentially related to oral cadmium exposure, with an incidence predominantly among postmenopausal women with a history of multiple childbirths

  17. Transient behavior of cadmium in a grassland arthropod food chain

    International Nuclear Information System (INIS)

    Van Hook, R.I.; Yates, A.J.

    1975-01-01

    Biological assimilation and transport of cadmium were determined for an arthropod food chain in an east Tennessee grassland community. Laboratory experiments demonstrated that there were no significant differences (P greater than 0.05) in assimilation rates (17 percent assimilation per day) or biological half-lives (7 days) of 109 Cd either as soluble nitrate or insoluble oxide in crickets under identical conditions. Field experiments demonstrated that primary consumers (crickets) accumulated 109 Cd much more rapidly (uptake rate = 0.55 day -1 ) than did the spider predators (uptake rate = 0.08 day -1 ). Equilibrium concentrations in crickets were obtained in 9 days (0.04 ppM cadmium), while equilibrium was not reached in spiders during the 30-day study. Food-chain concentration of cadmium did not occur as crickets accumulated levels of cadmium 60 percent of that in their vegetation food sources and spiders accumulated only 70 percent of the cadmium present in the cricket tissues

  18. Cadmium in milk and mammary gland in rats and mice

    International Nuclear Information System (INIS)

    Petersson Grawe, K.; Oskarsson, A.

    2000-01-01

    The purpose of the present investigation was to study the uptake of cadmium in mammary tissue, effects on milk secretion and composition, and lactational transport of cadmium to the sucklings. Cadmium exposure during lactation resulted in retention of cadmium in the mammary tissue in mice and rats. The uptake of cadmium in the mammary tissue was rapid, as shown in lactating mice by whole-body autoradiography 4 h after an intravenous injection of a tracer dose of 109 CdCl 2 . Retention of cadmium in kidneys of suckling pups was observed in the autoradiograms at 7 days after exposure of the dams. Lactating rats were intravenously infused with 109 CdCl 2 in 0.9% saline via osmotic minipumps from day 3 to day 16 after parturition. The cadmium dose given was 0, 8.8, 62 and 300 μg Cd/kg body wt. per day. Plasma and milk were collected at day 10 and 16 after parturition. Plasma cadmium levels in dams increased from day 10 to day 16. Cadmium levels were higher in milk than in plasma, with milk/plasma ratios varying from 2 to 6. Zinc levels in milk were positively correlated to cadmium levels in milk (r 2 =0.26; P=0.03). In milk, 109 Cd was distributed in fat (46-52%), casein fraction (40-46%), and whey fraction (6-8%). There was a high correlation between cadmium concentrations in pups' kidney and cadmium concentrations in dam's milk (r 2 =0.98; P 109 Cd was bound to metallothionein in mammary tissue. The fraction of radiolabelled cadmium bound to metallothionein increased in a dose-dependent manner in both the liver (88-98%) and mammary tissue (57-80%). The present results indicate a low transfer of cadmium to the suckling pup, which might be due to binding of cadmium to metallothionein in the mammary tissue. However, during the susceptible developmental period even a low cadmium exposure may be of concern. (orig.)

  19. Tyrosine phosphorylation of dihydrolipoamide dehydrogenase as a potential cadmium target and its inhibitory role in regulating mouse sperm motility.

    Science.gov (United States)

    Li, Xinhong; Wang, Lirui; Li, Yuhua; Fu, Jieli; Zhen, Linqing; Yang, Qiangzhen; Li, Sisi; Zhang, Yukun

    2016-05-16

    Cadmium (Cd) is reported to reduce sperm motility and functions. However, the molecular mechanisms of Cd-induced toxicity remain largely unknown, presenting a major knowledge gap in research on reproductive toxicology. In the present study, we identified a candidate protein, dihydrolipoamide dehydrogenase (DLD), which is a post-pyruvate metabolic enzyme, exhibiting tyrosine phosphorylation in mouse sperm exposed to Cd both in vivo and in vitro. Immunoprecipitation assay demonstrated DLD was phosphorylated in tyrosine residues without altered expression after Cd treatment, which further confirmed our identified result. However, the tyrosine phosphorylation of DLD did not participate in mouse sperm capacitation and Bovine Serum Albumin (BSA) effectively prevented the tyrosine phosphorylation of DLD. Moreover, Cd-induced tyrosine phosphorylation of DLD lowered its dehydrogenase activity and meanwhile, Nicotinamide Adenine Dinucleotide Hydrogen (NADH) content, Adenosine Triphosphate (ATP) production and sperm motility were all inhibited by Cd. Interestingly, when the tyrosine phosphorylation of DLD was blocked by BSA, the decrease of DLD activity, NADH and ATP content as well as sperm motility was also suppressed simultaneously. These results suggested that Cd-induced tyrosine phosphorylation of DLD inhibited its activity and thus suppressed the tricarboxylic acid (TCA) cycle, which resulted in the reduction of NADH and hence the ATP production generated through oxidative phosphorylation (OPHOXS). Taken together, our results revealed that Cd induced DLD tyrosine phosphorylation, in response to regulate TCA metabolic pathway, which reduced ATP levels and these negative effects led to decreased sperm motility. This study provided new understanding of the mechanisms contributing to the harmful effects of Cd on the motility and function of spermatozoa. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  20. The effects of primary beam filters on the analysis of rhodium and cadmium using a rhodium target x-ray tube

    International Nuclear Information System (INIS)

    Anzelmo, J.A.; Boyer, B.W.

    1986-01-01

    Since its introduction in 1964, the thin end-window rhodium target x-ray tube has been considered to be an excellent general purpose source of excitation. Heavy elements are efficiently excited by high Bremsstrahlung and the K lines of rhodium while the light elements are excited by the L lines of rhodium. The ability to efficiently excite both heavy and light elements is essential to special applications such as auto catalysts, which are composed of precious metals in a clay-like matrix. Close control of the light elements, including sodium, phosphorous, aluminum and silicon, and the heavy element precious metals, such as rhodium, are necessary to keep operating characteristics and manufacturing expense at desired levels. A quick survey of typical x-ray tube targets shows that some targets are more efficient for light elements while others are more efficient for heavy elements. The few general purpose x-ray tubes that are available have characteristic lines which overlap on elements to be determined. The rhodium target, which is a good excitation source for most of the elements mentioned, contains line overlaps on cadmium (RHKB) and rhodium (RHKA). When using a sequential wavelength dispersive XRF spectrometer, the characteristic lines of the tube scattered from the sample can be removed by a programmable primary beam filter having an absorption edge just higher in wavelength than the wavelengths to be removed. The thickness and composition of the filter, as well as the choice of KV and MA, will determine the operating parameter necessary to achieve the optimum precision and lowest limits of detection. For this study, synthetic samples are made up using Kaolin as the matrix

  1. Mechanisms of cadmium induced genomic instability

    Energy Technology Data Exchange (ETDEWEB)

    Filipic, Metka, E-mail: metka.filipic@nib.si [National Institute of Biology, Department for Genetic Toxicology and Cancer Biology, Ljubljana (Slovenia)

    2012-05-01

    Cadmium is an ubiquitous environmental contaminant that represents hazard to humans and wildlife. It is found in the air, soil and water and, due to its extremely long half-life, accumulates in plants and animals. The main source of cadmium exposure for non-smoking human population is food. Cadmium is primarily toxic to the kidney, but has been also classified as carcinogenic to humans by several regulatory agencies. Current evidence suggests that exposure to cadmium induces genomic instability through complex and multifactorial mechanisms. Cadmium dose not induce direct DNA damage, however it induces increase in reactive oxygen species (ROS) formation, which in turn induce DNA damage and can also interfere with cell signalling. More important seems to be cadmium interaction with DNA repair mechanisms, cell cycle checkpoints and apoptosis as well as with epigenetic mechanisms of gene expression control. Cadmium mediated inhibition of DNA repair mechanisms and apoptosis leads to accumulation of cells with unrepaired DNA damage, which in turn increases the mutation rate and thus genomic instability. This increases the probability of developing not only cancer but also other diseases associated with genomic instability. In the in vitro experiments cadmium induced effects leading to genomic instability have been observed at low concentrations that were comparable to those observed in target organs and tissues of humans that were non-occupationally exposed to cadmium. Therefore, further studies aiming to clarify the relevance of these observations for human health risks due to cadmium exposure are needed.

  2. Mechanisms of cadmium induced genomic instability

    International Nuclear Information System (INIS)

    Filipič, Metka

    2012-01-01

    Cadmium is an ubiquitous environmental contaminant that represents hazard to humans and wildlife. It is found in the air, soil and water and, due to its extremely long half-life, accumulates in plants and animals. The main source of cadmium exposure for non-smoking human population is food. Cadmium is primarily toxic to the kidney, but has been also classified as carcinogenic to humans by several regulatory agencies. Current evidence suggests that exposure to cadmium induces genomic instability through complex and multifactorial mechanisms. Cadmium dose not induce direct DNA damage, however it induces increase in reactive oxygen species (ROS) formation, which in turn induce DNA damage and can also interfere with cell signalling. More important seems to be cadmium interaction with DNA repair mechanisms, cell cycle checkpoints and apoptosis as well as with epigenetic mechanisms of gene expression control. Cadmium mediated inhibition of DNA repair mechanisms and apoptosis leads to accumulation of cells with unrepaired DNA damage, which in turn increases the mutation rate and thus genomic instability. This increases the probability of developing not only cancer but also other diseases associated with genomic instability. In the in vitro experiments cadmium induced effects leading to genomic instability have been observed at low concentrations that were comparable to those observed in target organs and tissues of humans that were non-occupationally exposed to cadmium. Therefore, further studies aiming to clarify the relevance of these observations for human health risks due to cadmium exposure are needed.

  3. Identification of a New Target slr0946 of the Response Regulator Sll0649 Involving Cadmium Tolerance in Synechocystis sp. PCC 6803

    Directory of Open Access Journals (Sweden)

    Tao Sun

    2017-08-01

    Full Text Available Survival of photosynthetic cyanobacteria is challenged by environmental contaminations like heavy metals. Among them, deciphering the regulatory mechanisms for cadmium (Cd in cyanobacteria would facilitate the construction of Cd-resistant strains. In this study, the DNA-Affinity-Purified-chromatin immunoprecipitation assay was employed to identify the direct targets of Sll0649, which was a Cd2+-related response regulator identified in our previous work in model cyanobacteria Synechocystis sp. PCC 6803. As a result, the promoter region of slr0946 encoding the arsenate reductase was enriched fourfolds by quantitative real time PCR analysis. Further, deletion of slr0946 led to a sensitive phenotype to Cd2+ stress compared with the wild type (WT and the sensitive phenotype of Δslr0946 could be rescued by complementation assay via introducing slr0946 back into Δslr0946. Finally, individually overexpression of slr0946 as well as two Cd2+-related genes identified priviously (i.e., sll1598 and slr0798 in WT could significantly improve the tolerance of Synechocystis sp. PCC 6803 to Cd2+. This study provided a better understanding of the tolerance mechanism to Cd2+ in cyanobacteria and also feasible strategies for tolerance modifications to heavy metals in the future.

  4. miR-122 promotes hepatic antioxidant defense of genetically improved farmed tilapia (GIFT, Oreochromis niloticus) exposed to cadmium by directly targeting a metallothionein gene.

    Science.gov (United States)

    Qiang, Jun; Tao, Yi-Fan; He, Jie; Xu, Pao; Bao, Jin-Wen; Sun, Yi-Lan

    2017-01-01

    MicroRNAs (miRNAs) are small, non-coding RNAs that regulate target gene expression by binding to the 3'untranslated region (3'UTR) of the target mRNA. MiRNAs regulate a large variety of genes, including those involved in liver homeostasis and energy metabolism. Down-regulated levels of hepatic miR-122 were found in genetically improved farmed tilapia (GIFT, Oreochromis niloticus) exposed to cadmium (Cd) stress. Here, we report for the first time that reduction of miR-122 post-transcriptionally increased metallothionein (MT) mRNA levels by binding to its 3'UTR, as shown by a 3' UTR luciferase reporter assay. The expression levels of miR-122 were negatively related to MT levels in GIFT under Cd stress. We performed in vivo functional analysis of miR-122 by injecting the fish with a miR-122 antagomir. Inhibition of miR-122 levels in GIFT liver caused a significant increase in MT expression, affected white blood cell and red blood cell counts, and serum alanine and aspartate aminotransferase activities, and glucose levels, all of which may help to relieve Cd stress-related liver stress. miR-122 silencing modulated oxidative stress and stimulated the activity of antioxidant enzymes. Our findings indicate that miR-122 regulated MT levels by binding to the 3'UTR of MT mRNA, and this interaction affected Cd stress induction and the resistance response in GIFT. We concluded that miR-122 plays an important role in regulating the stress response in GIFT liver. Our findings may contribute to understanding the mechanisms of miRNA-mediated gene regulation in tilapia in response to environmental stresses. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. Cadmium-induced fetal toxicity in the rat

    International Nuclear Information System (INIS)

    Levin, A.A.

    1980-01-01

    Cadmium, a heavy metal environment contaminant, induces fetal death and placental necrosis in the Wistar rat. This study investigated fetal, maternal, and placental responses to cadmium intoxication. Subcutaneous injection of CdCl 2 to dams on day 18 of pregnancy produced a high incidence of fetal death (75%) and placental necrosis. Death in the fetus was produced despite limited fetal accumulations of cadmium. Distribution studies using 109 Cd-labeled CdCl 2 demonstrated that less than 0.1% of the injected dose was associated with the fetus. To determine if fetuses were sensitive to these low levels of cadmium, direct injections of CdCl 2 into fetuses were performed in utero. Direct injections produced fetal accumulations 8-fold greater than those following maternal injections. The 8-fold greater fetal accumulations following direct injection were associated with only a 12% fetal mortality compared to the 75% mortality following maternal injections. The data indicated that the fetal toxicity of cadmium following maternal injections was not the result of direct effects of cadmium on the fetus. In conclusion, cadmium-induced fetal death was not the result of direct effects of cadmium on the fetus but may have been induced by placental cellular injury resulting from high accumulations of cadmium in the placenta. A vascular response to placental injury, leading to decreased utero-placental bood flow and cadmium-induced alterations in trophoblastic function, resulted in fetal death

  6. Mechanism for the generation of 109 G magnetic fields in the interaction of ultraintense short laser pulse with an overdense plasma target

    International Nuclear Information System (INIS)

    Sudan, R.N.

    1993-01-01

    The physical mechanism for the generation of very high ''dc'' magnetic fields in the interaction of ultraintense short laser pulse with an overdense plasma target originates in the spatial gradients and nonstationary character of the ponderomotive force. A set of model equations to determine the evolution of the ''dc'' fields is derived and it is shown that the ''dc'' magnetic field is of the same order of magnitude as the high frequency laser magnetic field

  7. miR-122 promotes hepatic antioxidant defense of genetically improved farmed tilapia (GIFT, Oreochromis niloticus) exposed to cadmium by directly targeting a metallothionein gene

    International Nuclear Information System (INIS)

    Qiang, Jun; Tao, Yi-Fan; He, Jie; Xu, Pao; Bao, Jin-Wen; Sun, Yi-Lan

    2017-01-01

    Highlights: • MiR-122 regulated tilapia MT by directly targeting MT 3′UTR. • MiR-122 level was negatively related to MT level under Cd stress. • MiR-122 silencing caused up-regulation of MT expression. • MiR-122 loss relieved liver stress and stimulated antioxidant enzymes. - Abastract: MicroRNAs (miRNAs) are small, non-coding RNAs that regulate target gene expression by binding to the 3′untranslated region (3′UTR) of the target mRNA. MiRNAs regulate a large variety of genes, including those involved in liver homeostasis and energy metabolism. Down-regulated levels of hepatic miR-122 were found in genetically improved farmed tilapia (GIFT, Oreochromis niloticus) exposed to cadmium (Cd) stress. Here, we report for the first time that reduction of miR-122 post-transcriptionally increased metallothionein (MT) mRNA levels by binding to its 3′UTR, as shown by a 3′ UTR luciferase reporter assay. The expression levels of miR-122 were negatively related to MT levels in GIFT under Cd stress. We performed in vivo functional analysis of miR-122 by injecting the fish with a miR-122 antagomir. Inhibition of miR-122 levels in GIFT liver caused a significant increase in MT expression, affected white blood cell and red blood cell counts, and serum alanine and aspartate aminotransferase activities, and glucose levels, all of which may help to relieve Cd stress-related liver stress. miR-122 silencing modulated oxidative stress and stimulated the activity of antioxidant enzymes. Our findings indicate that miR-122 regulated MT levels by binding to the 3′UTR of MT mRNA, and this interaction affected Cd stress induction and the resistance response in GIFT. We concluded that miR-122 plays an important role in regulating the stress response in GIFT liver. Our findings may contribute to understanding the mechanisms of miRNA-mediated gene regulation in tilapia in response to environmental stresses.

  8. miR-122 promotes hepatic antioxidant defense of genetically improved farmed tilapia (GIFT, Oreochromis niloticus) exposed to cadmium by directly targeting a metallothionein gene

    Energy Technology Data Exchange (ETDEWEB)

    Qiang, Jun, E-mail: Qiangj@ffrc.cn [Key Laboratory of Freshwater Fisheries and Germplasm Resources Utilization, Ministry of Agriculture, Freshwater Fisheries Research Center, Chinese Academy of Fishery Sciences, Wuxi 214081, Jiangsu (China); Tao, Yi-Fan [Wuxi Fisheries College, Nanjing Agricultural University, Wuxi 214081 (China); He, Jie [Key Laboratory of Freshwater Fisheries and Germplasm Resources Utilization, Ministry of Agriculture, Freshwater Fisheries Research Center, Chinese Academy of Fishery Sciences, Wuxi 214081, Jiangsu (China); Xu, Pao, E-mail: Xup@ffrc.cn [Key Laboratory of Freshwater Fisheries and Germplasm Resources Utilization, Ministry of Agriculture, Freshwater Fisheries Research Center, Chinese Academy of Fishery Sciences, Wuxi 214081, Jiangsu (China); Bao, Jin-Wen [Wuxi Fisheries College, Nanjing Agricultural University, Wuxi 214081 (China); Sun, Yi-Lan [Key Laboratory of Freshwater Fisheries and Germplasm Resources Utilization, Ministry of Agriculture, Freshwater Fisheries Research Center, Chinese Academy of Fishery Sciences, Wuxi 214081, Jiangsu (China)

    2017-01-15

    Highlights: • MiR-122 regulated tilapia MT by directly targeting MT 3′UTR. • MiR-122 level was negatively related to MT level under Cd stress. • MiR-122 silencing caused up-regulation of MT expression. • MiR-122 loss relieved liver stress and stimulated antioxidant enzymes. - Abastract: MicroRNAs (miRNAs) are small, non-coding RNAs that regulate target gene expression by binding to the 3′untranslated region (3′UTR) of the target mRNA. MiRNAs regulate a large variety of genes, including those involved in liver homeostasis and energy metabolism. Down-regulated levels of hepatic miR-122 were found in genetically improved farmed tilapia (GIFT, Oreochromis niloticus) exposed to cadmium (Cd) stress. Here, we report for the first time that reduction of miR-122 post-transcriptionally increased metallothionein (MT) mRNA levels by binding to its 3′UTR, as shown by a 3′ UTR luciferase reporter assay. The expression levels of miR-122 were negatively related to MT levels in GIFT under Cd stress. We performed in vivo functional analysis of miR-122 by injecting the fish with a miR-122 antagomir. Inhibition of miR-122 levels in GIFT liver caused a significant increase in MT expression, affected white blood cell and red blood cell counts, and serum alanine and aspartate aminotransferase activities, and glucose levels, all of which may help to relieve Cd stress-related liver stress. miR-122 silencing modulated oxidative stress and stimulated the activity of antioxidant enzymes. Our findings indicate that miR-122 regulated MT levels by binding to the 3′UTR of MT mRNA, and this interaction affected Cd stress induction and the resistance response in GIFT. We concluded that miR-122 plays an important role in regulating the stress response in GIFT liver. Our findings may contribute to understanding the mechanisms of miRNA-mediated gene regulation in tilapia in response to environmental stresses.

  9. PMK-1 p38 MAPK promotes cadmium stress resistance, the expression of SKN-1/Nrf and DAF-16 target genes, and protein biosynthesis in Caenorhabditis elegans.

    Science.gov (United States)

    Keshet, Alex; Mertenskötter, Ansgar; Winter, Sarah A; Brinkmann, Vanessa; Dölling, Ramona; Paul, Rüdiger J

    2017-12-01

    The mechanisms of cadmium (Cd) resistance are complex and not sufficiently understood. The present study, therefore, aimed at assessing the roles of important components of stress-signaling pathways and of ABC transporters under severe Cd stress in Caenorhabditis elegans. Survival assays on mutant and control animals revealed a significant promotion of Cd resistance by the PMK-1 p38 MAP kinase, the transcription factor DAF-16/FoxO, and the ABC transporter MRP-1. Transcriptome profiling by RNA-Seq on wild type and a pmk-1 mutant under control and Cd stress conditions revealed, inter alia, a PMK-1-dependent promotion of gene expression for the translational machinery. PMK-1 also promoted the expression of target genes of the transcription factors SKN-1/Nrf and DAF-16 in Cd-stressed animals, which included genes for molecular chaperones or immune proteins. Gene expression studies by qRT-PCR confirmed the positive effects of PMK-1 on DAF-16 activity under Cd stress and revealed negative effects of DAF-16 on the expression of genes for MRP-1 and DAF-15/raptor. Additional studies on pmk-1 RNAi-treated wild type and mutant strains provided further information on the effects of PMK-1 on SKN-1 and DAF-16, which resulted in a model of these relationships. The results of this study demonstrate a central role of PMK-1 for the processing of cellular responses to abiotic and biotic stressors, with the promoting effects of PMK-1 on Cd resistance mostly mediated by the transcription factors SKN-1 and DAF-16.

  10. Reviews of the environmental effects of pollutants: IV. Cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Hammons, A.S.; Huff, J.E.; Braunstein, H.M.; Drury, J.S.; Shriner, C.R.; Lewis, E.B.; Whitfield, B.L.; Towill, L.E.

    1978-06-01

    This report is a comprehensive, multidisciplinary review of the health and environmental effects of cadmium and specific cadmium derivatives. More than 500 references are cited. The cadmium body burden in animals and humans results mainly from the diet. In the United States, the normal intake of cadmium for adult humans is estimated at about 50 ..mu..g per day. Tobacco smoke is a significant additional source of cadmium exposure. The kidneys and liver together contain about 50% of the total cadmium body burden. Acute cadmium poisoning is primarily an occupational problem, generally from inhalation of cadmium fumes or dusts. In the general population, incidents of acute poisoning by inhaled or ingested cadmium or its compounds are relatively rare. The kidney is the primary target organ for toxicity from prolonged low-level exposure to cadmium. No causal relationship has been established between cadmium exposure and human cancer, although a possible link between cadmium and prostate cancer has been indicated. Cadmium has been shown to be teratogenic in rats, hamsters, and mice, but no such effects have been proven in humans. Cadmium has been reported to increase the frequency of chromosomal aberrations in cultured Chinese hamster ovary cells and in human peripheral leukocytes. The major concern about environmental cadmium is the potential effects on the general population. There is no substantial evidence of hazard from current levels of cadmium in air, water, or food. However, because cadmium is a cumulative poison and because present intake provides a relatively small safety margin, there are adequate reasons for concern over possible future increases in background levels.

  11. Reviews of the environmental effects of pollutants: IV. Cadmium

    International Nuclear Information System (INIS)

    Hammons, A.S.; Huff, J.E.; Braunstein, H.M.; Drury, J.S.; Shriner, C.R.; Lewis, E.B.; Whitfield, B.L.; Towill, L.E.

    1978-06-01

    This report is a comprehensive, multidisciplinary review of the health and environmental effects of cadmium and specific cadmium derivatives. More than 500 references are cited. The cadmium body burden in animals and humans results mainly from the diet. In the United States, the normal intake of cadmium for adult humans is estimated at about 50 μg per day. Tobacco smoke is a significant additional source of cadmium exposure. The kidneys and liver together contain about 50% of the total cadmium body burden. Acute cadmium poisoning is primarily an occupational problem, generally from inhalation of cadmium fumes or dusts. In the general population, incidents of acute poisoning by inhaled or ingested cadmium or its compounds are relatively rare. The kidney is the primary target organ for toxicity from prolonged low-level exposure to cadmium. No causal relationship has been established between cadmium exposure and human cancer, although a possible link between cadmium and prostate cancer has been indicated. Cadmium has been shown to be teratogenic in rats, hamsters, and mice, but no such effects have been proven in humans. Cadmium has been reported to increase the frequency of chromosomal aberrations in cultured Chinese hamster ovary cells and in human peripheral leukocytes. The major concern about environmental cadmium is the potential effects on the general population. There is no substantial evidence of hazard from current levels of cadmium in air, water, or food. However, because cadmium is a cumulative poison and because present intake provides a relatively small safety margin, there are adequate reasons for concern over possible future increases in background levels

  12. Cadmium and the kidney.

    OpenAIRE

    Friberg, L

    1984-01-01

    The paper is a review of certain aspects of importance of cadmium and the kidney regarding the assessment of risks and understanding of mechanisms of action. The review discusses the following topics: history and etiology of cadmium-induced kidney dysfunction and related disorders; cadmium metabolism, metallothionein and kidney dysfunction; cadmium in urine as indicator of body burden, exposure and kidney dysfunction; cadmium levels in kidney and liver as indicators of kidney dysfunction; cha...

  13. Cadmium incorporation by the marine copepod Pseudodiaptomus coronatus

    International Nuclear Information System (INIS)

    Sick, L.V.; Baptist, G.J.

    1979-01-01

    Pseudodiaptomus coronatus, after exposure to phytoplankton and cadmium in concentrations like those in temperate, coastal environments, incorporated 109 Cd at higher rates from ambient water than from phytoplankton food. When ambient stable cadmium concentrations were increased from 0.03 to 1.00 μg.liter -1 , cadmium concentration by phytoplankton cells increased and the rate of cell ingestion by P. coronatus decreased. This inverse relation between the accumulation of cadmium in phytoplankton cells and the animal's ingestion rate resulted in relatively small net increases in the cadmium accumulated from phytoplankton by copepods. Rates of stable cadmium ingestion for P. coronatus ranged from 0.18 to 0.38 ng.mg animal dry wt -1 .h -1 , depending on the initial algal cell density and the ambient cadmium concentration. For cadmium concentrations of 0.03 to 1.00 μg.liter -1 , percentage assimilation efficiencies ranged from 13.20 to 68.40. Both rates of cadmium ingestion and assimilation efficiencies were higher than published values for carnivorous zooplankton

  14. Cadmium, an environmental poison

    Energy Technology Data Exchange (ETDEWEB)

    Oestergaard, A K

    1974-04-15

    In recent years, industrial employment of cadmium has increased considerably. Cadmium is now present in the environment and has caused acute and chronic poisoning. Inhalation of cadmium vapor or dust causes pulmonary damage while the kidney is the critical organ in absorption of cadmium. The element accumulates in the kidney and causes tubular damage or 200 ppm in the renal cortex. In animal experiments, cadmium may cause raised blood pressure, sterility and malignant tumors. On account of the pronounced tendency of cadmium to accumulate and its toxicity, it is important to trace sources and to reduce exposure of the population. 62 references.

  15. Study on transfer of cadmium in soil-plant systems with the isotopic dilution method

    International Nuclear Information System (INIS)

    Wu Qitang; Morel, J.L.; Guckert, A.

    1993-01-01

    Experiments were conducted to determine the transfer rate from endogenous and exogenous cadmium in soil to plants. Soils were labelled with 109 Cd and amended with soluble cadmium salt or Cd containing sewage sludge. Ryegrass (Lolium perenne L.) were grown in pots and the effective transfer of cadmium from different sources to shoot of the plant were measured. The soils were also extracted with 0.1 M CaCl 2 , DTPA and 0.1 N HCl. The results showed that the addition of soluble cadmium salt substantially increased the plant cadmium content. Plant absorbed mainly the cadmium from exogenous sources in the soils treated with cadmium. The effective transfer rate of exogenous cadmium was higher than that of endogenous ones, and the soluble salt form was 2 to 3 times higher than that in the sewage sludge. 0.1 M CaCl 2 extracted Cd was significantly correlated with the plant cadmium content. The specific radioactivity of cadmium extracted by this reagent was nearer to the plant cadmium than that extracted by others. 0.1 N HCl extracted cadmium could not be absorbed by plants

  16. Calcium enhances cadmium tolerance and decreases cadmium ...

    African Journals Online (AJOL)

    We aimed at characterizing mechanisms controlling cadmium accumulation in lettuce, which is a food crop showing one of the highest capacities to accumulate this toxic compound. In this study, plants from three lettuce varieties were grown for eight days on media supplemented or not with cadmium (15 μM CdCl2) and ...

  17. Long term lung clearance and cellular retention of cadmium in rats and monkeys

    International Nuclear Information System (INIS)

    Oberdorster, G.; Cox, C.; Baggs, R.

    1987-01-01

    The paper describes experiments to determine the long term lung clearance and cellular retention of cadmium in rats and monkeys. The rats and monkeys were exposed to 109 Cd Cl 2 aerosols, and one monkey was exposed to 115 CdO particles. The thoracic activity of the respective Cd isotopes was measured with time after exposure, for both species. Accumulation of 109 Cd in the kidneys of the monkeys exposed to 109 Cd Cl 2 was also examined, and autoradiographs of lung sections of these monkeys were also prepared. The results showed that the cadmium accumulated differently in the lungs of the rats and primates. (U.K.)

  18. Cadmium and renal cancer

    International Nuclear Information System (INIS)

    Il'yasova, Dora; Schwartz, Gary G.

    2005-01-01

    Background: Rates of renal cancer have increased steadily during the past two decades, and these increases are not explicable solely by advances in imaging modalities. Cadmium, a widespread environmental pollutant, is a carcinogen that accumulates in the kidney cortex and is a cause of end-stage renal disease. Several observations suggest that cadmium may be a cause of renal cancer. Methods: We performed a systematic review of the literature on cadmium and renal cancer using MEDLINE for the years 1966-2003. We reviewed seven epidemiological and eleven clinical studies. Results: Despite different methodologies, three large epidemiologic studies indicate that occupational exposure to cadmium is associated with increased risk renal cancer, with odds ratios varying from 1.2 to 5.0. Six of seven studies that compared the cadmium content of kidneys from patients with kidney cancer to that of patients without kidney cancer found lower concentrations of cadmium in renal cancer tissues. Conclusions: Exposure to cadmium appears to be associated with renal cancer, although this conclusion is tempered by the inability of studies to assess cumulative cadmium exposure from all sources including smoking and diet. The paradoxical findings of lower cadmium content in kidney tissues from patients with renal cancer may be caused by dilution of cadmium in rapidly dividing cells. This and other methodological problems limit the interpretation of studies of cadmium in clinical samples. Whether cadmium is a cause of renal cancer may be answered more definitively by future studies that employ biomarkers of cadmium exposure, such as cadmium levels in blood and urine

  19. Isolation, identification and cadmium adsorption of a high cadmium ...

    African Journals Online (AJOL)

    GREGORY

    2010-09-27

    Sep 27, 2010 ... 1School of Minerals Processing and Bioengineering, Central South University, Changsha, ... Cadmium is a non-essential ... (1994) reported that cadmium might interact ... uptake of cadmium, lead and mercury (Svecova et al.,.

  20. Bioaccumulation and retention kinetics of cadmium in the freshwater decapod Macrobrachium australiense

    Energy Technology Data Exchange (ETDEWEB)

    Cresswell, Tom, E-mail: tom.cresswell@ansto.gov.au [Centre for Environmental Contaminants Research, CSIRO Land and Water, Locked Bag 2007, Kirrawee, NSW 2232 (Australia); School of Applied Sciences, RMIT University, Plenty Road, Bundoora, VIC 3083 (Australia); Simpson, Stuart L. [School of Applied Sciences, RMIT University, Plenty Road, Bundoora, VIC 3083 (Australia); Smith, Ross E.W. [Hydrobiology, Lang Parade, Auchenflower, QLD 4066 (Australia); Nugegoda, Dayanthi [School of Applied Sciences, RMIT University, Plenty Road, Bundoora, VIC 3083 (Australia); Mazumder, Debashish [Institute for Environmental Research, ANSTO, Locked Bag 2001, Kirrawee, NSW 2232 (Australia); Twining, John [Austral Radioecology, Oyster Bay, NSW, 2225 (Australia)

    2014-03-01

    Highlights: • Sources and mechanisms of Cd bioaccumulation were examined using radiotracers. • Macrobrachium australiense readily accumulated cadmium from the dissolved phase. • Assimilation efficiencies were comparable for sediment and algae. • A biokinetic model predicted ingestion accounted for majority of bioaccumulated Cd. - Abstract: The potential sources and mechanisms of cadmium bioaccumulation by the native freshwater decapods Macrobrachium species in the waters of the highly turbid Strickland River in Papua New Guinea were examined using {sup 109}Cd-labelled water and food sources and the Australian species Macrobrachium australiense as a surrogate. Synthetic river water was spiked with environmentally relevant concentrations of cadmium and animals were exposed for 7 days with daily renewal of test solutions. Dietary assimilation of cadmium was assessed through pulse-chase experiments where prawns were fed separately {sup 109}Cd-labelled fine sediment, filamentous algae and carrion (represented by cephalothorax tissue of water-exposed prawns). M. australiense readily accumulated cadmium from the dissolved phase and the uptake rate increased linearly with increasing exposure concentration. A cadmium uptake rate constant of 0.10 ± 0.05 L/g/d was determined in synthetic river water. During depuration following exposure to dissolved cadmium, efflux rates were low (0.9 ± 5%/d) and were not dependent on exposure concentration. Assimilation efficiencies of dietary sources were comparable for sediment and algae (48–51%), but lower for carrion (28 ± 5%) and efflux rates were low (0.2–2.6%/d) demonstrating that cadmium was well retained by M. australiense. A biokinetic model of cadmium accumulation by M. australiense predicted that for exposures to environmentally relevant cadmium concentrations in the Strickland River, uptake from ingestion of fine sediment and carrion would be the predominant sources of cadmium to the organism. The model predicted

  1. Cadmium toxicity studies under long term-low level exposure (LLE) conditions. I

    International Nuclear Information System (INIS)

    Sabbioni, E.; Marafante, E.; Amantini, L.; Ubertalli, L.; Pietra, R.

    1978-01-01

    A long term-low level exposure (LLE) experiment was conducted on rats to determine the metabolic patterns for realistic dietary levels of cadmium. Male rats fed with 61 ppb of cadmium ad libitum, 50 labelled with 109 Cd radiotracer as cadmium chloride via drinking mineral water and 11 unlabelled via food for 2 years. The diet was characterized in its metal content by neutron activation analysis to obtain the total dietary intake of different elements. The kidney was found to be the tissue with the major concentration of cadmium which accumulated continuously during the experiment. The variation of the accumulation pattern of Cd concentration in the liver and intestine indicated an initial rapid increase of Cd during the first 100 days. After this period an apparent equilibrium was attained in both these tissues until the end of the study. The intracellular distribution of cadmium in kidneys, liver, intestine and pancreas were similar, the cytosol fractions containing about 80% of the cellular cadmium. Dialysis experiments indicated that significant amounts of cadmium were able to be associated with cellular organelles, the mitochondria representing the most important organelle capable of binding cadmium. The cytoplasmatic Cd-profiles obtained at various stages of the experiment showed that the metal was only bound to a low-molecular-weight component, cadmium-binding protein (CdBP), which represents the specific cellular-binding component for cadmium under the long term-low level exposure (LLE) conditions. No significant variations in the concentrations of the elements in different organs were observed in animals supplemented with 109 Cd in respect to 109 Cd untreated controls. (Auth.)

  2. Metallothionein in brook trout (Salvenlinus fontinalis) as a biological indicator of cadmium stress

    International Nuclear Information System (INIS)

    Hamilton, S.J.; Mehrle, P.M.

    1987-01-01

    A cadmium-saturation technique for quantifying metallothionein in mammalian tissues was evaluated for use in fish tissue. Metallothionein characteristically binds 7 gram-atoms of a metal such as cadmium per mole of protein so saturating MT with respect to one metal and then quantifying that metal would thus result in the indirect quantification of MT. The authors administered 3 mg 109 cadmium/kg body weight by intraperitoneal injection over a 5-day period to adult brook trout Salvelinus fontinalis to induce MT in liver and kidney tissues. Homogenates were centrifuged and the supernatant was used to quantitate cadmium in three fractions: 100,000 g supernatant, cadmium-saturated MT, and unsaturated MT. The cadmium-saturated MT method involved the following steps: saturation of MT in an aliquot of 100,000 g supernatant with excess cadmium; removal of excess cadmium by addition of 2% hemoglobin; denaturation of hemoglobin by heating at 100 0 C followed by rapid cooling on ice; centrifugation at 10,000 g; digestion of an aliquot of supernatant in concentrated nitric acid for 16 hours at 70 0 C, and quantification of cadmium by atomic absorption and graphite furnace techniques or radiometric measurement with a scintillation counter. The cadmium saturation technique was modified in two ways so the amount of cadmium bound to unsaturated MT could be measured; first, the binding sites on MT were not saturated with excess cadmium, and second, the concentration of hemoglobin added to remove free cadmium and aid in coagulating low-molecular-weight proteins was 1% instead of 2%. The method gave precise measurements of MT concentrations when aliquots of liver homogenate which were analyzed separately were quantified by atomic absorption or radiometric measurements. Two to four times more cadmium and MT concentrated in the liver of treated fish than in the kidney

  3. Zinc and cadmium monosalicylates

    International Nuclear Information System (INIS)

    Kharitonov, Yu.Ya.; Tujebakhova, Z.K.

    1984-01-01

    Zinc and cadmium monosalicylates of the composition MSal, where M-Zn or Cd, Sal - twice deprotonated residue of salicylic acid O-HOC 6 H 4 COOH (H 2 Sal), are singled out and characterized. When studying thermograms, thermogravigrams, IR absorption spectra, roentgenograms of cadmium salicylate compounds (Cd(OC 6 H 4 COO) and products of their thepmal transformations, the processes of thermal decomposition of the compounds have been characterized. The process of cadmium monosalicylate decomposition takes place in one stage. Complete loss of salicylate acido group occurs in the range of 320-460 deg. At this decomposition stage cadmium oxide is formed. A supposition is made that cadmium complex has tetrahedral configuration, at that, each salicylate group plays the role of tetradentate-bridge ligand. The compound evidently has a polymer structure

  4. Determination of cadmium selenide nonstoichiometry

    International Nuclear Information System (INIS)

    Brezhnev, V.Yu.; Kharif, Ya.L.; Kovtunenko, P.V.

    1986-01-01

    Physicochemical method of determination of cadmium selenide nonstoichiometry is developed. The method nature consists in the fact, that under definite conditions dissolved cadmium is extracted from crystals to a vapor phase and then is determined in it using the photocolorimetric method. Cadmium solubility in CdSe crystal is calculated from known CdSe mass and amount of separated cadmium. The lower boundary of determined contents constitutes 1x10 -5 % mol at sample of cadmium selenide 10 g

  5. The vapour pressures over saturated aqueous solutions of cadmium chloride, cadmium bromide, cadmium iodide, cadmium nitrate, and cadmium sulphate

    International Nuclear Information System (INIS)

    Apelblat, Alexander; Korin, Eli

    2007-01-01

    Vapour pressures of water over saturated solutions of cadmium salts (chloride, bromide, iodide, nitrate, and sulphate) were determined over the temperature range 280 K to 322 K and compared with the literature data. The vapour pressures determined were used to obtain the water activities, osmotic coefficients and the molar enthalpies of vaporization in the (cadmium salt + water) systems

  6. The vapour pressures over saturated aqueous solutions of cadmium chloride, cadmium bromide, cadmium iodide, cadmium nitrate, and cadmium sulphate

    Energy Technology Data Exchange (ETDEWEB)

    Apelblat, Alexander [Department of Chemical Engineering, Ben Gurion University of the Negev, P.O. Box 653, Beer Sheva 84105 (Israel)]. E-mail: apelblat@bgu.ac.il; Korin, Eli [Department of Chemical Engineering, Ben Gurion University of the Negev, P.O. Box 653, Beer Sheva 84105 (Israel)

    2007-07-15

    Vapour pressures of water over saturated solutions of cadmium salts (chloride, bromide, iodide, nitrate, and sulphate) were determined over the temperature range 280 K to 322 K and compared with the literature data. The vapour pressures determined were used to obtain the water activities, osmotic coefficients and the molar enthalpies of vaporization in the (cadmium salt + water) systems.

  7. Calcium enhances cadmium tolerance and decreases cadmium ...

    African Journals Online (AJOL)

    Yomi

    2012-04-26

    Apr 26, 2012 ... concentrations alleviated the toxic effect of cadmium on the growth and water status of lettuce plants. The three lettuce varieties ... electroplating, in batteries, in electrical conductors, in the manufacture of alloys ..... Handbook on the Toxicology of Metals, Third edition, Salt Lake City, UT: Acad. Press. Österås ...

  8. Effect of and as probiotic on decreased absorption of cadmium in rat

    Directory of Open Access Journals (Sweden)

    M. Majlesi

    2016-08-01

    Full Text Available Cadmium is a wide-spread heavy metal that causes a wide range of health problems in animals and humans. Many reports showed the biosorption of heavy metals by bacteria. The objectives of this study were to evaluate the potency of probiotics bacteria of Lactobacillus plantarum and Bacillus coagulans against cadmium adsorption in rats. Twenty four male adult Wistar rats were randomly divided into six groups. Cadmium treated groups received 1 ml of 100 µg/ml CdCl2 and probiotics groups were administrated 1 ml of (109 CFU/ml of probiotics during 24 days by special gavage needle once daily. Levels of cadmium were determined by using graphite furnace atomic absorption spectrometry. Probiotics B. coagulans and L. plantarum caused 29.8% and 19.3% increasing in removal of cadmium through defecation and decreased 10.9 and 21.5 % of cadmium accumulation in kidney of Wistar rats. The results showed that oral administration of both probiotics offered a significant protective effect against cadmium adsorption in rats.

  9. Biosensors paving the way to understanding the interaction between cadmium and the estrogen receptor alpha.

    Directory of Open Access Journals (Sweden)

    Peter Fechner

    Full Text Available Cadmium is a toxic heavy metal ubiquitously present in the environment and subsequently in the human diet. Cadmium has been proposed to disrupt the endocrine system, targeting in particular the estrogen signaling pathway already at environmentally relevant concentrations. Thus far, the reports on the binding affinity of cadmium towards human estrogen receptor alpha (hERα have been contradicting, as have been the reports on the in vivo estrogenicity of cadmium. Hence, the mode of interaction between cadmium and the receptor remains unclear. Here, we investigated the interaction between cadmium and hERα on a molecular level by applying a novel, label-free biosensor technique based on reflectometric interference spectroscopy (RIfS. We studied the binding of cadmium to hERα, and the conformation of the receptor following cadmium treatment. Our data reveals that cadmium interacts with the ligand binding domain (LBD of the ERα and affects the conformation of the receptor. However, the binding event, as well as the induced conformation change, greatly depends on the accessibility of the cysteine tails in the LBD. As the LBD cysteine residues have been reported as targets of post-translational modifications in vivo, we present a hypothesis according to which different cellular pools of ERα respond to cadmium differently. Our proposed theory could help to explain some of the previously contradicting results regarding estrogen-like activity of cadmium.

  10. Simultaneous determination of oxygen and cadmium in cadmium and cadmium compounds

    International Nuclear Information System (INIS)

    Imaeda, K.; Kuriki, T.; Ohsawa, K.; Ishii, Y.

    1977-01-01

    Cadmium and its compounds were analysed for oxygen and cadmium by a modification of the Schutze-Unterzaucher method. Oxygen in some compounds such as cadmium oxide, nitrate and sulphate could not be determined by the usual method. The method of adding carbon was employed for the determination of total oxygen. Total oxygen could be determined by the addition of 5 mg of carbon to a sample boat and heating at 950 0 . The determination was also carried out by addition of naphthalene (2 mg). It was found that the cadmium powder and cadmium flake used contained ca. 1 and 0.15% oxygen, respectively. Oxygen and cadmium in cadmium and its compounds were simultaneously determined by the addition of 2 mg of naphthalene. Cadmium was determined colorimetrically by use of glyoxal-bis-(2-hydroxyanil). Oxygen and cadmium in the samples could be determined simultaneously with an average error of -0.02 and -0.22%, respectively. (author)

  11. Flux of Cadmium through Euphausiids

    International Nuclear Information System (INIS)

    Benayoun, G.; Fowler, S.W.; Oregioni, B.

    1976-01-01

    Flux of the heavy metal cadmium through the euphausiid Meganyctiphanes norvegica was examined. Radiotracer experiments showed that cadmium can be accumulated either directly from water or through the food chain. When comparing equilibrium cadmium concentration factors based on stable element measurements with those obtained from radiotracer experiments, it is evident that exchange between cadmium in the water and that in euphausiid tissue is a relatively slow process, indicating that, in the long term, ingestion of cadmium will probably be the more important route for the accumulation of this metal. Approximately 10% of cadmium ingested by euphausiids was incorporated into internal tissues when the food source was radioactive Artemia. After 1 month cadmium, accumulated directly from water, was found to be most concentrated in the viscera with lesser amounts in eyes, exoskeleton and muscle, respectively. Use of a simple model, based on the assumption that cadmium taken in by the organism must equal cadmium released plus that accumulated in tissue, allowed assessment of the relative importance of various metabolic parameters in controlling the cadmium flux through euphausiids. Fecal pellets, due to their relatively high rate of production and high cadmium content, accounted for 84% of the total cadmium flux through M. norvegica. Comparisons of stable cadmium concentrations in natural euphausiid food and the organism's resultant fecal pellets indicate that the cadmium concentration in ingested material was increased nearly 5-fold during its passage through the euphausiid. From comparisons of all routes by which cadmium can be released from M. norvegica to the water column, it is concluded that fecal pellet deposition represents the principal mechanism effecting the downward vertical transport of cadmium by this species. (author)

  12. Protective effects of synbiotic diets of Bacillus coagulans, Lactobacillus plantarum and inulin against acute cadmium toxicity in rats.

    Science.gov (United States)

    Jafarpour, Dornoush; Shekarforoush, Seyed Shahram; Ghaisari, Hamid Reza; Nazifi, Saeed; Sajedianfard, Javad; Eskandari, Mohammad Hadi

    2017-06-05

    Cadmium is a heavy metal that causes oxidative stress and has toxic effects in humans. The aim of this study was to investigate the influence of two probiotics along with a prebiotic in preventing the toxic effects of cadmium in rats. Twenty-four male Wistar rats were randomly divided into four groups namely control, cadmium only, cadmium along with Lactobacillus plantarum (1 × 109 CFU/day) and inulin (5% of feedstuff) and cadmium along with Bacillus coagulans (1 × 109 spore/day) and inulin (5% of feedstuff). Cadmium treated groups received 200 μg/rat/day CdCl2 administered by gavage. During the 42-day experimental period, they were weighed weekly. For evaluation of changes in oxidative stress, the levels of some biochemicals and enzymes of serum including SOD, GPX, MDA, AST, ALT, total bilirubin, BUN and creatinine, and also SOD level of livers were measured at day 21 and 42 of treatment. The cadmium content of kidney and liver was determined by using atomic absorption mass spectrophotometry. Data were analyzed using analysis of variance (ANOVA) followed by Duncan's post hoc test. Treatment of cadmium induced rats with synbiotic diets significantly improved the liver enzymes and biochemical parameters that decreased AST, ALT, total bilirubin, BUN and metal accumulation in the liver and kidney and increased body weight, serum and liver SOD values in comparison with the cadmium-treated group. No significant differences were observed with MDA and GP X values between all groups (p > 0.05). This study showed that synbiotic diets containing probiotics (L. plantarum and B. coagulans) in combination with the prebiotic (inulin) can reduce the level of cadmium in the liver and kidney, preventing their damage and recover antioxidant enzymes in acute cadmium poisoning in rat.

  13. Chlorination leaching of cadmium

    International Nuclear Information System (INIS)

    Lach, E.; Pajak, I.; Bojanowska, A.

    1978-01-01

    The results of the investigations on chlorination leaching of cadmium from dust coming from dry dust collector of sinter belt, that is leaching with water saturated with gaseous chlorine and leaching with solutions of ammonium chloride and sodium chloride were given. The optimum conditions for these processes were established. It was found, that the method of leaching in the presence of gaseous chlorine is more effective, as it allows to report into the solution over 90% cadmium contained in dust. Owing to technical difficulties, environmental protection and safety conditions more advantageous seems to be the use as leaching agent of the ammonium chloride solutions. When applying 20% NH 4 Cl and temperature of 60 0 C, the time of 2 hours and the ratio of solid to liquid of 1:5, 70% cadmium contained in the dust can be reported into the solution. (auth.)

  14. Uptake and translocation of 109Cd and stable Cd within tobacco plants (Nicotiana sylvestris)

    International Nuclear Information System (INIS)

    Rosén, K.; Eriksson, J.; Vinichuk, M.

    2012-01-01

    The availability, uptake, and translocation of recently added ( 109 Cd) and naturally occurring (stable) soil Cd within tobacco plants were compared. 109 Cd was added to soil in two treatments, A (0.25 MBq kg soil −1 DW) and B (eight-fold dose): stable Cd was measured in both treatments. Both the added and the stable Cd were higher in leaves and reproductive structures of the plant than in stalks and roots. The uptake of 109 Cd was 5.3 kBq plant −1 for treatment A and 36.7 kBq plant −1 for treatment B, and about 26 μg plant −1 for stable Cd. Leaves of the tobacco plants accumulated 40–45% of the total 109 Cd and about 50% of total stable Cd taken up by the plant. Cadmium concentration in the plant was three times higher than in roots and two times higher than the concentration in soil: the concentration in roots was lower than in the soil. - Capsule: The availability, uptake, and translocation of recently added ( 109 Cd) and naturally occurring (stable) soil Cd within tobacco plants (Nicotiana sylvestris) were investigated. - Highlights: ► We compared uptake recently added and naturally occurring soil Cd by tobacco plant. ► Both added and stable Cd display similar uptake and translocation within the plant. ► Leaves of tobacco plants accumulate half of the total Cd taken up by the plant. ► Recently added 109 Cd to soil is more available than naturally occurring cadmium.

  15. 46 CFR 109.577 - Helicopter fueling.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Helicopter fueling. 109.577 Section 109.577 Shipping... Miscellaneous § 109.577 Helicopter fueling. (a) The master or person in charge shall designate persons to conduct helicopter fueling operations. (b) Portable tanks are handled and stowed in accordance with...

  16. 46 CFR 109.521 - Cranes: General.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes: General. 109.521 Section 109.521 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Cranes § 109.521 Cranes: General. The master or person in charge shall ensure that each crane is operated and...

  17. 14 CFR 417.109 - Ground safety.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Ground safety. 417.109 Section 417.109... TRANSPORTATION LICENSING LAUNCH SAFETY Launch Safety Responsibilities § 417.109 Ground safety. (a) Ground safety... 417.115(c), and subpart E of this part provide launch operator ground safety requirements. ...

  18. 14 CFR 15.109 - Settlements.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Settlements. 15.109 Section 15.109... Act of 1958 § 15.109 Settlements. (a) A publisher may not settle a claim with another party, for which... publisher submits a copy of the proposed settlement, and a statement justifying the settlement, to the Chief...

  19. 23 CFR 500.109 - CMS.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false CMS. 500.109 Section 500.109 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION TRANSPORTATION INFRASTRUCTURE MANAGEMENT MANAGEMENT AND MONITORING SYSTEMS Management Systems § 500.109 CMS. (a) For purposes of this part, congestion means the level at...

  20. 9 CFR 3.109 - Separation.

    Science.gov (United States)

    2010-01-01

    ... Mammals Animal Health and Husbandry Standards § 3.109 Separation. Marine mammals, whenever known to be... in the same enclosure. Marine mammals must not be housed near other animals that cause them... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Separation. 3.109 Section 3.109...

  1. 46 CFR 109.555 - Propulsion boilers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Propulsion boilers. 109.555 Section 109.555 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Miscellaneous § 109.555 Propulsion boilers. The master or person in charge and the engineer in charge shall...

  2. 49 CFR 1580.109 - Preemptive effect.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Preemptive effect. 1580.109 Section 1580.109 Transportation Other Regulations Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION... Materials Receivers, and Private Cars § 1580.109 Preemptive effect. Under 49 U.S.C. 20106, issuance of the...

  3. 41 CFR 109-38.902 - Records.

    Science.gov (United States)

    2010-07-01

    ... 38-MOTOR EQUIPMENT MANAGEMENT 38.9-Federal Motor Vehicle Fleet Report § 109-38.902 Records. The... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Records. 109-38.902 Section 109-38.902 Public Contracts and Property Management Federal Property Management Regulations System...

  4. 40 CFR 109.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 109.2 Section 109.2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS CRITERIA FOR STATE, LOCAL AND REGIONAL OIL REMOVAL CONTINGENCY PLANS § 109.2 Definitions. As used in these guidelines, the...

  5. 40 CFR 59.109 - Circumvention.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Circumvention. 59.109 Section 59.109 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL... Compound Emission Standards for Automobile Refinish Coatings § 59.109 Circumvention. Each manufacturer and...

  6. 7 CFR 1220.109 - Eligible organization.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Eligible organization. 1220.109 Section 1220.109... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.109 Eligible organization. The term eligible organization means any organization which has been certified by the Secretary pursuant to...

  7. 41 CFR 105-1.109 - Numbering.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Numbering. 105-1.109 Section 105-1.109 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1.109 Numbering. ...

  8. 23 CFR 645.109 - Preliminary engineering.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Preliminary engineering. 645.109 Section 645.109 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS UTILITIES Utility Relocations, Adjustments, and Reimbursement § 645.109 Preliminary engineering. (a) As...

  9. 41 CFR 109-38.502 - Guidelines.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Guidelines. 109-38.502 Section 109-38.502 Public Contracts and Property Management Federal Property Management Regulations System... 38-MOTOR EQUIPMENT MANAGEMENT 38.5-Scheduled Maintenance § 109-38.502 Guidelines. ...

  10. 41 CFR 109-43.001 - Definition.

    Science.gov (United States)

    2010-07-01

    ... PERSONAL PROPERTY § 109-43.001 Definition. DOE screening period means the period of time that reportable... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Definition. 109-43.001 Section 109-43.001 Public Contracts and Property Management Federal Property Management Regulations System...

  11. 46 CFR 109.203 - Sanitation.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Sanitation. 109.203 Section 109.203 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Tests, Drills, and Inspections § 109.203 Sanitation. (a) The master or person in charge shall insure that the accommodation...

  12. 7 CFR 1160.109 - Milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Milk. 1160.109 Section 1160.109 Agriculture Regulations... Orders; Milk), DEPARTMENT OF AGRICULTURE FLUID MILK PROMOTION PROGRAM Fluid Milk Promotion Order Definitions § 1160.109 Milk. Milk means any class of cow's milk produced in the United States. ...

  13. 49 CFR 229.109 - Safety valves.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Safety valves. 229.109 Section 229.109..., DEPARTMENT OF TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Safety Requirements Steam Generators § 229.109 Safety valves. Every steam generator shall be equipped with at least two safety valves that have a...

  14. 47 CFR 69.109 - Information.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Information. 69.109 Section 69.109... Computation of Charges § 69.109 Information. (a) A charge shall be assessed upon all interexchange carriers..., the projected annual revenue requirement for the Information element shall be divided by 12 to compute...

  15. 19 CFR 207.109 - Discovery.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Discovery. 207.109 Section 207.109 Customs Duties... and Committee Proceedings § 207.109 Discovery. (a) Discovery methods. All parties may obtain discovery under such terms and limitations as the administrative law judge may order. Discovery may be by one or...

  16. 46 CFR 109.564 - Maneuvering characteristics.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Maneuvering characteristics. 109.564 Section 109.564 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Miscellaneous § 109.564 Maneuvering characteristics. (a) The master or person in charge of each...

  17. 47 CFR 97.109 - Station control.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station control. 97.109 Section 97.109... SERVICE Station Operation Standards § 97.109 Station control. (a) Each amateur station must have at least one control point. (b) When a station is being locally controlled, the control operator must be at the...

  18. 49 CFR 1572.109 - Mental capacity.

    Science.gov (United States)

    2010-10-01

    ... intelligence, mental illness, incompetence, condition, or disease, is a danger to himself or herself or to... 49 Transportation 9 2010-10-01 2010-10-01 false Mental capacity. 1572.109 Section 1572.109... ASSESSMENTS Standards for Security Threat Assessments § 1572.109 Mental capacity. (a) An applicant has mental...

  19. 40 CFR 109.6 - Coordination.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Coordination. 109.6 Section 109.6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS CRITERIA FOR STATE, LOCAL AND REGIONAL OIL REMOVAL CONTINGENCY PLANS § 109.6 Coordination. For the purposes of coordination...

  20. 26 CFR 509.109 - Interest.

    Science.gov (United States)

    2010-04-01

    ... SWITZERLAND General Income Tax § 509.109 Interest. The rate of United States tax imposed by the Internal Revenue Code of 1954 upon interest on bonds, securities, notes, debentures, or on any other form of... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Interest. 509.109 Section 509.109 Internal...

  1. Bioaccumulation and partitioning of cadmium within the freshwater mussel Dreissena polymorpha Pallas

    International Nuclear Information System (INIS)

    Bias, R.; Karbe, L.

    1985-01-01

    Kinetics of uptake, partitioning and elimination of cadmium were investigated in experimental studies with the freshwater mussel, Dreissena polymorpha. 109 Cd and 115 Cd were used as tracers. Shells, soft parts and body fluid of the mussel exhibited considerable differences in accumulation and elimination. Accumulation factors up to more than 70,000 were calculated for the periostracum, whereas accumulation factors for the whole mussels ranging up to 3,000 were calculated. The shells bound a great deal of cadmium, but only loosely, and the metal could be readily eliminated after transfer to uncontaminated water. In contrast, no significant amounts of the cadmium incorporated in the soft parts were eliminated. The results indicate that the major portion of cadmium in the soft parts is strongly bound and cannot be eliminated by exchange processes. (author)

  2. Cadmium plating replacements

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, M.J.; Groshart, E.C.

    1995-03-01

    The Boeing Company has been searching for replacements to cadmium plate. Two alloy plating systems seem close to meeting the needs of a cadmium replacement. The two alloys, zinc-nickel and tin-zinc are from alloy plating baths; both baths are neutral pH. The alloys meet the requirements for salt fog corrosion resistance, and both alloys excel as a paint base. Currently, tests are being performed on standard fasteners to compare zinc-nickel and tin-zinc on threaded hardware where cadmium is heavily used. The Hydrogen embrittlement propensity of the zinc-nickel bath has been tested, and just beginning for the tin-zinc bath. Another area of interest is the electrical properties on aluminum for tin-zinc and will be discussed. The zinc-nickel alloy plating bath is in production in Boeing Commercial Airplane Group for non-critical low strength steels. The outlook is promising that these two coatings will help The Boeing Company significantly reduce its dependence on cadmium plating.

  3. Cadmium: The deformed metal

    Energy Technology Data Exchange (ETDEWEB)

    Stubbs, R L [Cadmium Association, London (UK)

    1979-03-01

    The paper, which is a somewhat abridged version of the introductory paper of the 2nd International Cadmium Conference in Cannes on February 6 to 8, 1979, outlines the present trends in production, reserves, consumption, world trade, prices, and cost. Due to the lack of statistics on the USSR and other socialist countries, the review is limited to the non-socialist world.

  4. zinc, chromium, cadmium

    African Journals Online (AJOL)

    2016-06-30

    Jun 30, 2016 ... Cadmium also causes destruction of the immune system, thus, predisposes the consumer to infectious diseases like tuberculosis (Khan et al., 2008). ... years, sputum specimens positive for acid-fast bacilli by microscopy and clinical and radiographic abnormalities consistent with pulmonary tuberculosis.

  5. Determination of cadmium in environmental materials by fast neutron activation analysis

    International Nuclear Information System (INIS)

    Esprit, M.; Vandecasteele, C.; Hoste, J.

    1986-01-01

    Cadmium is determined by activation analysis with fast neutrons, obtained by irradiation of a thick beryllium target with 14.5-MeV deuterons. Cadmium-111m is separated by liquid-liquid extraction with zinc diethyldithiocarbamate in chloroform and measured with a Ge(Li) γ-spectrometer. For low concentrations, cadmium is precipitated as cadmium ammonium phosphate after the extraction. NBS and BCR reference materials were analyzed: for concentrations between 3 and 500 μg g -1 , the relative standard deviation ranges from 5 to 3%. The results obtained for sewage sludge are compared with those obtained by reactor neutron activation analysis. (Auth.)

  6. Cadmium Adsorption on HDTMA Modified Montmorillionite

    Directory of Open Access Journals (Sweden)

    Mohd. Elmuntasir I. Ahmed

    2009-06-01

    Full Text Available In this paper the possibility of cadmium removal from aqueous solutions by adsorption onto modified montmorillonite clay is investigated. Batch adsorption experiments performed revealed an enhanced removal of cadmium using HDTMA modified montmorillonite to 100% of its exchange capacity. Modified montmorillonite adsorption capacity increases at higher pHs suggesting adsorption occurs as a result of surface precipitation and HDTMA complex formation due to the fact that the original negatively charged montmorillonite is now covered by a cationic layer of HDTMA. Adsorption isotherms generated followed a Langmuir isotherm equation possibly indicating a monolayer coverage. Adsorption capacities of up to 49 mg/g and removals greater than 90% were achieved. Anionic selectivity of the HDTMA modified monmorillonite is particularly advantageous in water treatment applications where high concentrations of less adsorbable species are present, and the lack of organoclay affinity for these species may allow the available capacity to be utilized selectively by the targeted species.

  7. Cadmium in Sweden - environmental risks

    Energy Technology Data Exchange (ETDEWEB)

    Parkman, H; Iverfeldt, Aa [Swedish Environmental Research Inst. (Sweden); Borg, H; Lithner, G [Stockholm Univ. (Sweden). Inst. for Applied Environmental Research

    1998-03-01

    This report aims at assessing possible effects of cadmium in the Swedish environment. Swedish soils and soft freshwater systems are, due to a generally poor buffering capacity, severely affected by acidification. In addition, the low salinity in the Baltic Sea imply a naturally poor organism structure, with some important organisms living close to their limit of physiological tolerance. Cadmium in soils is mobilized at low pH, and the availability and toxicity of cadmium in marine systems are enhanced at low salinity. The Swedish environment is therefore extra vulnerable to cadmium pollution. The average concentrations of cadmium in the forest mor layers, agricultural soils, and fresh-waters in Sweden are enhanced compared to `back-ground concentrations`, with a general increasing trend from the north to the south-west, indicating strong impact of atmospheric deposition of cadmium originating from the central parts of Europe. In Swedish sea water, total cadmium concentrations, and the fraction of bio-available `free` cadmium, generally increases with decreasing salinity. Decreased emissions of cadmium to the environment have led to decreasing atmospheric deposition during the last decade. The net accumulation of cadmium in the forest mor layer has stopped, and even started to decrease. In northern Sweden, this is due to the decreased deposition, but in southern Sweden the main reason is increased leakage of cadmium from the topsoil as a consequence of acidification. As a result, cadmium in the Swedish environments is undergoing an extended redistribution between different soil compartments, and from the soils to the aquatic systems. 90 refs, 23 figs, 2 tabs. With 3 page summary in Swedish

  8. Biomedical silver-109m isotope generator

    Science.gov (United States)

    Wanek, Philip M.; Steinkruger, Frederick J.; Moody, David C.

    1987-01-01

    A method, composition of matter, and apparatus for producing substantially pure Ag-109m for use in biomedical imaging techniques. Cd-109, which decays with a half-life of 453 days to Ag-109m is loaded onto an ion exchange column consisting of particulate tin phosphate. After secular equilibrium is reached in about ten minutes, Ag-109m may be selectively eluted from the column by means of a physiologically acceptable aqueous buffered eluent solution of sodium thiosulfate, and either ascorbic acid or dextrose. The breakthrough of toxic Cd-109 is on the order of 1.times.10.sup.-7, which is sufficiently low to permit administration of the Ag-109m-containing eluate, with but a minor pH adjustment, directly to a human patient within a matter of seconds.

  9. Cadmium: The deformed metal

    International Nuclear Information System (INIS)

    Stubbs, R.L.

    1979-01-01

    The paper, which is a somewhat abridged version of the introductory paper of the 2nd International Cadmium Conference in Cannes on February 6 to 8, 1979, outlines the present trends in production, reserves, consumption, world trade, prices, and cost. Due to the lack of statistics on the USSR and other socialist countries, the review is limited to the non-socialist world. (orig./IHOE) [de

  10. 46 CFR 109.329 - Fire pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Fire pumps. 109.329 Section 109.329 Shipping COAST GUARD... of Safety Equipment § 109.329 Fire pumps. The master or person in charge shall insure that at least one of the fire pumps required in § 108.415 is ready for use on the fire main system at all times. ...

  11. Investigation of activation cross-sections of alpha-induced nuclear reactions on natural cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Khandaker, Mayeen Uddin [Department of Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Department of Physics, University of Malaya, 50603 Kuala Lumpur (Malaysia); Kim, Kwangsoo [Department of Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Lee, Manwoo [Department of Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Research Center, Dongnam Institute of Radiological and Medical Science, Busan 619-953 (Korea, Republic of); Kim, Guinyun, E-mail: gnkim@knu.ac.kr [Department of Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of)

    2014-08-15

    We measured production cross-sections of Sn, In, and Cd radionuclides from alpha-induced reactions on {sup nat}Cd from their respective threshold to 45 MeV by using a stacked-foil activation technique at the MC-50 cyclotron of the Korea Institute of Radiological and Medical Sciences. The results were compared with the earlier measurements as well as with the theoretical values obtained from the TENDL-2012 library based on the TALYS 1.4 code. Our measurements for the {sup 110,113g,117m}Sn, {sup 108m,108g,109g,110m,110g,111g,113m,114m,115m,116m,117m,117g}In, and {sup 111m,115g}Cd radionuclides in the energy region from the threshold energy to 45 MeV are in general good agreement with the other experimental data and calculated results. The integral yields for thick target were also deduced using the measured cross-sections and the stopping power of natural cadmium target and found in agreement with the directly measured yields available in the literature. The measured cross-sections find importance in various practical applications including nuclear medicine and improvement of nuclear model calculations.

  12. Subcellular site and nature of intracellular cadmium in plants

    International Nuclear Information System (INIS)

    Wagner, G.J.

    1979-01-01

    The mechanisms underlying heavy metal accumulation, toxicity, and tolerance in higher plants are poorly understood. Since subcellular processes are undoubtedly involved in all these phenomena, it is of interest to study the extent, subcellular site and nature of intracellularly accumulated cadmium in higher plants. Whole plants supplied 109 CdCl 2 or 112 CdSO 4 accumulated Cd into roots and aerial tissues. Preparation of protoplasts from aerial tissues followed by subcellular fractionation of the protoplasts to obtain intact vacuoles, chloroplasts and cytosol revealed the presence of Cd in the cytosol but not in vacuoles or chloroplasts. No evidence was obtained for the production of volatile Cd complexes in tobacco

  13. Cadmium in blood and hypertension

    International Nuclear Information System (INIS)

    Eum, Ki-Do; Lee, Mi-Sun; Paek, Domyung

    2008-01-01

    Objectives:: This study is to examine the effect of cadmium exposure on blood pressure in Korean general population. Methods:: The study population consisted of 958 men and 944 women who participated in the 2005 Korean National Health and Nutrition Examination Survey (KNHANES), in which blood pressure and blood cadmium were measured from each participant. Results:: The mean blood cadmium level was 1.67 μg/L (median level 1.55). The prevalence of hypertension was 26.2%. The blood cadmium level was significantly higher among those subjects with hypertension than those without (mean level 1.77 versus 1.64 μg/dL). After adjusting for covariates, the odds ratio of hypertension comparing the highest to the lowest tertile of cadmium in blood was 1.51 (95% confidence interval 1.13 to 2.05), and a dose-response relationship was observed. Systolic, diastolic, and mean arterial blood pressure were all positively associated with blood cadmium level, and this effect of cadmium on blood pressure was markedly stronger when the kidney function was reduced. Conclusions:: Cadmium exposures at the current level may have increased the blood pressure of Korean general population

  14. Cadmium in blood and hypertension

    Energy Technology Data Exchange (ETDEWEB)

    Eum, Ki-Do; Lee, Mi-Sun [Department of Environmental Health, Graduate School of Public Health and Institute of Health and Environment, Seoul National University, Seoul (Korea, Republic of); Paek, Domyung [Department of Environmental Health, Graduate School of Public Health and Institute of Health and Environment, Seoul National University, Seoul (Korea, Republic of)], E-mail: paekdm@snu.ac.kr

    2008-12-15

    Objectives:: This study is to examine the effect of cadmium exposure on blood pressure in Korean general population. Methods:: The study population consisted of 958 men and 944 women who participated in the 2005 Korean National Health and Nutrition Examination Survey (KNHANES), in which blood pressure and blood cadmium were measured from each participant. Results:: The mean blood cadmium level was 1.67 {mu}g/L (median level 1.55). The prevalence of hypertension was 26.2%. The blood cadmium level was significantly higher among those subjects with hypertension than those without (mean level 1.77 versus 1.64 {mu}g/dL). After adjusting for covariates, the odds ratio of hypertension comparing the highest to the lowest tertile of cadmium in blood was 1.51 (95% confidence interval 1.13 to 2.05), and a dose-response relationship was observed. Systolic, diastolic, and mean arterial blood pressure were all positively associated with blood cadmium level, and this effect of cadmium on blood pressure was markedly stronger when the kidney function was reduced. Conclusions:: Cadmium exposures at the current level may have increased the blood pressure of Korean general population.

  15. Subcellular site and nature of intracellular cadmium in plants

    International Nuclear Information System (INIS)

    Wagner, G.J.

    1979-01-01

    The mechanisms underlying heavy metal accumulation, toxicity and tolerance in higher plants are poorly understood. Since subcellular processes are undoubtedly involved in all these phenomena, it is of interest to study the extent of, subcellular site of and nature of intracellularly accumulated cadmium in higher plants. Whole plants supplied 109 CdCl 2 or 112 CdSO 4 accumulated Cd into roots and aerial tissues. Preparation of protoplasts from aerial tissue followed by subcellular fractionation of the protoplasts to obtain intact vacuoles, chloroplasts and cytosol revealed the presence of Cd in the cytosol but not in vacuoles or chloroplasts. Particulate materials containing other cell components were also labeled. Of the 109 Cd supplied to plants, 2 to 10% was recovered in both cytosol preparations and in particulate materials. Cytosol contained proteinaceous--Cd complexes, free metal and low molecular weight Cd complexes. Labeling of protoplasts gave similar results. No evidence was obtained for the production of volatile Cd complexes in tobacco

  16. 27 CFR 21.109 - Gasoline.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Gasoline. 21.109 Section 21.109 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF... Gasoline. (a) Distillation range. When 100 ml of gasoline are distilled, none shall distill below 90 °F...

  17. 41 CFR 109-38.5201 - Definition.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Definition. 109-38.5201... System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.52-Watercraft § 109-38.5201 Definition. As used in this...

  18. 41 CFR 109-40.5101 - Policy.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-40.5101... MOTOR VEHICLES 40-TRANSPORTATION AND TRAFFIC MANAGEMENT 40.51-Price-Anderson Coverage Certifications for Nuclear Shipments § 109-40.5101 Policy. Upon request of a carrier, an appropriate certification will be...

  19. 7 CFR 900.109 - Mediation agreement.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Mediation agreement. 900.109 Section 900.109 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... Mediation agreement. An agreement arrived at by mediation shall not become effective until approved by the...

  20. 33 CFR 127.109 - Lighting systems.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Lighting systems. 127.109 Section... Waterfront Facilities Handling Liquefied Natural Gas § 127.109 Lighting systems. (a) The marine transfer area for LNG must have a lighting system and separate emergency lighting. (b) All outdoor lighting must be...

  1. 7 CFR 1709.109 - Eligible projects.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Eligible projects. 1709.109 Section 1709.109... projects. Eligible projects are those that acquire, construct, extend, repair, upgrade or otherwise improve... are eligible. Projects providing or improving service to communities with extremely high energy costs...

  2. 20 CFR 653.109 - Data collection.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Data collection. 653.109 Section 653.109 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR SERVICES OF THE EMPLOYMENT... MSFWs who were served as to whether they were male, female, black, Hispanic, American Indian, Asian, or...

  3. 41 CFR 109-45.5105 - Reports.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Reports. 109-45.5105... Foreign Areas § 109-45.5105 Reports. (a) Proposed sales of foreign surplus personal property having an acquisition cost of $250,000 or more shall be reported to the DPMO and should include all pertinent data...

  4. 41 CFR 109-38.001 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Classification Group (FSCG) 38; material handling equipment set forth in FSCG 39; and fire fighting equipment set... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Definitions. 109-38.001 Section 109-38.001 Public Contracts and Property Management Federal Property Management Regulations System...

  5. 48 CFR 2131.109 - Advance agreements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Advance agreements. 2131... PRINCIPLES AND PROCEDURES Applicability 2131.109 Advance agreements. FAR 31.109 is applicable to FEGLI Program contracts, except that precontract costs and nonrecurring costs that exceed $100,000 will not be...

  6. 9 CFR 109.3 - Pasteurizers.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurizers. 109.3 Section 109.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STERILIZATION AND PASTEURIZATION AT...

  7. Large-sized and highly radioactive 3H and 109Cd Langmuir-Blodgett films

    International Nuclear Information System (INIS)

    Shibata, S.; Kawakami, H.; Kato, S.

    1994-02-01

    A device for the deposition of a radioactive Langmuir-Blodgett (LB) film was developed with the use of: (1) a modified horizontal lifting method, (2) an extremely shallow trough, and (3) a surface pressure-generating system without piston oil. It made a precious radioactive subphase solution repeatedly usable while keeping its radioactivity concentration as high as possible. Any large-size thin films can be prepared by just changing the trough size. Two monomolecular-layers of Y-type films of cadmium [ 3 H] icosanoate and 109 Cd icosanoate were built up as 3 H and 109 Cd β-sources for electron spectroscopy with intensities of 1.5 GBq (40 mCi) and 7.4 MBq (200 μCi), respectively, and a size of 65x200 mm 2 . Excellent uniformity of the distribution of deposited radioactivity was confirmed by autoradiography and photometry. (author)

  8. Cadmium exposure in the Swedish environment

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    This report gives a thorough description of cadmium in the Swedish environment. It comprises three parts: Cadmium in Sweden - environmental risks;, Cadmium in goods - contribution to environmental exposure;, and Cadmium in fertilizers, soil, crops and foods - the Swedish situation. Separate abstracts have been prepared for all three parts

  9. Cadmium and zinc

    International Nuclear Information System (INIS)

    Safaya, N.M.; McLean, J.E.; Halverson, G.A.

    1987-01-01

    Cadmium and zinc are naturally occurring trace metals that are often considered together because of their close geochemical association and similarities in chemical reactivity. The loss of two electrons from an atom of Cd or Zn imparts to each an electron configuration with completely filled d orbitals; this results in a highly stable 2/sup +/ oxidation state. But Cd and Zn differ greatly in their significance to biological systems. Whereas Zn is an essential nutrient for plants, animals, and humans, Cd is best known for its toxicity to plants and as a causative agent of several disease syndromes in animals and humans

  10. Exposure to environmental levels of waterborne cadmium impacts corticosteroidogenic and metabolic capacities, and compromises secondary stressor performance in rainbow trout

    International Nuclear Information System (INIS)

    Sandhu, Navdeep; McGeer, James C.; Vijayan, Mathilakath M.

    2014-01-01

    Highlights: •Low level chronic waterborne cadmium exposure did not evoke a plasma cortisol response in rainbow trout. •Chronic cadmium exposure increases liver and gill metabolic capacities. •Chronic cadmium exposure disrupts head kidney steroidogenic capacity. •Chronic cadmium exposure disrupts glucocorticoid and mineralocorticoid receptor protein expressions in target tissues. •Chronic cadmium exposure compromises physiological performances to a secondary stressor in trout. -- Abstract: The physiological responses to waterborne cadmium exposure have been well documented; however, few studies have examined animal performances at low exposure concentrations of this metal. We tested the hypothesis that longer-term exposure to low levels of cadmium will compromise the steroidogenic and metabolic capacities, and reduce the cortisol response to a secondary stressor in fish. To test this, juvenile rainbow trout (Oncorhynchus mykiss) were exposed to 0 (control), 0.75 or 2.0 μg/L waterborne cadmium in a flow-through system and were sampled at 1, 7 and 28 d of exposure. There were only very slight disturbances in basal plasma cortisol, lactate or glucose levels in response to cadmium exposure over the 28 d period. Chronic cadmium exposure significantly affected key genes involved in corticosteroidogenesis, including melanocortin 2 receptor, steroidogenic acute regulatory protein and cytochrome P450 side chain cleavage enzyme. At 28 d, the high cadmium exposure group showed a significant drop in the glucocorticoid receptor and mineralocorticoid receptor protein expressions in the liver and brain, respectively. There were also perturbations in the metabolic capacities in the liver and gill of cadmium-exposed trout. Subjecting these fish to a secondary handling disturbance led to a significant attenuation of the stressor-induced plasma cortisol, glucose and lactate levels in the cadmium groups. Collectively, although trout appears to adjust to subchronic exposure

  11. Exposure to environmental levels of waterborne cadmium impacts corticosteroidogenic and metabolic capacities, and compromises secondary stressor performance in rainbow trout

    Energy Technology Data Exchange (ETDEWEB)

    Sandhu, Navdeep [Department of Biology, University of Waterloo, Waterloo, Ontario N2L 3G1 (Canada); McGeer, James C. [Department of Biology, Wilfrid Laurier University, Waterloo, Ontario N2L 3C5 (Canada); Vijayan, Mathilakath M., E-mail: matt.vijayan@ucalgary.ca [Department of Biology, University of Waterloo, Waterloo, Ontario N2L 3G1 (Canada)

    2014-01-15

    Highlights: •Low level chronic waterborne cadmium exposure did not evoke a plasma cortisol response in rainbow trout. •Chronic cadmium exposure increases liver and gill metabolic capacities. •Chronic cadmium exposure disrupts head kidney steroidogenic capacity. •Chronic cadmium exposure disrupts glucocorticoid and mineralocorticoid receptor protein expressions in target tissues. •Chronic cadmium exposure compromises physiological performances to a secondary stressor in trout. -- Abstract: The physiological responses to waterborne cadmium exposure have been well documented; however, few studies have examined animal performances at low exposure concentrations of this metal. We tested the hypothesis that longer-term exposure to low levels of cadmium will compromise the steroidogenic and metabolic capacities, and reduce the cortisol response to a secondary stressor in fish. To test this, juvenile rainbow trout (Oncorhynchus mykiss) were exposed to 0 (control), 0.75 or 2.0 μg/L waterborne cadmium in a flow-through system and were sampled at 1, 7 and 28 d of exposure. There were only very slight disturbances in basal plasma cortisol, lactate or glucose levels in response to cadmium exposure over the 28 d period. Chronic cadmium exposure significantly affected key genes involved in corticosteroidogenesis, including melanocortin 2 receptor, steroidogenic acute regulatory protein and cytochrome P450 side chain cleavage enzyme. At 28 d, the high cadmium exposure group showed a significant drop in the glucocorticoid receptor and mineralocorticoid receptor protein expressions in the liver and brain, respectively. There were also perturbations in the metabolic capacities in the liver and gill of cadmium-exposed trout. Subjecting these fish to a secondary handling disturbance led to a significant attenuation of the stressor-induced plasma cortisol, glucose and lactate levels in the cadmium groups. Collectively, although trout appears to adjust to subchronic exposure

  12. Cadmium immobilization by hydroxyapatite

    Directory of Open Access Journals (Sweden)

    Smičiklas Ivana D.

    2003-01-01

    Full Text Available The contamination of air, soil and water by cadmium is a great environmental problem. If cadmium occurs in nature in ionic form, soluble in water, it easily enters into the food chain. Hydroxyapatite (HAP, Ca-o(POAe(OH2 is a sparingly soluble salt and an excellent matrix for the removal of heavy metals from solutions. Considerable research attention has been paid to the bond between Cc/2+ ions and synthetic hydroxyapatite of known composition. The sorption mechanism is complex. The dominant process is ion exchange, but surface adsorption, surface complexation and coprecipitation can also contribute to the overall mechanism. The sorption capacity depends on the characteristics of hydroxyapatite itself and on the experimental conditions. Under optimum conditions a maximum capacity of 0.8 mol Cd2+/mol HAP can be achieved. HAP is a potential sorbent for the remediation of contaminated water and soil, for industrial waste treatment, and it is also referenced as a material that can be used as a barrier around waste depositories.

  13. Low serum zinc is associated with elevated risk of cadmium nephrotoxicity

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Yu-Sheng, E-mail: Lin.Yu-Sheng@epa.gov [National Center for Environmental Assessment, Office of Research and Development, U.S. Environmental Protection Agency, Washington, DC (United States); Ho, Wen-Chao [Department of Public Health, College of Public Health, China Medical University, Taichung, Taiwan (China); Caffrey, James L. [Integrative Physiology and Cardiovascular Research Institute, University of North Texas Health Science Center, Fort Worth, TX (United States); Sonawane, Babasaheb [National Center for Environmental Assessment, Office of Research and Development, U.S. Environmental Protection Agency, Washington, DC (United States)

    2014-10-15

    Background: Despite animal evidence suggests that zinc modulates cadmium nephrotoxicity, limited human data are available. Objective: To test the hypothesis that low serum zinc concentrations may increase the risk of cadmium-mediated renal dysfunction in humans. Methods: Data from 1545 subjects aged 20 or older in the National Health and Nutrition Examination Survey (NHANES), 2011–2012 were analyzed. Renal function was defined as impaired when estimated glomerular filtration rate (eGFR) fell below 60 ml/min/1.73 m{sup 2} and/or the urinary albumin-to-creatinine ratio surpassed 2.5 in men and 3.5 mg/mmol in women. Results: Within the study cohort, 117 subjects had reduced eGFR and 214 had elevated urinary albumin. After adjusting for potential confounders, subjects with elevated blood cadmium (>0.53 μg/L) were more likely to have a reduced eGFR (odds ratio [OR]=2.21, 95% confidence interval [CI]: 1.09–4.50) and a higher urinary albumin (OR=2.04, 95% CI: 1.13–3.69) than their low cadmium (<0.18 μg/L) peers. In addition, for any given cadmium exposure, low serum zinc is associated with elevated risk of reduced eGFR (OR=3.38, 95% CI: 1.39–8.28). A similar increase in the odds ratio was observed between declining serum zinc and albuminuria but failed to reach statistical significance. Those with lower serum zinc/blood cadmium ratios were likewise at a greater risk of renal dysfunction (p<0.01). Conclusions: This study results suggest that low serum zinc concentrations are associated with an increased risk of cadmium nephrotoxicity. Elevated cadmium exposure is global public health issue and the assessment of zinc nutritional status may be an important covariate in determining its effective renal toxicity. - Highlights: • Blood cadmium was associated with increased risk of nephrotoxicity. • Low serum zinc may exacerbate risk of cadmium-mediated renal dysfunction. • Both zinc deficiency and elevated cadmium exposure are global public health issues.

  14. Cadmium colours: composition and properties

    International Nuclear Information System (INIS)

    Paulus, J.; Knuutinen, U.

    2004-01-01

    The composition and the properties of cadmium aquarelle colours are discussed. The examined colours were 24 different aquarelle cadmium colours from six different manufacturers. The colours ranged from light, bright yellows to dark, deep-red tones. The aim of this research was to find out if the pigments contain cadmium salts: sulphides and/or selenides. This information will help in choosing watercolours in conservation processes. Today, aquarelle colours not containing cadmium pigments are being sold as cadmium colours; thus their properties might be different from actual cadmium colours. The aim of the research was to verify that the colour samples contained cadmium pigments and to estimate their compositions and ageing properties. Element analyses were performed from colour samples using micro-chemical tests and X-ray fluorescence measurements. Thin-layer chromatography was used for analysing gum Arabic as a possible binding medium in the chosen colour samples. Through ageing tests, the resistance of the colour samples to the exposure to light, heat and humidity was studied. Visible-light spectroscopy was used in determining the hues and hue changes of the aquarelle colour samples. The spectrophotometer used the CIE L * a * b * tone colour measuring system. From the colour measurements the changes in the lightness/darkness, the redness, the yellowness and the saturation of the samples were examined. (orig.)

  15. Cadmium in the biofuel system

    International Nuclear Information System (INIS)

    Aabyhammar, T.; Fahlin, M.; Holmroos, S.

    1993-12-01

    Removal of biofuel depletes the soil of important nutrients. Investigations are being made of possibilities to return most of these nutrients by spreading the ashes remaining after combustion in the forest or on field. Return of ashes implies that both beneficial and harmful substances are returned. This study has been conducted to illustrate that the return of cadmium implies the greatest risk for negative influences. The occurrence, utilization, emissions and effects of cadmium are discussed. The behaviour of cadmium in soil is discussed in detail. Flows and quantities of cadmium in Swedish society are reviewed. Flows and quantities of both total and plant available cadmium in the entire forest and arable areas of Sweden are given. A scenario for a bioenergy system of max 100 TWh is discussed. The cadmium flow in different biofuels and forest raw products, and anticipated amounts of ashes and cadmium concentrations, are calculated. Power production from biofuels is surveyed. Possibilities to clean ashes have been examined in laboratory experiments. Ashes and trace elements occurring as a result of the gasification of biofuels are reviewed. Strategies for handling ashes are discussed. Proposals on continued inputs in both the biological and technical sciences are made. 146 refs, 23 figs, 38 tabs

  16. Cadmium exposure in association with history of stroke and heart failure

    Energy Technology Data Exchange (ETDEWEB)

    Peters, Junenette L., E-mail: jpeters@hsph.harvard.edu [Department of Environmental Health, Harvard School of Public Health, Landmark Center, P.O. Box 15697, 401 Park Drive, Boston, MA 02215 (United States); Perlstein, Todd S. [Division of Cardiology, Department of Medicine, Brigham and Women' s Hospital, Harvard Medical School, Boston, MA (United States); Perry, Melissa J.; McNeely, Eileen [Department of Environmental Health, Harvard School of Public Health, Landmark Center, P.O. Box 15697, 401 Park Drive, Boston, MA 02215 (United States); Weuve, Jennifer [Department of Environmental Health, Harvard School of Public Health, Landmark Center, P.O. Box 15697, 401 Park Drive, Boston, MA 02215 (United States); Rush Institute for Healthy Aging, Rush University, Chicago, IL (United States)

    2010-02-15

    Background: It is unclear whether environmental cadmium exposure is associated with cardiovascular disease, although recent data suggest associations with myocardial infarction and peripheral arterial disease. Objective: The objective of this study was to evaluate the association of measured cadmium exposure with stroke and heart failure (HF) in the general population. Methods: We analyzed data from 12,049 participants, aged 30 years and older, in the 1999-2006 National Health and Nutrition Examination Survey (NHANES) for whom information was available on body mass index, smoking status, alcohol consumption, and socio-demographic characteristics. Results: At their interviews, 492 persons reported a history of stroke, and 471 a history of HF. After adjusting for demographic and cardiovascular risk factors, a 50% increase in blood cadmium corresponded to a 35% increased odds of prevalent stroke [OR: 1.35; 95% confidence interval (CI): 1.12-1.65] and a 50% increase in urinary cadmium corresponded to a 9% increase in prevalent stroke [OR: 1.09; 95% CI: 1.00-1.19]. This association was higher among women [OR: 1.38; 95% CI: 1.11-1.72] than men [OR: 1.30; 95% CI: 0.93-1.79] (p-value for interaction=0.05). A 50% increase in blood cadmium corresponded to a 48% increased odds of prevalent HF [OR: 1.48; 95% CI: 1.17-1.87] and a 50% increase in urinary cadmium corresponded to a 12% increase in prevalent HF [OR: 1.12; 95% CI: 1.03-1.20], with no difference in sex-specific associations. Conclusions: Environmental exposure to cadmium was associated with significantly increased stroke and heart failure prevalence. Cadmium exposure may increase these important manifestations of cardiovascular disease.

  17. Bioavailability of cadmium from infant diets in newborn rats

    International Nuclear Information System (INIS)

    Eklund, G.; Oskarsson, A.; Petersson Grawe, K.

    2001-01-01

    Infants are exposed to higher levels of cadmium (Cd) from infant and follow-on formulas than from breast milk. We studied the bioavailability of 109 CdCl 2 from cows' milk formula, soy formula, wheat/oat/milk formula, wholemeal/milk formula and water in 11-day-old rat pups. The pups received a single oral dose of one diet labelled with 109 Cd, 0.1 or 0.3 mg Cd/kg body weight. After 2 or 24 h or 4, 9 or 12 days the fractional retention of 109 Cd in the whole body, in segments of rinsed small intestine and in tissue was measured in a gamma counter. Pups receiving 109 Cd in water or cows' milk formula had the highest mean whole-body retention. It ranged from 67% of the dose in the water group to 52% in the wholemeal/milk formula group 4 days after dosing. The retention of 109 Cd in the rinsed small intestine was significantly higher in the water group and the cows' milk formula group than in the cereal-based formula groups at 24 h and 4 days after dosing. It was still high in all groups on day 9, ranging from 26 to 11%. Initially most of the 109 Cd was retained in the duodenum but by day 4 it had moved further down into the jejunum. In the liver, the highest and lowest retention on day 4 was 16 permille and 3 permille of the dose in the water group and wholemeal/milk formula group, respectively. In the kidney, 109 Cd was still increasing 12 days after exposure in all groups. Whole-body retention and tissue levels were higher than previously reported in adult animals. The lower bioavailability of 109 Cd from the cereal-based formulas compared to water and cows' milk formula on the longer survival times is most likely explained by Cd binding to dietary fibre and phytic acid in the cereal-based formulas reducing the intestinal binding and decreasing the bioavailability of Cd. The high retention of 109 Cd in the small intestine, leading to a prolonged absorption period, emphasizes the importance of extending studies on neonatal Cd absorption over a long time period in

  18. Bioavailability of cadmium from infant diets in newborn rats

    Energy Technology Data Exchange (ETDEWEB)

    Eklund, G.; Oskarsson, A. [Dept. of Pharmacology and Toxicology, Swedish University of Agricultural Sciences, Uppsala (Sweden); Petersson Grawe, K. [Toxicology Div., National Food Administration, Uppsala (Sweden)

    2001-11-01

    Infants are exposed to higher levels of cadmium (Cd) from infant and follow-on formulas than from breast milk. We studied the bioavailability of {sup 109}CdCl{sub 2} from cows' milk formula, soy formula, wheat/oat/milk formula, wholemeal/milk formula and water in 11-day-old rat pups. The pups received a single oral dose of one diet labelled with {sup 109}Cd, 0.1 or 0.3 mg Cd/kg body weight. After 2 or 24 h or 4, 9 or 12 days the fractional retention of {sup 109}Cd in the whole body, in segments of rinsed small intestine and in tissue was measured in a gamma counter. Pups receiving {sup 109}Cd in water or cows' milk formula had the highest mean whole-body retention. It ranged from 67% of the dose in the water group to 52% in the wholemeal/milk formula group 4 days after dosing. The retention of {sup 109}Cd in the rinsed small intestine was significantly higher in the water group and the cows' milk formula group than in the cereal-based formula groups at 24 h and 4 days after dosing. It was still high in all groups on day 9, ranging from 26 to 11%. Initially most of the {sup 109}Cd was retained in the duodenum but by day 4 it had moved further down into the jejunum. In the liver, the highest and lowest retention on day 4 was 16 permille and 3 permille of the dose in the water group and wholemeal/milk formula group, respectively. In the kidney, {sup 109}Cd was still increasing 12 days after exposure in all groups. Whole-body retention and tissue levels were higher than previously reported in adult animals. The lower bioavailability of {sup 109}Cd from the cereal-based formulas compared to water and cows' milk formula on the longer survival times is most likely explained by Cd binding to dietary fibre and phytic acid in the cereal-based formulas reducing the intestinal binding and decreasing the bioavailability of Cd. The high retention of {sup 109}Cd in the small intestine, leading to a prolonged absorption period, emphasizes the importance of

  19. 41 CFR 109-50.204 - Limitations.

    Science.gov (United States)

    2010-07-01

    ... DISPOSAL AUTHORITIES 50.2-Math and Science Equipment Gift Program § 109-50.204 Limitations. (a) Excess and... (or unlimited) level of authority. (d) Gifts shall be serviceable and in working order. Disposal...

  20. Aequorin chimeras as valuable tool in the measurement of Ca2+ concentration during cadmium injury

    International Nuclear Information System (INIS)

    Biagioli, M.; Pinton, P.; Scudiero, R.; Ragghianti, M.; Bucci, S.; Rizzuto, R.

    2005-01-01

    The ability of cadmium to disrupt calcium homeostasis has been known since a long time, but the precise cellular targets of its toxic action are still debated. A great problem in the interpretation of data has been associated with the ability of cadmium to strongly bind traditional calcium probes. Aequorin, the well-characterized calcium-sensitive photoprotein, was used as intracellular calcium indicator during cadmium injury in NIH 3T3 murine fibroblasts. NIH 3T3 cells were transfected with a cDNA construct containing aequorin fused to a truncated glutamate receptor, which directs the probe to the outer surface of intracellular membranes. At first, we tested if different cadmium concentrations were able to modify the rate of light emission by aequorin showing that cadmium concentrations 2+ /Ca 2+ interference. To directly investigate the role of Cd 2+ in Ca 2+ homeostasis, we have started to selectively measure the free Ca 2+ concentration in different cell compartments. Here, we report that cadmium reduces the transient free calcium signal after stimulation of cells with bradykinin. Further studies are in progress to clarify the role of mitochondria and endoplasmic reticulum in cadmium-induced alterations of Ca 2+ homeostasis in order to link signal transduction modifications with the onset of apoptosis induced by cadmium exposure

  1. Cadmium-containing waste and recycling possibilities

    International Nuclear Information System (INIS)

    Wiegand, V.; Rauhut, A.

    1981-01-01

    To begin with, the processes of cadmium production from zinc ores in smelting plants or from intermediates of other metal works are described. A considerable amount of the cadmium is obtained in the recycling process in zinc, lead, and copper works. The way of the cadmium-containing intermediaries, processing, enrichment, and disposal of cadmium waste are described. Uses of cadmium and its compounds are mentioned, and cadmium consumption in the years 1973-1977 in West Germany is presented in a table. Further chapters discuss the production and the way of waste during production and processing of cadmium-containing products, the problem of cadmium in household refuse and waste incineration plants, and the problem of cadmium emissions. (IHOE) [de

  2. Discovery of the cadmium isotopes

    International Nuclear Information System (INIS)

    Amos, S.; Thoennessen, M.

    2010-01-01

    Thirty-seven cadmium isotopes have been observed so far and the discovery of these isotopes is discussed here. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. First observation of 109Te β+ and electron capture decay to levels of 109Sb

    International Nuclear Information System (INIS)

    Ressler, J.J.; Walters, W.B.; Shergur, J.; Davids, C.N.; Heinz, A.; Seweryniak, D.; Dean, D.J.; Hjorth-Jensen, M.

    2002-01-01

    Low-spin levels in 109 Sb populated by 109 Te beta decay are reported for the first time. Seven new levels are proposed, two below 1 MeV excitation energy. Spins and parities of (1/2 + ) and (3/2 + ,5/2 + ) are suggested for the low energy levels by comparison to beta feeding intensities and systematics. These results are compared with new calculated levels for 109 Sb

  4. Biological indicators of cadmium exposure and toxicity

    Energy Technology Data Exchange (ETDEWEB)

    Shaikh, Z A; Smith, L M

    1986-01-01

    The increasing environmental and occupational exposure of populations to cadmium creates the need for biological indicators of cadmium exposure and toxicity. The advantages and disadvantages of monitoring blood cadmium, urinary, fecal, hair, and tissue cadmium, serum creatine, beta 2-microglobulin, alpha 1-anti-trypsin and other proteins, and urinary amino acids, enzymes, total proteins, glucose, beta 2-microglobulin, retinol-binding protein, lysozyme, and metallothionein are discussed. It is concluded that urinary cadmium, metallothionein and beta 2-microglubulin may be used together to assess cadmium exposure and toxicity. 66 references.

  5. The toxicokinetics of cadmium in carp under normoxic and hypoxic conditions

    International Nuclear Information System (INIS)

    Hattink, Jasper; Boeck, Gudrun De; Blust, Ronny

    2005-01-01

    Temporal depletion of oxygen, i.e. hypoxic events, frequently occurs in natural waters. It has been suggested that accumulation of micro-pollutants increases in aquatic animals as a result of an increased ventilation rate during such occasions. The observed increased toxicity under hypoxia of micro-pollutants may support this hypothesis, but for heavy metals the available uptake studies are contradictory. The present study tests whether accumulation of cadmium in common carp, Cyprinus carpio (L.) is increased under hypoxia and if the toxicokinetics are altered. A cadmium toxicity study was performed in which the cadmium uptake rates were determined using the radiotracer 109 Cd under hypoxia and normoxia. The cadmium toxicokinetics were studied with radiotracer experiments at 100% air saturation, 50%, and 25% saturation from 6.5 nmol/L Cd at 25 deg C. We could confirm the higher sensitivity of carp to cadmium under hypoxia. Hypoxic conditions did not influence the uptake rates or the accumulation dynamics. Therefore, the increased sensitivity of carp for Cd under hypoxia cannot be explained by a higher Cd body burden, initiated by a higher uptake rate or lower elimination rate under hypoxia. Additional, possible indirect effects, such as internal anoxia due to gill damage, could play a role in Cd toxicity under hypoxia

  6. The toxicokinetics of cadmium in carp under normoxic and hypoxic conditions

    Energy Technology Data Exchange (ETDEWEB)

    Hattink, Jasper [University of Antwerp, Department of Biology, Laboratory of Ecophysiology, Biochemistry, and Toxicology, Groenenborgerlaan 171, 2020 Antwerp (Belgium)]. E-mail: jasper.hattink@ua.ac.be; Boeck, Gudrun De [University of Antwerp, Department of Biology, Laboratory of Ecophysiology, Biochemistry, and Toxicology, Groenenborgerlaan 171, 2020 Antwerp (Belgium); Blust, Ronny [University of Antwerp, Department of Biology, Laboratory of Ecophysiology, Biochemistry, and Toxicology, Groenenborgerlaan 171, 2020 Antwerp (Belgium)

    2005-10-05

    Temporal depletion of oxygen, i.e. hypoxic events, frequently occurs in natural waters. It has been suggested that accumulation of micro-pollutants increases in aquatic animals as a result of an increased ventilation rate during such occasions. The observed increased toxicity under hypoxia of micro-pollutants may support this hypothesis, but for heavy metals the available uptake studies are contradictory. The present study tests whether accumulation of cadmium in common carp, Cyprinus carpio (L.) is increased under hypoxia and if the toxicokinetics are altered. A cadmium toxicity study was performed in which the cadmium uptake rates were determined using the radiotracer {sup 109}Cd under hypoxia and normoxia. The cadmium toxicokinetics were studied with radiotracer experiments at 100% air saturation, 50%, and 25% saturation from 6.5 nmol/L Cd at 25 deg C. We could confirm the higher sensitivity of carp to cadmium under hypoxia. Hypoxic conditions did not influence the uptake rates or the accumulation dynamics. Therefore, the increased sensitivity of carp for Cd under hypoxia cannot be explained by a higher Cd body burden, initiated by a higher uptake rate or lower elimination rate under hypoxia. Additional, possible indirect effects, such as internal anoxia due to gill damage, could play a role in Cd toxicity under hypoxia.

  7. Examination of some chelating agents to decorporate fixed body-burdens of cadmium

    International Nuclear Information System (INIS)

    Jones, C.W.; Lloyd, R.D.; Mays, C.W.

    1979-01-01

    Male and female C57BL/Do mice, five to six months old, were injected intraperitoneally with 2.0 mg/kg cadmium citrate labeled with about 2.0 μCi 109 Cd per mouse. Three days after cadmium injection, male mice were injected subcutaneously with 2,3 dimercaptopropanesulfonate (DMPS), and female mice were injected subcutaneously with calcium disodium ethylenediaminetetra-acetate (CaEDTA), salicylic acid (SA), or 2,3 dimercaptopropanesulfonate, alone, or in combination. A total of four treatment injections were administered to each group of mice. Cadmium total-body retention was measured by in vivo counting using NaI(T1) spectrometry. Male mice given DMPS, and groups of females given EDTA, SA, EDTA + DMPS, EDTA + SA, or EDTA + DMPS + SA had total-body retentions of cadmium no different from saline controls (P > 0.05). Measurement of cadmium content in kidneys, livers, gonads, and femora excised from test animals also showed no difference from corresponding organs in control animals

  8. The relationship between cadmium in kidney and cadmium in urine and blood in an environmentally exposed population

    International Nuclear Information System (INIS)

    Akerstrom, Magnus; Barregard, Lars; Lundh, Thomas; Sallsten, Gerd

    2013-01-01

    Introduction: Cadmium (Cd) is toxic to the kidney and a major part of the body burden occurs here. Cd in urine (U-Cd) and blood (B-Cd) are widely-used biomarkers for assessing Cd exposure or body burden. However, empirical general population data on the relationship between Cd in kidney (K-Cd), urine, and blood are scarce. Our objectives were to determine the relationship between cadmium in kidney, urine, and blood, and calculate the elimination half-time of Cd from the kidney. Methods: Kidney cortex biopsies, urine, and blood samples were collected from 109 living kidney donors. Cd concentrations were determined and the relationships between K-Cd, U-Cd, and B-Cd were investigated in regression models. The half-time of K-Cd was estimated from the elimination constant. Results: There was a strong association between K-Cd and U-Cd adjusted for creatinine (r p = 0.70, p p = 0.44, p < 0.001). The relationship between K-Cd and U-Cd was nonlinear, with slower elimination of Cd at high K-Cd. Estimates of the K-Cd half-time varied between 18 and 44 years. A K-Cd of 25 μg/g corresponds to U-Cd of 0.42 μg/g creatinine in overnight urine (U-Cd/K-Cd ratio: about 1:60). Multivariate models showed Cd in blood and urinary albumin as determinants for U-Cd excretion. Discussion: In healthy individuals with low-level Cd exposure, there was a strong correlation between Cd in kidney and urine, especially after adjustment for creatinine. Urinary Cd was also affected by Cd in blood and urinary albumin. Previous estimates of the U-Cd/K-Cd ratio may underestimate K-Cd at low U-Cd. - Highlights: ► The first study of the relation between Cd in kidney, blood and urine at low U-Cd ► Simultaneous samples were collected from healthy kidney donors. ► There was a nonlinear relationship between cadmium in kidney and urine. ► Estimates of the kidney cadmium half-time were 18–44 years, depending on model used. ► Previous data seem to underestimate kidney cadmium at low urinary cadmium

  9. The relationship between cadmium in kidney and cadmium in urine and blood in an environmentally exposed population

    Energy Technology Data Exchange (ETDEWEB)

    Akerstrom, Magnus, E-mail: magnus.akerstrom@amm.gu.se [Department of Occupational and Environmental Medicine, Sahlgrenska University Hospital, University of Gothenburg, Gothenburg (Sweden); Barregard, Lars [Department of Occupational and Environmental Medicine, Sahlgrenska University Hospital, University of Gothenburg, Gothenburg (Sweden); Lundh, Thomas [Department of Occupational and Environmental Medicine, Lund University Hospital, Lund University, Lund (Sweden); Sallsten, Gerd [Department of Occupational and Environmental Medicine, Sahlgrenska University Hospital, University of Gothenburg, Gothenburg (Sweden)

    2013-05-01

    Introduction: Cadmium (Cd) is toxic to the kidney and a major part of the body burden occurs here. Cd in urine (U-Cd) and blood (B-Cd) are widely-used biomarkers for assessing Cd exposure or body burden. However, empirical general population data on the relationship between Cd in kidney (K-Cd), urine, and blood are scarce. Our objectives were to determine the relationship between cadmium in kidney, urine, and blood, and calculate the elimination half-time of Cd from the kidney. Methods: Kidney cortex biopsies, urine, and blood samples were collected from 109 living kidney donors. Cd concentrations were determined and the relationships between K-Cd, U-Cd, and B-Cd were investigated in regression models. The half-time of K-Cd was estimated from the elimination constant. Results: There was a strong association between K-Cd and U-Cd adjusted for creatinine (r{sub p} = 0.70, p < 0.001), while the association with B-Cd was weaker (r{sub p} = 0.44, p < 0.001). The relationship between K-Cd and U-Cd was nonlinear, with slower elimination of Cd at high K-Cd. Estimates of the K-Cd half-time varied between 18 and 44 years. A K-Cd of 25 μg/g corresponds to U-Cd of 0.42 μg/g creatinine in overnight urine (U-Cd/K-Cd ratio: about 1:60). Multivariate models showed Cd in blood and urinary albumin as determinants for U-Cd excretion. Discussion: In healthy individuals with low-level Cd exposure, there was a strong correlation between Cd in kidney and urine, especially after adjustment for creatinine. Urinary Cd was also affected by Cd in blood and urinary albumin. Previous estimates of the U-Cd/K-Cd ratio may underestimate K-Cd at low U-Cd. - Highlights: ► The first study of the relation between Cd in kidney, blood and urine at low U-Cd ► Simultaneous samples were collected from healthy kidney donors. ► There was a nonlinear relationship between cadmium in kidney and urine. ► Estimates of the kidney cadmium half-time were 18–44 years, depending on model used. ► Previous

  10. Uptake and distribution of cadmium in corn

    International Nuclear Information System (INIS)

    Peel, J.W.; Vetter, R.J.; Christian, J.E.; Kessler, W.V.; McFee, W.W.

    1978-01-01

    The uptake and distribution of cadmium in corn (Zea mays) treated at various time intervals after planting and sampled at various times after treatment were measured. Cadmium was found to accumulate in all parts sampled. As shown in field studies, stems and leaves generally concentrated more cadmium than did husks, cobs, kernels, silks, or tassels. Samples of stems and leaves from corn treated 23 days after planting and sampled 5 days later exhibited higher concentrations of cadmium than samples taken 25, 45, 65, or 85 days after treatment. Concentrations generally decreased with time. Greenhouse studies showed that corn exposed to cadmium for the longest period of time accumulated the greatest total cadmium. The highest cadmium concentrations were found in the base or lowest leaves sampled 45 days after planting; this suggests a useful technique for quick screening corn crops for cadmium pollution

  11. Zinc-induced protection against cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Early, J.L.; Schnell, R.C.

    1978-02-01

    Pretreatment of male rats with cadmium acetate potentiates the duration of hexobarbital hypnosis and inhibits the rate of hepatic microsomal drug metabolism. Pretreatment of rats with zinc acetate protects against these alterations in drug action elicited by cadmium.

  12. Cadmium exposure is associated with soluble urokinase plasminogen activator receptor, a circulating marker of inflammation and future cardiovascular disease

    International Nuclear Information System (INIS)

    Fagerberg, Björn; Borné, Yan; Barregard, Lars; Sallsten, Gerd; Forsgard, Niklas; Hedblad, Bo; Persson, Margaretha; Engström, Gunnar

    2017-01-01

    Background: Diet and smoking are the main sources of cadmium exposure in the general population. Cadmium increases the risk of cardiovascular diseases, and experimental studies show that it induces inflammation. Blood cadmium levels are associated with macrophages in human atherosclerotic plaques. Soluble urokinase-type plasminogen activator receptor (suPAR) is an emerging biomarker for cardiovascular events related to inflammation and atherosclerotic plaques. The aim was to examine whether blood cadmium levels are associated with circulating suPAR and other markers of inflammation. Methods: A population sample of 4648 Swedish middle-aged women and men was examined cross-sectionally in 1991–1994. Plasma suPAR was assessed by ELISA, leukocytes were measured by standard methods, and blood cadmium was analysed by inductively coupled plasma mass spectrometry. Prevalent cardiovascular disease, ultrasound-assessed carotid plaque occurrence, and several possible confounding factors were recorded. Results: After full adjustment for risk factors and confounding variables, a 3-fold increase in blood cadmium was associated with an 10.9% increase in suPAR concentration (p<0.001). In never-smokers, a 3-fold increase in blood cadmium was associated with a 3.7% increase in suPAR concentration (p<0.01) after full adjustment. Blood cadmium was not associated with C-reactive protein, white blood cell count and Lp-PLA2 but with neutrophil/lymphocyte ratio in one of two statistical models. Conclusions: Exposure to cadmium was associated with increased plasma suPAR in the general population, independently of smoking and cardiovascular disease. These results imply that cadmium is a possible cause for raised levels of this inflammatory marker. - Highlights: • Cadmium is a toxic proinflammatory, proatherosclerotic metal. • Soluble urokinase-type plasminogen activator receptor (suPAR) in plasma is a promising proinflammatory marker of atherosclerosis. • Blood cadmium and plasma su

  13. Cadmium exposure is associated with soluble urokinase plasminogen activator receptor, a circulating marker of inflammation and future cardiovascular disease

    Energy Technology Data Exchange (ETDEWEB)

    Fagerberg, Björn, E-mail: bjorn.fagerberg@wlab.gu.se [Department of Molecular and Clinical Medicine, Wallenberg Laboratory for Cardiovascular and Metabolic Research, University of Gothenburg, Sahlgrenska University Hospital, SE-413 45 Gothenburg (Sweden); Borné, Yan [Department of Clinical Sciences in Malmö, Cardiovascular Epidemiology, CRC, Jan Waldenströms gata 35, Lund University, Skåne University Hospital, Malmö, SE-205 02 Malmö (Sweden); Barregard, Lars; Sallsten, Gerd [Occupational and Environmental Medicine, Sahlgrenska University Hospital and University of Gothenburg, SE-413 45 Gothenburg (Sweden); Forsgard, Niklas [Department of Clinical Chemistry, Sahlgrenska University Hospital, SE-413 45 Gothenburg (Sweden); Hedblad, Bo; Persson, Margaretha; Engström, Gunnar [Department of Clinical Sciences in Malmö, Cardiovascular Epidemiology, CRC, Jan Waldenströms gata 35, Lund University, Skåne University Hospital, Malmö, SE-205 02 Malmö (Sweden)

    2017-01-15

    Background: Diet and smoking are the main sources of cadmium exposure in the general population. Cadmium increases the risk of cardiovascular diseases, and experimental studies show that it induces inflammation. Blood cadmium levels are associated with macrophages in human atherosclerotic plaques. Soluble urokinase-type plasminogen activator receptor (suPAR) is an emerging biomarker for cardiovascular events related to inflammation and atherosclerotic plaques. The aim was to examine whether blood cadmium levels are associated with circulating suPAR and other markers of inflammation. Methods: A population sample of 4648 Swedish middle-aged women and men was examined cross-sectionally in 1991–1994. Plasma suPAR was assessed by ELISA, leukocytes were measured by standard methods, and blood cadmium was analysed by inductively coupled plasma mass spectrometry. Prevalent cardiovascular disease, ultrasound-assessed carotid plaque occurrence, and several possible confounding factors were recorded. Results: After full adjustment for risk factors and confounding variables, a 3-fold increase in blood cadmium was associated with an 10.9% increase in suPAR concentration (p<0.001). In never-smokers, a 3-fold increase in blood cadmium was associated with a 3.7% increase in suPAR concentration (p<0.01) after full adjustment. Blood cadmium was not associated with C-reactive protein, white blood cell count and Lp-PLA2 but with neutrophil/lymphocyte ratio in one of two statistical models. Conclusions: Exposure to cadmium was associated with increased plasma suPAR in the general population, independently of smoking and cardiovascular disease. These results imply that cadmium is a possible cause for raised levels of this inflammatory marker. - Highlights: • Cadmium is a toxic proinflammatory, proatherosclerotic metal. • Soluble urokinase-type plasminogen activator receptor (suPAR) in plasma is a promising proinflammatory marker of atherosclerosis. • Blood cadmium and plasma su

  14. Cadmium uptake by plants

    Energy Technology Data Exchange (ETDEWEB)

    Haghiri, F.

    1973-01-01

    Absorption of /sup 115m/Cd by soybean (Gylcine max l.) plants via foliar and root systems and translocation into the seed was determined. The uptake of /sup 115m/Cd by soybeans via the root system was more efficient than that of the foliar placement. Growth and Cd concentrations of soybean and wheat (Triticum aestivum l.) tops were influenced by soil-applied Cd. In both crops, the Cd concentration of plant tops increased while yield decreased with increasing levels of applied Cd. Cadmium toxicitiy began to occur in both crops at the lowest level of soil applied Cd (2.5 ppM). With soybean plants, Cd toxicity symptoms resembled fe chlorosis. For wheat plants there were no visual symptoms other than the studied growth. The relative concentration of Cd found in several vegetable crops varied depending on the plant species. The relative Cd concentration in descending order for various vegetables was lettuce (Lactuca sativa l.) > radish top (Raphanus sativus l.) > celery stalk (Apium graveolens l.) > celery leaves greater than or equal to green pepper (Capsicum frutescens l.) > radish roots.

  15. Bioavailability of cadmium from linseed and cocoa

    DEFF Research Database (Denmark)

    Hansen, Max; Sloth, Jens Jørgen; Rasmussen, Rie Romme

    In Denmark and EU the exposure of cadmium from food is at a level that is relatively close to the Tolerable Daily Intake (TDI). This report describes an investigation of the bioavailability of cadmium in selected food items known to contain high levels of cadmium. The purpose was to provide data...

  16. Association between cadmium and calcium uptake and distribution during the moult cycle of female shore crabs, Carcinus maenas: an in vivo study

    International Nuclear Information System (INIS)

    Bondgaard, Morten; Bjerregaard, Poul

    2005-01-01

    Net influxes into the haemolymph and tissue distribution of 45 Ca and 109 Cd were studied in vivo in female Carcinus maenas at different moult stages. Net influxes of 45 Ca and 109 Cd from water were higher in postmoult (A and B) C. maenas than in C 3 - and C 4 -intermoult crabs and the net influx of calcium was higher in C 3 -intermoult crabs than in C 4 -intermoult crabs. The net influxes of 45 Ca and 109 Cd increased in postmoult C. maenas with decreasing external calcium concentrations at constant salinity. At all external calcium concentrations a significant correlation existed between 45 Ca and 109 Cd accumulated in the haemolymph of individual animals. In vivo exposure of postmoult C. maenas to external lanthanum decreased the 45 Ca and 109 Cd uptake rates to 30 and 10%, respectively, of the control values. About 30% of injected 109 Cd were found in the midgut gland, 10-20% in the gills and only a few (1-2) percent was lost to the seawater 24 h after injection. No major variations in tissue distribution of 109 Cd were observed between moult stages in these tissues. Premoult crabs retained more cadmium in the haemolymph 24 h after injection than other moult stages, and postmoult crabs retained more in muscle. Between 20 and 40% of the injected 45 Ca were excreted to the water, while only a few percent of the injected 45 Ca were found in the soft tissues 24 h after injection. Large moult stage variations, however, were observed in the tissue distribution of internalised 45 Ca. This study demonstrates that cadmium and calcium uptakes are elevated in postmoult C. maenas. The results indicate that cadmium and calcium in this stage are taken up via Ca 2+ -channels located in the apical membrane of gill epithelium cells. When internalised, however, cadmium and calcium are metabolised in fundamentally different ways, determined by the chemical properties and biological significance of the two metals

  17. Dicty_cDB: SFE109 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFE109 (Link to dictyBase) - - - Contig-U10771-1 SFE109P (Link... to Original site) SFE109F 197 SFE109Z 630 SFE109P 827 - - Show SFE109 Library SF (Link to library) Clone ID SFE109 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10771-1 Original site URL http://dict...anslated Amino Acid sequence elnykfhftlnttqiei*inknfllflf*fffyfqi*iqlcfilkllllptiink*INKI FLKKK--- ---VTTSQCESLIQAGVDGLRVGMGVGSICT...fkfnsvsy*nyyyyqpslink*ik ff*kk--- ---VTTSQCESLIQAGVDGLRVGMGVGSICTTQEVMACGRPQATAVFKCALYSSQYNVPI IADGGIRTIGHII

  18. Cross section measurement of alpha particle induced nuclear reactions on natural cadmium up to 52MeV.

    Science.gov (United States)

    Ditrói, F; Takács, S; Haba, H; Komori, Y; Aikawa, M

    2016-12-01

    Cross sections of alpha particle induced nuclear reactions have been measured on thin natural cadmium targets foils in the energy range from 11 to 51.2MeV. This work was a part of our systematic study on excitation functions of light ion induced nuclear reactions on different target materials. Regarding the cross sections, the alpha induced reactions are not deeply enough investigated. Some of the produced isotopes are of medical interest, others have application in research and industry. The radioisotope 117m Sn is a very important theranostic (therapeutic + diagnostic) radioisotope, so special care was taken to the results for that isotope. The well-established stacked foil technique followed by gamma-spectrometry with HPGe gamma spectrometers were used. The target and monitor foils in the stack were commercial high purity metal foils. From the irradiated targets 117m Sn, 113 Sn, 110 Sn, 117m,g In, 116m In, 115m In, 114m In, 113m In, 111 In, 110m,g In, 109m In, 108m,g In, 115g Cd and 111m Cd were identified and their excitation functions were derived. The results were compared with the data of the previous measurements from the literature and with the results of the theoretical nuclear reaction model code calculations TALYS 1.8 (TENDL-2015) and EMPIRE 3.2 (Malta). From the cross section curves thick target yields were calculated and compared with the available literature data. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. Coprecipitation of cadmium with calcite

    International Nuclear Information System (INIS)

    Fujino, Osamu; Kumagai, Tetsu; Shigematsu, Tsunenobu; Matsui, Masakazu

    1976-01-01

    The distribution of cadmium between precipitates of calcite and saturated aqueous solution was measured at 25 0 C to understand the distribution of cadmium in the bivalves. Calcite was precipitated from calcium bicarbonate solution by the gradual release of carbon dioxide. The cadmium ions were coprecipitated in calcite, obeying the logarithmic distribution law. The apparent distribution coefficient was decreased as α, α'-dipyridyl increased, but the true distribution coefficient was found to be an almost constant value, 560. This value is fairly close to the ratio of solubility product constants K sub(calcite)/K sub(CdCO 3 ), 890. This suggests that the deviation of the present solid solution from ideality is not very large. (auth.)

  20. 10 CFR 50.109 - Backfitting.

    Science.gov (United States)

    2010-01-01

    ... REGULATORY COMMISSION DOMESTIC LICENSING OF PRODUCTION AND UTILIZATION FACILITIES Backfitting § 50.109... design under appendix N of this part; or (vii) The date of issuance of a combined license under subpart C... requirements or to achieve adequate protection, then cost may be a factor in selecting the way, provided that...

  1. 41 CFR 109-50.103 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... museums located in the United States and interested in establishing or upgrading energy-oriented education... Section 109-50.103 Public Contracts and Property Management Federal Property Management Regulations System... uniform administrative system for application, award, and administration of assistance awards, including...

  2. 41 CFR 109-39.300 - General.

    Science.gov (United States)

    2010-07-01

    ... 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.3-Use and Care of GSA Interagency Fleet Management System... operators and passengers in GSA Interagency Fleet Management System (IFMS) motor vehicles are aware of the... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false General. 109-39.300...

  3. 23 CFR 668.109 - Eligibility.

    Science.gov (United States)

    2010-04-01

    ...) Betterments, only where clearly economically justified to prevent future recurring damage. Economic justification must weigh the cost of betterment against the risk of eligible recurring damage and the cost of... a betterment for the purpose of 23 CFR 668.109(b)(6); and (9) Repair of toll facilities when the...

  4. 5 CFR 4001.109 - Waivers.

    Science.gov (United States)

    2010-01-01

    ... EMPLOYEES OF THE FARM CREDIT SYSTEM INSURANCE CORPORATION § 4001.109 Waivers. The DAEO may grant a written waiver from any provision of this part based on a determination that the waiver is not inconsistent with... programs are administered. A waiver under this paragraph may impose appropriate conditions, such as...

  5. 5 CFR 4101.109 - Waivers.

    Science.gov (United States)

    2010-01-01

    ... THE FARM CREDIT ADMINISTRATION § 4101.109 Waivers. The DAEO may grant a written waiver from any provision of this part based on a determination that the waiver is not inconsistent with part 2635 of this... administered. A waiver under this paragraph may impose appropriate conditions, such as requiring execution of a...

  6. 41 CFR 109-38.800 - General.

    Science.gov (United States)

    2010-07-01

    ... motor vehicle operators with appropriate instructions regarding the use and protection of credit cards... 38-MOTOR EQUIPMENT MANAGEMENT 38.8-Standard Form 149, U.S. Government National Credit Card § 109-38... the administrative control of fleet credit cards. Administrative control shall include, as a minimum...

  7. 48 CFR 32.109 - Termination financing.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Termination financing. 32... CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.109 Termination financing. To encourage contractors to invest their own funds in performance despite the susceptibility of...

  8. 41 CFR 109-27.5001 - Objectives.

    Science.gov (United States)

    2010-07-01

    ... misappropriation; (c) The maintenance of an efficient operation; and (d) The standardization of inventories to the...-INVENTORY MANAGEMENT 27.50-Inventory Management Policies, Procedures, and Guidelines § 109-27.5001 Objectives. Necessary inventories shall be established and maintained at reasonable levels, consistent with...

  9. Health hazards of environmental cadmium pollution

    Energy Technology Data Exchange (ETDEWEB)

    Nordberg, G F

    1974-01-01

    Cadmium, a metal widely used in industrial processes, has been recognized to be a highly toxic and dangerous environmental pollutant. In this study the author describes the sources and occurrence of cadmium, and the intake by human beings. He states that present standards for daily intake do not allow sufficient safety margins. The fate and known effects of cadmium in human beings are summarized; some effects associated with cadmium are renal (kidney) damage, anemia, hypertension, and liver damage. Cadmium was identified as the main cause of the Itai-Itai disease in Japan, and epidemiological studies from various areas of Japan are presented. 64 references, 9 figures, 5 tables.

  10. 57Co and 109Cd production study in cyclotron

    International Nuclear Information System (INIS)

    Landini, Liliane

    2000-01-01

    The main objective of this work was the detailed study of all parameters involved in the production of 57 Co through the irradiation of natural Ni ( nat Ni) with a proton beam of the CV-28 Cyclotron at IPEN-CNEN/SP. The excitation functions of these reactions were measured by the stacked foil technique and were compared with literature values and those generated by the ALICE code. The results showed a good agreement with the experimental values measured for the radioisotopes: 55 Co, 56 Co, 57 Co, 58 Co, 56 Ni and 57 Ni . Thick target yields for these radioisotopes were measured, and the mean values were (346.69±203.50)kBq/μA.h, for the direct production of 57 Co and (150.59±29.60)kBq/μA.h, through the decay of 57 Ni (11,31 days after EOB - End of Bombardment). A solution of 57 CoC 2 was prepared, to fill a flood source for calibration of gamma camera, with activity of 222 MBq (6mCi) of 57 Co and impurity levels of 1.13 and 1.29% for 56 Co and 58 Co, respectively, at delivery time. In order to achieve these results, a chemical separation method was developed with a separation yield of 93% for 57 Co and a negligible loss of Ni. A composite target of Ni and Ag was prepared and a chemical separation method proposed to allow the separation between the targets and the products of interest, 57 Co and 109 Cd. The yields obtained in the irradiation of the composite target were: (947.94±239.39)kBq/μA.h of 57 Co - direct reaction, (259.00±35.15)kBq/μA.h of 57 Co - indirect reaction (11,31 days after EOB) and (71.41±5.55)kBq/μA.h of 109 Cd, which showed the efficiency of its use, as well as the chemical separation, with a yield of 80% for 57 Co and 109 Cd. The best conditions for the production of 57 Co, with the least level of radionuclidic impurities was the use of the indirect reaction, and performing the chemical separation 2 hours after EOB and a decay time of 11.31 days for the separation of 57 Co. (author)

  11. [Investigation of urinary cadmium reference of general population in two rural high background areas of soil cadmium and non-cadmium-polluted in China].

    Science.gov (United States)

    Han, Jingxiu; Li, Qiujuan; Yao, Dancheng; Zheng, Jiangang; Zhang, Wenli; Shang, Qi

    2014-09-01

    To study the reference of urinary. cadmium of the general population in rural high background areas of soil cadmium and non-cadmium contaminated in China. In rural high background areas of soil cadmium and non-cadmium contaminated, randomly selected non-occupational-cadmium exposed population 1134 people (male 519, female 615) with each gender and age groups, questionnaire surveyed and collected random urine. Urinary cadmium and urinary creatinine (Cr) concentration were tested, excluding urinary Cr 3 g/L. Analyze the impact factors of urinary cadmium and calculated 95% quantile (P,95 ) of urinary cadmium after correction by urinary Cr. Female median urinary cadmium was significantly higher than men, male smokers median urinary cadmium was significantly higher than male non-smokers (P 30 year-old. According to gender, and 15 -30, 30 years old, analysis the upper limit of cadmium in urine. The 95% upper limit of urinary cadmium of 30 year-old female (12.24 microg/gCr) was significantly higher than other populations ( population exceeded the upper limit (5 microg/gCr) of the occupational cadmium poisoning diagnostic criteria in China (GBZ 17-2002). In the two rural high background areas of soil cadmium and non-cadmium polluted , urinary cadmium reference of non-cadmium-occupational-exposed male is <9.0 microg/gCr, and female <13.0 microg/gCr.

  12. Effect of cadmium on gonadogenesis and metamorphosis in Pleurodeles waltl (urodele amphibian)

    International Nuclear Information System (INIS)

    Flament, S.; Kuntz, S.; Chesnel, A.; Grillier-Vuissoz, I.; Tankozic, C.; Penrad-Mobayed, M.; Auque, G.; Shirali, P.; Schroeder, H.; Chardard, D.

    2003-01-01

    In the amphibian Pleurodeles waltl, steroid hormones play a key role in sex differentiation. Since cadmium has been reported to block receptors of sex steroid hormones, we analyzed the effects of this heavy metal on Pleurodeles larvae gonadogenesis. At stage 42, larvae die in the presence of 10.9 μM Cd in the rearing tap water, with TL 50 of 46.3 h, but the concentration of 5.5 μM is tolerated for more than 60 days. When used at 5.5 μM cadmium accumulation measured by atomic absorption spectrophotometry (AAS) in total homogenates of larvae at stage 54 (after 77 days of exposure to the heavy metal) reached 58.1 μg/g of dry weight. At stage 54, we did not detect inhibitory effects on gonadogenesis in larvae reared in the presence of 5.5 μM Cd since stage 42. When the exposure to 5.5 μM Cd was lengthened after stage 54, metamorphosis was delayed and could not be completed. When larvae were exposed to 10.9 μM Cd from stage 54, metamorphosis did not occur and gonad development was stopped. Our study demonstrates a lack of a direct effect of cadmium on sex determination-differentiation but a strong inhibitory effect on metamorphosis, which impairs further gonadal development

  13. Effect of cadmium on gonadogenesis and metamorphosis in Pleurodeles waltl (urodele amphibian)

    Energy Technology Data Exchange (ETDEWEB)

    Flament, S.; Kuntz, S.; Chesnel, A.; Grillier-Vuissoz, I.; Tankozic, C.; Penrad-Mobayed, M.; Auque, G.; Shirali, P.; Schroeder, H.; Chardard, D

    2003-07-16

    In the amphibian Pleurodeles waltl, steroid hormones play a key role in sex differentiation. Since cadmium has been reported to block receptors of sex steroid hormones, we analyzed the effects of this heavy metal on Pleurodeles larvae gonadogenesis. At stage 42, larvae die in the presence of 10.9 {mu}M Cd in the rearing tap water, with TL{sub 50} of 46.3 h, but the concentration of 5.5 {mu}M is tolerated for more than 60 days. When used at 5.5 {mu}M cadmium accumulation measured by atomic absorption spectrophotometry (AAS) in total homogenates of larvae at stage 54 (after 77 days of exposure to the heavy metal) reached 58.1 {mu}g/g of dry weight. At stage 54, we did not detect inhibitory effects on gonadogenesis in larvae reared in the presence of 5.5 {mu}M Cd since stage 42. When the exposure to 5.5 {mu}M Cd was lengthened after stage 54, metamorphosis was delayed and could not be completed. When larvae were exposed to 10.9 {mu}M Cd from stage 54, metamorphosis did not occur and gonad development was stopped. Our study demonstrates a lack of a direct effect of cadmium on sex determination-differentiation but a strong inhibitory effect on metamorphosis, which impairs further gonadal development.

  14. Association of lead and cadmium exposure with frailty in US older adults

    Energy Technology Data Exchange (ETDEWEB)

    García-Esquinas, Esther, E-mail: esthergge@gmail.com [Department of Preventive Medicine and Public Health, School of Medicine, Universidad Autónoma de Madrid/ IdiPAZ, Madrid (Spain); CIBER of Epidemiology and Public Health (CIBERESP), Madrid (Spain); Department of Environmental Health Sciences, Johns Hopkins University Bloomberg School of Public Health, Baltimore, MD (United States); Navas-Acien, Ana [Department of Environmental Health Sciences, Johns Hopkins University Bloomberg School of Public Health, Baltimore, MD (United States); Department of Epidemiology, Johns Hopkins University Bloomberg School of Public Health, Baltimore, MD (United States); Welch Center for Prevention, Epidemiology, and Clinical Research, Johns Hopkins University Bloomberg School of Public Health, Baltimore, MD (United States); Pérez-Gómez, Beatriz [CIBER of Epidemiology and Public Health (CIBERESP), Madrid (Spain); Environmental Epidemiology and Cancer Unit, National Center for Epidemiology, Carlos III Institute of Health, Madrid (Spain); Artalejo, Fernando Rodríguez [Department of Preventive Medicine and Public Health, School of Medicine, Universidad Autónoma de Madrid/ IdiPAZ, Madrid (Spain); CIBER of Epidemiology and Public Health (CIBERESP), Madrid (Spain)

    2015-02-15

    Background: Environmental lead and cadmium exposure is associated with higher risk of several age-related chronic diseases, including cardiovascular disease, chronic kidney disease and osteoporosis. These diseases may lead to frailty, a geriatric syndrome characterized by diminished physiologic reserve in multiple systems with decreased ability to cope with acute stressors. However, no previous study has evaluated the association between lead or cadmium exposure and frailty. Methods: Cross-sectional study among individuals aged ≥60 years who participated in the third U.S. National Health and Nutrition Examination Survey and had either blood lead (N=5272) or urine cadmium (N=4887) determinations. Frailty was ascertained with a slight modification of the Fried criteria, so that individuals meeting ≥3 of 5 pre-defined criteria (exhaustion, low body weight, low physical activity, weakness and slow walking speed), were considered as frail. The association between lead and cadmium with frailty was evaluated using logistic regression with adjustment for relevant confounders. Results: Median (intertertile range) concentrations of blood lead and urine cadmium were 3.9 µg/dl (2.9–4.9) and 0.62 µg/l (0.41–0.91), respectively. The prevalence of frailty was 7.1%. The adjusted odds ratios (95% confidence interval) of frailty comparing the second and third to the lowest tertile of blood lead were, respectively, 1.40 (0.96–2.04) and 1.75 (1.33–2.31). Lead concentrations were also associated with the frequency of exhaustion, weakness and slowness. The corresponding odds ratios (95% confidence interval) for cadmium were, respectively, 0.97 (0.68–1.39) and 1.55 (1.03–2.32), but this association did not hold after excluding participants with reduced glomerular filtration rate: 0.70 (0.43–1.14) and 1.09 (0.56–2.11), respectively. Conclusions: In the US older adult population, blood lead but not urine cadmium concentrations showed a direct dose

  15. Association of lead and cadmium exposure with frailty in US older adults

    International Nuclear Information System (INIS)

    García-Esquinas, Esther; Navas-Acien, Ana; Pérez-Gómez, Beatriz; Artalejo, Fernando Rodríguez

    2015-01-01

    Background: Environmental lead and cadmium exposure is associated with higher risk of several age-related chronic diseases, including cardiovascular disease, chronic kidney disease and osteoporosis. These diseases may lead to frailty, a geriatric syndrome characterized by diminished physiologic reserve in multiple systems with decreased ability to cope with acute stressors. However, no previous study has evaluated the association between lead or cadmium exposure and frailty. Methods: Cross-sectional study among individuals aged ≥60 years who participated in the third U.S. National Health and Nutrition Examination Survey and had either blood lead (N=5272) or urine cadmium (N=4887) determinations. Frailty was ascertained with a slight modification of the Fried criteria, so that individuals meeting ≥3 of 5 pre-defined criteria (exhaustion, low body weight, low physical activity, weakness and slow walking speed), were considered as frail. The association between lead and cadmium with frailty was evaluated using logistic regression with adjustment for relevant confounders. Results: Median (intertertile range) concentrations of blood lead and urine cadmium were 3.9 µg/dl (2.9–4.9) and 0.62 µg/l (0.41–0.91), respectively. The prevalence of frailty was 7.1%. The adjusted odds ratios (95% confidence interval) of frailty comparing the second and third to the lowest tertile of blood lead were, respectively, 1.40 (0.96–2.04) and 1.75 (1.33–2.31). Lead concentrations were also associated with the frequency of exhaustion, weakness and slowness. The corresponding odds ratios (95% confidence interval) for cadmium were, respectively, 0.97 (0.68–1.39) and 1.55 (1.03–2.32), but this association did not hold after excluding participants with reduced glomerular filtration rate: 0.70 (0.43–1.14) and 1.09 (0.56–2.11), respectively. Conclusions: In the US older adult population, blood lead but not urine cadmium concentrations showed a direct dose

  16. Absorption and excretion of zinc, cadmium and mercury in the gastrointestinal tract

    Energy Technology Data Exchange (ETDEWEB)

    Shibata, H [National Inst. of Radiological Sciences, Chiba (Japan)

    1975-10-01

    The absorption and excretion of inorganic zinc, cadmium and mercury in the gastrointestinal tract were compared using /sup 65/Zn, /sup 109/Cd and /sup 203/Hg. A single dose of /sup 65/Zn, /sup 109/Cd or /sup 203/Hg was administered orally or injected intravenously to investigate the distribution, excretion into bile and excretion into feces or urine. Absorption and excretion through the gastrointestinal tract of mice were studied by the tied loop method. Groups of eight mice or rats were used to measure the radioactivity in sample with a scintillation counter. Most of the orally administered /sup 65/Zn, /sup 109/Cd or /sup 203/Hg was excreted into feces and was less absorbed by the gastrointestinal tract, respectively. Absorption rate in the gastrointestinal tract was as follows: /sup 203/Hg>/sup 65/Zn>/sup 109/Cd. Intravenously injected /sup 65/Zn, /sup 109/Cd or /sup 203/Hg was escreted into the gastrointestinal tract through the gastrointestinal wall and bile duct, respectively. Excretion rate in the gastrointestinal tract was as follows: /sup 65/Zn>/sup 203/Hg>/sup 109/Cd. When comparing the absorption and excretion in each gastrointestinal tract divided into 10 parts, /sup 65/Zn, and /sup 109/Cd were relatively well absorbed from the upper and lower part of small intestine and excreted into the upper, middle, lower part. /sup 203/Hg was relatively well absorbed from the upper, lower part of small intestine and excreted into the stomach and the caecum. The major organs that accumulated absorbed /sup 65/Zn, /sup 109/Cd or /sup 203/Hg were the pancreas and liver, liver and kidney, kidney and liver, respectively.

  17. Hsp27, Hsp70, and metallothionein in MDCK and LLC-PK1 renal epithelial cells: effects of prolonged exposure to cadmium

    International Nuclear Information System (INIS)

    Bonham, Rita T.; Fine, Michael R.; Pollock, Fiona M.; Shelden, Eric A.

    2003-01-01

    Cadmium is a widely distributed industrial and environmental toxin. The principal target organ of chronic sublethal cadmium exposure is the kidney. In renal epithelial cells, acute high-dose cadmium exposure induces differential expression of proteins, including heat shock proteins. However, few studies have examined heat shock protein expression in cells after prolonged exposure to cadmium at sublethal concentrations. Here, we assayed total cell protein, neutral red uptake, cell death, and levels of metallothionein and heat shock proteins Hsp27 and inducible Hsp70 in cultures of MDCK and LLC-PK1 renal epithelial cells treated with cadmium for 3 days. Treatment with cadmium at concentrations equal to or greater than 10 μM (LLC-PK1) or 25 μM (MDCK) reduced measures of cell vitality and induced cell death. However, a concentration-dependent increase in Hsp27 was detected in both cell types treated with as little as 5 μM cadmium. Accumulation of Hsp70 was correlated only with cadmium treatment at concentrations also causing cell death. Metallothionein was maximally detected in cells treated with cadmium at concentrations that did not reduce cell vitality, and further increases were not detected at greater concentrations. These results reveal that heat shock proteins accumulate in renal epithelial cells during prolonged cadmium exposure, that cadmium induces differential expression of heat shock protein in epithelial cells, and that protein expression patterns in epithelial cells are specific to the cadmium concentration and degree of cellular injury. A potential role for Hsp27 in the cellular response to sublethal cadmium-induced injury is also implicated by our results

  18. Cadmium bioaccumulation and retention kinetics in the Chilean blue mussel Mytilus chilensis: seawater and food exposure pathways.

    Science.gov (United States)

    Hervé-Fernández, Pedro; Houlbrèque, Fanny; Boisson, Florence; Mulsow, Sandor; Teyssié, Jean-Louis; Oberhaënsli, François; Azemard, Sabine; Jeffree, Ross

    2010-09-15

    The Chilean blue mussel (Mytilus chilensis, Hupe 1854) represents the most important bivalve exploited along the Chilean coast and is a major food source for the Chilean population. Unfortunately, local fish and shellfish farming face severe problems as a result of bioaccumulation of toxic trace metals into shellfishes. Blue mussels collected along the Chilean coasts contain levels of Cd above the regulatory limits for human consumption. In this study, we examined the bioaccumulation, depuration and organ distribution of Cd in the M. chilensis, from 109Cd-labelled bulk seawater and from feeding with 109Cd-labelled algae. The uptake of 109Cd via seawater displayed a simple exponential kinetic model suggesting that cadmium activity tends to reach an equilibrium value of 1.838+/-0.175 ng g(-1) (mean+/-asymptotic standard error, p food uptake was fast, reaching only 20% of retention in 10 days. This knowledge of the long half-life of cadmium accumulated via seawater as well as the non-negligible level of cadmium accumulated into the shells is relevant to the management of Cd levels in this species and the refinement of detoxification processes in order to comply with authorized Cd levels. 2010 Elsevier B.V. All rights reserved.

  19. Cadmium resistance in Drosophila: a small cadmium binding substance

    International Nuclear Information System (INIS)

    Jacobson, K.B.; Williams, M.W.; Richter, L.J.; Holt, S.E.; Hook, G.J.; Knoop, S.M.; Sloop, F.V.; Faust, J.B.

    1985-01-01

    A small cadmium-binding substance (CdBS) has been observed in adult Drosophila melanogaster that were raised for their entire growth cycle on a diet that contained 0.15 mM CdCl 2 . Induction of CdBS was observed in strains that differed widely in their sensitivity of CdCl 2 . This report describes the induction of CdBS and some of its characteristics. 17 refs., 4 figs., 1 tab

  20. Cadmium and Cadmium/Zinc Ratios and Tobacco-Related Morbidities

    Science.gov (United States)

    Richter, Patricia; Faroon, Obaid; Pappas, R. Steven

    2017-01-01

    Metals are one of five major categories of carcinogenic or toxic constituents in tobacco and tobacco smoke. Cadmium is highly volatile and a higher percentage of the total tobacco cadmium content is efficiently transferred to mainstream tobacco smoke than many other toxic metals in tobacco. Inhaled cadmium bioaccumulates in the lungs and is distributed beyond the lungs to other tissues, with a total body biological half-life of one to two decades. Chronic cadmium exposure through tobacco use elevates blood and urine cadmium concentrations. Cadmium is a carcinogen, and an inducer of proinflammatory immune responses. Elevated exposure to cadmium is associated with reduced pulmonary function, obstructive lung disease, bronchogenic carcinoma, cardiovascular diseases including myocardial infarction, peripheral arterial disease, prostate cancer, cervical cancer, pancreatic cancer, and various oral pathologies. Cadmium and zinc have a toxicologically inverse relationship. Zinc is an essential element and is reportedly antagonistic to some manifestations of cadmium toxicity. This review summarizes associations between blood, urine, and tissue cadmium concentrations with emphasis on cadmium exposure due to tobacco use and several disease states. Available data about zinc and cadmium/zinc ratios and tobacco-related diseases is summarized from studies reporting smoking status. Collectively, data suggest that blood, urine, and tissue cadmium and cadmium/zinc ratios are often significantly different between smokers and nonsmokers and they are also different in smokers for several diseases and cancers. Additional biomonitoring data such as blood or serum and urine zinc and cadmium levels and cadmium/zinc ratios in smokers may provide further insight into the development and progression of diseases of the lung, cardiovascular system, and possibly other organs. PMID:28961214

  1. Cadmium and Cadmium/Zinc Ratios and Tobacco-Related Morbidities.

    Science.gov (United States)

    Richter, Patricia; Faroon, Obaid; Pappas, R Steven

    2017-09-29

    Metals are one of five major categories of carcinogenic or toxic constituents in tobacco and tobacco smoke. Cadmium is highly volatile and a higher percentage of the total tobacco cadmium content is efficiently transferred to mainstream tobacco smoke than many other toxic metals in tobacco. Inhaled cadmium bioaccumulates in the lungs and is distributed beyond the lungs to other tissues, with a total body biological half-life of one to two decades. Chronic cadmium exposure through tobacco use elevates blood and urine cadmium concentrations. Cadmium is a carcinogen, and an inducer of proinflammatory immune responses. Elevated exposure to cadmium is associated with reduced pulmonary function, obstructive lung disease, bronchogenic carcinoma, cardiovascular diseases including myocardial infarction, peripheral arterial disease, prostate cancer, cervical cancer, pancreatic cancer, and various oral pathologies. Cadmium and zinc have a toxicologically inverse relationship. Zinc is an essential element and is reportedly antagonistic to some manifestations of cadmium toxicity. This review summarizes associations between blood, urine, and tissue cadmium concentrations with emphasis on cadmium exposure due to tobacco use and several disease states. Available data about zinc and cadmium/zinc ratios and tobacco-related diseases is summarized from studies reporting smoking status. Collectively, data suggest that blood, urine, and tissue cadmium and cadmium/zinc ratios are often significantly different between smokers and nonsmokers and they are also different in smokers for several diseases and cancers. Additional biomonitoring data such as blood or serum and urine zinc and cadmium levels and cadmium/zinc ratios in smokers may provide further insight into the development and progression of diseases of the lung, cardiovascular system, and possibly other organs.

  2. Effects of iron deficiency on the absorption and distribution of lead and cadmium in rats

    International Nuclear Information System (INIS)

    Ragan, H.A.

    1977-01-01

    In order to evaluate the effects of iron deficiency on the absorption of pollutant metals, an iron-deficient diet was fed to young rats until their tissue-iron stores were depleted. Prior to the development of anemia, the iron-deficient rats and littermate controls were administered an intragastric gavage of lead-210 or cadmium-109 and were killed 48 hr later. The body burden of lead was approximately 6 times greater, and that of cadmium approximately 7 times greater, in iron-deficient rats than in the controls. No consistent effects were observed on concentrations of serum total lipids or serum proteins nor on protein electrophoretic patterns in rats with a deficit in iron stores

  3. Cadmium bioaccumulation and retention kinetics in the Chilean blue mussel Mytilus chilensis: Seawater and food exposure pathways

    International Nuclear Information System (INIS)

    Herve-Fernandez, Pedro; Houlbreque, Fanny; Boisson, Florence; Mulsow, Sandor; Teyssie, Jean-Louis; Oberhaensli, Francois; Azemard, Sabine; Jeffree, Ross

    2010-01-01

    The Chilean blue mussel (Mytilus chilensis, Hupe 1854) represents the most important bivalve exploited along the Chilean coast and is a major food source for the Chilean population. Unfortunately, local fish and shellfish farming face severe problems as a result of bioaccumulation of toxic trace metals into shellfishes. Blue mussels collected along the Chilean coasts contain levels of Cd above the regulatory limits for human consumption. In this study, we examined the bioaccumulation, depuration and organ distribution of Cd in the M. chilensis, from 109 Cd-labelled bulk seawater and from feeding with 109 Cd-labelled algae. The uptake of 109 Cd via seawater displayed a simple exponential kinetic model suggesting that cadmium activity tends to reach an equilibrium value of 1.838 ± 0.175 ng g -1 (mean ± asymptotic standard error, p 109 Cd accumulated via seawater was slow, with only 21% of the total 109 Cd accumulated in the whole mussel being eliminated after 52 days. Total elimination of Cd in mussels was adequately described by a double component kinetic model, in which the biological half-life for the long-lived component represents more than 6 months. In contrast, depuration after radiolabelled food uptake was fast, reaching only 20% of retention in 10 days. This knowledge of the long half-life of cadmium accumulated via seawater as well as the non-negligible level of cadmium accumulated into the shells is relevant to the management of Cd levels in this species and the refinement of detoxification processes in order to comply with authorized Cd levels.

  4. Cadmium bioaccumulation and retention kinetics in the Chilean blue mussel Mytilus chilensis: Seawater and food exposure pathways

    Energy Technology Data Exchange (ETDEWEB)

    Herve-Fernandez, Pedro [Instituto de Geociencias, Universidad Austral de Chile, Castilla 567, Valdivia (Chile); Houlbreque, Fanny, E-mail: F.Houlbreque@iaea.org [International Atomic Energy Agency - Marine Environment Laboratories, 4 Quai Antoine 1er, 98000 Monaco (Monaco); Boisson, Florence [International Atomic Energy Agency - Marine Environment Laboratories, 4 Quai Antoine 1er, 98000 Monaco (Monaco); Mulsow, Sandor [Instituto de Geociencias, Universidad Austral de Chile, Castilla 567, Valdivia (Chile); Teyssie, Jean-Louis; Oberhaensli, Francois; Azemard, Sabine; Jeffree, Ross [International Atomic Energy Agency - Marine Environment Laboratories, 4 Quai Antoine 1er, 98000 Monaco (Monaco)

    2010-09-15

    The Chilean blue mussel (Mytilus chilensis, Hupe 1854) represents the most important bivalve exploited along the Chilean coast and is a major food source for the Chilean population. Unfortunately, local fish and shellfish farming face severe problems as a result of bioaccumulation of toxic trace metals into shellfishes. Blue mussels collected along the Chilean coasts contain levels of Cd above the regulatory limits for human consumption. In this study, we examined the bioaccumulation, depuration and organ distribution of Cd in the M. chilensis, from {sup 109}Cd-labelled bulk seawater and from feeding with {sup 109}Cd-labelled algae. The uptake of {sup 109}Cd via seawater displayed a simple exponential kinetic model suggesting that cadmium activity tends to reach an equilibrium value of 1.838 {+-} 0.175 ng g{sup -1} (mean {+-} asymptotic standard error, p < 0.001) after 78 {+-} 9 days. The depuration rate for {sup 109}Cd accumulated via seawater was slow, with only 21% of the total {sup 109}Cd accumulated in the whole mussel being eliminated after 52 days. Total elimination of Cd in mussels was adequately described by a double component kinetic model, in which the biological half-life for the long-lived component represents more than 6 months. In contrast, depuration after radiolabelled food uptake was fast, reaching only 20% of retention in 10 days. This knowledge of the long half-life of cadmium accumulated via seawater as well as the non-negligible level of cadmium accumulated into the shells is relevant to the management of Cd levels in this species and the refinement of detoxification processes in order to comply with authorized Cd levels.

  5. Cadmium but not lead exposure affects Xenopus laevis fertilization and embryo cleavage

    Energy Technology Data Exchange (ETDEWEB)

    Slaby, Sylvain [Univ. Lille Nord de France, EA 4515 – LGCgE – Laboratoire Génie Civil et géo-Environnement, Université de Lille 1, Cité scientifique, SN3, F-59655 Villeneuve d’Ascq (France); Univ. Lille, CNRS, INRA, UMR 8576 – UGSF – Unité de Glycobiologie Structurale et Fonctionnelle, F-59000 Lille (France); Lemière, Sébastien [Univ. Lille Nord de France, EA 4515 – LGCgE – Laboratoire Génie Civil et géo-Environnement, Université de Lille 1, Cité scientifique, SN3, F-59655 Villeneuve d’Ascq (France); Hanotel, Julie; Lescuyer, Arlette [Univ. Lille, CNRS, INRA, UMR 8576 – UGSF – Unité de Glycobiologie Structurale et Fonctionnelle, F-59000 Lille (France); Demuynck, Sylvain [Univ. Lille Nord de France, EA 4515 – LGCgE – Laboratoire Génie Civil et géo-Environnement, Université de Lille 1, Cité scientifique, SN3, F-59655 Villeneuve d’Ascq (France); Bodart, Jean-François [Univ. Lille, CNRS, INRA, UMR 8576 – UGSF – Unité de Glycobiologie Structurale et Fonctionnelle, F-59000 Lille (France); and others

    2016-08-15

    Highlights: • First embryonic steps were studied. • Fertilization success was impacted by cadmium exposures. • Oocytes were most affected instead of spermatozoa by cadmium exposures. • First embryonic cleavages were slown down or stopped by cadmium exposures. • Lead exposures did not affected fertilization and segmentation. - Abstract: Among the toxicological and ecotoxicological studies, few have investigated the effects on germ cells, gametes or embryos, while an impact at these stages will result in serious damage at a population level. Thus, it appeared essential to characterize consequences of environmental contaminant exposures at these stages. Therefore, we proposed to assess the effects of exposure to cadmium and lead ions, alone or in a binary mixture, on early stages of Xenopus laevis life cycle. Fertilization and cell division during segmentation were the studied endpoints. Cadmium ion exposures decreased in the fertilization rates in a concentration-dependent manner, targeting mainly the oocytes. Exposure to this metal ions induced also delays or blockages in the embryonic development. For lead ion exposure, no such effect was observed. For the exposure to the mixture of the two metal ions, concerning the fertilization success, we observed results similar to those obtained with the highest cadmium ion concentration.

  6. Cadmium nanoparticles citrullinate cytokeratins within lung epithelial cells: cadmium as a potential cause of citrullination in chronic obstructive pulmonary disease

    Directory of Open Access Journals (Sweden)

    Hutchinson D

    2018-01-01

    Full Text Available David Hutchinson,1,2 Judith Müller,3 Joseph E McCarthy,4 Yurii K Gun’ko,4,5 Navin Kumar Verma,6 Xuezhi Bi,7 Luisana Di Cristo,8 Laura Kickham,8 Dania Movia,8 Adriele Prina-Mello,5,8 Yuri Volkov5,8,9 1Royal Cornwall Hospital NHS Trust, Treliske, 2University of Exeter Medical School Cornwall, UK; 3University of Basel, Basel, Switzerland; 4School of Chemistry, 5Advanced Materials for BioEngineering Research Centre (AMBER, Trinity College Dublin, Dublin, Ireland; 6Lee Kong Chian School of Medicine, Nanyang Technological University, 7Bioprocessing Technology Institute, A*STAR Graduate Academy, Singapore; 8Department of Clinical Medicine, School of Medicine, Trinity College Dublin, Dublin, Ireland; 9International Laboratory of Magnetically Controlled Nanosystems for Theranostics of Oncological and Cardiovascular Diseases, ITMO University, St. Petersburg, Russia Objective: The objective of the study was to determine whether the cadmium-derived materials induce intracellular protein citrullination. Methods: Human A549 lung epithelial cells were exposed to cadmium in soluble and nanoparticulate forms represented by cadmium chloride (CdCl2 and cadmium oxide (CdO, respectively, and their combinations with ultrafine carbon black (ufCB produced by high temperature combustion, imitating cigarette burning. Protein citrullination in cell lysates was analyzed by Western immunoblotting and verified by immunofluorescent confocal microscopy. Target citrullinated proteins were identified by proteomic analysis. Results: CdO, ufCB and its combination with CdCl2 and CdO after high temperature combustion induced protein citrullination in cultured human lung epithelial cells, as detected by immunoblotting with anti-citrullinated protein antibody. Cytokeratins of type II (1, 2, 5, 6A, 6B and 77 and type I (9, 10 were identified as major intracellular citrullination targets. Immunofluorescent staining confirmed the localization of citrullinated proteins both in the

  7. 46 CFR 109.525 - Cranes: Working loads.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes: Working loads. 109.525 Section 109.525 Shipping... Cranes § 109.525 Cranes: Working loads. The master or person in charge shall ensure that tables... working the crane. ...

  8. 46 CFR 109.527 - Cranes: Operator designation.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes: Operator designation. 109.527 Section 109.527... OPERATIONS Cranes § 109.527 Cranes: Operator designation. (a) The master or person in charge shall designate, in writing, each crane operator. (b) The master or person in charge shall ensure that only designated...

  9. 49 CFR 224.109 - Inspection, repair, and replacement.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Inspection, repair, and replacement. 224.109 Section 224.109 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD..., Inspection, and Maintenance of Retroreflective Material § 224.109 Inspection, repair, and replacement. (a...

  10. 36 CFR 406.104-406.109 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.104-406.109 Section 406.104-406.109 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.104-406.109 [Reserved] ...

  11. 50 CFR 14.109 - Care in transit.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Care in transit. 14.109 Section 14.109 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR TAKING... Wild Mammals and Birds to the United States § 14.109 Care in transit. (a) During transportation to the...

  12. 41 CFR 109-40.103-3 - International transportation.

    Science.gov (United States)

    2010-07-01

    ... transportation. 109-40.103-3 Section 109-40.103-3 Public Contracts and Property Management Federal Property..., TRANSPORTATION, AND MOTOR VEHICLES 40-TRANSPORTATION AND TRAFFIC MANAGEMENT 40.1-General Provision § 109-40.103-3 International transportation. See 4 CFR 52.2 for a certificate required in nonuse of U.S. flag vessels or U.S...

  13. 41 CFR 109-27.102 - Economic order quantity principle.

    Science.gov (United States)

    2010-07-01

    ... PROCUREMENT 27-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102 Economic order quantity principle. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Economic order quantity principle. 109-27.102 Section 109-27.102 Public Contracts and Property Management Federal Property...

  14. 46 CFR 109.205 - Inspection of boilers and machinery.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Inspection of boilers and machinery. 109.205 Section 109... OPERATIONS Tests, Drills, and Inspections § 109.205 Inspection of boilers and machinery. The chief engineer or engineer in charge, before he assumes charge of the boilers and machinery of a unit shall inspect...

  15. 41 CFR 109-38.903 - Reporting of data.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.9-Federal Motor Vehicle Fleet Report § 109-38.903... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Reporting of data. 109-38.903 Section 109-38.903 Public Contracts and Property Management Federal Property Management...

  16. 46 CFR 109.347 - Pilot boarding equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Pilot boarding equipment. 109.347 Section 109.347... OPERATIONS Operation and Stowage of Safety Equipment § 109.347 Pilot boarding equipment. (a) The master or person in charge shall ensure that pilot boarding equipment is maintained as follows: (1) The equipment...

  17. 28 CFR 39.104-39.109 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.104-39.109 Section 39.104-39.109 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.104-39.109 [Reserved] ...

  18. 46 CFR 109.437 - Crane record book.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Crane record book. 109.437 Section 109.437 Shipping... Reports, Notifications, and Records Records § 109.437 Crane record book. The master or person in charge shall ensure that the following are maintained in a crane record book: (a) Descriptive information which...

  19. 40 CFR 57.109 - Maintenance of pay.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Maintenance of pay. 57.109 Section 57.109 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) PRIMARY NONFERROUS SMELTER ORDERS General § 57.109 Maintenance of pay. The Administrator will not approve...

  20. 46 CFR 109.565 - Charts and nautical publications.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 109.565 Section 109... OPERATIONS Miscellaneous § 109.565 Charts and nautical publications. The master or person in charge of a self...) Notices to mariners. (f) Tide Tables. (g) Current Tables. (h) All other nautical publications necessary. 1...

  1. 41 CFR 105-1.109-50 - General plan.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false General plan. 105-1.109-50 Section 105-1.109-50 Public Contracts and Property Management Federal Property Management....109-50 General plan. Chapter 105 is divided into parts, subparts, and further subdivisions as...

  2. 46 CFR 109.585 - Use of auto pilot.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Use of auto pilot. 109.585 Section 109.585 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Miscellaneous § 109.585 Use of auto pilot. Except as provided in 33 CFR 164.15, when the automatic pilot is used...

  3. 41 CFR 109-27.102-50 - Systems contracting.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-50 Systems contracting. Systems contracting may... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Systems contracting. 109-27.102-50 Section 109-27.102-50 Public Contracts and Property Management Federal Property Management...

  4. 41 CFR 109-27.102-1 - Applicability.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-1 Applicability. Replenishment of inventories of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability. 109-27.102-1 Section 109-27.102-1 Public Contracts and Property Management Federal Property Management...

  5. 41 CFR 109-27.102-51 - Policy.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-51 Policy. Systems contracting for supply... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-27.102-51 Section 109-27.102-51 Public Contracts and Property Management Federal Property Management Regulations...

  6. 41 CFR 109-28.000-51 - Storage guidelines.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Storage guidelines. 109-28.000-51 Section 109-28.000-51 Public Contracts and Property Management Federal Property Management...-STORAGE AND DISTRIBUTION § 109-28.000-51 Storage guidelines. (a) Indoor storage areas should be arranged...

  7. 10 CFR 9.109 - Report to Congress.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Report to Congress. 9.109 Section 9.109 Energy NUCLEAR REGULATORY COMMISSION PUBLIC RECORDS Government in the Sunshine Act Regulations § 9.109 Report to Congress. The Secretary shall annually report to the Congress regarding the Commission's compliance with the...

  8. 41 CFR 109-1.5108-3 - Stores inventories.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Stores inventories. 109-1.5108-3 Section 109-1.5108-3 Public Contracts and Property Management Federal Property Management....51-Personal Property Management Standards and Practices § 109-1.5108-3 Stores inventories. Perpetual...

  9. 41 CFR 109-27.5006 - Stores catalogs.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Stores catalogs. 109-27.5006 Section 109-27.5006 Public Contracts and Property Management Federal Property Management...-INVENTORY MANAGEMENT 27.50-Inventory Management Policies, Procedures, and Guidelines § 109-27.5006 Stores...

  10. 45 CFR 2490.104-2490.109 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.104-2490.109 Section 2490.104-2490.109 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.104-2490.109 [Reserved] ...

  11. 19 CFR 12.109 - Seizure and forfeiture.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Seizure and forfeiture. 12.109 Section 12.109 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE... § 12.109 Seizure and forfeiture. (a) Whenever any pre-Columbian monumental or architectural sculpture...

  12. 49 CFR 28.104-28.109 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.104-28.109 Section 28.104-28.109 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.104-28.109 [Reserved] ...

  13. 46 CFR 109.334 - Working over water.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Working over water. 109.334 Section 109.334 Shipping... Operation and Stowage of Safety Equipment § 109.334 Working over water. The master or person in charge shall insure that each person working over the water is wearing a life preserver or a buoyant work vest. ...

  14. 41 CFR 109-45.303-3 - Delivery.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Delivery. 109-45.303-3 Section 109-45.303-3 Public Contracts and Property Management Federal Property Management Regulations..., ABANDONMENT, OR DESTRUCTION OF PERSONAL PROPERTY 45.3-Sale of Personal Property § 109-45.303-3 Delivery. (a...

  15. 46 CFR 109.209 - Appliances for watertight integrity.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Appliances for watertight integrity. 109.209 Section 109... OPERATIONS Tests, Drills, and Inspections § 109.209 Appliances for watertight integrity. (a) Before getting underway, the master or person in charge shall insure that each appliance for watertight integrity is...

  16. Search for chirality in 109Ag

    International Nuclear Information System (INIS)

    Timar, J.; Nyako, B.M.; Berek, G.; Gal, J.; Kalinka, G.; Krasznahorkay, A.; Molnar, J.; Zolnai, L.

    2007-01-01

    Complete text of publication follows. The existence of nuclear chirality is one of the most intriguing questions of contemporary high-spin nuclear structure studies. Rotational doublet-band candidates for chiral structures have been observed mostly in two regions of the nuclear chart: around 134 Pr, and around 104 Rh. In this second region chirality in the Rh isotopes are rather well studied, chiral doubling have also been observed in 100 Tc, however, results obtained for chirality in the studied Ag nuclei ( 105 Ag and 106 Ag) look rather contradictory. Thus, it is interesting to study these doublet bands in the nearby higher-mass Ag nuclei. In order to search for a chiral-candidate partner band to the yrast πg 9/2 v(h 11/2 ) 2 band in 109 Ag, high-spin states of this nucleus have been studied using the 96 Zr( 18 O,p4n) reaction. The experiment was performed at iThemba LABS using 8 Clover detectors of the AFRODITE array and the DIAMANT charged-particle array to detect the γ-rays and the charged particles, respectively. Altogether ∼140 million γγ-coincidence events were collected. Approximately 10 million events of them correspond to the reaction channel producing 109 Ag. No chiral candidate partner band has been found to the πg 9/2 v(h 11/2 ) 2 band with this statistics, however, the level scheme could be extended by several new levels and γ-transitions. A preliminary level scheme of 109 Ag obtained from the ongoing data analysis is shown in Fig. 1

  17. Nuclear Data Sheets for A = 109

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, S.; Chen, J.; Kondev, F.G.

    2016-11-15

    Evaluated nuclear structure and decay data for all nuclei with mass number A = 109 (Y, Zr, Nb, Mo, Tc, Ru, Rh, Pd, Ag, Cd, In, Sn, Sb, Te, I, Xe) are presented. The experimental data are compiled and evaluated, and the best values for level and gamma-ray energies, quantum numbers, lifetimes, gamma-ray intensities, and other nuclear properties are recommended. Inconsistencies and discrepancies that exist in the literature are noted. This work supersedes the earlier evaluation by J. Blachot (2006Bl02), published in Nuclear Data Sheets107, 355 (2006).

  18. Distribution of cadmium between calcium carbonate and solution, 2

    International Nuclear Information System (INIS)

    Kitano, Yasushi; Kanamori, Nobuko; Fujiyoshi, Ryoko

    1978-01-01

    The distribution coefficient of cadmium between calcite and solution has been measured in the calcium bicarbonate solution containing cadmium and chloride ions, which forms complexes with cadmium ions. It has been confirmed experimentally that cadmium carbonate is present as a solid solution between calcitic calcium carbonate and cadmium carbonate in the carbonate precipitate formed in the solution system. However, the constant value of the thermodynamic distribution coefficient of cadmium between calcite and solution has not been obtained experimentally in the calcium bicarbonate solution containing cadmium and chloride ions. It may have been caused by the very specific behavior of cadmium ions, but the exact reason remains unsolved and must be studied. (Kobatake, H.)

  19. Historical perspectives on cadmium toxicology

    International Nuclear Information System (INIS)

    Nordberg, Gunnar F.

    2009-01-01

    The first health effects of cadmium (Cd) were reported already in 1858. Respiratory and gastrointestinal symptoms occurred among persons using Cd-containing polishing agent. The first experimental toxicological studies are from 1919. Bone effects and proteinuria in humans were reported in the 1940's. After World War II, a bone disease with fractures and severe pain, the itai-itai disease, a form of Cd-induced renal osteomalacia, was identified in Japan. Subsequently, the toxicokinetics and toxicodynamics of Cd were described including its binding to the protein metallothionein. International warnings of health risks from Cd-pollution were issued in the 1970's. Reproductive and carcinogenic effects were studied at an early stage, but a quantitative assessment of these effects in humans is still subject to considerable uncertainty. The World Health Organization in its International Program on Chemical Safety, WHO/IPCS (1992) (Cadmium. Environmental Health Criteria Document 134, IPCS. WHO, Geneva, 1-280.) identified renal dysfunction as the critical effect and a crude quantitative evaluation was presented. In the 1990's and 2000 several epidemiological studies have reported adverse health effects, sometimes at low environmental exposures to Cd, in population groups in Japan, China, Europe and USA (reviewed in other contributions to the present volume). The early identification of an important role of metallothionein in cadmium toxicology formed the basis for recent studies using biomarkers of susceptibility to development of Cd-related renal dysfunction such as gene expression of metallothionein in peripheral lymphocytes and autoantibodies against metallothionein in blood plasma. Findings in these studies indicate that very low exposure levels to cadmium may give rise to renal dysfunction among sensitive subgroups of human populations such as persons with diabetes.

  20. Lead and cadmium in food

    International Nuclear Information System (INIS)

    Gliesmann, S.; Kruse, H.; Kriews, M.; Mangels, H.

    1992-08-01

    The amounts of lead and cadmium produced and processed in these days are considerable. As a result, our environment is increasingly polluted by heavy metals and industrial installations, motor vehicles or incinerating plants appear to be among the main culprits here. Air and water are the media permitting the entry of heavy metals into our natural environment where they accumulate in the soil and then gradually migrate into the plants. Their further transport in the food constitutes the third step in the environmental spread of heavy metals. The consumption of muscle and organ meats, of vegetables, fruits, canned food and drinking water is unavoidably associated with some ingestion of lead and cadmium. The degree to which they are taken up and stored in different tissues is determined by absorption properties and the nutritional state of the organism. Cadmium tends to accumulate in the kidneys, lead is mainly stored in the bones. A continuously increasing uptake finally results in health injuries that range from unspecific complaints to damaged kidneys or bones and disorders of liver function. Children and elderly people are at a particular risk here. The level of food contamination is such that screening for heavy metals must be rigorously carried out once appropriate legal thresholds have been set, which ought to be based on proven detrimental effects of lead and cadmium on our health and also take account of infants and children or any other risk groups, where particular caution must be exercised. It should be pointed out that such thresholds have so far not been determined. (orig./MG) [de

  1. Influence of biological activity on sorption by using 65Zn and 109Cd into mangrove sediment

    International Nuclear Information System (INIS)

    Sondermann, Melissa N.; Barros, Joanna F.; Suzuki, Katia N.; Bellido, Alfredo V.B.; Lopes, Ricardo T.

    2015-01-01

    Evaluation of the chemical behavior of zinc and cadmium as well as the influence of biological activity in the sorption kinetics under microcosm experiments by mangrove sediments collected in Sepetiba Bay - Rio de Janeiro was carried out. The mentioned area was well contaminated due to the leaching from the tailing pile by the abandoned zinc processing company Inga Mercantil. Radiotracer 65 Zn and 109 Cd were used to follow their exchange across water-sediment interfaces up to 48 hours experiments in six mangrove sediment cores. To determine the benthic activity index (BAI) the cores were treated with formaldehyde (biocide) and it was found that the presence of the radiotracers in the deeper layers of sediment without formaldehyde treatment showed clearly the influence of benthic activity retention (benthic faunal and microbial effects), since the same pattern was not found in the treated sediment. The activity values obtained for 65 Zn and 109 Cd in the untreated sediment with formaldehyde on the first centimeter were 53.79±0.28 % and 67.34±0.16 % respectively, whereas for the treated ones, were 98.72 ± 0.29 % and 98.31 ± 0.24 % respectively. Thus, it was demonstrated that the use of formaldehyde, as biological activity inhibitor, ceases the bioturbation process and allowed the accumulation along the sediment. (author)

  2. Cadmium induces carcinogenesis in BEAS-2B cells through ROS-dependent activation of PI3K/AKT/GSK-3β/β-catenin signaling

    Energy Technology Data Exchange (ETDEWEB)

    Son, Young-Ok; Wang, Lei; Poyil, Pratheeshkumar; Budhraja, Amit; Hitron, J. Andrew; Zhang, Zhuo [Graduate Center for Toxicology, College of Medicine, University of Kentucky, Lexington, KY (United States); Lee, Jeong-Chae [Graduate Center for Toxicology, College of Medicine, University of Kentucky, Lexington, KY (United States); School of Dentistry and Institute of Oral Biosciences (BK21 program), Research Center of Bioactive Materials, Chonbuk National University, Jeonju 561-756 (Korea, Republic of); Shi, Xianglin, E-mail: xshi5@email.uky.edu [Graduate Center for Toxicology, College of Medicine, University of Kentucky, Lexington, KY (United States)

    2012-10-15

    -dependent signaling as potential therapeutic targets in cadmium carcinogenesis.

  3. Cadmium accumulation by Axonopus compressus (Sw.) P. Beauv and Cyperus rotundas Linn growing in cadmium solution and cadmium-zinc contaminated soil

    OpenAIRE

    Paitip Thiravetyan; Vibol Sao; Woranan Nakbanpote

    2007-01-01

    This research investigated the phyto-remediation potentials of Cyperus rotundas Linn (Nutgrass) and Axonopus compressus (Sw.) P. Beauv (Carpetgrass) for cadmium removal from cadmium solution andcadmium-zinc contaminated soil. Plants growth in the solution showed that cadmium decreased the relative growth rate of both grasses. However, the amount of cadmium accumulated in shoot and root was increasedwith the increase in cadmium concentration and exposure time. Growth in fertile soil mixed with...

  4. Cadmium-mediated disruption of cortisol biosynthesis involves suppression of corticosteroidogenic genes in rainbow trout

    International Nuclear Information System (INIS)

    Sandhu, Navdeep; Vijayan, Mathilakath M.

    2011-01-01

    Cadmium is widely distributed in the aquatic environment and is toxic to fish even at sublethal concentrations. This metal is an endocrine disruptor, and one well established role in teleosts is the suppression of adrenocorticotrophic hormone (ACTH)-stimulated cortisol biosynthesis by the interrenal tissue. However the mechanism(s) leading to this steroid suppression is poorly understood. We tested the hypothesis that cadmium targets genes encoding proteins critical for corticosteroid biosynthesis, including melanocortin 2 receptor (MC2R), steroidogenic acute regulatory protein (StAR) and cytochrome P450 side chain cleavage enzyme (P450scc), in rainbow trout (Oncorhynchus mykiss). To test this, head kidney slices (containing the interrenal tissues) were incubated in vitro with cadmium chloride (0, 10, 100 and 1000 nM) for 4 h either in the presence or absence of ACTH (0.5 IU/mL). In the unstimulated head kidney slices, cadmium exposure did not affect basal cortisol secretion and the mRNA levels of MC2R and P450scc, while StAR gene expression was significantly reduced. Cadmium exposure significantly suppressed ACTH-stimulated cortisol production in a dose-related fashion. This cadmium-mediated suppression in corticosteroidogenesis corresponded with a significant reduction in MC2R, StAR and P450scc mRNA levels in trout head kidney slices. The inhibition of ACTH-stimulated cortisol production and suppression of genes involved in corticosteroidogenesis by cadmium were completely abolished in the presence of 8-Bromo-cAMP (a cAMP analog). Overall, cadmium disrupts the expression of genes critical for corticosteroid biosynthesis in rainbow trout head kidney slices. However, the rescue of cortisol production as well as StAR and P450scc gene expressions by cAMP analog suggests that cadmium impact occurs upstream of cAMP production. We propose that MC2R signaling, the primary step in ACTH-induced cortocosteroidogenesis, is a key target for cadmium-mediated disruption of

  5. Cadmium-mediated disruption of cortisol biosynthesis involves suppression of corticosteroidogenic genes in rainbow trout

    Energy Technology Data Exchange (ETDEWEB)

    Sandhu, Navdeep [Department of Biology, University of Waterloo, 200 University Avenue West, Waterloo, Ontario N2L 3G1 (Canada); Vijayan, Mathilakath M., E-mail: mvijayan@uwaterloo.ca [Department of Biology, University of Waterloo, 200 University Avenue West, Waterloo, Ontario N2L 3G1 (Canada)

    2011-05-15

    Cadmium is widely distributed in the aquatic environment and is toxic to fish even at sublethal concentrations. This metal is an endocrine disruptor, and one well established role in teleosts is the suppression of adrenocorticotrophic hormone (ACTH)-stimulated cortisol biosynthesis by the interrenal tissue. However the mechanism(s) leading to this steroid suppression is poorly understood. We tested the hypothesis that cadmium targets genes encoding proteins critical for corticosteroid biosynthesis, including melanocortin 2 receptor (MC2R), steroidogenic acute regulatory protein (StAR) and cytochrome P450 side chain cleavage enzyme (P450scc), in rainbow trout (Oncorhynchus mykiss). To test this, head kidney slices (containing the interrenal tissues) were incubated in vitro with cadmium chloride (0, 10, 100 and 1000 nM) for 4 h either in the presence or absence of ACTH (0.5 IU/mL). In the unstimulated head kidney slices, cadmium exposure did not affect basal cortisol secretion and the mRNA levels of MC2R and P450scc, while StAR gene expression was significantly reduced. Cadmium exposure significantly suppressed ACTH-stimulated cortisol production in a dose-related fashion. This cadmium-mediated suppression in corticosteroidogenesis corresponded with a significant reduction in MC2R, StAR and P450scc mRNA levels in trout head kidney slices. The inhibition of ACTH-stimulated cortisol production and suppression of genes involved in corticosteroidogenesis by cadmium were completely abolished in the presence of 8-Bromo-cAMP (a cAMP analog). Overall, cadmium disrupts the expression of genes critical for corticosteroid biosynthesis in rainbow trout head kidney slices. However, the rescue of cortisol production as well as StAR and P450scc gene expressions by cAMP analog suggests that cadmium impact occurs upstream of cAMP production. We propose that MC2R signaling, the primary step in ACTH-induced cortocosteroidogenesis, is a key target for cadmium-mediated disruption of

  6. Improvement of cadmium phytoremediation after soil inoculation with a cadmium-resistant Micrococcus sp.

    Science.gov (United States)

    Sangthong, Chirawee; Setkit, Kunchaya; Prapagdee, Benjaphorn

    2016-01-01

    Cadmium-resistant Micrococcus sp. TISTR2221, a plant growth-promoting bacterium, has stimulatory effects on the root lengths of Zea mays L. seedlings under toxic cadmium conditions compared to uninoculated seedlings. The performance of Micrococcus sp. TISTR2221 on promoting growth and cadmium accumulation in Z. mays L. was investigated in a pot experiment. The results indicated that Micrococcus sp. TISTR2221significantly promoted the root length, shoot length, and dry biomass of Z. mays L. transplanted in both uncontaminated and cadmium-contaminated soils. Micrococcus sp. TISTR2221 significantly increased cadmium accumulation in the roots and shoots of Z. mays L. compared to uninoculated plants. At the beginning of the planting period, cadmium accumulated mainly in the shoots. With a prolonged duration of cultivation, cadmium content increased in the roots. As expected, little cadmium was found in maize grains. Soil cadmium was significantly reduced with time, and the highest percentage of cadmium removal was found in the bacterial-inoculated Z. mays L. after transplantation for 6 weeks. We conclude that Micrococcus sp. TISTR2221 is a potent bioaugmenting agent, facilitating cadmium phytoextraction in Z. mays L.

  7. Impact of synbiotic diets including inulin, Bacillus coagulans and Lactobacillus plantarum on intestinal microbiota of rat exposed to cadmium and mercury

    Directory of Open Access Journals (Sweden)

    Dornoush Jafarpour

    2015-09-01

    Full Text Available The aim of this study was to investigate the efficacy of two probiotics and a prebiotic (inulin on intestinal microbiota of rats exposed to cadmium and mercury. Fifty-four male Wistar rats were randomly divided into nine groups. All groups except control group were fed standard rat chow with 5% inulin and treated as follows: i control (standard diet, ii Lactobacillus plantarum- treated group (1×109 CFU/day, iii Bacillus coagulans-treated group (1×109 spores/day, iv cadmium-treated group (200 μg/rat/day, v L. plantarum and cadmium-treated group, vi B. coagulans and cadmium-treated group, vii mercury-treated group (10 μg/rat/day, viii L. plantarum and mercurytreated group, ix B. coagulans and mercurytreated group. Cadmium, mercury and probiotics were daily gavaged to individual rats for 42 days. Treatment effects on intestinal microbiota composition of rats were determined. Data showed that cadmium and mercury accumulation in rat intestine affected the gastrointestinal tract and had a reduction effect on all microbial counts (total aerobic bacteria, total anaerobic bacteria, total Lactic acid bacteria, L. plantarum and B. coagulans counts compared to the control group. It was also observed that application of synbiotics in synbiotic and heavy metals-treated groups had a significant effect and increased the number of fecal bacteria compared to the heavy metals groups. Based on our study, it can be concluded that L. plantarum and B. coagulans along with prebiotic inulin play a role in protection against cadmium and mercury inhibitory effect and have the potential to be a beneficial supplement in rats’ diets.

  8. Cadmium-containing nanoparticles: Perspectives on pharmacology and toxicology of quantum dots

    International Nuclear Information System (INIS)

    Rzigalinski, Beverly A.; Strobl, Jeannine S.

    2009-01-01

    The field of nanotechnology is rapidly expanding with the development of novel nanopharmaceuticals that have potential for revolutionizing medical treatment. The rapid pace of expansion in this field has exceeded the pace of pharmacological and toxicological research on the effects of nanoparticles in the biological environment. The development of cadmium-containing nanoparticles, known as quantum dots, show great promise for treatment and diagnosis of cancer and targeted drug delivery, due to their size-tunable fluorescence and ease of functionalization for tissue targeting. However, information on pharmacology and toxicology of quantum dots needs much further development, making it difficult to assess the risks associated with this new nanotechnology. Further, nanotechnology poses yet another risk for toxic cadmium, which will now enter the biological realm in nano-form. In this review, we discuss cadmium-containing quantum dots and their physicochemical properties at the nano-scale. We summarize the existing work on pharmacology and toxicology of cadmium-containing quantum dots and discuss perspectives in their utility in disease treatment. Finally, we identify critical gaps in our knowledge of cadmium quantum dot toxicity, and how these gaps need to be assessed to enable quantum dot nanotechnology to transit safely from bench to bedside.

  9. [Investigation of urinary cadmium characteristics of the general population in three non-cadmium-polluted rural areas in China].

    Science.gov (United States)

    Han, Jingxiu; Hu, Ji; Sun, Hong; Jing, Qiqing; Wang, Xiaofeng; Lou, Xiaoming; Ding, Zhen; Chen, Xiaodong; Zhang, Wenli; Shang, Qi

    2014-11-01

    To investigate the characteristics of urinary cadmium of the non-occupational-cadmium-exposed population in non-cadmium contaminated rural area in China. Randomly selected non-occupational cadmium exposed population 2548 people (male 1290, female 1258) with each gender and age groups, questionnaire surveyed and collected random urine. Urinary cadmium and urinary creatinine (Cr) concentration were tested, excluding urinary Cr 3 g/L. Analyze the impact factors of urinary cadmium and calculated 95% quantile (P95) of urinary cadmium after correction by urinary Cr. Urinary cadmium increased with age and showed an upward trend. The urinary cadmium of the population of ≥ 30 years old was significantly higher than that of populations (China (GB Z17-2002). The urinary cadmium reference value of non-occupational-cadmium-exposed populations is China, but for smoking women over 30 year-old it needs more research to explore.

  10. Cadmium stress in wheat seedlings: growth, cadmium accumulation and photosynthesis

    DEFF Research Database (Denmark)

    Ci, Dunwei; Jiang, Dong; Wollenweber, Bernd

    2010-01-01

    parameters were generally depressed by Cd stress, especially under the high Cd concentrations. Cd concentration and accumulation in both shoots and roots increased with increasing external Cd concentrations. Relationships between corrected parameters of growth, photosynthesis and fluorescence and corrected......Seedlings of wheat (Triticum aestivum L.) cultivars Jing 411, Jinmai 30 and Yangmai 10 were exposed to 0, 10, 20, 30, 40 or 50 μM of CdCl2 in a solution culture experiment. The effects of cadmium (Cd) stress on wheat growth, leaf photon energy conversion, gas exchange, and Cd accumulation in wheat...

  11. Cadmium in the bioenergy system - a synthesis

    International Nuclear Information System (INIS)

    Ahlfont, K.

    1997-12-01

    Cadmium is a toxic metal without any known positive biological effects. Both emissions and atmospheric deposition of cadmium have decreased radically in Sweden during recent years. In Sweden, about 150 tonnes of cadmium was supplied to the technosphere in 1990, mostly originating from NiCd batteries. More than 100 tonnes of cadmium accumulated in the technosphere. Mankind takes up cadmium from water, food and particulate atmospheric pollution. Even small amounts may be injurious in the long-term since the half-life in the kidneys is 30 years. Cadmium in biofuel and ashes are generally a cause of discussion. Ashes from biofuel constitute a nutrient resource that should be returned to the soil. A possible risk with spreading ashes is the spreading of heavy metals, and then foremost cadmium, which is among the heavy metals that forest soils are considered to tolerate the least. Several studies on cadmium in the bioenergy system have been made, both within the Research Programme for Recycling of Wood-ash, and within Vattenfall's Bioenergy Project. The present report is intended to provide a picture of the current state of knowledge and to review plans for the future With a 3 page summary in English. 51 refs, 1 fig, 3 tabs

  12. 29 CFR 1926.1127 - Cadmium.

    Science.gov (United States)

    2010-07-01

    ... occupational exposure to cadmium as follows: (1) Reassess the employee's work practices and personal hygiene... employee's work practices and personal hygiene; the employee's respirator use, if any; the employee's...; assuring that all employees exposed to air cadmium levels above the PEL wear appropriate personal...

  13. Cadmium and children: Exposure and health effects.

    NARCIS (Netherlands)

    Schoeters, G.; Hond, E. Den; Zuurbier, M.; Naginiene, R.; Hazel, P.J. van den; Stilianakis, N.; Ronchetti, R.; Koppe, J.G.

    2006-01-01

    Cadmium exposure and accumulation in the body start at young age. Exposure routes in children are mainly via food, environmental tobacco smoke and house dust. Excretion from the body is limited. Cadmium accumulation in the kidney is responsible for effects such as nephrotoxicity and osteoporosis

  14. Immunochromatographic assay of cadmium levels in oysters.

    Science.gov (United States)

    Nishi, Kosuke; Kim, In-Hae; Itai, Takaaki; Sugahara, Takuya; Takeyama, Haruko; Ohkawa, Hideo

    2012-08-15

    Oysters are one of foodstuffs containing a relatively high amount of cadmium. Here we report on establishment of an immunochromatographic assay (ICA) method of cadmium levels in oysters. Cadmium was extracted with 0.l mol L(-1) HCl from oysters and cleaned up from other metals by the use of an anion-exchange column. The behavior of five metals Mn, Fe, Cu, Zn, and Cd was monitored at each step of extraction and clean-up procedure for the ICA method in an inductively coupled plasma-mass spectrometry (ICP-MS) analysis. The results revealed that a simple extraction method with the HCl solution was efficient enough to extract almost all of cadmium from oysters. Clean-up with an anion-exchange column presented almost no loss of cadmium adsorbed on the column and an efficient removal of metals other than cadmium. When a spiked recovery test was performed in the ICA method, the recovery ranged from 98% to 112% with relative standard deviations between 5.9% and 9.2%. The measured values of cadmium in various oyster samples in the ICA method were favorably correlated with those in ICP-MS analysis (r(2)=0.97). Overall results indicate that the ICA method established in the present study is an adequate and reliable detection method for cadmium levels in oysters. Copyright © 2012 Elsevier B.V. All rights reserved.

  15. Association of urinary cadmium and myocardial infarction

    International Nuclear Information System (INIS)

    Everett, Charles J.; Frithsen, Ivar L.

    2008-01-01

    We conducted a cross-sectional analysis of individuals 45-79 years old in the National Health and Nutrition Examination Survey III (1988-1994) (NHANES III). Myocardial infarction was determined by electrocardiogram (ECG). Our sample included 4912 participants, which when weighted represented 52,234,055 Americans. We performed adjusted logistic regressions with the Framingham risk score, pack-years of smoking, race-ethnicity, and family history of heart attack, and diabetes as covariates. Urinary cadmium ≥0.88 μg/g creatinine had an odds ratio of 1.86 (95% CI 1.26-2.75) compared to urinary cadmium <0.43 μg/g creatinine. This result supports the hypothesis that cadmium is associated with coronary heart disease. When logistic regressions were done by gender, women, but not men, showed a significant association of urinary cadmium with myocardial infarction. Women with urinary cadmium ≥0.88 μg/g creatinine had an odds ratio of 1.80 (95% CI 1.06-3.04) compared to urinary cadmium <0.43 μg/g creatinine. When the analysis was restricted to never smokers (N=2187) urinary cadmium ≥0.88 μg/g creatinine had an odds ratio of 1.85 (95% CI 1.10-3.14) compared to urinary cadmium <0.43 μg/g creatinine

  16. Oral cadmium chloride intoxication in mice

    DEFF Research Database (Denmark)

    Andersen, O; Nielsen, J B; Svendsen, P

    1988-01-01

    Diethyldithiocarbamate (DDC) is known to alleviate acute toxicity due to injection of cadmium salts. However, when cadmium chloride was administered by the oral route, DDC enhanced rather than alleviated the acute toxicity; both oral and intraperitoneal (i.p.) administration of DDC had this effect...

  17. Electro-spark machining of cadmium antimonide

    International Nuclear Information System (INIS)

    Ivanovskij, V.N.; Stepakhina, K.A.

    1975-01-01

    Experimental data on electrical erosion of the semiconductor material (cadmium antimonide) alloyed with tellurium are given. The potentialisies and expediency of using the electric-spark method of cutting cadmium antimonide ingots with the resistivity of 1 ohm is discussed. Cutting has been carried out in distilled water and in the air

  18. Cadmium toxcity in the pregnant rat

    International Nuclear Information System (INIS)

    Martin, P.G.; Hitchcock, B.B.; King, J.F.

    1978-01-01

    Iron-deficient and normal pregnant rats were assigned to groups that either received a dose of cadmium (0.025, 0.050, or 0.100 mmole) plus 8 μCi of /sup 115m/Cd on day 18 of gestation or served as a nondosed group. Animals were either sacrificed 3 days after the dosing or allowed to litter (nondosed and 0.100 mmole cadmium groups only); pups and dams were sacrificed at 14 days of age. Viability of iron-deficient dams and fetuses and pups from iron-deficient dams was affected by the 0.100 mmole cadmium dose to a greater degree than was that in comparable normal animals. Although calculated amounts of cadmium deposited in the dam's liver, kidney, blood, tibia, and fetuses were greater in iron-deficient than in normal animals at all doses, differences were not significant except in the amount of cadmium accumulated in the placenta at the highest cadmium doses. Total deposition in the placentas/litter was similar for normal and iron-deficient groups at each dose level. The decreased viability may have been due to the dam's decreased food intake; blockage of nutrients, especially minerals, by cadmium--protein complexes in the placenta; or hormonal interruptions of pregnancy by steroid--cadmium complexes

  19. Novel Cadmium Resistance Determinant in Listeria monocytogenes.

    Science.gov (United States)

    Parsons, Cameron; Lee, Sangmi; Jayeola, Victor; Kathariou, Sophia

    2017-03-01

    Listeria monocytogenes is a foodborne pathogen that can cause severe disease (listeriosis) in susceptible individuals. It is ubiquitous in the environment and often exhibits resistance to heavy metals. One of the determinants that enables Listeria to tolerate exposure to cadmium is the cadAC efflux system, with CadA being a P-type ATPase. Three different cadA genes (designated cadA1 to cadA3 ) were previously characterized in L. monocytogenes A novel putative cadmium resistance gene ( cadA4 ) was recently identified through whole-genome sequencing, but experimental confirmation for its involvement in cadmium resistance is lacking. In this study, we characterized cadA4 in L. monocytogenes strain F8027, a cadmium-resistant strain of serotype 4b. By screening a mariner-based transposon library of this strain, we identified a mutant with reduced tolerance to cadmium and that harbored a single transposon insertion in cadA4 The tolerance to cadmium was restored by genetic complementation with the cadmium resistance cassette ( cadA4C ), and enhanced cadmium tolerance was conferred to two unrelated cadmium-sensitive strains via heterologous complementation with cadA4C Cadmium exposure induced cadA4 expression, even at noninhibitory levels. Virulence assessments in the Galleria mellonella model suggested that a functional cadA4 suppressed virulence, potentially promoting commensal colonization of the insect larvae. Biofilm assays suggested that cadA4 inactivation reduced biofilm formation. These data not only confirm cadA4 as a novel cadmium resistance determinant in L. monocytogenes but also provide evidence for roles in virulence and biofilm formation. IMPORTANCE Listeria monocytogenes is an intracellular foodborne pathogen causing the disease listeriosis, which is responsible for numerous hospitalizations and deaths every year. Among the adaptations that enable the survival of Listeria in the environment are the abilities to persist in biofilms, grow in the cold, and

  20. Molecular and cellular mechanisms of cadmium carcinogenesis

    International Nuclear Information System (INIS)

    Waisberg, Michael; Joseph, Pius; Hale, Beverley; Beyersmann, Detmar

    2003-01-01

    Cadmium is a heavy metal, which is widely used in industry, affecting human health through occupational and environmental exposure. In mammals, it exerts multiple toxic effects and has been classified as a human carcinogen by the International Agency for Research on Cancer. Cadmium affects cell proliferation, differentiation, apoptosis and other cellular activities. Cd 2+ does not catalyze Fenton-type reactions because it does not accept or donate electrons under physiological conditions, and it is only weakly genotoxic. Hence, indirect mechanisms are implicated in the carcinogenicity of cadmium. In this review multiple mechanisms are discussed, such as modulation of gene expression and signal transduction, interference with enzymes of the cellular antioxidant system and generation of reactive oxygen species (ROS), inhibition of DNA repair and DNA methylation, role in apoptosis and disruption of E-cadherin-mediated cell-cell adhesion. Cadmium affects both gene transcription and translation. The major mechanisms of gene induction by cadmium known so far are modulation of cellular signal transduction pathways by enhancement of protein phosphorylation and activation of transcription and translation factors. Cadmium interferes with antioxidant defense mechanisms and stimulates the production of reactive oxygen species, which may act as signaling molecules in the induction of gene expression and apoptosis. The inhibition of DNA repair processes by cadmium represents a mechanism by which cadmium enhances the genotoxicity of other agents and may contribute to the tumor initiation by this metal. The disruption of E-cadherin-mediated cell-cell adhesion by cadmium probably further stimulates the development of tumors. It becomes clear that there exist multiple mechanisms which contribute to the carcinogenicity of cadmium, although the relative weights of these contributions are difficult to estimate

  1. Cadmium safety rod thermal tests

    International Nuclear Information System (INIS)

    Thomas, J.K.; Iyer, N.C.; Peacock, H.B.

    1992-01-01

    Thermal testing of cadmium safety rods was conducted as part of a program to define the response of Savannah River Site (SRS) production reactor core components to a hypothetical LOCA leading to a drained reactor tank. The safety rods are present in the reactor core only during shutdown and are not used as a control mechanism during operation; thus, their response to the conditions predicted for the LOCA is only of interest to the extent that it could impact the progression of the accident. This document provides a description of this testing

  2. Testing Cadmium-Free Coatings

    Science.gov (United States)

    2011-08-30

    Secretary of Defense Directive • “Approve the use of alternatives [to hexavalent chromium (Cr6+)] where they can perform adequately for the intended...Effect of corrosion on breakaway torque 12 OPSEC approved for public release Fastener Finish Study FINISH POST-TREATMENT LUBRICANT Cadmium Hexavalent ...Past Testing Electrical Connectors Coatings Al / TCP ZnNi / TCP ZnNi / Non- Chrome Passivation (NCP) Ni-PTFE 1 Ni-PTFE 2 Note: SnZn tested on flat

  3. Relation between dietary cadmium intake and biomarkers of cadmium exposure in premenopausal women accounting for body iron stores

    Directory of Open Access Journals (Sweden)

    Julin Bettina

    2011-12-01

    Full Text Available Abstract Background Cadmium is a widespread environmental pollutant with adverse effects on kidneys and bone, but with insufficiently elucidated public health consequences such as risk of end-stage renal diseases, fractures and cancer. Urinary cadmium is considered a valid biomarker of lifetime kidney accumulation from overall cadmium exposure and thus used in the assessment of cadmium-induced health effects. We aimed to assess the relationship between dietary cadmium intake assessed by analyses of duplicate food portions and cadmium concentrations in urine and blood, taking the toxicokinetics of cadmium into consideration. Methods In a sample of 57 non-smoking Swedish women aged 20-50 years, we assessed Pearson's correlation coefficients between: 1 Dietary intake of cadmium assessed by analyses of cadmium in duplicate food portions collected during four consecutive days and cadmium concentrations in urine, 2 Partial correlations between the duplicate food portions and urinary and blood cadmium concentrations, respectively, and 3 Model-predicted urinary cadmium concentration predicted from the dietary intake using a one-compartment toxicokinetic model (with individual data on age, weight and gastrointestinal cadmium absorption and urinary cadmium concentration. Results The mean concentration of cadmium in urine was 0.18 (+/- s.d.0.12 μg/g creatinine and the model-predicted urinary cadmium concentration was 0.19 (+/- s.d.0.15 μg/g creatinine. The partial Pearson correlations between analyzed dietary cadmium intake and urinary cadmium or blood concentrations were r = 0.43 and 0.42, respectively. The correlation between diet and urinary cadmium increased to r = 0.54 when using a one-compartment model with individual gastrointestinal cadmium absorption coefficients based on the women's iron status. Conclusions Our results indicate that measured dietary cadmium intake can reasonably well predict biomarkers of both long-term kidney accumulation

  4. Influence of protein deficiency on cadmium toxicity in rats

    Energy Technology Data Exchange (ETDEWEB)

    Tewari, P C; Jain, V K; Ashquin, M; Tandon, S K

    1986-07-01

    The effects of a low protein diet on the body uptake and retention of cadmium, levels of essential trace elements, and cadmium-induced biochemical alterations in liver and kidneys of the rat were investigated. Low dietary protein disturbs cadmium induced alterations in carbohydrate metabolism, essential trace elements metabolism and offsets the hepatic and renal process of cadmium detoxification. Protein malnutrition enhances the susceptibility to cadmium intoxication.

  5. Cadmium Exposure is Associated with the Prevalence of Dyslipidemia.

    Science.gov (United States)

    Zhou, Zhou; Lu, Yong-Hui; Pi, Hui-Feng; Gao, Peng; Li, Min; Zhang, Lei; Pei, Li-Ping; Mei, Xiang; Liu, Lin; Zhao, Qi; Qin, Qi-Zhong; Chen, Yu; Jiang, Yue-Ming; Zhang, Zhao-Hui; Yu, Zheng-Ping

    2016-01-01

    Cadmium is a widespread environmental and occupational pollutant that accumulates in human body with a biological half-life exceeding 10 years. Cadmium exposure has been demonstrated to increase rates of cardiovascular diseases. Whether occupational cadmium exposure is associated with the increase in the prevalence of dyslipidemia and hence contributes to the risk of cardiovascular diseases is still equivocal. To test the hypothesis that exposure to cadmium is related to the prevalence of dyslipidemia, we examined the associations between blood cadmium concentration and the prevalence of dyslipidemia in workers occupationally exposed to cadmium in China. A cross-sectional survey on demographic data, blood cadmium level and lipid profile in cadmium exposed workers from seven cadmium smelting factories in central and southwestern China was conducted. We measured blood cadmium concentration and lipid components of 1489 cadmium exposed workers. The prevalence of dyslipidemia was compared across blood cadmium quartiles. Associations between the blood cadmium concentrations and the prevalence of dyslipidemia were assessed using confounder adjusted linear and logistic regressions. The blood cadmium concentration was 3.61±0.84µg/L ( mean ±SD). The prevalence of dyslipidemia in this occupational population was 66.3%. Mean blood cadmium concentration of workers with dyslipedemia was significantly higher than that of workers without dyslipidemia (p dyslipidemia increased dose-dependently with elevations in blood cadmium concentrations (p for trend dyslipidemia across the increasing blood cadmium quartiles were 1.21(1.16-1.55), 1.56(1.11-1.87), 1.79(1.26-2.25) respectively (referencing to 1.00; p for trend dyslipidemia remained unchanged (all p for trend dyslipidemia. Cadmium exposure could alter lipid metabolism in humans. It is imperative to control cadmium exposure of occupational population in cadmium related industries and reduce adverse health effects. © 2016 The

  6. Histological changes, apoptosis and metallothionein levels in Triturus carnifex (Amphibia, Urodela) exposed to environmental cadmium concentrations

    Energy Technology Data Exchange (ETDEWEB)

    Capaldo, Anna, E-mail: anna.capaldo@unina.it [Department of Biology, University of Naples Federico II, Naples (Italy); Gay, Flaminia [Department of Chemistry and Biology, University of Salerno, Salerno (Italy); Scudiero, Rosaria; Trinchella, Francesca [Department of Biology, University of Naples Federico II, Naples (Italy); Caputo, Ivana; Lepretti, Marilena; Marabotti, Anna; Esposito, Carla [Department of Chemistry and Biology, University of Salerno, Salerno (Italy); Laforgia, Vincenza [Department of Biology, University of Naples Federico II, Naples (Italy)

    2016-04-15

    Highlights: • Specimens of the newt Triturus carnifex were exposed to environmental Cd doses. • Newts exposed to Cd during 9 months accumulated Cd in their tissues. • Cd induced histological alterations in the skin, liver and kidneys. • Cd induced apoptosis only in the kidneys. • Cd did not increase metallothionein levels in the skin and the liver, nor MTs mRNA. - Abstract: The aim of this study was to verify if the freshwater safety values established from the European Community (1998) and the Italian Ministry of Health (2001) for cadmium (44.5 nM/L in drinking water and 178 nM/L in sewage waters) were safe for amphibians, since at these same concentrations cadmium induced endocrine disruption in the newt Triturus carnifex. Adult male specimens of T. carnifex were exposed daily to cadmium (44.5 nM/L and 178 nM/L as CdCl{sub 2}, nominal concentrations), respectively, during 3- and 9-months; at the same time, control newts were exposed to tap water only. The accumulation of cadmium in the skin, liver and kidney, the levels of metallothioneins in the skin and the liver, the expression of metallothionein mRNA in the liver, as well as the presence of histological alterations and of apoptosis in the target organs were evaluated. The 9-months exposure induced cadmium accumulation in all the tissues examined; moreover, histological changes were observed in all the tissues examined, irrespective of the dose or the time of exposure. Apoptosis was only detected in the kidney, whereas metallothioneins and metallothionein mRNA did not increase. This study demonstrates that the existing chronic water quality criterion established for cadmium induces in the newt T. carnifex cadmium accumulation and histological alterations in the target organs examined. Together with our previous results, showing that, at these same concentrations, cadmium induced endocrine disruption, the present results suggest that the existing chronic water quality criterion for cadmium appears to

  7. Cadmium - a case of mistaken identity

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, D

    1984-05-01

    New evidence is presented which describes the impact of cadmium in the environment. Cadmium is a persistent material, although its compounds may undergo a range of chemical changes in the environment. In soluble form cadmium and its compounds are toxic at relatively low concentrations to aquatic animals although their bioconcentrations in such animals is in general low, and there is no evidence of biomagnification. In insoluble form cadmium and its compounds are relatively non-toxic to aquatic animals and are unlikely to be bioconcentrated. As such, cadmium is similar to most other heavy metals. Recent studies indicate that cadmium is not implicated in Itai-Itai disease and does not appear to cause hypertension or cancer. In addition, the accepted critical level in the kidney may have been underestimated. Thus, the hazard to man appears to be considerably less than the original estimates. In view of these data, there seems little justification in treating cadmium in any way differently from the other metals and hence no reason for retaining it on the Black List of the international conventions. 19 references.

  8. Response of Saccharomyces cerevisiae to cadmium stress

    International Nuclear Information System (INIS)

    Moreira, Luciana Mara Costa; Ribeiro, Frederico Haddad; Neves, Maria Jose; Porto, Barbara Abranches Araujo; Amaral, Angela M.; Menezes, Maria Angela B.C.; Rosa, Carlos Augusto

    2009-01-01

    The intensification of industrial activity has been greatly contributing with the increase of heavy metals in the environment. Among these heavy metals, cadmium becomes a serious pervasive environmental pollutant. The cadmium is a heavy metal with no biological function, very toxic and carcinogenic at low concentrations. The toxicity of cadmium and several other metals can be mainly attributed to the multiplicity of coordination complexes and clusters that they can form. Some aspects of the cellular response to cadmium were extensively investigated in the yeast Saccharomyces cerevisiae. The primary site of interaction between many toxic metals and microbial cells is the plasma membrane. Plasma-membrane permeabilisation has been reported in a variety of microorganisms following cadmium exposure, and is considered one mechanism of cadmium toxicity in the yeast. In this work, using the yeast strain S. cerevisiae W303-WT, we have investigated the relationships between Cd uptake and release of cellular metal ions (K + and Na + ) using neutron activation technique. The neutron activation was an easy, rapid and suitable technique for doing these metal determinations on yeast cells; was observed the change in morphology of the strains during the process of Cd accumulation, these alterations were observed by Transmission Electron Microscopy (TEM) and Scanning Electron Microscopy (SEM) during incorporation of cadmium. (author)

  9. Response of Saccharomyces cerevisiae to cadmium stress

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Luciana Mara Costa; Ribeiro, Frederico Haddad; Neves, Maria Jose [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Lab. de Radiobiologia], e-mail: luamatu@uol.com.br; Porto, Barbara Abranches Araujo; Amaral, Angela M.; Menezes, Maria Angela B.C. [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Lab. de Ativacao Neutronica], e-mail: menezes@cdtn.br; Rosa, Carlos Augusto [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Microbiologia], e-mail: carlrosa@icb.ufmg

    2009-07-01

    The intensification of industrial activity has been greatly contributing with the increase of heavy metals in the environment. Among these heavy metals, cadmium becomes a serious pervasive environmental pollutant. The cadmium is a heavy metal with no biological function, very toxic and carcinogenic at low concentrations. The toxicity of cadmium and several other metals can be mainly attributed to the multiplicity of coordination complexes and clusters that they can form. Some aspects of the cellular response to cadmium were extensively investigated in the yeast Saccharomyces cerevisiae. The primary site of interaction between many toxic metals and microbial cells is the plasma membrane. Plasma-membrane permeabilisation has been reported in a variety of microorganisms following cadmium exposure, and is considered one mechanism of cadmium toxicity in the yeast. In this work, using the yeast strain S. cerevisiae W303-WT, we have investigated the relationships between Cd uptake and release of cellular metal ions (K{sup +} and Na{sup +}) using neutron activation technique. The neutron activation was an easy, rapid and suitable technique for doing these metal determinations on yeast cells; was observed the change in morphology of the strains during the process of Cd accumulation, these alterations were observed by Transmission Electron Microscopy (TEM) and Scanning Electron Microscopy (SEM) during incorporation of cadmium. (author)

  10. Epidemiological approach to cadmium pollution in Japan

    Energy Technology Data Exchange (ETDEWEB)

    Shigematsu, I.

    1984-04-01

    The study of health problems due to cadmium pollution in Japan originated from an endemic episode of Itai-itai disease in a rural area in north-central Japan after World War II. The disease was defined as osteomalacia with tubular changes in the kidney and considered to be associated with excess intake of cadmium. This episode motivated the Japanese Government to conduct health examinations on the general population in cadmium-polluted and non-polluted areas throughout the country since 1969. Although Itai-itai disease-like bone changes were rarely found, these studies revealed a higher prevalence of renal tubular dysfunction among elderly people in the cadmium-polluted areas. No significant difference was noted in cancer mortality, but mortality from cardiovascular diseases and all causes tended to be lower in cadmium-polluted areas. Clinical and pathological studies in man as well as experiments on primates have recently been made to elucidate the pathogenesis of Itai-itai disease and the health effects of cadmium. The lack of knowledge on the ecological and biological complex of cadmium resulted in the impediment of studies on this problem. The lesson from this experience is that basic research is essential for promoting the study of pollutants such as heavy metals, though pollution problems usually require urgent solutions.

  11. The role of microRNAs in copper and cadmium homeostasis

    International Nuclear Information System (INIS)

    Ding, Yan-Fei; Zhu, Cheng

    2009-01-01

    Essential heavy metals (e.g., copper) and non-essential metals (e.g., cadmium) are both toxic to plants at high concentrations. Recently, microRNAs (miRNAs) have emerged as important modulators of plants adaptive response to heavy metal stress. Plant miRNAs negatively regulate target mRNAs by post-transcriptional cleavage. miR398 regulates copper homeostasis via down-regulating the expression of Cu,Zn-superoxide dismutase (CSD), a scavenger of superoxide radicals. miR393 and miR171 play an important role in cadmium stress mediation. This review focuses on the recent advance in the involvement of miRNAs in copper and cadmium stress regulatory networks in plants.

  12. Cadmium decontamination using in-house resin

    International Nuclear Information System (INIS)

    Pal, Sangita; Thalor, K.L; Prabhakar, S.; Srivastava, V.K.; Goswami, J.L.; Tewari, P.K.; Dhanpal, Pranav; Goswami, J.L.

    2010-01-01

    A selective and strong in-house chelator has been studied w.r.t. basic parameters like concentration, time, and elution. De-contamination of cadmium, mercury, chromium, lead etc by using high uptake values fro cadmium ions proves its selectivity with high elution ratio ensures further decontamination of run-off water during natural calamities. In three step cascade use the concentration of original cadmium solution (500 ppm) decocted to safe disposable attribute. This polymeric ligand exchanger displayed outlet effluent concentration to 1 ppm and less than 200 ppb when treated for inlet feed concentration of 50 ppm and 500 ppm respectively. (author)

  13. Lead and cadmium content of spices

    Energy Technology Data Exchange (ETDEWEB)

    Bielig, H J; Dreyer, H; Askar, A

    1977-02-02

    The lead and cadmium content of various spices was determined by flameless atomic absorption (AAS). With the exception of one sample, the lead content was lower than 5 ppm, averaging a value of 2,2 ppm Pb. Thus, the maximum permissible level of 5 ppm Pb as recommended by different DIN standards, is not exceeded. The cadmium content was - except for one sample - lower than 0,5 ppm averaging a value of 0,23 ppm Cd. It can be assumed, that by spicing our dishes, the ingestion of lead and cadmium stays at a low level.

  14. Influence of exposure time on the distribution of cadmium within the cladoceran Ceriodaphnia dubia

    International Nuclear Information System (INIS)

    Munger, C.; Hare, L.; Craig, A.; Charest, P.-M.

    1998-01-01

    The internal distribution of a trace metal can be useful in determining in which body organ toxic effects are most likely to occur and the animal function most likely to be affected. In addition, because a metal's distribution within an organism is likely to influence the rate and efficiency with which it is transferred to a higher trophic level, laboratory measurements of trophic transfer could be influenced by exposure duration. We compared the internal distribution of cadmium (Cd) in a cladoceran crustacean (Ceriodaphnia dubia) destined as food for a predatory insect (Chaoborus) after either a 1 day or a lifetime of exposure of prey to the trace metal. Prey were exposed to 112+109 Cd in both water (10 nM) and their food (algae), as might occur in nature. The internal distribution of 109 Cd in the cladoceran was determined by whole-animal autoradiography. Both the amount and the tissue distribution of Cd in prey were the same after the short and the long term exposures, suggesting that metal accumulation parameters measured after short-term metal exposures can be valid for this animal. Cadmium was mainly accumulated in diverticula of the anterior midgut, a region reported to be responsible for nutrient absorption. We hypothesize that Cd is accumulated in the diverticula because of their purported role as sites of calcium uptake. (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)

  15. Cadmium Exposure is Associated with the Prevalence of Dyslipidemia

    Directory of Open Access Journals (Sweden)

    Zhou Zhou

    2016-11-01

    Full Text Available Background: Cadmium is a widespread environmental and occupational pollutant that accumulates in human body with a biological half-life exceeding 10 years. Cadmium exposure has been demonstrated to increase rates of cardiovascular diseases. Whether occupational cadmium exposure is associated with the increase in the prevalence of dyslipidemia and hence contributes to the risk of cardiovascular diseases is still equivocal. To test the hypothesis that exposure to cadmium is related to the prevalence of dyslipidemia, we examined the associations between blood cadmium concentration and the prevalence of dyslipidemia in workers occupationally exposed to cadmium in China. Methods: A cross-sectional survey on demographic data, blood cadmium level and lipid profile in cadmium exposed workers from seven cadmium smelting factories in central and southwestern China was conducted. We measured blood cadmium concentration and lipid components of 1489 cadmium exposed workers. The prevalence of dyslipidemia was compared across blood cadmium quartiles. Associations between the blood cadmium concentrations and the prevalence of dyslipidemia were assessed using confounder adjusted linear and logistic regressions. Results: The blood cadmium concentration was 3.61±0.84µg/L ( mean ±SD. The prevalence of dyslipidemia in this occupational population was 66.3%. Mean blood cadmium concentration of workers with dyslipedemia was significantly higher than that of workers without dyslipidemia (p Conclusion: Elevated blood cadmium concentration is associated with prevalence of dyslipidemia. Cadmium exposure could alter lipid metabolism in humans. It is imperative to control cadmium exposure of occupational population in cadmium related industries and reduce adverse health effects.

  16. 41 CFR 115-1.109 - Numbering in FPMR system.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Numbering in FPMR system. 115-1.109 Section 115-1.109 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1...

  17. 41 CFR 105-1.109-52 - Cross-references.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Cross-references. 105-1.109-52 Section 105-1.109-52 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1...

  18. 19 CFR 10.9 - Articles exported for processing.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles exported for processing. 10.9 Section 10... THE TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. General Provisions Articles Exported and Returned § 10.9 Articles exported for processing. (a) Except as otherwise provided for in this...

  19. 41 CFR 109-26.501-54 - Communications equipment.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Communications equipment. 109-26.501-54 Section 109-26.501-54 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND...

  20. 41 CFR 109-28.000-50 - Policy.

    Science.gov (United States)

    2010-07-01

    ... industrial management practices and principles. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-28.000-50 Section 109-28.000-50 Public Contracts and Property Management Federal Property Management Regulations...

  1. 40 CFR 26.109 - IRB review of research.

    Science.gov (United States)

    2010-07-01

    ... 26.109 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PROTECTION OF HUMAN SUBJECTS Basic EPA Policy for Protection of Subjects in Human Research Conducted or Supported by EPA § 26.109 IRB... subjects when in the IRB's judgment the information would meaningfully add to the protection of the rights...

  2. 32 CFR 701.109 - Privacy Act (PA) appeals.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Privacy Act (PA) appeals. 701.109 Section 701... OF THE NAVY DOCUMENTS AFFECTING THE PUBLIC DON Privacy Program § 701.109 Privacy Act (PA) appeals. (a... commence when the appeal reaches the office of the review authority having jurisdiction over the record...

  3. 41 CFR 109-26.501-1 - General.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false General. 109-26.501-1 Section 109-26.501-1 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26...

  4. 41 CFR 109-26.501-53 - Acquisitions by transfer.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Acquisitions by transfer. 109-26.501-53 Section 109-26.501-53 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND...

  5. 41 CFR 109-26.501-51 - Used vehicles.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Used vehicles. 109-26.501-51 Section 109-26.501-51 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26...

  6. 41 CFR 109-26.501-4 - Submission of orders.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Submission of orders. 109-26.501-4 Section 109-26.501-4 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 26...

  7. 41 CFR 109-38.202-50 - Security.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Security. 109-38.202-50 Section 109-38.202-50 Public Contracts and Property Management Federal Property Management Regulations....202-50 Security. Unissued license tags shall be stored in a locked drawer, cabinet, or storage area...

  8. 41 CFR 109-45.310 - Antitrust laws.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Antitrust laws. 109-45.310 Section 109-45.310 Public Contracts and Property Management Federal Property Management... Antitrust laws. DOE offices shall submit to the Deputy Assistant Secretary for Procurement and Assistance...

  9. 14 CFR 1245.109 - Assignment of title to NASA.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Assignment of title to NASA. 1245.109... INTELLECTUAL PROPERTY RIGHTS Patent Waiver Regulations § 1245.109 Assignment of title to NASA. (a) The instrument of waiver set forth in § 1245.115(c) shall be voided by NASA with respect to the domestic title to...

  10. 14 CFR 1221.109 - Use of the NASA Seal.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Use of the NASA Seal. 1221.109 Section 1221.109 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION THE NASA SEAL AND OTHER DEVICES, AND THE CONGRESSIONAL SPACE MEDAL OF HONOR NASA Seal, NASA Insignia, NASA Logotype, NASA Program...

  11. 41 CFR 101-1.109 - Numbering in FPMR System.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Numbering in FPMR System. 101-1.109 Section 101-1.109 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation System § 101...

  12. 41 CFR 105-1.109-51 - Arrangement.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Arrangement. 105-1.109-51 Section 105-1.109-51 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1...

  13. 41 CFR 109-38.502-50 - DOE guidelines.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false DOE guidelines. 109-38.502-50 Section 109-38.502-50 Public Contracts and Property Management Federal Property Management... guidelines. (a) Whenever practicable and cost effective, commercial service facilities shall be utilized for...

  14. 47 CFR 25.109 - Cross-reference.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cross-reference. 25.109 Section 25.109 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS... licensed under this part: (a) Amateur Satellite Service, see 47 CFR part 97. (b) Ship earth stations in the...

  15. 49 CFR 1522.109 - TSA review and approval.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false TSA review and approval. 1522.109 Section 1522.109..., DEPARTMENT OF HOMELAND SECURITY SECURITY RULES FOR ALL MODES OF TRANSPORTATION TSA-APPROVED VALIDATION FIRMS AND VALIDATORS TSA-Approved Validation Firms and Validators for the Certified Cargo Screening Program...

  16. 41 CFR 109-27.5106-5 - Assistance.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.51-Management of Precious Metals § 109-27.5106-5 Assistance. The Business Center for... Management Branch, Oak Ridge Operations Office. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Assistance. 109-27.5106...

  17. 41 CFR 109-27.5002 - Stores inventory turnover ratio.

    Science.gov (United States)

    2010-07-01

    ... turnover ratio. 109-27.5002 Section 109-27.5002 Public Contracts and Property Management Federal Property....5002 Stores inventory turnover ratio. Comparison of investment in stores inventories to annual issues... comparison may be expressed either as a turnover ratio (dollar value of issues divided by dollar value of...

  18. 12 CFR 410.104-410.109 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.104-410.109 Section 410.104-410.109 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...

  19. 41 CFR 109-40.302 - Standard routing principle.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Standard routing principle. 109-40.302 Section 109-40.302 Public Contracts and Property Management Federal Property... Standard routing principle. (a) Shipments shall be routed using the mode of transportation, or individual...

  20. 40 CFR 600.109-78 - EPA driving cycles.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false EPA driving cycles. 600.109-78 Section... Model Year Automobiles-Test Procedures § 600.109-78 EPA driving cycles. (a) The driving cycle to be... driving cycle to be utilized for generation of the highway fuel economy data is specified in this...

  1. 40 CFR 600.109-08 - EPA driving cycles.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false EPA driving cycles. 600.109-08 Section... Model Year Automobiles-Test Procedures § 600.109-08 EPA driving cycles. (a) The FTP driving cycle is prescribed in § 86.115 of this chapter. (b) The highway fuel economy driving cycle is specified in this...

  2. 41 CFR 109-27.102-52 - Implementation.

    Science.gov (United States)

    2010-07-01

    ... contracting, and shall approve its implementation. In those instances where a cost benefit study has... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Implementation. 109-27...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-52 Implementation. (a) DOE OPMOs shall establish...

  3. 41 CFR 109-38.203 - Agency identification.

    Science.gov (United States)

    2010-07-01

    ... Administrative Services, Logistics Management Division, Headquarters, using DOE Form 4250.2, “Requisition for... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Agency identification. 109-38.203 Section 109-38.203 Public Contracts and Property Management Federal Property Management...

  4. 41 CFR 109-50.402 - Submission of proposals.

    Science.gov (United States)

    2010-07-01

    ... for any proposed charge to DOE for amortizing the cost of plant and equipment items; (3) Recapture of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Submission of proposals. 109-50.402 Section 109-50.402 Public Contracts and Property Management Federal Property Management...

  5. 41 CFR 109-27.5004 - Sub-stores.

    Science.gov (United States)

    2010-07-01

    ... to the users, serve emergencies, provide economy in transportation, reduce shop and site stocks, and... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Sub-stores. 109-27.5004 Section 109-27.5004 Public Contracts and Property Management Federal Property Management Regulations...

  6. Rising environmental cadmium levels in developing countries ...

    African Journals Online (AJOL)

    olayemitoyin

    Cadmium (Cd) is a non essential heavy metal belonging to group ... Cd from a contaminated environment leads to various pathological ..... interact with genes that are involved in human ..... Tolonen, M. (1990) Vitamins and minerals in Health.

  7. Large silver-cadmium technology program

    Science.gov (United States)

    Charlip, S.; Lerner, S.

    1971-01-01

    The effects of varying cell design on operation factors on the electrochemical performance of sealed, silver-cadmium cells were determined. A factorial experiment was conducted for all test cells constructed with organic separators. Three operating factors were evaluated: temperature, depth of discharge, and charge rate. The six construction factors considered were separator, absorber, electrolyte quantity, cadmium electrode type, cadmium-to-silver ratio, and auxiliary electrode. Test cells of 4 ampere-hour capacity were fabricated and cycled. The best performing cells, on a 94 minute orbit, at 40% depth of discharge, were those containing silver-treated fibrous sausage casings as the separator, and Teflon-ated, pressed cadmium electrodes. Cycling data of cells with inorganic separators (Astroset) are given. Best performance was shown by cells with nonwoven nylon absorbers. Rigid inorganic separators provided the best barrier to silver migration.

  8. Cadmium poisoning. Knowledge of the risk

    International Nuclear Information System (INIS)

    Peltier, A.; Demange, M.; Carton, M.B.

    1979-01-01

    This data sheet provides an up-to-date summary of information on cadmium poisoning. The following points are examined: - the problem of increasing pollution of soil, water and the food chain; - physical and chemical properties, manufacture, industrial applications; - the toxic action of cadmium and its derivatives; - methods and apparatus for taking and analysis samples from the atmosphere and from body fluids; - existing French regulations; - technical control and medical surveillance [fr

  9. Biological monitoring results for cadmium exposed workers.

    Science.gov (United States)

    McDiarmid, M A; Freeman, C S; Grossman, E A; Martonik, J

    1996-11-01

    As part of a settlement agreement with the Occupational Safety and Health Administration (OSHA) involving exposure to cadmium (Cd), a battery production facility provided medical surveillance data to OSHA for review. Measurements of cadmium in blood, cadmium in urine, and beta 2-microglobulin in urine were obtained for more than 100 workers over an 18-month period. Some airborne Cd exposure data were also made available. Two subpopulations of this cohort were of primary interest in evaluating compliance with the medical surveillance provisions of the Cadmium Standard. These were a group of 16 workers medically removed from cadmium exposure due to elevations in some biological parameter, and a group of platemakers. Platemaking had presented a particularly high exposure opportunity and had recently undergone engineering interventions to minimize exposure. The effect on three biological monitoring parameters of medical removal protection in the first group and engineering controls in platemakers is reported. Results reveal that both medical removal from cadmium exposures and exposure abatement through the use of engineering and work practice controls generally result in declines in biological monitoring parameters of exposed workers. Implications for the success of interventions are discussed.

  10. Cadmium affects retinogenesis during zebrafish embryonic development

    International Nuclear Information System (INIS)

    Hen Chow, Elly Suk; Yu Hui, Michelle Nga; Cheng, Chi Wa; Cheng, Shuk Han

    2009-01-01

    Ocular malformations are commonly observed in embryos of aquatic species after exposure to toxicants. Using zebrafish embryos as the model organism, we showed that cadmium exposure from sphere stage (4 hpf) to end of segmentation stage (24 hpf) induced microphthalmia in cadmium-treated embryos. Embryos with eye defects were then assessed for visual abilities. Cadmium-exposed embryos were behaviorally blind, showing hyperpigmentation and loss of camouflage response to light. We investigated the cellular basis of the formation of the small eyes phenotype and the induction of blindness by studying retina development and retinotectal projections. Retinal progenitors were found in cadmium-treated embryos albeit in smaller numbers. The number of retinal ganglion cells (RGC), the first class of retinal cells to differentiate during retinogenesis, was reduced, while photoreceptor cells, the last batch of retinal neurons to differentiate, were absent. Cadmium also affected the propagation of neurons in neurogenic waves. The neurons remained in the ventronasal area and failed to spread across the retina. Drastically reduced RGC axons and disrupted optic stalk showed that the optic nerves did not extend from the retina beyond the chiasm into the tectum. Our data suggested that impairment in neuronal differentiation of the retina, disruption in RGC axon formation and absence of cone photoreceptors were the causes of microphthalmia and visual impairment in cadmium-treated embryos

  11. Human health effects of exposure to cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Hallenbeck, W.H.

    1986-01-01

    The health effects of human exposure to cadmium are discussed with emphases on intake, absorption, body burden, and excretion; osteomalacia in Japan; hypertension; and proteinuria, emphysema, osteomalacia, and cancer in workers. Elevated blood pressure has not been observed as a result of excessive exposures to cadmium in Japan or the workplace. Renal tubular dysfunction and consequent proteinuria is generally accepted as the main effect following long-term, low-level exposure to cadmium. Studies of workers show that proteinuria may develop after the first year of exposure or many years after the last exposure. Proteinuria and deterioration of renal function may continue even after cessation of exposure. The immediate health significance of low-level proteinuria is still under debate. However, there is evidence that long-term renal tubular dysfunction may lead to abnormalities of calcium metabolism and osteomalacia. The few autopsy and cross-sectional studies of workers do not permit conclusions to be drawn regarding the relationship between cadmium exposure and emphysema. Retrospective and historical-prospective studies are needed to settle this important question. No conclusive evidence has been published regarding cadmium-induced cancer in humans. However, there is sufficient evidence to regard cadmium as a suspect renal and prostate carcinogen. Because of equivocal results and the absence of dose-response relationships, the studies reviewed should be used with caution in making regulatory decisions and low-dose risk assessments. 62 references.

  12. Human health effects of exposure to cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Hallenbeck, W.H.

    1984-02-15

    The health effects of human exposure to cadmium are discussed with emphasis on intake, absorption, body burden, and excretion; osteomalacia in Japan; hypertension; and proteinuria, emphysema, osteomalacia, and cancer in workers. Elevated blood pressure has not been observed as a result of excessive exposures to cadmium in Japan or the workplace. Renal tubular dysfunction and consequent proteinuria is generally accepted as the main effect following long-term, low-level exposure to cadmium. Studies of workers show that proteinuria may develop after the first year of exposure or many years after the last exposure. Proteinuria and deterioration of renal function may continue even after cessation of exposure. The immediate health significance of low-level proteinuria is still under debate. However, there is evidence that long-term renal tubular dysfunction may lead to abnormalities of calcium metabolism and osteomalacia. The few autopsy and cross-sectional studies of workers do not permit conclusions to be drawn regarding the relationship between cadmium exposure and emphysema. Retrospective and historical-prospective studies are needed to settle this important question. No conclusive evidence has been published regarding cadmium-induced cancer in humans. However, there is sufficient evidence to regard cadmium as a suspect renal and prostate carcinogen. Because of equivocal results and the absence of dose-response relationships, the studies reviewed should be used with caution in making regulatory decisions and low-dose risk assessments.

  13. Effect of dietary zinc deficiency on the accumulation of cadmium and metallothionein in selected tissues of the rat

    Energy Technology Data Exchange (ETDEWEB)

    Waalkes, M.P.

    1986-01-01

    The effect of continuous dietary zinc deficiency on the metabolism of the toxic heavy metal cadmium has not been widely studied. This investigation was designed to assess the effects of subadequate dietary zinc intake on the accumulation of dietary cadmium and on metallothionein (MT) and zinc concentrations in target organs of cadmium toxicity. Adult male Wistar rats (180-200 g) were allowed, ad libitum, diets either adequate (60 ppm) or deficient (7 ppm) in zinc for a total of 9 wk. The zinc-deficient diet resulted in an approximately 40% reduction in plasma zinc (assessed at 3, 6, and 9 wk) in the absence of overt signs of zinc deficiency (i.e., reduced weight gain, alopecia, etc.). Separate groups of rats were also maintained on zinc-defined diets for a total of 9 wk, but cadmium was added to the diet (0, 12.5, 25, 50, 100, and 200 ppm) a the end of wk 3 and maintained at that level throughout the remaining 6 wk of the study, when the rats were killed. The feeding of the zinc-deficient diet markedly enhanced the accumulation of cadmium in the liver, kidney, and testes. Hepatic, renal, and testicular zinc concentrations were not affected by suboptimal zinc intake alone. However, marked reductions in renal and testicular zinc concentrations were caused by zinc deficiency in concert with cadmium exposure. MT levels, when related to tissue cadmium concentrations, were elevated to a significantly lesser extent in the kidneys of zinc-deficient animals. These results indicate that marginal zinc deficiency markedly increases cadmium accumulation in various organs and reduces zinc content and MT induction in some organs.

  14. Cadmium removal by Lemna minor and Spirodela polyrhiza.

    Science.gov (United States)

    Chaudhuri, Devaleena; Majumder, Arunabha; Misra, Amal K; Bandyopadhyay, Kaushik

    2014-01-01

    The present study investigates the ability of two genus of duckweed (Lemna minor and Spirodela polyrhiza) to phytoremediate cadmium from aqueous solution. Duckweed was exposed to six different cadmium concentrations, such as, 0.5,1.0,1.5, 2.0, 2.5, and 3.0 mg/L and the experiment was continued for 22 days. Water samples were collected periodically for estimation of residual cadmium content in aqueous solution. At the end of treatment period plant samples were collected and accumulated cadmium content was measured. Cadmium toxicity was observed through relative growth factor and changes in chlorophyll content Experimental results showed that Lemna minor and Spirodela polyrhiza were capable of removing 42-78% and 52-75% cadmium from media depending upon initial cadmium concentrations. Cadmium was removed following pseudo second order kinetic model Maximum cadmium accumulation in Lemna minor was 4734.56 mg/kg at 2 mg/L initial cadmium concentration and 7711.00 mg/kg in Spirodela polyrhiza at 3 mg/L initial cadmium concentration at the end of treatment period. Conversely in both cases maximum bioconcentration factor obtained at lowest initial cadmium concentrations, i.e., 0.5 mg/L, were 3295.61 and 4752.00 for Lemna minor and Spirodela polyrhiza respectively. The present study revealed that both Lemna minor and Spirodela polyrhiza was potential cadmium accumulator.

  15. Isotope effect of impurity diffusion of cadmium in silver

    International Nuclear Information System (INIS)

    Rockosch, H.J.; Herzig, C.

    1984-01-01

    The isotope effect of impurity diffusion of cadmium in silver single crystals was measured with the radioisotopes 115 Cd/ 109 Cd by gamma spectrometry. As a mean value E = 0.37 at T = 1060 K was obtained. The correlation factor f /SUB Cd/ = 0.41 is in disagreement with previous results of other investigators due to their unfavourable experimental approach. The present value of f /SUB Cd/ , however, is consistent with those of In and Sn in Ag. A comparison with the corresponding correlation factors in the copper solvent reveals a distinct influence of lattice perturbations because of the different atomic volumes of the solvents. Since the size effect is neglected in the electrostatic diffusion model, the agreement with this model is only qualitative. The frequency ratios for vacancy jumps were calculated. The free binding enthalpy of the vacancy-impurity complex was estimated to be Δg /SUB Cd/ = -0.064 eV. This value is smaller than those for In and Sn in Ag and complies with the relative diffusivities of these impurities in Ag

  16. Penerapan PSAK No.109 atas Pengungkapan Wajib dan Sukarela

    Directory of Open Access Journals (Sweden)

    Yulifa Puspitasari

    2013-12-01

    Full Text Available The purpose of this research was to understand the impact of PSAK No. 109 about Akuntansi Zakat and Infaq/Sedekah on mandatory and voluntary disclosure. This study employed a case study method and comparative literature/documentary studies between financial statements of BAZNAS and financial statements of Yayasan Yatim Mandiri. The findings indicated that there was incompliance of disclosure with PSAK No.109. There were also some wakaf issues that have not been accommodated by PSAK No.109, which ultimately affected the disclosure of LAZ. The existence non-halal funds contrary to Sharia must be removed.

  17. Dynamic of cadmium accumulation in the internal organs of rats after exposure to cadmium chloride and cadmium sulphide nanoparticules of various sizes

    Directory of Open Access Journals (Sweden)

    Apykhtina O.L.

    2017-06-01

    Full Text Available The article presents the results of study of cadmium accumulation in the internal organs of Wistar rats after prolonged intraperitoneal administration of cadmium chloride and cadmium sulphide nanoparticles of 4-6 nm and 9-11 nm in size in a dose of 0.08 mg /kg/day calculated as cadmium. Toxic effects were evaluated after 30 injections (1.5 months, 60 injections (3 months, and 1.5 months after the exposure has been ceased. The results of the study showed that the most intensive accumulation of cadmium was observed in the kidneys and liver of experimental animals, which is due to the peculiarities of the toxicokinetics and the route of administration of cadmium compounds. In the kidneys, spleen and thymus of animals exposed to cadmium sulphide nanoparticles, a greater concentration of cadmium than in the organs of animals exposed to cadmium chloride was found. Cadmium accumulated more intensively in the spleen after exposure to larger nanoparticles, than in the kidneys and thymus. In the liver, heart, aorta and brain significant accumulation was observed after cadmium chloride exposure.

  18. Cadmium exposure induces hematuria in Korean adults

    Energy Technology Data Exchange (ETDEWEB)

    Han, Seung Seok [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Kim, Myounghee, E-mail: dkkim73@gmail.com [Department of Dental Hygiene, College of Health Science, Eulji University, Gyeonggi-do 461-713 (Korea, Republic of); Lee, Su Mi [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Lee, Jung Pyo [Department of Internal Medicine, Seoul National University Boramae Medical Center, Seoul 156-707 (Korea, Republic of); Kim, Sejoong [Department of Internal Medicine, Seoul National University Bundang Hospital, Gyeonggi-do 463-707 (Korea, Republic of); Joo, Kwon Wook [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Lim, Chun Soo [Department of Internal Medicine, Seoul National University Boramae Medical Center, Seoul 156-707 (Korea, Republic of); Kim, Yon Su; Kim, Dong Ki [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of)

    2013-07-15

    Introduction: Toxic heavy metals have adverse effects on human health. However, the risk of hematuria caused by heavy metal exposure has not been evaluated. Methods: Data from 4701 Korean adults were obtained in the Korean National Health and Nutritional Examination Survey (2008–2010). Blood levels of the toxic heavy metals cadmium, lead, and mercury were measured. Hematuria was defined as a result of ≥+1 on a urine dipstick test. The odds ratios (ORs) for hematuria were measured according to the blood heavy metal levels after adjusting for multiple variables. Results: Individuals with blood cadmium levels in the 3rd and 4th quartiles had a greater OR for hematuria than those in the 1st quartile group: 3rd quartile, 1.35 (1.019–1.777; P=0.037); 4th quartile, 1.52 (1.140–2.017; P=0.004). When blood cadmium was considered as a log-transformed continuous variable, the correlation between blood cadmium and hematuria was significant: OR, 1.97 (1.224–3.160; P{sub trend}=0.005). In contrast, no significant correlations between hematuria and blood lead or mercury were found in the multivariate analyses. Discussion: The present study shows that high cadmium exposure is associated with a risk of hematuria. -- Highlights: • A high level of blood cadmium is associated with a high risk of hematuria. • This correlation is independent of several confounding factors. • Blood levels of lead and mercury are not associated with risk of hematuria. • This is the first study on the correlation between cadmium exposure and hematuria risk.

  19. Uptake of cadmium from hydroponic solutions by willows ( Salix spp ...

    African Journals Online (AJOL)

    Salix integra 'Weishanhu') and Yizhibi (S. integra 'Yizhibi') were chosen as model plants to evaluate their potential for uptake of cadmium from hydroponic culture and relative uptake mechanism. Cadmium uptake showed a linear increase in the ...

  20. SUBSTITUTION OF CADMIUM CYANIDE ELECTROPLATING WITH ZINC CHLORIDE ELECTROPLATING

    Science.gov (United States)

    The study evaluated the zinc chloride electroplating process as a substitute for cadmium cyanide electroplating in the manufacture of industrial connectors and fittings at Aeroquip Corporation. The process substitution eliminates certain wastes, specifically cadmium and cyanide, ...

  1. Influence of food quality and salinity on dietary cadmium availability in Mytilus trossulus

    Energy Technology Data Exchange (ETDEWEB)

    Widmeyer, Joline R. [Simon Fraser University, Department of Biological Sciences, Burnaby, British Columbia, V5A 1S6 (Canada)]. E-mail: joline_widmeyer@alumni.sfu.ca; Bendell-Young, Leah I. [Simon Fraser University, Department of Biological Sciences, Burnaby, British Columbia, V5A 1S6 (Canada)

    2007-02-28

    Surficial sediments (a combination of re-suspended and suspended sediments denoted as RSS) were collected from two distinct marine intertidal habitats. The two habitats differed with respect to salinity (25 ppt versus 15 ppt) and RSS % organic carbon content (24% versus 15%). Feeding experiments were conducted simulating the conditions in the two habitats to determine if salinity and RSS % organic carbon content affected cadmium accumulation in the pacific blue mussel Mytilus trossulus. Eleven different treatments including pure phytoplankton, collected RSS and control clay were radiolabeled with {sup 109}Cd and pulse-fed to M. trossulus under both high (25 ppt) and low salinities (15 ppt). Metal uptake and accumulation was determined using the DYMBAM biodynamic metal bioaccumulation model. Although M. trossulus ingestion rates (IR) were significantly higher at 25 ppt as compared to 15 ppt, assimilation efficiencies (AEs) and [{sup 109}Cd] tissue levels were significantly lower at high as compared to low salinity exposures. Of the abiotic and biotic parameters examined and in contrast to other studies, differences in salinity rather than ingestion rate or food quality (as defined by % organic carbon content) seemed to best define the observed differences in {sup 109}Cd AE by M. trossulus.

  2. Influence of food quality and salinity on dietary cadmium availability in Mytilus trossulus

    International Nuclear Information System (INIS)

    Widmeyer, Joline R.; Bendell-Young, Leah I.

    2007-01-01

    Surficial sediments (a combination of re-suspended and suspended sediments denoted as RSS) were collected from two distinct marine intertidal habitats. The two habitats differed with respect to salinity (25 ppt versus 15 ppt) and RSS % organic carbon content (24% versus 15%). Feeding experiments were conducted simulating the conditions in the two habitats to determine if salinity and RSS % organic carbon content affected cadmium accumulation in the pacific blue mussel Mytilus trossulus. Eleven different treatments including pure phytoplankton, collected RSS and control clay were radiolabeled with 109 Cd and pulse-fed to M. trossulus under both high (25 ppt) and low salinities (15 ppt). Metal uptake and accumulation was determined using the DYMBAM biodynamic metal bioaccumulation model. Although M. trossulus ingestion rates (IR) were significantly higher at 25 ppt as compared to 15 ppt, assimilation efficiencies (AEs) and [ 109 Cd] tissue levels were significantly lower at high as compared to low salinity exposures. Of the abiotic and biotic parameters examined and in contrast to other studies, differences in salinity rather than ingestion rate or food quality (as defined by % organic carbon content) seemed to best define the observed differences in 109 Cd AE by M. trossulus

  3. Involvement of PKA/DARPP-32/PP1α and β- arrestin/Akt/GSK-3β Signaling in Cadmium-Induced DA-D2 Receptor-Mediated Motor Dysfunctions: Protective Role of Quercetin.

    Science.gov (United States)

    Gupta, Richa; Shukla, Rajendra K; Pandey, Ankita; Sharma, Tanuj; Dhuriya, Yogesh K; Srivastava, Pranay; Singh, Manjul P; Siddiqi, Mohammad Imran; Pant, Aditya B; Khanna, Vinay K

    2018-02-06

    Given increasing risk of cadmium-induced neurotoxicity, the study was conducted to delineate the molecular mechanisms associated with cadmium-induced motor dysfunctions and identify targets that govern dopaminergic signaling in the brain involving in vivo, in vitro, and in silico approaches. Selective decrease in dopamine (DA)-D2 receptors on cadmium exposure was evident which affected the post-synaptic PKA/DARPP-32/PP1α and β-arrestin/Akt/GSK-3β signaling concurrently in rat corpus striatum and PC12 cells. Pharmacological inhibition of PKA and Akt in vitro demonstrates that both pathways are independently modulated by DA-D2 receptors and associated with cadmium-induced motor deficits. Ultrastructural changes in the corpus striatum demonstrated neuronal degeneration and loss of synapse on cadmium exposure. Further, molecular docking provided interesting evidence that decrease in DA-D2 receptors may be due to direct binding of cadmium at the competitive site of dopamine on DA-D2 receptors. Treatment with quercetin resulted in the alleviation of cadmium-induced behavioral and neurochemical alterations. This is the first report demonstrating that cadmium-induced motor deficits are associated with alteration in postsynaptic dopaminergic signaling due to a decrease in DA-D2 receptors in the corpus striatum. The results further demonstrate that quercetin has the potential to alleviate cadmium-induced dopaminergic dysfunctions.

  4. Cadmium Exposure is Associated with the Prevalence of Dyslipidemia

    OpenAIRE

    Zhou Zhou; Yong-hui Lu; Hui-feng Pi; Peng Gao; Min Li; Lei Zhang; Li-ping Pei; Xiang Mei; Lin Liu; Qi Zhao; Qi-Zhong Qin; Yu Chen; Yue-ming Jiang; Zhao-hui Zhang; Zheng-ping Yu

    2016-01-01

    Background: Cadmium is a widespread environmental and occupational pollutant that accumulates in human body with a biological half-life exceeding 10 years. Cadmium exposure has been demonstrated to increase rates of cardiovascular diseases. Whether occupational cadmium exposure is associated with the increase in the prevalence of dyslipidemia and hence contributes to the risk of cardiovascular diseases is still equivocal. To test the hypothesis that exposure to cadmium is related to the preva...

  5. An assessment of the effects of a cadmium discharge ordinance

    International Nuclear Information System (INIS)

    Moser, J.H.; Schultz, J.L.

    1982-01-01

    The problem facing the MMSD was high levels of cadmium in Milorganite fertilizer. The cause was determined to be discharges from industry, primarily electroplaters. The solution was the cooperative development of an ordinance to limit the discharge of cadmium. Because the dischargers acted responsibly to comply with the ordinance, the ordinance succeeded in achieving its objective of significantly reducing the cadmium loading to the municipal sewerage system and subsequently reducing the cadmium concentration in Milorganite fertilizer

  6. 41 CFR 109-39.107 - Limited exemptions.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.107 Limited exemptions. The Director, Office of... exemptions from the fleet management system. ...

  7. 47 CFR 18.109 - General technical requirements.

    Science.gov (United States)

    2010-10-01

    ... MEDICAL EQUIPMENT General Information § 18.109 General technical requirements. ISM equipment shall be... filtering to provide adequate suppression of emissions on frequencies outside the frequency bands specified...

  8. 48 CFR 49.109-7 - Settlement by determination.

    Science.gov (United States)

    2010-10-01

    ... CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.109-7 Settlement by determination. (a... determination of the amount due consistent with the termination clause, including any cost principles...

  9. 49 CFR 212.109 - Joint planning of inspections.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STATE SAFETY PARTICIPATION REGULATIONS State/Federal Roles § 212.109... designed to monitor the compliance of the railroads, shippers, and manufacturers operating within the State...

  10. 24 CFR 811.109 - Trust indenture provisions.

    Science.gov (United States)

    2010-04-01

    ... AND URBAN DEVELOPMENT (SECTION 8 HOUSING ASSISTANCE PROGRAMS, SECTION 202 DIRECT LOAN PROGRAM, SECTION... DISABILITIES PROGRAM) TAX EXEMPTION OF OBLIGATIONS OF PUBLIC HOUSING AGENCIES AND RELATED AMENDMENTS § 811.109...

  11. Measurements of the thermal neutron cross-section and resonance integral for the 108Pd(n,γ)109Pd reaction

    Science.gov (United States)

    Hien, Nguyen Thi; Kim, Guinyun; Kim, Kwangsoo; Do, Nguyen Van; Khue, Pham Duc; Thanh, Kim Tien; Shin, Sung-Gyun; Cho, Moo-Hyun

    2018-06-01

    The thermal neutron capture cross-section (σ0) and resonance integral (I0) of the 108Pd(n,γ)109Pd reaction have been measured relative to that of the monitor reaction 197Au(n,γ)198Au. The measurements were carried out using the neutron activation with the cadmium ratio method. Both the samples and monitors were irradiated with and without cadmium cover of 0.5 mm thickness. The induced activities of the reaction products were measured with a well calibrated HPGe γ-ray detector. In order to improve the accuracy of the results, the necessary corrections for the counting losses were made. The thermal neutron capture cross-section and resonance integral of the 108Pd(n,γ)109Pd reaction were determined to be σ0,Pd = 8.68 ± 0.41 barn and I0,Pd = 245.6 ± 24.8 barn, respectively. The obtained results are compared with literature values and discussed.

  12. Cadmium exposure and health risks: Recent findings

    Energy Technology Data Exchange (ETDEWEB)

    Elinder, C.G. [Huddinge Hospital (Sweden). Dept. of Renal Medicine; Jaerup, L. [Stockholm City Council (Sweden). Dept. of Environmental Health

    1996-08-01

    Environmental and/or occupational exposure to cadmium give rise to a tubular kidney dysfunction which may proceed to more generalized renal damage and bone disease if exposure has been high and prolonged. Recent scientific work shows that early renal effects develop at lower levels of exposure than previously anticipated. Previous risk assessments for cadmium were mainly based on studies on healthy male workers. The general population, however, also include particularly susceptible groups such as elderly and individuals with illnesses (e.g. diabetes) that may predispose to cadmium-induced health effects. A significant proportion of the general population displays early signs of toxicity already at urinary cadmium concentrations around 3 nmol mmol{sup -1} creatinine. In addition to early tubular effects, cadmium may exert direct or indirect effects on mineral metabolism and the mineralization of the skeleton at relatively low levels of exposure. This may have important health implications, as poor and easily fractured bone is a major problem among the elderly in all industrialized countries. 41 refs, 4 figs

  13. Uptake of cadmium from hydroponic solutions by willows (Salix spp ...

    African Journals Online (AJOL)

    DR. NJ TONUKARI

    2011-11-16

    Nov 16, 2011 ... which indicated that cadmium uptake across the plasma membrane was ... to cadmium pollution in water-soil-plant systems because .... plants were separated into roots and shoots, blotted dry with paper tissue .... Analysis of the kinetic constants for cadmium uptake ..... proteins (Welch and Norvell, 1999).

  14. Cadmium affects the social behaviour of rainbow trout, Oncorhynchus mykiss

    International Nuclear Information System (INIS)

    Sloman, Katherine A.; Scott, Graham R.; Diao Zhongyu; Rouleau, Claude; Wood, Chris M.; McDonald, D. Gord

    2003-01-01

    The present study investigated both the effects of cadmium on the social interactions of rainbow trout and the differential accumulation of waterborne cadmium among social ranks of fish. Fish exposed to waterborne cadmium concentrations of 2 μg l -1 for 24 h, followed by a 1, 2 or 3 day depuration period in clean water, had a decreased ability to compete with non-exposed fish. However, the competitive ability of exposed fish given a 5 day depuration period was not significantly impaired. Cadmium accumulated in the olfactory apparatus of fish exposed to waterborne cadmium for 24 h and decreased significantly only after 5 days depuration in clean water. Among groups of ten fish held in stream tanks, where all fish were exposed to cadmium, there were significant effects on social behaviour and growth rate. Dominance hierarchies formed faster among fish exposed to cadmium than among control fish, and overall growth rates were higher in the cadmium treatment. In groups of ten fish, social status also affected tissue accumulation of cadmium during waterborne exposure, with dominant fish accumulating more cadmium at the gill. In conclusion, exposure to low levels of cadmium, affects the social behaviour of fish, in part due to accumulation in the olfactory apparatus, and dominant fish accumulate more gill cadmium than subordinates during chronic waterborne exposure

  15. Modeling cadmium in the feed chain and cattle organs

    NARCIS (Netherlands)

    Fels-Klerx, van der H.J.; Romkens, P.F.A.M.; Franz, E.; Raamsdonk, van L.W.D.

    2011-01-01

    The objectives of this study were to estimate cadmium contamination levels in different scenarios related to soil characteristics and assumptions regarding cadmium accumulation in the animal tissues, using quantitative supply chain modeling. The model takes into account soil cadmium levels, soil pH,

  16. Cadmium induces cadmium-tolerant gene expression in the filamentous fungus Trichoderma harzianum.

    Science.gov (United States)

    Cacciola, Santa O; Puglisi, Ivana; Faedda, Roberto; Sanzaro, Vincenzo; Pane, Antonella; Lo Piero, Angela R; Evoli, Maria; Petrone, Goffredo

    2015-11-01

    The filamentous fungus Trichoderma harzianum, strain IMI 393899, was able to grow in the presence of the heavy metals cadmium and mercury. The main objective of this research was to study the molecular mechanisms underlying the tolerance of the fungus T. harzianum to cadmium. The suppression subtractive hybridization (SSH) method was used for the characterization of the genes of T. harzianum implicated in cadmium tolerance compared with those expressed in the response to the stress induced by mercury. Finally, the effects of cadmium exposure were also validated by measuring the expression levels of the putative genes coding for a glucose transporter, a plasma membrane ATPase, a Cd(2+)/Zn(2+) transporter protein and a two-component system sensor histidine kinase YcbA, by real-time-PCR. By using the aforementioned SSH strategy, it was possible to identify 108 differentially expressed genes of the strain IMI 393899 of T. harzianum grown in a mineral substrate with the addition of cadmium. The expressed sequence tags identified by SSH technique were encoding different genes that may be involved in different biological processes, including those associated to primary and secondary metabolism, intracellular transport, transcription factors, cell defence, signal transduction, DNA metabolism, cell growth and protein synthesis. Finally, the results show that in the mechanism of tolerance to cadmium a possible signal transduction pathway could activate a Cd(2+)/Zn(2+) transporter protein and/or a plasma membrane ATPase that could be involved in the compartmentalization of cadmium inside the cell.

  17. Hip fracture risk and cadmium in erythrocytes: a nested case-control study with prospectively collected samples.

    Science.gov (United States)

    Sommar, Johan Nilsson; Pettersson-Kymmer, Ulrika; Lundh, Thomas; Svensson, Olle; Hallmans, Göran; Bergdahl, Ingvar A

    2014-02-01

    Several studies have investigated the relation between bone mass density and cadmium exposure, but only few studies have been performed on fractures and biomarkers of cadmium. This study analyzed the association between hip fracture risk and cadmium in erythrocytes (Ery-Cd). Prospective samples from the Northern Sweden Health and Disease Study's biobank were used for 109 individuals who later in life had sustained a low-trauma hip fracture, matched with two controls of the same age and gender. The mean concentration of Ery-Cd (±SD) in case samples was 1.3 ± 1.4 versus 0.9 ± 1.0 μg/L in controls. The odds ratio (OR) was 1.63 [95% confidence interval (CI) 1.10-2.42] for suffering a hip fracture for each microgram per liter increase in Ery-Cd. However, when taking smoking into consideration (never, former, or current), neither Ery-Cd nor smoking showed a statistically significant increase in fracture risk. Using multiple conditional logistic regression with BMI, height, and smoking, the estimated OR for a 1-μg/L increase in Ery-Cd was 1.52 (95% CI 0.77-2.97). Subgroup analysis showed an increased fracture risk among women (OR = 1.94, 95% CI 1.18-3.20, for a 1 μg/L increase), which also remained in the multiple analysis (OR = 3.33, 95% CI 1.29-8.56). This study shows that fracture risk is associated with Ery-Cd. It is, however, not possible to draw firm conclusions on whether cadmium is the causal factor or whether other smoking-related factors cause this association. Subgroup analysis shows that cadmium is a risk factor for hip fracture among women.

  18. Influence of biological activity on sorption by using {sup 65}Zn and {sup 109}Cd into mangrove sediment

    Energy Technology Data Exchange (ETDEWEB)

    Sondermann, Melissa N.; Barros, Joanna F.; Suzuki, Katia N.; Bellido, Alfredo V.B., E-mail: melissa.sonder@gmail.com, E-mail: joanna_barros2@hotmail.com, E-mail: ksuzuki@id.uff.br, E-mail: alfredobellido@gmail.com [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil). Instituto de Quimica. Pos-Graduacao em Geoquimica Ambiental; Bellido, Luis F., E-mail: lbellido@cnen.gov.br [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil); Lopes, Ricardo T., E-mail: ricardo@lin.ufrj.br [Coordenacao dos Programas de Pos-Graduacao em Engenharia (COPPE/UFRJ), Rio de Janeiro, RJ (Brazil)

    2015-07-01

    Evaluation of the chemical behavior of zinc and cadmium as well as the influence of biological activity in the sorption kinetics under microcosm experiments by mangrove sediments collected in Sepetiba Bay - Rio de Janeiro was carried out. The mentioned area was well contaminated due to the leaching from the tailing pile by the abandoned zinc processing company Inga Mercantil. Radiotracer {sup 65}Zn and {sup 109}Cd were used to follow their exchange across water-sediment interfaces up to 48 hours experiments in six mangrove sediment cores. To determine the benthic activity index (BAI) the cores were treated with formaldehyde (biocide) and it was found that the presence of the radiotracers in the deeper layers of sediment without formaldehyde treatment showed clearly the influence of benthic activity retention (benthic faunal and microbial effects), since the same pattern was not found in the treated sediment. The activity values obtained for {sup 65}Zn and {sup 109}Cd in the untreated sediment with formaldehyde on the first centimeter were 53.79±0.28 % and 67.34±0.16 % respectively, whereas for the treated ones, were 98.72 ± 0.29 % and 98.31 ± 0.24 % respectively. Thus, it was demonstrated that the use of formaldehyde, as biological activity inhibitor, ceases the bioturbation process and allowed the accumulation along the sediment. (author)

  19. Analysis of cadmium in high alpha solutions

    International Nuclear Information System (INIS)

    Gray, L.W.; Overman, L.A.; Hodgens, H.F.

    1977-07-01

    Cadmium nitrate is occasionally used as a neutron poison for convenience in the separation of uranium, neptunium, and plutonium. As the classical methods of analysis for cadmium are very time-consuming, a method to isolate it in solution using solvent extraction of uranium, neptunium, and plutonium with TBP in an n-paraffin hydrocarbon was investigated. After removal of the radionuclides, the cadmium is determined by atomic absorption spectroscopy. Precision of the method at the 95 percent confidence level is +-2.4 percent. Alpha content of the solutions was typically reduced from 1-10 x 10 11 dis/(min ml) 238 Pu to 1-15 x 10 4 dis/(min ml). Analysis time was typically reduced from approximately 24 hours per sample to less than 1 hour

  20. Bireactor Electronuclear Systems with Liquid Cadmium Valve

    CERN Document Server

    Bznuni, S A; Zhamkochyan, V M; ASosnin, A N; Polanski, A; Khudaverdyan, A H

    2002-01-01

    Three main types of bireactor electronuclear systems are discussed. From the point of view of assuring high level of functional characteristics and safety bireactor electronuclear systems with booster using enriched uranium (20 %) and with a liquid cadmium valve appears to be the most effective. It is shown by means of Monte-Carlo modeling that such operation conditions can be achieved which lead to the destruction of the intermediate cadmium layer making the systems supercritical (k_{eff}>1). One can avoid the problem by using a special design of the liquid cadmium valve. In comparison with other nuclear systems (critical reactors, one-reactor electronuclear systems) cascade electronuclear systems have essential advantages allowing the decrease of the proton beam current by one order of magnitude and providing at same time the necessary level of power generation and neutron flux. Availability of both the thermal and fast cones allows one to transmute not only transuranics but also the fission products - cesi...

  1. Cadmium accumulation by Axonopus compressus (Sw. P. Beauv and Cyperus rotundas Linn growing in cadmium solution and cadmium-zinc contaminated soil

    Directory of Open Access Journals (Sweden)

    Paitip Thiravetyan

    2007-05-01

    Full Text Available This research investigated the phyto-remediation potentials of Cyperus rotundas Linn (Nutgrass and Axonopus compressus (Sw. P. Beauv (Carpetgrass for cadmium removal from cadmium solution andcadmium-zinc contaminated soil. Plants growth in the solution showed that cadmium decreased the relative growth rate of both grasses. However, the amount of cadmium accumulated in shoot and root was increasedwith the increase in cadmium concentration and exposure time. Growth in fertile soil mixed with Cd-contaminated zinc silicate residue (65% Si, 19% Ca, 2% Zn, 1% Mg and 0.03% Cd at the ratio of 50:50 (w/wfor 30 days showed that C. rotundas Linn accumulated cadmium in root and shoot to 2,178 and 1,144 mg kg-1 dry weight, respectively. A. compressus (Sw. P. Beauv accumulated cadmium in root and shoot to 1,965and 669 mg kg-1 dry weight, respectively. Scanning electron microscope connected to energy-dispersive X-ray spectroscopy suggested that the mechanism of cadmium accumulation by both grasses involved thecadmium precipitation in the stable form of cadmium silicate, which indicated that C. rotundas Linn and A. compressus (Sw. P. Beauv could be grown to prevent soil erosion and to remediate cadmium-contaminatedsoil.

  2. Excitation of long living isomers 107m,109m Ag in the fast neutron inelastic scattering reactions

    International Nuclear Information System (INIS)

    Alpatov, V.G.; Borzakov, S.B.; Chinaeva, V.P

    1999-01-01

    The cross sections for excitation of 107m,109m Ag isomeric states are measured in the reactions of inelastic scattering of reactor fast neutrons. The measurements were performed on the rabbit tube 'Regata' of the IBR-2 reactor (JINR, Dubna). The method consisted in comparing the γ-line intensities of silver isomers with the 103m Rh isomer irradiated in the same neutron flux. The cross sections of 103 Rh are well known in wide range of neutron energy. The measured values are the following: σ( 107m Ag) = 204 ± 18 mb, σ( 109m Ag) = 262 ± 26 mb. The estimate is made of the possible yield of 109m Ag isomeric nuclei if one uses the high-current proton accelerator with heavy target to produce fast neutrons in reactions of spallation. (authors)

  3. Reduction of Cadmium Uptake of Rice Plants Using Soil Amendments in High Cadmium Contaminated Soil: A Pot Experiment

    Directory of Open Access Journals (Sweden)

    Dian Siswanto

    2013-05-01

    Full Text Available The aims of this study were to investigate the effect of agricultural residues on reducing cadmium uptake in rice plants. The rice plants growing on no cadmium/free cadmium soils (N, Cd soils (Cds, and Cd soils each amended with 1% w/w of coir pith (CP, coir pith modified with sodium hydroxide (CPm and corncob (CC under high cadmium contaminated soil with an average 145 mg Cd kg-1 soil were investigated. The results showed that the cumulative transpiration of rice grown in various treatments under high cadmium contaminated soil followed the order: Cds > CPm ≥ CP ≥ CC. These transpirations directly influenced cadmium accumulation in shoots and husks of rice plants. The CC and CP seemed to work to reduce the cadmium uptake by rice plants indicated by accumulated cadmium in the husk that were 2.47 and 7.38 mg Cd kg-1 dry weight, respectively. Overall, transpiration tended to drive cadmium accumulation in plants for rice grown in high cadmium contaminated soil. The more that plants uptake cadmium, the lower cadmium that remains in the soil.

  4. Effects of cadmium and mycorrhizal fungi on growth, fitness, and cadmium accumulation in flax (Linum usitatissimum; Linaceae).

    Science.gov (United States)

    Hancock, Laura M S; Ernst, Charlotte L; Charneskie, Rebecca; Ruane, Lauren G

    2012-09-01

    Agricultural soils have become contaminated with a variety of heavy metals, including cadmium. The degree to which soil contaminants affect plants may depend on symbiotic relationships between plant roots and soil microorganisms. We examined (1) whether mycorrhizal fungi counteract the potentially negative effects of cadmium on the growth and fitness of flax (Linum usitatissimum) and (2) whether mycorrhizal fungi affect the accumulation of cadmium within plant parts. Two flax cultivars (Linott and Omega) were grown in three soil cadmium environments (0, 5, and 15 ppm). Within each cadmium environment, plants were grown in either the presence or absence of mycorrhizal fungi. Upon senescence, we measured growth and fitness and quantified the concentration of cadmium within plants. Soil cadmium significantly decreased plant fitness, but did not affect plant growth. Mycorrhizal fungi, which were able to colonize roots of plants growing in all cadmium levels, significantly increased plant growth and fitness. Although mycorrhizal fungi counteracted the negative effects of cadmium on fruit and seed production, they also enhanced the concentration of cadmium within roots, fruits, and seeds. The degree to which soil cadmium affects plant fitness and the accumulation of cadmium within plants depended on the ability of plants to form symbiotic relationships with mycorrhizal fungi. The use of mycorrhizal fungi in contaminated agricultural soils may offset the negative effects of metals on the quantity of seeds produced, but exacerbate the accumulation of these metals in our food supply.

  5. Histopathological alterations of white seabass, Lates calcarifer, in acute and subchronic cadmium exposure

    Energy Technology Data Exchange (ETDEWEB)

    Thophon, S.; Kruatrachue, M.; Upatham, E.S.; Pokethitiyook, P.; Sahaphong, S.; Jaritkhuan, S

    2003-03-01

    White seabass responded differently to cadmium at chronic and subchronic levels. - Histopathological alterations to white seabass, Lates calcarifer aged 3 months in acute and subchronic cadmium exposure were studied by light and scanning electron microscopy. The 96-h LC{sub 50} values of cadmium to L. calcarifer was found to be 20.12{+-}0.61 mg/l and the maximum acceptable toxicant concentration (MATC) was 7.79 mg/l. Fish were exposed to 10 and 0.8 mg/l of Cd (as CdCl{sub 2}H{sub 2}O) for 96 h and 90 days, respectively. The study showed that gill lamellae and kidney tubules were the primary target organs for the acute toxic effect of cadmium while in the subchronic exposure, the toxic effect to gills was less than that of kidney and liver. Gill alterations included edema of the epithelial cells with the breakdown of pillar cell system, aneurisms with some ruptures, hypertrophy and hyperplasia of epithelial and chloride cells. The liver showed blood congestion in sinusoids and hydropic swelling of hepatocytes, vacuolation and dark granule accumulation. Lipid droplets and glycogen content were observed in hepatocytes at the second and third month of subchronic exposure. The kidney showed hydropic swelling of tubular cell vacuolation and numerous dark granule accumulation in many tubules. Tubular degeneration and necrosis were seen in some areas.

  6. Comparison of radioisotopic studied calcium metabolism in the orally administered and inhaled cadmium rat

    International Nuclear Information System (INIS)

    Fauran-Clavel, M.J.; Oustrin, J.; Godin, J.; Boudene, C.

    1982-01-01

    The radioisotopic study of calcium metabolism in the rat after oral administration of cadmium, 8 mg/kg during 13 weeks, has shown two different effects of this ion: 1) in the intestine, cadmium inhibits the absorption of calcium by active transport; 2) in the deep bone compartment, the decrease of the bone calcium used for the crystallization and slowly exchangeable with the calcium central pool (serum, extracellular and soft tissues calcium) is combined with a reduction of the exchange rates between the two compartments. When administered through a microparticle aerosol inhalation (1 mg/m 3 of air, 30 mn a day, during 12 weeks), cadmium's main target organ is the deep bone compartment. For both modes of administration, the slowing down of osteogenesis is confirmed by a drop in serum alkaline phosphatase after a four weeks period which reflects a decrease of the osteoblastic activity. Therefore it appears that the effects on bones observed during the chronic oral cadmium administration, do not result from a malabsorption of intestine calcium but also from the very action the Cd ++ ion on the bone crystallization process [fr

  7. Environmental cadmium and breast cancer risk

    OpenAIRE

    Gallagher, Carolyn M.; Chen, John J.; Kovach, John S.

    2010-01-01

    Breast cancer is the most prevalent women's cancer, with an age-adjusted incidence of 122.9 per 100,000 US women. Cadmium, a ubiquitous carcinogenic pollutant with multiple biological effects, has been reported to be associated with breast cancer in one US regional case-control study. We examined the association of breast cancer with urinary cadmium (UCd), in a case-control sample of women living on Long Island (LI), NY (100 with breast cancer and 98 without), a region with an especially high...

  8. Fuel conditioning facility electrorefiner cadmium vapor trap operation

    International Nuclear Information System (INIS)

    Vaden, D. E.

    1998-01-01

    Processing sodium-bonded spent nuclear fuel at the Fuel Conditioning Facility at Argonne National Laboratory-West involves an electrometallurgical process employing a molten LiCl-KCl salt covering a pool of molten cadmium. Previous research has shown that the cadmium dissolves in the salt as a gas, diffuses through the salt layer and vaporizes at the salt surface. This cadmium vapor condenses on cool surfaces, causing equipment operation and handling problems. Using a cadmium vapor trap to condense the cadmium vapors and reflux them back to the electrorefiner has mitigated equipment problems and improved electrorefiner operations

  9. Effect of cadmium on myocardial contractility and calcium fluxes

    International Nuclear Information System (INIS)

    Pilati, C.F.

    1979-01-01

    The effect of cadmium on myocardial mechanical performance and calcium fluxes was studied in kitten isometric papillary muscles and in isovolumic Langendorff-perfused rabbit hearts. Therefore, it is concluded that cadmium-induced decreases in contractility are not primarily the result of cadmium interference with ATP metabolic processes. Furthermore, these results imply that cadmium causes no structural alterations of the contractile proteins. These data suggest that cadmium may be competing with the calcium needed for excitation-contraction coupling. During experiments using radioisotopic calcium, a statistically significant cellular influx of calcium was observed following the onset of 100 μM Cd ++ perfusion of isolated, Langendorff-prepared rabbit hearts

  10. Effects of cadmium electrode properties on nickel-cadmium cell performance

    International Nuclear Information System (INIS)

    Zimmerman, A.H.

    1986-01-01

    Tests have been conducted on a number of nickel-cadmium cells that have exhibited a variety of performance problems, ranging from high voltages and pressures during overcharge to low capacity. The performance problems that have been specifically linked to the cadmium electrode are primarily related to two areas, poor sinter and the buildup of excessive pressure during overcharge. A number of specific nickel-cadmium cell and cadmium electrode characterists have been studied in this work to determine what the effects of poor sinter are, and to determine what factors are important in causing excessive pressures during overcharge in cells that otherwise appear normal. Several of the tests appear suitable for screening cells and electrodes for such problems

  11. Effects of Different Dietary Cadmium Levels on Growth and Tissue Cadmium Content in Juvenile Parrotfish,

    Directory of Open Access Journals (Sweden)

    Okorie E. Okorie

    2014-01-01

    Full Text Available This feeding trial was carried out to evaluate the effects of different dietary cadmium levels on growth and tissue cadmium content in juvenile parrotfish, Oplegnathus fasciatus, using cadmium chloride (CdCl2 as the cadmium source. Fifteen fish averaging 5.5±0.06 g (mean±SD were randomly distributed into each of twenty one rectangular fiber tanks of 30 L capacity. Each tank was then randomly assigned to one of three replicates of seven diets containing 0.30 (C0, 21.0 (C21, 40.7 (C41, 83.5 (C83, 162 (C162, 1,387 (C1,387 and 2,743 (C2,743 mg cadmium/kg diet. At the end of sixteen weeks of feeding trial, weight gain (WG, specific growth rate (SGR and feed efficiency (FE of fish fed C21 were significantly higher than those of fish fed C83, C162, C1,387 and C2,743 (p<0.05. Weight gain, SGR and FE of fish fed C0, C21 and C41 were significantly higher than those of fish fed C162, C1,387 and C2,743. Protein efficiency ratio of fish fed C0, C21 and C41 were significantly higher than those of fish fed C1,387 and C2,743. Average survival of fish fed C0, C21, C41 and C162 were significantly higher than that of fish fed C2,743. Tissue cadmium concentrations increased with cadmium content of diets. Cadmium accumulated the most in liver, followed by gill and then muscle. Muscle, gill and liver cadmium concentrations of fish fed C0, C21, C41 and C83 were significantly lower than those of fish fed C162, C1,387 and C2,743. Based on the ANOVA results of growth performance and tissue cadmium concentrations the safe dietary cadmium level could be lower than 40.7 mg Cd/kg diet while the toxic level could be higher than 162 mg Cd/kg diet.

  12. Remediation of cadmium by Indian mustard (Brassica juncea L.) from cadmium contaminated soil: a phytoextraction study

    OpenAIRE

    Rajeev Kumar Bhadkariya; VK Jain; GPS Chak; SK Gupta

    2014-01-01

    Cadmium is a toxic metal for living organisms and an environmental contaminant. Soils in many parts of the world are slightly too moderately contaminated by Cd due to long term use and disposal of Cd-contaminated wastes. Cost effective technologies are needed to remove cadmium from the contaminated sites. Soil phytoextraction is engineering based, low cost and socially accepted developing technology that uses plants to clean up contaminants in soils. This technology can be adopted as a remedi...

  13. Cadmium in Salix. A study to show the capacity of Salix to remove cadmium from farmland

    International Nuclear Information System (INIS)

    Oestman, G.

    1994-01-01

    The aim of this report has been to show the ability of Salix to take up cadmium and how the uptake varies between different types of soil. The information that the results are based on has been obtained from analyses of soil and Salix. The samples were taken at five sites in the district around Lake Maelaren. Two or three stands were taken at each place. The factors studied were the pH, the organic matter content, and the concentration of cadmium in the soil. Salix has a good ability, relative to other crops, to remove cadmium from arable land. The cadmium uptake is 35 times higher with Salix than with straw or energy grass. Salix uptake of cadmium varies between 3 and 14% of the cadmium content in the soil that is accessible to plants. The present annual increase of cadmium in arable land is 1 g/ha, whereas the removal in a Salix plantation is 21 g Cd/ha, yr at an annual growth of 10 tonnes DM. If the Cd uptake is the same each year, then a total of 420 g Cd/ha is removed when Salix is grown over a 20-year period. This is a very large part of the topsoil's total cadmium content, which is 550 g/ha on average in Sweden. The investigation reveals no clear relationship between the Cd concentration in Salix and the concentration of Cd in the soil, the organic matter content or the pH. 22 refs, 4 figs, 2 tabs

  14. Murine strain differences and the effects of zinc on cadmium concentrations in tissues after acute cadmium exposure

    Energy Technology Data Exchange (ETDEWEB)

    King, L.M. [ARS USDA, Germplasm and Gamete Physiology Lab., Beltsville, MD (United States); Anderson, M.B. [Dept. of Anatomy, Tulane Univ. School of Medicine, New Orleans, LA (United States); Sikka, S.C. [Dept. of Urology, Tulane Univ. School of Medicine, New Orleans, LA (United States); George, W.J. [Dept. of Pharmacology, Tulane Univ. School of Medicine, New Orleans, LA (United States)

    1998-10-01

    The role of strain differences in cadmium tissue distribution was studied using sensitive (129/J) and resistant (A/J) mice. These murine strains have previously been shown to differ in their susceptibility to cadmium-induced testicular toxicity. Cadmium concentration was measured in testis, epididymis, seminal vesicle, liver, and kidney at 24 h after cadmium chloride exposure (4, 10, and 20 {mu}mol/kg CdCl{sub 2}). The 129/J mice exhibited a significant increase in cadmium concentration in testis, epididymis, and seminal vesicle at all cadmium doses used, compared to A/J mice. However, cadmium concentrations in liver and kidney were not different between the strains, at any dose, indicating that cadmium uptake is similar in these organs at 24 h. These murine strains demonstrate similar hepatic and renal cadmium uptake but significantly different cadmium accumulation in the reproductive organs at 24 h. The mechanism of the protective effect of zinc on cadmium toxicity was studied by assessing the impact of zinc acetate (ZnAc) treatment on cadmium concentrations in 129/J mice after 24 h. Zinc pretreatment (250 {mu}mol/kg ZnAc), given 24 h prior to 20 {mu}mol/kg CdCl{sub 2} administration, significantly decreased the amount of cadmium in the testis, epididymis, and seminal vesicle of 129/J mice, and significantly increased the cadmium content of the liver after 24 h. Cadmium levels in the kidney were unaffected at this time. Zinc pretreatment also prevented the cadmium-induced decrease in testicular sperm concentration and epididymal sperm motility seen in 129/J mice. These findings suggest that the differences in the two murine strains may be attributed partly to the differential accumulation of cadmium in murine gonads. This may be caused by strain differences in the specificity of cadmium transport mechanisms. The protective role of zinc in cadmium-induced testicular toxicity in the sensitive strain may be due to an interference in the cadmium uptake by susceptible

  15. Remediation of cadmium by Indian mustard (Brassica juncea L. from cadmium contaminated soil: a phytoextraction study

    Directory of Open Access Journals (Sweden)

    Rajeev Kumar Bhadkariya

    2014-05-01

    Full Text Available Cadmium is a toxic metal for living organisms and an environmental contaminant. Soils in many parts of the world are slightly too moderately contaminated by Cd due to long term use and disposal of Cd-contaminated wastes. Cost effective technologies are needed to remove cadmium from the contaminated sites. Soil phytoextraction is engineering based, low cost and socially accepted developing technology that uses plants to clean up contaminants in soils. This technology can be adopted as a remediation of cadmium from Cd-contaminated soils with the help of Brassica juncea plant. The objective of this work was to evaluate the cadmium (Cd accumulate and the tolerance of Brassica juncea. The Cd accumulates in all parts of plants (roots, stems and leaves. It was found that accumulating efficiency increased with the increase in the concentration of applied cadmium metal solution. Maximum accumulation of cadmium was found in roots than stem and leaves. Phytoextraction coefficient and translocation factor were highest to show the validity of the Brassica juncea species for hyperaccumulation of the Cd metal. These results suggested that Brassica juncea has a high ability to tolerate and accumulate Cd, so it might be a promising plant to be used for phytoextraction of Cd contaminated soil. DOI: http://dx.doi.org/10.3126/ije.v3i2.10533 International Journal of the Environment Vol.3(2 2014: 229-237

  16. Subcellular localization of cadmium in hyperaccumulator Populus ...

    African Journals Online (AJOL)

    In this study, subcellular localization of cadmium in hyperaccumulator grey poplar (Populus × canescens) was investigated by the transmission electron microscopy (TEM) method. Young Populus × canescens were grown and hydroponic experiments were conducted under four Cd2+ concentrations (10, 30, 50, and 70 μM) ...

  17. Rise time spectroscopy in cadmium telluride detectors

    International Nuclear Information System (INIS)

    Scharager, Claude; Siffert, Paul; Carnet, Bernard; Le Meur, Roger.

    1980-11-01

    By a simultaneous analysis of rise time and pulse amplitude distributions of the signals issued from various cadmium telluride detectors, it is possible to obtain informations about surface and bulk trapping, field distribution within the detectors, as well as charge collection and transport properties. These investigations have been performed on both pure and chlorine doped and materials for various surfaces preparation conditions [fr

  18. Bioavailability of cadmium from linseed and cocoa

    DEFF Research Database (Denmark)

    Hansen, Max; Rasmussen, Rie Romme; Sloth, Jens Jørgen

    2014-01-01

    The exposure of the European population to cadmium from food is high compared with the tolerable weekly intake of 2.5 μg/kg bodyweight set by EFSA in 2009. Only few studies on the bioavailability of cadmium from different food sources has been performed but this information in very important...... for the food authorities in order to give correct advises to the population. The aim of this study was to investigate the bioavailability of cadmium from whole linseed, crushed linseed, cocoa and cadmium chloride in rats. An experiment where 40 rats were divided into 4 groups and a control group and dosed...... be measured in the kidney compared to the calculated total intake was as follows: Control 2.0 %, Crushed linseed 0.9 %, whole linseed, 1.5 %, cocoa 0.7 % and CdCl2 4.6 %. Based on this study it could not be concluded that the bioavailability in rats form whole linseed is lower that for crushed linseed...

  19. Cadmium versus phosphate in the world ocean

    NARCIS (Netherlands)

    Baar, Hein J.W. de; Saager, Paul M.; Nolting, Rob F.; Meer, Jaap van der

    1994-01-01

    Cadmium (Cd) is one of the best studied trace metals in seawater and at individual stations exhibits a more or less linear relation with phosphate. The compilation of all data from all oceans taken from over 30 different published sources into one global dataset yields only a broad scatterplot of Cd

  20. PRELIMINARY ASSESSMENT OF CADMIUM MOBILITY IN ...

    African Journals Online (AJOL)

    Preferred Customer

    ABSTRACT. Cadmium is a toxic metal often found with a strong enrichment factor in coastal sediments. ... into the food chain, which could result in a wide variety of adverse effects in animals and ... Sampling scheme and sample conservation ..... of Cd with Fe and Mn oxides has also been reported in others studies [38, 39].

  1. Combustion synthesis of cadmium sulphide nanomaterials

    Indian Academy of Sciences (India)

    Anion-doped cadmium sulphide nanomaterials have been synthesized by using combustionmethod at normal atmospheric conditions. Oxidant/fuel ratios have been optimized in order to obtain CdS with best characteristics. Formation of CdS and size of crystallite were identified by X-ray diffraction and confirmed by ...

  2. Phytochelatin and cadmium accumulation in wheat.

    NARCIS (Netherlands)

    Stolt, J.P.; Sneller, F.E.C.; Bryngelson, T.; Lundborg, T.; Schat, H.

    2003-01-01

    Cadmium (Cd) is a nonessential heavy metal that can be harmful at low concentrations in organisms. Therefore, it is necessary to decrease Cd accumulation in the grains of wheats aimed for human consumption. In response to Cd, higher plants synthesize sulphur-rich peptides, phytochelatins (PCs).

  3. New process to discharge negative cadmium electrodes for Ni/Cd batteries

    International Nuclear Information System (INIS)

    Stiker, B.; Vignaud, R.

    1984-01-01

    The new process relates to the chemical oxidation (whether partial or total) of cadmium metal negative electrodes, as used in alkaline nickel-cadmium or silver-cadmium batteries. This process concerns all cadmium electrodes but more particularly the electrodeposited cadmium electrode developed by the company LES PILES WONDER and described in this publication

  4. Dietary intake of cadmium from Bangladeshi foods.

    Science.gov (United States)

    Al-Rmalli, S W; Jenkins, R O; Haris, P I

    2012-01-01

    Human exposure to cadmium (Cd) is associated with various diseases and high levels of Cd have been detected in Bangladeshi population warranting further research to identify the source of this exposure. In this study, Cd levels in 327 and 94 samples of Bangladeshi food and non-food samples, respectively, were determined using inductively coupled plasma mass spectrometry. This is the largest number of Bangladeshi food and nonfood samples investigated for their Cd content. High Cd levels were detected in leafy vegetables (mean 31 [SD 29]μg/kg). Of these vegetables, lal shak (Amaranthus tricolor) contained the highest Cd level (303 μg/kg [wet weight]; mean 100.5 [SD 95]μg/kg). Bangladeshi rice also showed significant concentration of Cd (mean 37.2 [SD 30]μg/kg). Of particular concern is the very high level of Cd detected in some puffed rice, which we attribute to the illegal practice of using urea for whitening the puffed rice. Tobacco leaves, which are commonly consumed during betel quid chewing by Bangladeshis, contain significant levels of Cd (mean 95 [SD 87]μg/kg). The total daily intake (TDI) of Cd from foods for Bangladeshis was estimated to be 34.55 μg/d. This is rather high when compared to the TDI of Cd for other populations. Our analysis reveals that this is mainly due to the very high intake of rice and vegetables, and lower consumption of animal products (which are low in Cd), by the Bangladeshis. We also determined the provisional maximum tolerable daily intake and target hazard quotients values for Cd. Clearly a more balanced diet is necessary to reduce the Cd intake in the Bangladeshi population, especially by reducing the very high intake of rice and certain leafy vegetables. Food manufacturing and agricultural practices needs to be altered to reduce the entry of Cd into the food chain. Exposure to high levels of Cd can be harmful to human health and this study provides a comprehensive analysis of Cd levels in a variety of food items from

  5. Cadmium phytoextraction potential of different Alyssum species

    International Nuclear Information System (INIS)

    Barzanti, R.; Colzi, I.; Arnetoli, M.; Gallo, A.; Pignattelli, S.; Gabbrielli, R.; Gonnelli, C.

    2011-01-01

    Highlights: ► The possibility of using serpentine plants for phytoextraction of Cd was investigated. ► Variation in Cd tolerance, accumulation and translocation in three Alyssum plants with different phenotypes were found. ► Alyssum montanum showed higher Cd tolerance and accumulation than the Ni hyperaccumulator Alyssum bertolonii. ► As for the kinetic parameters of the Cd uptake system, A. montanum presented a low apparent K m value. ► The V max values were not significantly different among the plants. - Abstract: This work was planned for providing useful information about the possibility of using serpentine adapted plants for phytoextraction of cadmium, element scarcely represented in such metalliferous environment. To this aim, we investigated variation in cadmium tolerance, accumulation and translocation in three Alyssum plants with different phenotypes: Alyssum bertolonii, that is a serpentine endemic nickel hyperaccumulator, and two populations of Alyssum montanum, one adapted and one not adapted to serpentine soils. Plants were hydroponically cultivated in presence of increasing concentrations of CdSO 4 for two weeks. For the metal concentration used in the experiments, the three different Alyssum populations showed variation in cadmium tolerance, accumulation and content. The serpentine adapted population of A. montanum showed statistically higher cadmium tolerance and accumulation than A. bertolonii and the population of A. montanum not adapted to serpentine soil thus deserving to be investigated for phytoextraction purposes. Furthermore, as for the kinetic parameters of the cadmium uptake system, A. montanum serpentine population presented a low apparent K m value, suggesting a high affinity for this metal of its uptake system, whereas the V max values were not significantly different among the plants. Present data revealed metallicolous plants are also suitable for the phytoremediation of metals underrepresented in the environment of their

  6. Cadmium phytoextraction potential of different Alyssum species

    Energy Technology Data Exchange (ETDEWEB)

    Barzanti, R., E-mail: rbarzanti@supereva.it [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Colzi, I., E-mail: ilariacolzi@hotmail.it [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Arnetoli, M., E-mail: miluscia@gmail.com [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Gallo, A., E-mail: galloalessia@hotmail.com [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Pignattelli, S., E-mail: sara.pignattelli@gmail.com [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Gabbrielli, R., E-mail: gabbrielli@unifi.it [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Gonnelli, C., E-mail: cristina.gonnelli@unifi.it [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy)

    2011-11-30

    Highlights: Black-Right-Pointing-Pointer The possibility of using serpentine plants for phytoextraction of Cd was investigated. Black-Right-Pointing-Pointer Variation in Cd tolerance, accumulation and translocation in three Alyssum plants with different phenotypes were found. Black-Right-Pointing-Pointer Alyssum montanum showed higher Cd tolerance and accumulation than the Ni hyperaccumulator Alyssum bertolonii. Black-Right-Pointing-Pointer As for the kinetic parameters of the Cd uptake system, A. montanum presented a low apparent K{sub m} value. Black-Right-Pointing-Pointer The V{sub max} values were not significantly different among the plants. - Abstract: This work was planned for providing useful information about the possibility of using serpentine adapted plants for phytoextraction of cadmium, element scarcely represented in such metalliferous environment. To this aim, we investigated variation in cadmium tolerance, accumulation and translocation in three Alyssum plants with different phenotypes: Alyssum bertolonii, that is a serpentine endemic nickel hyperaccumulator, and two populations of Alyssum montanum, one adapted and one not adapted to serpentine soils. Plants were hydroponically cultivated in presence of increasing concentrations of CdSO{sub 4} for two weeks. For the metal concentration used in the experiments, the three different Alyssum populations showed variation in cadmium tolerance, accumulation and content. The serpentine adapted population of A. montanum showed statistically higher cadmium tolerance and accumulation than A. bertolonii and the population of A. montanum not adapted to serpentine soil thus deserving to be investigated for phytoextraction purposes. Furthermore, as for the kinetic parameters of the cadmium uptake system, A. montanum serpentine population presented a low apparent K{sub m} value, suggesting a high affinity for this metal of its uptake system, whereas the V{sub max} values were not significantly different among the

  7. The effects of changes in cadmium and lead air pollution on cancer incidence in children.

    Science.gov (United States)

    Absalon, Damian; Slesak, Barbara

    2010-09-15

    This article presents the results of research on the effects of air pollution on cancer incidence in children in the region of Silesia (Poland), which has undergone one of the most profound anthropogenic transformations in Europe. The main objective of the research was to specify the impact of changes in cadmium and lead pollution in the years 1990-2005 on the incidence of cancers reported in children. Lead concentration ranged from 0 to 1490 x 10(-9) G m(-2)/year, and cadmium concentration ranged from 0 to 33.7 x 10(-9) G m(-2)/year. There was no strong significant correlation (max 0.3) between air pollution and incidence rate (IR) in the general population of children in any particular year. Alongside the cartographic presentation of dependences, correlation coefficients between the variables in question were calculated. This made it possible to determine the relationship between the pollution levels and incidence rates in the area. There was a significant reduction in the level of pollution during the investigated period. The study of the relationship between the number of cancers reported and the condition of the natural environment revealed increased sensitivity to toxins in boys (correlation coefficient 0.3). In addition, the spatial distribution of the number of cases reported in boys suggests a correlation with the spatial distribution of the coefficients for the entire group of children included in the study. The yearly average IR of childhood cancer in specific districts ranged from 0 to 61.48/100,000 children under 18 years of age during the 1995-2004 period. Copyright 2010 Elsevier B.V. All rights reserved.

  8. Accumulation of cadmium in livers and kidneys in Greenlanders

    International Nuclear Information System (INIS)

    Johansen, Poul; Mulvad, Gert; Pedersen, Henning Sloth; Hansen, Jens C.; Riget, Frank

    2006-01-01

    In the Arctic, the traditional diet exposes its people to a very high intake of cadmium because it is highly concentrated in the liver and kidneys of commonly eaten marine mammals. In one study in Greenland, the cadmium intake was estimated to 182 μg/day/person in the fall and 346 in the spring. To determine whether the cadmium is accumulated in humans, we analyzed autopsy samples of liver and kidneys from 95 ethnic Greenlanders (aged 19-89) who died from a wide range of causes. The cadmium concentration in liver (overall mean 1.97 μg/g wet wt) appeared to be unrelated to any particular age group, whereas the concentrations in the kidneys peaked in Greenlanders between 40 and 50 years of age (peak concentration 22.3 μg/g wet wt). Despite the high cadmium levels in the typical Greenlander diet, we found that the cadmium concentrations in livers and kidneys were comparable to those reported from Denmark, Sweden, Australia and Great Britain. Furthermore, even though the mean cadmium intake from the diet was estimated to be 13-25 times higher in Greenlanders than in Danes, we found similar cadmium levels in the kidneys of both. Seal livers and kidneys are the main source of cadmium in the diet of Greenlanders, but these tissues are not eaten in Denmark. Thus, our results suggest that the accumulation of cadmium from Greenlander's marine diet is very low

  9. Accumulation of cadmium in livers and kidneys in Greenlanders

    Energy Technology Data Exchange (ETDEWEB)

    Johansen, Poul [National Environmental Research Institute, Frederiksborgvej 399, DK-4000 Roskilde (Denmark)]. E-mail: poj@dmu.dk; Mulvad, Gert [Primary Health Care Center, DK-3900 Nuuk, Greenland (Denmark); Centre for Arctic Environmental Medicine, University of Aarhus, Universitetsparken, DK-8000 Aarhus C (Denmark); Pedersen, Henning Sloth [Primary Health Care Center, DK-3900 Nuuk, Greenland (Denmark); Centre for Arctic Environmental Medicine, University of Aarhus, Universitetsparken, DK-8000 Aarhus C (Denmark); Hansen, Jens C. [Centre for Arctic Environmental Medicine, University of Aarhus, Universitetsparken, DK-8000 Aarhus C (Denmark); Riget, Frank [National Environmental Research Institute, Frederiksborgvej 399, DK-4000 Roskilde (Denmark)

    2006-12-15

    In the Arctic, the traditional diet exposes its people to a very high intake of cadmium because it is highly concentrated in the liver and kidneys of commonly eaten marine mammals. In one study in Greenland, the cadmium intake was estimated to 182 {mu}g/day/person in the fall and 346 in the spring. To determine whether the cadmium is accumulated in humans, we analyzed autopsy samples of liver and kidneys from 95 ethnic Greenlanders (aged 19-89) who died from a wide range of causes. The cadmium concentration in liver (overall mean 1.97 {mu}g/g wet wt) appeared to be unrelated to any particular age group, whereas the concentrations in the kidneys peaked in Greenlanders between 40 and 50 years of age (peak concentration 22.3 {mu}g/g wet wt). Despite the high cadmium levels in the typical Greenlander diet, we found that the cadmium concentrations in livers and kidneys were comparable to those reported from Denmark, Sweden, Australia and Great Britain. Furthermore, even though the mean cadmium intake from the diet was estimated to be 13-25 times higher in Greenlanders than in Danes, we found similar cadmium levels in the kidneys of both. Seal livers and kidneys are the main source of cadmium in the diet of Greenlanders, but these tissues are not eaten in Denmark. Thus, our results suggest that the accumulation of cadmium from Greenlander's marine diet is very low.

  10. Modelling of cadmium fluxes on energy crop land

    International Nuclear Information System (INIS)

    Palm, V.

    1992-04-01

    The flux of cadmium on energy crop land is investigated. Three mechanisms are accounted for; Uptake by plant, transport with water, and sorption to soil. Sorption is described with Freundlich isotherms. The system is simulated mathematically in order to estimate the sensitivity and importance of different parameters on the cadmium flow and sorption. The water flux through the soil and the uptake by plants are simulated with a hydrological model, SOIL. The simulated time period is two years. The parameters describing root distribution and evaporation due to crop are taken from measurements on energy crop (Salix). The resulting water flux, water content in the soil profile and the water uptake into roots, for each day and soil compartment, are used in the cadmium sorption simulation. In the cadmium sorption simulation the flux and equilibrium chemistry of cadmium is calculated. It is shown that the amount of cadmium that accumulates in the plant, and the depth to which the applied cadmium reaches depends strongly on the constants in the sorption isotherm. With an application of 10 mg Cd/m 2 in the given range of Freundlich equations, the simulations gave a plant uptake of between 0 and 30 % of the applied cadmium in two years. At higher concentrations, where cadmium sorption can be described by nonlinear isotherms, more cadmium is present in soil water and is generally more bioavailable. 25 refs

  11. Cross section measurement of alpha particle induced nuclear reactions on natural cadmium up to 52 MeV

    OpenAIRE

    Ditrói, F.; Takács, S.; Haba, H.; Komori, Y.; Aikawa, M.

    2016-01-01

    Cross sections of alpha particle induced nuclear reactions have been measured on thin natural cadmium targets foils in the energy range from 11 to 51.2 MeV. This work was a part of our systematic study on excitation functions of light ion induced nuclear reactions on different target materials. Regarding the cross sections, the alpha induced reactions are not deeply enough investigated. Some of the produced isotopes are of medical interest, others have application in research and industry. Th...

  12. 41 CFR 109-27.5107 - Recovery of silver from used hypo solution and scrap film.

    Science.gov (United States)

    2010-07-01

    ... used hypo solution and scrap film. 109-27.5107 Section 109-27.5107 Public Contracts and Property... § 109-27.5107 Recovery of silver from used hypo solution and scrap film. The requirements for the recovery of silver from used hypo solution and scrap film are contained in § 109-45.1003 of this chapter. ...

  13. 41 CFR 109-38.5102 - Utilization controls and practices.

    Science.gov (United States)

    2010-07-01

    ... hazards, particularly when mingled with other motor vehicle traffic; and (h) The use of electric vehicles..., TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.51-Utilization of Motor Equipment § 109-38... motor vehicle is involved, such as assignments from motor pools, the individual's trip records must, as...

  14. 48 CFR 49.109-4 - No-cost settlement.

    Science.gov (United States)

    2010-10-01

    ... incurred costs for the terminated portion of the contract or (b) the contractor is willing to waive the costs incurred and (c) no amounts are due the Government under the contract. ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false No-cost settlement. 49.109...

  15. 41 CFR 109-40.103-1 - Domestic transportation.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Domestic transportation... Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 40-TRANSPORTATION AND TRAFFIC MANAGEMENT 40.1-General Provision § 109-40.103-1...

  16. 45 CFR 46.109 - IRB review of research.

    Science.gov (United States)

    2010-10-01

    ... Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROTECTION OF HUMAN SUBJECTS Basic HHS Policy for Protection of Human Research Subjects § 46.109 IRB review of research. (a) An... judgment the information would meaningfully add to the protection of the rights and welfare of subjects. (c...

  17. 34 CFR 97.109 - IRB review of research.

    Science.gov (United States)

    2010-07-01

    ... Office of the Secretary, Department of Education PROTECTION OF HUMAN SUBJECTS Federal Policy for the Protection of Human Subjects (Basic ED Policy for Protection of Human Research Subjects) § 97.109 IRB review... subjects when in the IRB's judgment the information would meaningfully add to the protection of the rights...

  18. 48 CFR 49.109-5 - Partial settlements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Partial settlements. 49... MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.109-5 Partial settlements. The TCO should attempt... settlements covering particular items of the prime contractor's settlement proposal. However, when a TCO...

  19. 23 CFR 635.109 - Standardized changed condition clauses.

    Science.gov (United States)

    2010-04-01

    ... OPERATIONS CONSTRUCTION AND MAINTENANCE Contract Procedures § 635.109 Standardized changed condition clauses. (a) Except as provided in paragraph (b) of this section, the following changed conditions contract... contract or if unknown physical conditions of an unusual nature, differing materially from those ordinarily...

  20. 41 CFR 109-39.103 - Agency appeals.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.103 Agency appeals. The Director, Office of... request exemption from, a determination made by GSA concerning the establishment of a fleet management...

  1. 41 CFR 109-39.101-1 - Agency cooperation.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.101-1 Agency cooperation. The Director, Office of... representatives to coordinate with GSA concerning the establishment of a GSA fleet management system to serve...

  2. 41 CFR 109-39.106 - Unlimited exemptions.

    Science.gov (United States)

    2010-07-01

    ..., AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 109-39.106 Unlimited exemptions. The Director, Office of... determination that an unlimited exemption from inclusion of a motor vehicle in a fleet management system is...

  3. 14 CFR 25.109 - Accelerate-stop distance.

    Science.gov (United States)

    2010-01-01

    ... AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Flight Performance § 25.109 Accelerate-stop distance. (a...) The maximum tire-to-ground wet runway braking coefficient of friction is defined as: ER18FE98.004 Where— Tire Pressure=maximum airplane operating tire pressure (psi); μt/gMAX=maximum tire-to-ground...

  4. 41 CFR 109-1.5109 - Control of sensitive items.

    Science.gov (United States)

    2010-07-01

    ... administrative control of sensitive items assigned for general use within an organizational unit as appropriate... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Control of sensitive...-INTRODUCTION 1.51-Personal Property Management Standards and Practices § 109-1.5109 Control of sensitive items...

  5. 14 CFR 152.109 - Project eligibility: Airport planning.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Project eligibility: Airport planning. 152....109 Project eligibility: Airport planning. (a) Airport master planning. A proposed project for airport master planning is not approved unless— (1) The location of the existing or proposed airport is included...

  6. 33 CFR 211.109 - Contract of sale.

    Science.gov (United States)

    2010-07-01

    ... Navigation Project in Oklahoma, to Former Owners § 211.109 Contract of sale. Upon determination of the price... and deliver it to the applicant for acceptance. The contract of sale shall provide for the deposit of earnest money equal to twenty (20) percent of the price at which the land will be sold or the estimated...

  7. 41 CFR 109-39.301 - Utilization guidelines.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Utilization guidelines... Management System Vehicles § 109-39.301 Utilization guidelines. DOE activities utilizing GSA IFMS motor... meeting DOE utilization guidelines or established local use objectives, as appropriate. Those vehicles not...

  8. 41 CFR 109-27.5007-1 - Procedures.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.50-Inventory Management Policies, Procedures, and Guidelines § 109-27.5007-1 Procedures. The following procedures shall be established for taking physical inventory of stocks subjected to quantity controls as well as those under financial control: (a) Completion of a physical inventory...

  9. 41 CFR 109-44.702 - Donations to public bodies.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Donations to public... AND DISPOSAL 44-DONATION OF PERSONAL PROPERTY 44.7-Donations of Property to Public Bodies § 109-44.702 Donations to public bodies. ...

  10. 40 CFR 266.109 - Low risk waste exemption.

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT FACILITIES Hazardous Waste Burned in Boilers and Industrial Furnaces § 266.109 Low risk waste exemption. (a) Waiver of DRE standard. The DRE standard of § 266.104(a) does not apply if the boiler or... 99.9 percent destruction and removal efficiency. That is, assume that 0.1 percent of the mass weight...

  11. 41 CFR 109-38.403-2 - Responsibility.

    Science.gov (United States)

    2010-07-01

    ..., including vandalism, theft and parking lot damage to a DOE vehicle which occurs during the period that the vehicle is assigned to an employee of that organization. The charges recovered by the designated..., AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.4-Use and Replacement Standards § 109-38.403-2...

  12. 41 CFR 109-50.4801 - Equipment Gift Agreement.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Equipment Gift Agreement... 50-SPECIAL DOE DISPOSAL AUTHORITIES 50.48-Exhibits § 109-50.4801 Equipment Gift Agreement. (a) The following Equipment Gift Agreement format will be used to provide gifts of excess and/or surplus equipment...

  13. 41 CFR 109-1.5300 - Scope of subpart.

    Science.gov (United States)

    2010-07-01

    ... Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1... identification, accounting, control, and disposal policy guidance for the following categories of high risk... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Scope of subpart. 109-1...

  14. 41 CFR 109-38.5103 - Motor vehicle utilization standards.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Motor vehicle... AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.51-Utilization of Motor Equipment § 109-38.5103 Motor vehicle utilization standards. (a) The following average utilization standards...

  15. 5 CFR 950.109 - Avoidance of conflict of interest.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Avoidance of conflict of interest. 950... PRIVATE VOLUNTARY ORGANIZATIONS General Provisions § 950.109 Avoidance of conflict of interest. Any... affiliation with a charitable organization, there could be or appear to be a conflict of interest under any...

  16. 41 CFR 109-1.5104 - Borrowing of personal property.

    Science.gov (United States)

    2010-07-01

    ... personal property, consideration shall be given to suitability, condition, value, extent and nature of use... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Borrowing of personal...-INTRODUCTION 1.51-Personal Property Management Standards and Practices § 109-1.5104 Borrowing of personal...

  17. 41 CFR 109-27.5003 - Stock control.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Stock control. 109-27... control. (a) Stock control shall be maintained on the basis of stock record accounts of inventories on... property under stock control for greater than 90 days shall be maintained in stock record accounts. ...

  18. 41 CFR 109-38.204-1 - Unlimited exemptions.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Unlimited exemptions... Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION... § 109-38.204-1 Unlimited exemptions. (a)-(f) [Reserved] (g) The Director, Office of Administrative...

  19. 24 CFR 972.109 - Conversion of developments.

    Science.gov (United States)

    2010-04-01

    ... writing whether it has approved the conversion plan. Units that are vacant or vacated on or after the... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Conversion of developments. 972.109... DEVELOPMENT CONVERSION OF PUBLIC HOUSING TO TENANT-BASED ASSISTANCE Required Conversion of Public Housing...

  20. Image collection: 109 [Togo Picture Gallery[Archive

    Lifescience Database Archive (English)

    Full Text Available 109 Tyrannosaurus_rex_NL.png ティラノサウルス Tyrannosaurus Tyrannosaurus rex ... 生物アイコン,脊索動物門,脊椎動物亜門,爬虫綱,恐竜上目・翼竜上目

  1. Separation of cadmium from solutions containing high concentration of zinc ions

    International Nuclear Information System (INIS)

    Sharma, K.D.; Bhutani, A.K.; Parvathisem, P.

    1984-01-01

    In hydrometallurgical process of extracting cadmium as a byproduct, zinc dust is added for separation of cadmium as cadimum sponge. High amounts of zinc are quite often noticed in the cadmium electrolyte subjected for electrowinning of the metal. This leads to poor quality of cadmium deposit and lower current efficiencies. Study of cadmium sponge cementation process revealed that zinc dust may be added to an acidic cadmium solution for precipitation of cadmium sponge without neutralization of the free acidity present in the system. This fact is utilized for obtaining a high cadmium sponge with 75-80 per cent cadmium and 5-10 per cent zinc with 98 per cent recovery of cadmium from the solution as sponge. The suggested process is confirmed in a cadmium production plant producing 11.0 MT of cadmium per month. (author)

  2. Electrotransport of Uranium from a Liquid Cadmium Anode to a Solid Cathode

    International Nuclear Information System (INIS)

    Ahluwalia, Rajesh K.; Hua, Thanh Q.

    2002-01-01

    During anodic dissolution of irradiated binary Experimental Breeder Reactor-II fuel, a portion of the electrorefined uranium collects in the underlying cadmium pool. It is periodically recovered by setting up a cell configuration in which the pool is made the anode and uranium is electrodeposited on a solid cathode mandrel. A theoretical model is used to determine the current structure of the liquid cadmium anode. The model is validated by comparing against the measured composition of the cathode deposits. Multinodal simulations are conducted to explain the bell shape of deposits observed with this mode of electrotransport. The simulations also determine the dependence of collection efficiency on the electrical charge passed that is functionally consistent with the experimental data. Finally, a simplified operating map of the electrorefiner is presented that can be used to determine the conditions for growing cathode deposits of target composition

  3. Cadmium uptake in oyster isognomon alatus under laboratory condition

    International Nuclear Information System (INIS)

    Katayon Saed; Ahmad Ismail; Missri Kusnan; Hishamuddin Omar

    1999-01-01

    The uptake of cadmium in Flat tree oyster Isognomon alatus was investigated under controlled laboratory conditions for two weeks. Oysters were exposed to 100 μg 1'-1 cadmium and the accumulation of cadmium in the tissues was measured for every two days. Soft tissues of oyster were digested in concentrated acid and cadmium concentrations were determined by using Atomic Absorption Spectrophotometer. The accumulation of cadmium in the soft tissues of oysters was increased during the first six days from 0.73 μg g- 1 to 10.77 μg g'-1, and remaining constant for four days at average level of 10.96 μg g'-1. The Cl concentrations was increased to 32.70 μg g'-1 until the end of experiment. There was no sign of cadmium accumulation approaching saturation for the period of exposure. (author)

  4. Assessment and management of risk to wildlife from cadmium

    International Nuclear Information System (INIS)

    Burger, Joanna

    2008-01-01

    Cadmium, a nonessential heavy metal that comes from natural and anthropogenic sources, is a teratogen, carcinogen, and a possible mutagen. Assessment of potential risk from cadmium requires understanding environmental exposure, mainly from ingestion, although there is some local exposure through inhalation. Chronic exposure is more problematic than acute exposure for wildlife. There is evidence for bioaccumulation, particularly in freshwater organisms, but evidence for biomagnification up the food chain is inconsistent; in some bird studies, cadmium levels were higher in species that are higher on the food chain than those that are lower. Some freshwater and marine invertebrates are more adversely affected by cadmium exposure than are birds and mammals. There is very little experimental laboratory research on the effects of cadmium in amphibians, birds and reptiles, and almost no data from studies of wildlife in nature. Managing the risk from cadmium to wildlife involves assessment (including ecological risk assessment), biomonitoring, setting benchmarks of effects, regulations and enforcement, and source reduction

  5. Assessment and management of risk to wildlife from cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Burger, Joanna [Division of Life Sciences, Environmental and Occupational Health Sciences Institute, Consortium for Risk Evaluation with Stakeholder Participation, Rutgers University, Piscataway, New Jersey, 08854-8082 (United States)], E-mail: burger@biology.rutgers.edu

    2008-01-15

    Cadmium, a nonessential heavy metal that comes from natural and anthropogenic sources, is a teratogen, carcinogen, and a possible mutagen. Assessment of potential risk from cadmium requires understanding environmental exposure, mainly from ingestion, although there is some local exposure through inhalation. Chronic exposure is more problematic than acute exposure for wildlife. There is evidence for bioaccumulation, particularly in freshwater organisms, but evidence for biomagnification up the food chain is inconsistent; in some bird studies, cadmium levels were higher in species that are higher on the food chain than those that are lower. Some freshwater and marine invertebrates are more adversely affected by cadmium exposure than are birds and mammals. There is very little experimental laboratory research on the effects of cadmium in amphibians, birds and reptiles, and almost no data from studies of wildlife in nature. Managing the risk from cadmium to wildlife involves assessment (including ecological risk assessment), biomonitoring, setting benchmarks of effects, regulations and enforcement, and source reduction.

  6. Growth of cadmium oxide whiskers on cadmium sulphide single crystals with copper as growth activator

    Energy Technology Data Exchange (ETDEWEB)

    Koparanova, N.; Simov, S. (Bylgarska Akademiya na Naukite, Sofia. Inst. po Fizika na Tvyrdoto Tyalo); Genchev, D. (Bylgarska Akademiya na Naukite, Sofia. Inst. za Yadrena Izsledvaniya i Yadrena Energetika); Metchenov, G. (Research Inst. of Criminalistics and Criminology, Sofia (Bulgaria))

    1985-02-01

    Some results on the growth and morphology of cadmium oxide whiskers, obtained on cadmium sulphide single crystals with copper as a growth activator, are presented in this work. Cadmium oxide whiskers have been obtained on brace 112-bar0 brace faces of cadmium sulphide plates with a copper layer deposited in advance. The whiskers grew during the annealing of the plates in a weak stream of technically pure argon at temperatures 670 to 730 deg C for 15 min to 3.5 h. Details about the procedure have been given elsewhere. The composition and morphology of the whiskers have been studied by an X-ray microanalyser JEOL 35 DDS and a scanning electron microscope JEOL, JSM 35. The optical microscopic observations have shown that after annealing, a gray-black granular layer is formed on the cadmium sulphide single crystals and this layer can easily be separated from the crystal substrate. Under the granular layer the crystal is heavily damaged. The whiskers grow on the granular layer and they are coloured yellow-brown or red-brown. The maximum whisker length attains several hundreds of micrometres and in some cases up to 1 mm or more.

  7. Growth of cadmium oxide whiskers on cadmium sulphide single crystals with copper as growth activator

    International Nuclear Information System (INIS)

    Koparanova, N.; Simov, S.

    1985-01-01

    Some results on the growth and morphology of cadmium oxide whiskers, obtained on cadmium sulphide single crystals with copper as a growth activator, are presented in this work. Cadmium oxide whiskers have been obtained on brace 112-bar0 brace faces of cadmium sulphide plates with a copper layer deposited in advance. The whiskers grew during the annealing of the plates in a weak stream of technically pure argon at temperatures 670 to 730 deg C for 15 min to 3.5 h. Details about the procedure have been given elsewhere. The composition and morphology of the whiskers have been studied by an X-ray microanalyser JEOL 35 DDS and a scanning electron microscope JEOL, JSM 35. The optical microscopic observations have shown that after annealing, a gray-black granular layer is formed on the cadmium sulphide single crystals and this layer can easily be separated from the crystal substrate. Under the granular layer the crystal is heavily damaged. The whiskers grow on the granular layer and they are coloured yellow-brown or red-brown. The maximum whisker length attains several hundreds of micrometres and in some cases up to 1 mm or more. (author)

  8. The effects of low environmental cadmium exposure on bone density

    Energy Technology Data Exchange (ETDEWEB)

    Trzcinka-Ochocka, M., E-mail: ochocka@imp.lodz.pl [Department of Chemical Hazards, Laboratory of Biomonitoring, Nofer Institute of Occupational Medicine, Lodz (Poland); Jakubowski, M. [Department of Chemical Hazards, Laboratory of Biomonitoring, Nofer Institute of Occupational Medicine, Lodz (Poland); Szymczak, W. [Department of Environmental Epidemiology, Nofer Institute of Occupational Medicine, Lodz (Poland); Insitute of Psychology, University of Lodz (Poland); Janasik, B.; Brodzka, R. [Department of Chemical Hazards, Laboratory of Biomonitoring, Nofer Institute of Occupational Medicine, Lodz (Poland)

    2010-04-15

    Recent epidemiological data indicate that low environmental exposure to cadmium, as shown by cadmium body burden (Cd-U), is associated with renal dysfunction as well as an increased risk of cadmium-induced bone disorders. The present study was designed to assess the effects of low environmental cadmium exposure, at the level sufficient to induce kidney damage, on bone metabolism and mineral density (BMD). The project was conducted in the area contaminated with cadmium, nearby a zinc smelter located in the region of Poland where heavy industry prevails. The study population comprised 170 women (mean age=39.7; 18-70 years) and 100 men (mean age=31.9; 18-76 years). Urinary and blood cadmium and the markers of renal tubular dysfunction ({beta}{sub 2}M-U RBP, NAG), glomerular dysfunction (Alb-U and {beta}{sub 2}M-S) and bone metabolism markers (BAP-S, CTX-S) as well as forearm BMD, were measured. The results of this study based on simple dose-effect analysis showed the relationship between increasing cadmium concentrations and an increased excretion of renal dysfunction markers and decreasing bone density. However, the results of the multivariate analysis did not indicate the association between exposure to cadmium and decrease in bone density. They showed that the most important factors that have impact on bone density are body weight and age in the female subjects and body weight and calcium excretion in males. Our investigation revealed that the excretion of low molecular weight proteins occurred at a lower level of cadmium exposure than the possible loss of bone mass. It seems that renal tubular markers are the most sensitive and significant indicators of early health effects of cadmium intoxication in the general population. The correlation of urinary cadmium concentration with markers of kidney dysfunction was observed in the absence of significant correlations with bone effects. Our findings did not indicate any effects of environmental cadmium exposure on bone

  9. Modeling cadmium in the feed chain and cattle organs

    OpenAIRE

    Fels-Klerx, van der, H.J.; Romkens, P.F.A.M.; Franz, E.; Raamsdonk, van, L.W.D.

    2011-01-01

    The objectives of this study were to estimate cadmium contamination levels in different scenarios related to soil characteristics and assumptions regarding cadmium accumulation in the animal tissues, using quantitative supply chain modeling. The model takes into account soil cadmium levels, soil pH, soil-to-plant transfer, animal consumption patterns, and transfer into animal organs (liver and kidneys). The model was applied to cattle up to the age of six years which were fed roughage (maize ...

  10. Phytoremediation of cadmium contaminated soils by tuberose

    International Nuclear Information System (INIS)

    Ramana, S.; Biswas, A.K.; Singh, A.B.; Ajay; Ahirwar, N.K.; Behera, S.K.; Subba Rao, A.; Naveen Kumar, P.

    2012-01-01

    The potential of three varieties of tuberose (Prajwal, Shringar and Mexican single) for phytoremediation of soil contaminated with cadmium was evaluated by subjecting the plants to five levels of Cd (0, 25, 50, 75 and 100 mg kg -1 soil). Applied Cd did not produce any toxic symptoms in all the three varieties of tuberose except marginal reduction in the photosynthesis rate and total dry weight beyond 50 mg Cd kg -1 soil. The study showed that tuberose possessed the typical ability of Cd hyper accumulator characterized by (1) accumulation of Cd in the shoots of the plant exceeding the critical judging standard i.e., 100 μg g -1 DW and (2) ratio of Cd in the shoots to bulbs >1. It was concluded that tuberose may be an effective accumulator plant for phytoremediation of cadmium polluted soils. (author)

  11. Effect of rhizosphere pH condition on cadmium movement in a soybean plant

    International Nuclear Information System (INIS)

    Ohya, T.; Tanoi, K.; Iikura, H.; Rai, H.; Nakanishi, T.M.

    2008-01-01

    To study the effect of rhizosphere pH condition on the cadmium uptake movement, 109 Cd, was applied as a radioisotope tracer to a soybean plant grown in a water culture at pH 4.5 or pH 6.5. The distribution of 109 Cd in the soybean plant was observed radiographically with an imaging plate (IP). The amount of Cd transported from the root to the upper part of the plant at pH 4.5 was approximately two times higher than that at pH 6.5. However, the movement of Cd in the upper part of the plant was similar under both pH conditions. The distribution of Cd inside the internodes at pH 4.5 also showed similar pattern to that at pH 6.5, suggesting that once Cd reached to the vessel of the root, the movement of Cd was not dependent on rhizosphere pH conditions. (author)

  12. Cadmium elemination from phosphoric acid by ionic flotation

    International Nuclear Information System (INIS)

    Brikci-Nigassa, Mounir; Hamouche, Hafida

    1995-11-01

    The ion flotation process for the recovery of cadmium from wet phosphoric acid (30%P2O5) has been studied. This technique combines a chemical recation between the collector and the cadmium to form a precipitate (sublate) which is carried to the surface of the solution by air bubbles. the resulting foam containing the cadmium may then separated from solution. The influence of parameters such as collector and cadmium concentration as well as iron content have been investigated for the case a synthetic acid (30% P2O5). The result have been applied to the industrial phosphoric acid produced from Djebel Onk's phosphates (Algeria)

  13. Cadmium accumulation by the marine red alga Porphyra umbilicalis

    Energy Technology Data Exchange (ETDEWEB)

    McLean, M.W.; Williamson, F.B.

    1977-01-01

    The characteristics of cadmium accumulation by the marine red alga Porphyra umbilicalis L. in culture are reported. The time course of uptake under various light conditions shows that cadmium is concentrated as the result of an on-going anabolic process and not as a consequence of a pH gradient as provided by photosynthesis. The effect of cycloheximide is in agreement with de novo protein synthesis being a prerequisite for cadmium accumulation. Autoradiography suggests a specific intracellular location for bound cadmium--apparently the nucleus.

  14. Stabilization of cadmium electrode properties when introducing surfactants

    International Nuclear Information System (INIS)

    Alekseeva, M.E.; Mansurov, F.Kh.; Nikol'skij, V.A.

    1995-01-01

    The results of tests of both separate cadmium electrodes and silver-cadmium accumulators, depending on introduction of surfactants (polyethylene oxide - PO - and its derivatives), have been considered. The influence of PO on the course of electrochemical reaction on cadmium is pronounced in facilitation of anodic process. In case of PO introduction in the amount of 1 % instead of sodium lignosulfonate (2 %) into accumulators with silver-cadmium electrodes, the electrode potential is stabilized, while the accumulator capacity increases. The time period of the accumulation maintenance in the charged state increases 2-3 fold (1-1,5 years). 5 refs.; 4 figs.; 2 tabs

  15. Bioremoval of cadmium by lemna minor in different aquatic conditions

    Energy Technology Data Exchange (ETDEWEB)

    Uysal, Yagmur [Dept. of Environmental Engineering, Kahramanmaras Sutcu Imam University, Kahramanmaras (Turkey); Taner, Fadime [Dept. of Environmental Engineering, Mersin University, Mersin (Turkey)

    2010-04-15

    This study was undertaken to determine the cadmium removal efficiency of Lemna minor when it was used for treatment of wastewater having different characteristics, i. e., pH, temperature and cadmium concentration. Plants were cultivated in different pH solutions (4.5-8.0) and temperatures (15-35 C) in the presence of cadmium (0.1-10.0 mg/L) for 168 h. The amount of biomass obtained in the study period, the concentrations of cadmium in the tissues and in the media and net uptake of cadmium by Lemna have been determined for each condition. The percentages of cadmium uptake (PMU) and bioconcentration factors (BCF) were also calculated. The highest accumulation was obtained for the highest cadmium concentration of 10.0 mg Cd/L as 11.668 mg Cd/g at pH 6.0, and as 38.650 mg Cd/g at 35 C and pH 5.0. The cadmium accumulation gradually increased with initial concentration of the medium, but the opposite trend was observed for the PMU. However, the maximum PMU was obtained as 52.2% in the solution with the lowest concentration of 0.1 mg Cd/L. A mathematical model was used to describe the cadmium uptake and the equation obtained was seen to fit the experimental data very well. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  16. Modification of cadmium pigments for colouring of polyolefins

    International Nuclear Information System (INIS)

    Kalinskaya, T.V.; Livshits, I.M.

    1976-01-01

    Modification conditions are studied of cadmium pigments, obtained by different methods, aliphatic acids(C 5 , C 8 and C 17 ). It is found, that cadmium pigments can adsorb acids with the number of atoms of carbon not less than 8. Stearic acid adsorption on lemon cadmium pigment taken as an example has shown the efficiency of pigment modification influence on its dispersancy in non-polar medium. Modification of yellow cadmium pigments of stearic acid makes possible to obtain pigment output forms ensuring a good particle distribution during polyolefine colouring

  17. ELECTROKINETIC REMEDIATION STUDY FOR CADMIUM CONTAMINATED SOIL

    OpenAIRE

    P. Bala Ramudu; R. P. Tiwari; R. K. Srivastava

    2007-01-01

    This paper presents the results of an experimental research undertaken to evaluate different purging solutions to enhance the removal of cadmium from spiked contaminated field soil by electrokinetic remediation. Three experiments were conducted when soil was saturated with deionised water and subsequently deionised water, ammonium citrate and sodium citrate were used as purging solutions at anode end. One experiment was conducted when the soil was saturated with ammonium citrate and itself wa...

  18. Genetic variability and cadmium metabolism and toxicity

    OpenAIRE

    Rentschler, Gerda

    2014-01-01

    Abstract: Cadmium (Cd) is ubiquitous in the environment. Human exposure in non-smokers occurs mainly via intake of healthy food like vegetables, cereals, and shellfish. Adverse health effects on kidney and bone at low-level environmental Cd exposure are well-documented in adults. There is considerable inter-individual variation in both metabolism (toxicokinetics) and toxicity (toxicodynamics) of Cd. This may be due to genetic factors. The aim of this thesis was to identify genetic fact...

  19. Mercury Cadmium Selenide for Infrared Detection

    Science.gov (United States)

    2013-06-01

    were grown using elemental mercury (Hg), cadmium (Cd), and selenium (Se) sources. The beam equiva- lent pressure ( BEP ) emanating from all sources was...flux), the BEP measured for the cracker source was found to vary with the cracking zone temperature, tracking with the data found in Ref. 7. This sug...The Se BEP measured for the typical cracking zone temperature of 800 C was found to be close to a factor of two lower than at the typical effusion cell

  20. Soil ecotoxicity assessment using cadmium sensitive plants

    Energy Technology Data Exchange (ETDEWEB)

    An, Youn-Joo

    2004-01-01

    The crop plants, sorghum and cucumber, can be used as indicator species to assess ecotoxicity of soils contaminated by cadmium. - Four crop plant species (sweet corn, Zea may; wheat, Triticum aestivum; cucumber, Cucumis sativus; and sorghum, Sorghum bicolor) were tested to assess an ecotoxicity in cadmium-amended soils. The measurement endpoints used were seed germination and seedling growth (shoot and root). The presence of cadmium decreased the seedling growth. The medium effective concentration values (EC50) for shoot or root growth were calculated by the Trimmed Spearman-Karber method. Due to the greater accumulation of Cd to the roots, root growth was a more sensitive endpoint than shoot growth. Bioavailability and transport of Cd within plant were related to concentration and species. The ratio of bioaccumulation factor (BAF) in the shoots to the roots indicated high immobilization of Cd in the roots. Seed germination was insensitive to Cd toxicity, and is not recommended for a suitable assay. Among the test plants and test endpoints, root growth of sorghum and cucumber appears to be a good protocol to assess ecotoxicity of soils contaminated by Cd.

  1. Soil ecotoxicity assessment using cadmium sensitive plants

    International Nuclear Information System (INIS)

    An, Youn-Joo

    2004-01-01

    The crop plants, sorghum and cucumber, can be used as indicator species to assess ecotoxicity of soils contaminated by cadmium. - Four crop plant species (sweet corn, Zea may; wheat, Triticum aestivum; cucumber, Cucumis sativus; and sorghum, Sorghum bicolor) were tested to assess an ecotoxicity in cadmium-amended soils. The measurement endpoints used were seed germination and seedling growth (shoot and root). The presence of cadmium decreased the seedling growth. The medium effective concentration values (EC50) for shoot or root growth were calculated by the Trimmed Spearman-Karber method. Due to the greater accumulation of Cd to the roots, root growth was a more sensitive endpoint than shoot growth. Bioavailability and transport of Cd within plant were related to concentration and species. The ratio of bioaccumulation factor (BAF) in the shoots to the roots indicated high immobilization of Cd in the roots. Seed germination was insensitive to Cd toxicity, and is not recommended for a suitable assay. Among the test plants and test endpoints, root growth of sorghum and cucumber appears to be a good protocol to assess ecotoxicity of soils contaminated by Cd

  2. Cadmium-related mortality and long-term secular trends in the cadmium body burden of an environmentally exposed population.

    Science.gov (United States)

    Nawrot, Tim S; Van Hecke, Etienne; Thijs, Lutgarde; Richart, Tom; Kuznetsova, Tatiana; Jin, Yu; Vangronsveld, Jaco; Roels, Harry A; Staessen, Jan A

    2008-12-01

    Few population studies have reported on the long-term changes in the internal cadmium dose and simultaneously occurring mortality. We monitored blood cadmium (BCd), 24-hr urinary cadmium (UCd), and mortality in an environmentally exposed population. Starting from 1985, we followed BCd (until 2003), UCd (until 1996), and mortality (until 2007) among 476 and 480 subjects, randomly recruited from low- exposure areas (LEA) and high-exposure areas (HEA). The last cadmium-producing plant in the HEA closed in 2002. From 1985-1989 to 1991-1996, BCd decreased by 40.3% and 18.9% in the LEA and HEA, respectively (p fashion without threshold.

  3. CD109 is a component of exosome secreted from cultured cells

    International Nuclear Information System (INIS)

    Sakakura, Hiroki; Mii, Shinji; Hagiwara, Sumitaka; Kato, Takuya; Yamamoto, Noriyuki; Hibi, Hideharu; Takahashi, Masahide; Murakumo, Yoshiki

    2016-01-01

    Exosomes are 50–100-nm-diameter membrane vesicles released from various types of cells. Exosomes retain proteins, mRNAs and miRNAs, which can be transported to surrounding cells. CD109 is a glycosylphosphatidylinositol-anchored glycoprotein, and is released from the cell surface to the culture medium in vitro. Recently, it was reported that secreted CD109 from the cell surface downregulates transforming growth factor-β signaling in human keratinocytes. In this study, we revealed that CD109 is a component of the exosome in conditioned medium. FLAG-tagged human CD109 (FLAG-CD109) in conditioned medium secreted from HEK293 cells expressing FLAG-CD109 (293/FLAG-CD109) was immunoprecipitated with anti-FLAG affinity gel, and the co-precipitated proteins were analyzed by mass spectrometry and western blotting. Exosomal proteins were associated with CD109. We revealed the presence of CD109 in exosome fractions from conditioned medium of 293/FLAG-CD109. Moreover, the localization of CD109 in the exosome was demonstrated using immuno-electron microscopy. When we used HEK293 cells expressing FLAG-tagged truncated CD109, which does not contain the C-terminal region, the association of truncated CD109 with exosomes was not detected in conditioned medium. These findings indicate that CD109 is an exosomal protein and that the C-terminal region of CD109 is required for its presence in the exosome. - Highlights: • CD109 is an exosomal protein. • The C-terminal region of CD109 is required for its presence in the exosome. • Part of the secreted CD109 is present in the exosome-free fraction in the conditioned medium.

  4. CD109 is a component of exosome secreted from cultured cells

    Energy Technology Data Exchange (ETDEWEB)

    Sakakura, Hiroki [Department of Pathology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Department of Oral and Maxillofacial Surgery, Nagoya University Graduate School of Medicine, Nagoya (Japan); Mii, Shinji [Department of Pathology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Hagiwara, Sumitaka [Department of Oral and Maxillofacial Surgery, Nagoya University Graduate School of Medicine, Nagoya (Japan); Department of Head and Neck Surgery, Aichi Cancer Center Hospital, Nagoya (Japan); Kato, Takuya [Department of Pathology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Yamamoto, Noriyuki; Hibi, Hideharu [Department of Oral and Maxillofacial Surgery, Nagoya University Graduate School of Medicine, Nagoya (Japan); Takahashi, Masahide, E-mail: mtakaha@med.nagoya-u.ac.jp [Department of Pathology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Murakumo, Yoshiki, E-mail: murakumo@med.kitasato-u.ac.jp [Department of Pathology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Department of Pathology, Kitasato University School of Medicine, Sagamihara, Kanagawa (Japan)

    2016-01-22

    Exosomes are 50–100-nm-diameter membrane vesicles released from various types of cells. Exosomes retain proteins, mRNAs and miRNAs, which can be transported to surrounding cells. CD109 is a glycosylphosphatidylinositol-anchored glycoprotein, and is released from the cell surface to the culture medium in vitro. Recently, it was reported that secreted CD109 from the cell surface downregulates transforming growth factor-β signaling in human keratinocytes. In this study, we revealed that CD109 is a component of the exosome in conditioned medium. FLAG-tagged human CD109 (FLAG-CD109) in conditioned medium secreted from HEK293 cells expressing FLAG-CD109 (293/FLAG-CD109) was immunoprecipitated with anti-FLAG affinity gel, and the co-precipitated proteins were analyzed by mass spectrometry and western blotting. Exosomal proteins were associated with CD109. We revealed the presence of CD109 in exosome fractions from conditioned medium of 293/FLAG-CD109. Moreover, the localization of CD109 in the exosome was demonstrated using immuno-electron microscopy. When we used HEK293 cells expressing FLAG-tagged truncated CD109, which does not contain the C-terminal region, the association of truncated CD109 with exosomes was not detected in conditioned medium. These findings indicate that CD109 is an exosomal protein and that the C-terminal region of CD109 is required for its presence in the exosome. - Highlights: • CD109 is an exosomal protein. • The C-terminal region of CD109 is required for its presence in the exosome. • Part of the secreted CD109 is present in the exosome-free fraction in the conditioned medium.

  5. studies on the use of organic and inorganic ion exchangers for separation of indium(III) from cadmium(II) using analytical methods

    International Nuclear Information System (INIS)

    Mohamed, A.A.E.

    2011-01-01

    Organic and inorganic ion exchangers have many applications not only in the industrial, environmental and the nuclear fields but also in the separation of metal ions. This may be returned to its high measured capacity, high selectivity for some metal ions, low solubility, high chemical radiation stability and easy to use.Indium and cadmium are produced from cyclotron target where the solvent extraction represents an ordinary method for separation of indium and cadmium from its target. In the present work, More than chromatographic columns were successfully used for the separation and recovery of indium(III) and cadmium(II) ions from di-component system in aqueous solution using organic and inorganic ion exchangers. The work was carried out in three main parts;1- In the first part, the commercial resin (Dowex50w-x8) was used for the separation of indium from cadmium. The effect of pH, the weight of resin, and equilibrium time on the sorption process of both metal ions were determined. It was found that the adsorption percentage was more than 99% at pH 4 (as optimum pH value) using batch experiment. The results show that indium was first extracted while cadmium is slightly extracted at this pH value. The recovery of indium and cadmium is about 98% using hydrochloric acid as best eluent. The ion exchange/complexing properties of Dowex50w-x8 resin containing various substituted groups towards indium and cadmium cations were investigated.2- In the second part, Zn(II)polymethacrylates, and poly (acrylamide-acrylic acid), as synthetic organic ion exchangers were prepared by gamma irradiation polymerization technique of the corresponding monomer at 30 kGy. The obtained organic resins were mixed with indium ions to determine its capacity in aqueous solutions using batch experiment.

  6. Mutagenic effect of cadmium on tetranucleotide repeats in human cells

    Energy Technology Data Exchange (ETDEWEB)

    Slebos, Robbert J.C. [Department of Cancer Biology, Vanderbilt-Ingram Cancer Center, Vanderbilt University School of Medicine, Nashville, TN 37232 (United States) and Department of Otolaryngology, Vanderbilt-Ingram Cancer Center, Vanderbilt University School of Medicine, Nashville, TN 37232 (United States)]. E-mail: r.slebos@vanderbilt.edu; Li Ming [Department of Biostatistics, Vanderbilt-Ingram Cancer Center, Vanderbilt University School of Medicine, Nashville, TN 37232 (United States); Evjen, Amy N. [Department of Cancer Biology, Vanderbilt-Ingram Cancer Center, Vanderbilt University School of Medicine, Nashville, TN 37232 (United States); Coffa, Jordy [Department of Cancer Biology, Vanderbilt-Ingram Cancer Center, Vanderbilt University School of Medicine, Nashville, TN 37232 (United States); Shyr, Yu [Department of Biostatistics, Vanderbilt-Ingram Cancer Center, Vanderbilt University School of Medicine, Nashville, TN 37232 (United States); Yarbrough, Wendell G. [Department of Cancer Biology, Vanderbilt-Ingram Cancer Center, Vanderbilt University School of Medicine, Nashville, TN 37232 (United States); Department of Otolaryngology, Vanderbilt-Ingram Cancer Center, Vanderbilt University School of Medicine, Nashville, TN 37232 (United States)

    2006-12-01

    Cadmium is a human carcinogen that affects cell proliferation, apoptosis and DNA repair processes that are all important to carcinogenesis. We previously demonstrated that cadmium inhibits DNA mismatch repair (MMR) in yeast cells and in human cell-free extracts (H.W. Jin, A.B. Clark, R.J.C. Slebos, H. Al-Refai, J.A. Taylor, T.A. Kunkel, M.A. Resnick, D.A. Gordenin, Cadmium is a mutagen that acts by inhibiting mismatch repair, Nat. Genet. 34 (3) (2003) 326-329), but cadmium also inhibits DNA excision repair. For this study, we selected a panel of three hypermutable tetranucleotide markers (MycL1, D7S1482 and DXS981) and studied their suitability as readout for the mutagenic effects of cadmium. We used a clonal derivative of the human fibrosarcoma cell line HT1080 to assess mutation levels in microsatellites after cadmium and/or N-methyl-N-nitro-N-nitrosoguanidine (MNNG) exposure to study effects of cadmium in the presence or absence of base damage. Mutations were measured in clonally expanded cells obtained by limiting dilution after exposure to zero dose, 0.5 {mu}M cadmium, 5 nM MNNG or a combination of 0.5 {mu}M cadmium and 5 nM MNNG. Exposure of HT1080-C1 to cadmium led to statistically significant increases in microsatellite mutations, either with or without concurrent exposure to MNNG. A majority of the observed mutant molecules involved 4-nucleotide shifts consistent with DNA slippage mutations that are normally repaired by MMR. These results provide evidence for the mutagenic effects of low, environmentally relevant levels of cadmium in intact human cells and suggest that inhibition of DNA repair is involved.

  7. Critical review of animal carcinogenesis by cadmium and its inorganic compounds

    International Nuclear Information System (INIS)

    Maximilien, R.; Dero, B.

    1990-01-01

    Animal carcinogenic biassays relative to 6 inorganic cadmium substances (cadmium metal, cadmium oxide, cadmium sulfide, cadmium sulfate, cadmium chloride and cadmium acetate) are reviewed (speciation). Critical evaluation of literature data on carcinogenicity has been performed by making reference to E.C. guidelines of good laboratory practice. There are few data on routes relevant for human risk assessment: experiments on inhalation demonstrate lung carcinogenicity of cadmium oxide, cadmium sulfide, cadmium sulfate and cadmium chloride in rats but not in mice nor in hamsters; no carcinogenic effects of cadmium compounds are observed following oral administration. For routes of less or no relevance for human risk assessment, some results are clearly positive: subcutaneous injection induces cancers in situ (various cadmium compounds), testicular tumours (cadmium sulfate and cadmium chloride) and prostatic tumours (cadmium chloride) but such effects are not observed using relevant malignancies in rats. With respect to other no relevant routes (intraperitoneal, intrarenal...) tumours are incidentally produced in situ, but not in remote organs. Numerous studies fail to demonstrate cadmium carcinogenicity, but methodologically acceptable negative ones are very limited in number. Accordingly strain dependent effects and dose effect relationship could not be thoroughly assessed

  8. High rate deposition of thin film cadmium sulphide by pulsed direct current magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Lisco, F., E-mail: F.Lisco@lboro.ac.uk [Centre for Renewable Energy Systems Technology (CREST), School of Electronic, Electrical and Systems Engineering, Loughborough University, Leicestershire LE11 3TU (United Kingdom); Kaminski, P.M.; Abbas, A.; Bowers, J.W.; Claudio, G. [Centre for Renewable Energy Systems Technology (CREST), School of Electronic, Electrical and Systems Engineering, Loughborough University, Leicestershire LE11 3TU (United Kingdom); Losurdo, M. [Institute of Inorganic Methodologies and of Plasmas, IMIP-CNR, via Orabona 4, 70126 Bari (Italy); Walls, J.M. [Centre for Renewable Energy Systems Technology (CREST), School of Electronic, Electrical and Systems Engineering, Loughborough University, Leicestershire LE11 3TU (United Kingdom)

    2015-01-01

    Cadmium Sulphide (CdS) is an important n-type semiconductor widely used as a window layer in thin film photovoltaics Copper Indium Selenide, Copper Indium Gallium (di)Selenide, Copper Zinc Tin Sulphide and Cadmium Telluride (CdTe). Cadmium Sulphide has been deposited using a number of techniques but these techniques can be slow (chemical bath deposition and Radio Frequency sputtering) or the uniformity and the control of thickness can be relatively difficult (close space sublimation). In this paper we report on the development of a process using pulsed Direct Current magnetron sputtering which allows nanometre control of thin film thickness using time only. The CdS thin films deposited in this process are highly uniform and smooth. They exhibit the preferred hexagonal structure at room temperature deposition and they have excellent optical properties. Importantly, the process is highly stable despite the use of a semi-insulating magnetron target. Moreover, the process is very fast. The deposition rate using 1.5 kW of power to a 6-inch circular magnetron was measured to be greater than 8 nm/s. This makes the process suitable for industrial deployment. - Highlights: • Pulsed DC magnetron sputtering of CdS • High deposition rate deposition • Uniform, pinhole free films.

  9. High rate deposition of thin film cadmium sulphide by pulsed direct current magnetron sputtering

    International Nuclear Information System (INIS)

    Lisco, F.; Kaminski, P.M.; Abbas, A.; Bowers, J.W.; Claudio, G.; Losurdo, M.; Walls, J.M.

    2015-01-01

    Cadmium Sulphide (CdS) is an important n-type semiconductor widely used as a window layer in thin film photovoltaics Copper Indium Selenide, Copper Indium Gallium (di)Selenide, Copper Zinc Tin Sulphide and Cadmium Telluride (CdTe). Cadmium Sulphide has been deposited using a number of techniques but these techniques can be slow (chemical bath deposition and Radio Frequency sputtering) or the uniformity and the control of thickness can be relatively difficult (close space sublimation). In this paper we report on the development of a process using pulsed Direct Current magnetron sputtering which allows nanometre control of thin film thickness using time only. The CdS thin films deposited in this process are highly uniform and smooth. They exhibit the preferred hexagonal structure at room temperature deposition and they have excellent optical properties. Importantly, the process is highly stable despite the use of a semi-insulating magnetron target. Moreover, the process is very fast. The deposition rate using 1.5 kW of power to a 6-inch circular magnetron was measured to be greater than 8 nm/s. This makes the process suitable for industrial deployment. - Highlights: • Pulsed DC magnetron sputtering of CdS • High deposition rate deposition • Uniform, pinhole free films

  10. Cu induced reactions on 110Cd-108Cd-106Cd, 109Ag-107Ag and 110Pd. New rhenium, osmium and iridium isotopes

    International Nuclear Information System (INIS)

    Cabot, C.; Della Negra, S.; Deprun, C.; Gauvin, H.; Le Beyec, Y.

    1978-01-01

    By 63 Cu induced reactions on 110 Cd, 108 Cd, 106 Cd, 109 Ag, 107 Ag and 110 Pd targets, new isotopes were searched in the Ir, Os, Re region. Cross bombardments and excitation function measurements were used to identify new α emitting isotopes. The α-decay measurements are compared to the Qα values obtained from different mass predictions

  11. Determination of cadmium, lead and mercury residual levels in meat ...

    African Journals Online (AJOL)

    Determination of cadmium, lead and mercury residual levels in meat of canned light tuna ( Katsuwonus pelamis and Thunnus albacares ) and fresh little tunny ( Euthynnus alletteratus ) in Libya. ... Surveillance for mercury (Hg), lead (Pb) and cadmium (Cd) contamination in tuna products is crucial for consumer food safety.

  12. Fetal contamination with cadmium following chronic exposure of rat ...

    African Journals Online (AJOL)

    Fetal contamination with cadmium following chronic exposure of rat dams during gestation. ... African Journal of Applied Zoology and Environmental Biology ... It was concluded that cadmium, contrary to previous reports, can pass through the placenta in appreciable quantity to contaminate the fetus to possibly cause fetal ...

  13. Effect of Low Level Cadmium Exposure on Superoxide Dismutase ...

    African Journals Online (AJOL)

    Purpose: To investigate the effect of low level cadmium (Cd) exposure on the activity of superoxide dismutase ... cancer, aging and a diversity of diseases [5]. Superoxide .... responsible for the long biological half-life of cadmium [12]. ... indicator of the balance between the damaging effects and the ... Scand J Work Environ.

  14. Mercury, arsenic and cadmium in the unfried and fried fish

    International Nuclear Information System (INIS)

    Anand, S.J.S.

    1978-01-01

    Determination of mercury, arsenic and cadmium in unfried and fried fish samples has been carried out by neutron activation followed by chemical separation to remove the interfering activies of copper, zinc etc. This paper presents results of finding on losses of mercury, arsenic and cadmium in the unfried and fried fish. (author)

  15. The relationship between maternal blood cadmium, zinc levels and ...

    African Journals Online (AJOL)

    The delivery of babies with low birth weight is a prognosis of neonatal mortality, morbidity and poor health outcomes later in life. This study evaluates the levels of cadmium, zinc and calculated cadmium/zinc ratio in non-occupationally exposed pregnant women at delivery and their relationship with birth weight of babies.

  16. Evaluation of cadmium bioaccumulation and translocation by Hopea ...

    African Journals Online (AJOL)

    Cadmium (Cd) contamination has an adverse effect on soil productivity and crop production. Phytoremediation is a long term and environmental friendly technology to remediate Cadmium polluted areas. This study was conducted to evaluate the potential of Hopea adorata for remediation of soils contaminated with Cd.

  17. Cadmium ion removal using biosorbents derived from fruit peel wastes

    Directory of Open Access Journals (Sweden)

    Wanna Saikaew

    2009-11-01

    Full Text Available The ability of fruit peel wastes, corn, durian, pummelo, and banana, to remove cadmium ions from aqueous solution by biosorption were investigated. The experiments were carried out by batch method at 25oC. The influence of particle sizes, solution pH, and initial cadmium ion concentrations were evaluated on the biosorption studies. The result showed that banana peel had the highest cadmium ions removal followed by durian, pummelo, and corn peels at cadmium ions removal of 73.15, 72.17, 70.56, and 51.22%, respectively. There was a minimal effect when using different particle sizes of corn peel as biosorbent, while the particle size of the others had no influence on the removal of cadmium ions. The cadmium ions removal increased significantly as the pH of the solution increased rapidly from 1 to 5. At pH 5, the cadmium ions removal reached a maximum value. The equilibrium process was best described by the Langmuir isotherms, with maximum biosorption capacities of durian, pummelo, and banana peel of 18.55, 21.83, and 20.88 mg/g respectively. Fourier Transform Infrared Spectroscopy revealed that carboxyl, hydroxyl, and amide groups on the fruit peels’ surface and these groups were involved in the adsorption of the cadmium ions.

  18. Phytoremediation of cadmium and nickel by Spirodela polyrhiza

    International Nuclear Information System (INIS)

    Chaudhuri, Devaleena; Goswami, Chandrima; Chatterjee, Sumon; Majumder, Arunabha; Mishra, A.K.; Bandyopadhyay, Kaushik

    2011-01-01

    Heavy metal pollution in surface and groundwater has considerably increased in the last few years. It is essential to have an effective removal mechanism of these toxic metals. Current research includes the need to develop environment friendly and cost effective technologies for removing heavy metals from water. In several studies cadmium and nickel have been considerably removed using phytoremediation. The removal efficiency of cadmium and nickel by Spirodela polyrhiza, common duckweed has been examined in the present study for 3 different concentrations of cadmium (1, 2 and 3 mg/L) and nickel (4, 5 and 6 mg/L). Two sets of experiments for cadmium and nickel were conducted separately. Effect of metal toxicity on Spirodela polyrhiza was evaluated in terms of relative growth factor and cadmium was found to be more toxic than nickel. Under experimental condition BCF value for cadmium removal was more than >1000 in all the 3 concentrations of cadmium. But the BCF value was found to be more than > 1000 only when input nickel concentration was 4 mg/L during phytoremediation process. Experimental results suggest that Spirodela polyrhiza has the potential of accumulating cadmium and nickel from aqueous solution at lower metal concentration. (author)

  19. Cadmium verification measurements of HFIR shroud assembly 22

    International Nuclear Information System (INIS)

    Chapman, J.A.; Schultz, F.J.

    1994-04-01

    This report discusses radiation-based nondestructive examination methods which have been used to successfully verify the presence of cadmium in High Flux Isotope Reactor (HFIR) spent-fuel shroud assembly number 22 (SA22). These measurements show, in part, that SA22 is certified to meet the criticality safety specifications for a proposed reconfiguration of the HFIR spent-fuel storage array. Measurement of the unique 558.6-keV gamma-ray from neutron radiative capture on cadmium provided conclusive evidence for the presence of cadmium in the outer shroud of the assembly. Cadmium verification in the center post and outer shroud was performed by measuring the degree of neutron transmission in SA22 relative to two calibration shroud assemblies. Each measurement was performed at a single location on the center post and outer shroud. These measurements do not provide information on the spatial distribution or uniformity of cadmium within an assembly. Separate measurements using analog and digital radiography were performed to (a) globally map the continuity of cadmium internal mass, and (b) locally determine the thickness of cadmium. Radiography results will be reported elsewhere. The measurements reported here should not be used to infer the thickness of cadmium in either the center post or outer shroud of an assembly

  20. Use of cadmium in solution in the EL 4 reactor moderator irreversible fixing of cadmium on the metallic surfaces; Utilisation du cadmium en solution dans le moderateur du reacteur EL 4 - fixation irreversible du cadmium sur les surfaces metalliques

    Energy Technology Data Exchange (ETDEWEB)

    Croix, O; Paoli, O; Lecomte, J; Dolle, L; Gallic, Y [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1964-07-01

    In the framework of research into the poisoning of the EL-4 reactor by cadmium sulphate, measurements have been made by two different methods of the residual amounts of cadmium liable to be fixed irreversibly on the surfaces in contact with the heavy water. A marked influence of the pH has been noticed. The mechanism of the irreversible fixing is compatible with the hypothesis of an ion-exchange in the surface oxide layer. In a sufficiently wide range of pH the cadmium thus fixed causes very little residual poisoning. The stability of the cadmium sulphate solutions is however rather low in the conditions of poisoning. (authors) [French] Dans le cadre des etudes sur l'empoisonnement du reacteur EL-4 par le sulfate de cadmium, les quantites residuelles de cadmium susceptibles de se fixer irreversiblement sur les parois que mouillerait l'eau lourde, ont ete mesurees experimentalement par deux methodes differentes. On observe une influence nette du pH. Le mecanisme de la fixation irreversible est compatible avec l'hypothese d'un echange d'ions dans la pellicule d'oxyde superficielle. Dans des limites suffisamment larges de pH, la cadmium ainsi fixe n'occasionne pas d'empoisonnement residuel important. La stabilite des solutions de sulfate de cadmium dans les conditions de l'empoisonnement est cependant mediocre. (auteurs)

  1. Cadmium inhibits neurogenesis in zebrafish embryonic brain development

    Energy Technology Data Exchange (ETDEWEB)

    Chow, Elly Suk Hen [Division of Biology, California Institute of Technology, 1200 California Boulevard, Pasadena, CA 91125 (United States); Hui, Michelle Nga Yu; Lin Chunchi [Department of Biology and Chemistry, City University of Hong Kong, 83 Tat Chee Avenue, Kowloon, Hong Kong (China); Cheng Shukhan [Department of Biology and Chemistry, City University of Hong Kong, 83 Tat Chee Avenue, Kowloon, Hong Kong (China)], E-mail: bhcheng@cityu.edu.hk

    2008-05-01

    Cadmium is a non-essential heavy metal found abundantly in the environment. Children of women exposed to cadmium during pregnancy display lower motor and perceptual abilities. High cadmium body burden in children is also related to impaired intelligence and lowered school achievement. However, little is known about the molecular and cellular basis of developmental neurotoxicity in the sensitive early life stages of animals. In this study, we explore neurological deficits caused by cadmium during early embryonic stages in zebrafish by examining regionalization of the neural tube, pattern formation and cell fate determination, commitment of proneural genes and induction of neurogenesis. We show that cadmium-treated embryos developed a smaller head with unclear boundaries between the brain subdivisions, particularly in the mid-hindbrain region. Embryos display normal anterior to posterior regionalization; however, the commitment of neural progenitor cells was affected by cadmium. We observe prominent reductions in the expression of several proneuronal genes including ngn1 in cell clusters, zash1a in the developing optic tectum, and zash1b in the telencephalon and tectum. Cadmium-treated embryos also have fewer differentiated neurons and glia in the facial sensory ganglia as indicated by decreased zn-12 expression. Also, a lower transcription level of neurogenic genes, ngn1 and neuroD, is observed in neurons. Our data suggest that cadmium-induced neurotoxicity can be caused by impaired neurogenesis, resulting in markedly reduced neuronal differentiation and axonogenesis.

  2. Effects of Aluminium Sulfate on Cadmium Accumulation in Rice

    International Nuclear Information System (INIS)

    Khamvarn, Vararas; Boontanon, Narin; Prapagdee, Benjaphorn; Kumsopa, Acharaporn; Boonsirichai, Kanokporn

    2011-06-01

    Full text: Cadmium accumulation in Pathum Thani 1 and Suphan Buri 60 rice cultivars was investigated upon treatment with aluminium sulfate as a precipitant. Rice was grown hydroponically in a medium containing 4 ppm cadmium nitrate with or without 4 ppm aluminium sulfate. Root, stem with leaves and grain samples were collected and analyzed for cadmium content using atomic absorption spectroscopy and inductively coupled plasma atomic emission spectroscopy. Without the addition of aluminium sulfate, Pathum Thani 1 and Suphan Buri 60 accumulated 24.71∫ 3.14 ppm and 34.43 ∫ 4.51 ppm (dry weight of whole plant) of cadmium, respectively. With aluminium sulfate, cadmium accumulation increased to 40.66 ∫ 2.47 ppm and 62.94 ∫ 10.69 ppm, respectively. The addition of aluminium sulfate to the planting medium did not reduce cadmium accumulation but caused the rice to accumulate more cadmium especially in the shoots and grains. This observation might serve as the basis for future research on the management of agricultural areas that are contaminated with cadmium and aluminium

  3. Cadmium Removal from Aqueous Solutions by Ground Pine Cone

    Directory of Open Access Journals (Sweden)

    H Izanloo, S Nasseri

    2005-01-01

    Full Text Available A study on the removal of cadmium ions from aqueous solutions by pine cone was conducted in batch conditions. Kinetic data and equilibrium removal isotherms were obtained. The influence of different experimental parameters such as contact time, initial concentration of cadmium, pine cone mass and particle size, and temperature on the kinetics of cadmium removal was studied. Results showed that the main parameters that played an important role in removal phenomenon were initial cadmium concentration, particle size and pine cone mass. The necessary time to reach equilibrium was between 4 and 7 hours based on the initial concentration of cadmium. The capacity of cadmium adsorption at equilibrium increased with the decrease of pine cone particle size. The capacity of cadmium adsorption at equilibrium by pine cone increased with the quantity of pine cone introduced (1–4 g/L. Temperature in the range of 20-30°C showed a restricted effect on the removal kinetics (13.56 mg/g at 20°C and a low capacity of adsorption about 11.48 mg/g at 30°C. The process followed pseudo second-order kinetics. The cadmium uptake of pine cone was quantitatively evaluated using adsorption isotherms. Results indicated that the Langmuir model gave a better fit to the experimental data in comparison with the Freundlich equation.

  4. Cadmium inhibits neurogenesis in zebrafish embryonic brain development

    International Nuclear Information System (INIS)

    Chow, Elly Suk Hen; Hui, Michelle Nga Yu; Lin Chunchi; Cheng Shukhan

    2008-01-01

    Cadmium is a non-essential heavy metal found abundantly in the environment. Children of women exposed to cadmium during pregnancy display lower motor and perceptual abilities. High cadmium body burden in children is also related to impaired intelligence and lowered school achievement. However, little is known about the molecular and cellular basis of developmental neurotoxicity in the sensitive early life stages of animals. In this study, we explore neurological deficits caused by cadmium during early embryonic stages in zebrafish by examining regionalization of the neural tube, pattern formation and cell fate determination, commitment of proneural genes and induction of neurogenesis. We show that cadmium-treated embryos developed a smaller head with unclear boundaries between the brain subdivisions, particularly in the mid-hindbrain region. Embryos display normal anterior to posterior regionalization; however, the commitment of neural progenitor cells was affected by cadmium. We observe prominent reductions in the expression of several proneuronal genes including ngn1 in cell clusters, zash1a in the developing optic tectum, and zash1b in the telencephalon and tectum. Cadmium-treated embryos also have fewer differentiated neurons and glia in the facial sensory ganglia as indicated by decreased zn-12 expression. Also, a lower transcription level of neurogenic genes, ngn1 and neuroD, is observed in neurons. Our data suggest that cadmium-induced neurotoxicity can be caused by impaired neurogenesis, resulting in markedly reduced neuronal differentiation and axonogenesis

  5. Cadmium chronic administration to lactating ewes. Reproductive performance, cadmium tissue accumulation and placental transfer

    Energy Technology Data Exchange (ETDEWEB)

    Floris, B.; Bomboi, G.; Sechi, P.; Marongiu, M. L. [Sassari Univ., Sassari (Italy). Dipt. di Biologia Animale; Pirino, S. [Sassari Univ., Sassari (Italy). Ist. di Patologia Generale, Anatomia Patologica e Clinica Ostetrico-chirurgica Veterinaria

    2000-12-01

    20 lactating ewes were allotted to two groups: 10 subjects received orally 100 mg/day of CdCl{sub 2} for 108 consecutive days, and the remaining 10 acted as control. Reproductive performance in ewes and cadmium tissue accumulation, both in ewes and their lambs, were investigated. The results showed that in ewes: 1) the regular cadmium intestinal intake negatively influences all reproductive parameters; 2) cadmium is particularly accumulated in kidney and liver, bur also in mammary gland, although at distinctly lower level; 3) chronic administration does not increase cadmium placental transfer in lactating pregnant subjects. [Italian] 20 pecore in lattazione sono state suddivise in 2 gruppi: 10 soggetti ricevettero per os 100 mg/giorno di CdCl{sub 2} per 108 giorni consecutivi, e i restanti 10 funsero da controllo. Sono stati studiati i parametri riproduttivi delle pecore e l'accumulo di cadmio nei tessuti, sia delle pecore che dei loro agnelli. I risultati hanno mostrato che negli ovini: 1) il regolare assorbimento intestinale di cadmio influenza negativamente tutti i parametri riproduttivi; 2) il cadmio viene accumulato principalmente nei reni e nel fegato, ma anche dalla ghiandola mammaria, sebbene in misura nettamente inferiore; 3) la somministrazione cronica di cadmio nei soggetti gravidi non incrementa il suo passaggio transplacentare.

  6. Concentration of Cadmium in Cacao Beans and its Relationship with Soil Cadmium in Southern Ecuador

    Science.gov (United States)

    The concentration of cadmium (Cd) in cacao (Theobroma cacao, L.) beans above a critical level (0.6 mg kg-1 established by the European Union) has raised concerns of safety in the consumption of cacao-based chocolate (dark chocolate). Currently, little is available regarding Cd concentration in soil,...

  7. A cell-free fluorometric high-throughput screen for inhibitors of Rtt109-catalyzed histone acetylation.

    Directory of Open Access Journals (Sweden)

    Jayme L Dahlin

    Full Text Available The lysine acetyltransferase (KAT Rtt109 forms a complex with Vps75 and catalyzes the acetylation of histone H3 lysine 56 (H3K56ac in the Asf1-H3-H4 complex. Rtt109 and H3K56ac are vital for replication-coupled nucleosome assembly and genotoxic resistance in yeast and pathogenic fungal species such as Candida albicans. Remarkably, sequence homologs of Rtt109 are absent in humans. Therefore, inhibitors of Rtt109 are hypothesized as potential and minimally toxic antifungal agents. Herein, we report the development and optimization of a cell-free fluorometric high-throughput screen (HTS for small-molecule inhibitors of Rtt109-catalyzed histone acetylation. The KAT component of the assay consists of the yeast Rtt109-Vps75 complex, while the histone substrate complex consists of full-length Drosophila histone H3-H4 bound to yeast Asf1. Duplicated assay runs of the LOPAC demonstrated day-to-day and plate-to-plate reproducibility. Approximately 225,000 compounds were assayed in a 384-well plate format with an average Z' factor of 0.71. Based on a 3σ cut-off criterion, 1,587 actives (0.7% were identified in the primary screen. The assay method is capable of identifying previously reported KAT inhibitors such as garcinol. We also observed several prominent active classes of pan-assay interference compounds such as Mannich bases, catechols and p-hydroxyarylsulfonamides. The majority of the primary active compounds showed assay signal interference, though most assay artifacts can be efficiently removed by a series of straightforward counter-screens and orthogonal assays. Post-HTS triage demonstrated a comparatively small number of confirmed actives with IC50 values in the low micromolar range. This assay, which utilizes five label-free proteins involved in H3K56 acetylation in vivo, can in principle identify compounds that inhibit Rtt109-catalyzed H3K56 acetylation via different mechanisms. Compounds discovered via this assay or adaptations thereof could

  8. Gene expression profiling in rat kidney after intratracheal exposure to cadmium-doped nanoparticles

    Science.gov (United States)

    Coccini, Teresa; Roda, Elisa; Fabbri, Marco; Sacco, Maria Grazia; Gribaldo, Laura; Manzo, Luigi

    2012-08-01

    While nephrotoxicity of cadmium is well documented, very limited information exists on renal effects of exposure to cadmium-containing nanomaterials. In this work, "omics" methodologies have been used to assess the action of cadmium-containing silica nanoparticles (Cd-SiNPs) in the kidney of Sprague-Dawley rats exposed intratracheally. Groups of animals received a single dose of Cd-SiNPs (1 mg/rat), CdCl2 (400 μg/rat) or 0.1 ml saline (control). Renal gene expression was evaluated 7 and 30 days post exposure by DNA microarray technology using the Agilent Whole Rat Genome Microarray 4x44K. Gene modulating effects were observed in kidney at both time periods after treatment with Cd-SiNPs. The number of differentially expressed genes being 139 and 153 at the post exposure days 7 and 30, respectively. Renal gene expression changes were also observed in the kidney of CdCl2-treated rats with a total of 253 and 70 probes modulated at 7 and 30 days, respectively. Analysis of renal gene expression profiles at day 7 indicated in both Cd-SiNP and CdCl2 groups downregulation of several cluster genes linked to immune function, oxidative stress, and inflammation processes. Differing from day 7, the majority of cluster gene categories modified by nanoparticles in kidney 30 days after dosing were genes implicated in cell regulation and apoptosis. Modest renal gene expression changes were observed at day 30 in rats treated with CdCl2. These results indicate that kidney may be a susceptible target for subtle long-lasting molecular alterations produced by cadmium nanoparticles locally instilled in the lung.

  9. Gene expression profiling in rat kidney after intratracheal exposure to cadmium-doped nanoparticles

    International Nuclear Information System (INIS)

    Coccini, Teresa; Roda, Elisa; Fabbri, Marco; Sacco, Maria Grazia; Gribaldo, Laura; Manzo, Luigi

    2012-01-01

    While nephrotoxicity of cadmium is well documented, very limited information exists on renal effects of exposure to cadmium-containing nanomaterials. In this work, “omics” methodologies have been used to assess the action of cadmium-containing silica nanoparticles (Cd-SiNPs) in the kidney of Sprague-Dawley rats exposed intratracheally. Groups of animals received a single dose of Cd-SiNPs (1 mg/rat), CdCl 2 (400 μg/rat) or 0.1 ml saline (control). Renal gene expression was evaluated 7 and 30 days post exposure by DNA microarray technology using the Agilent Whole Rat Genome Microarray 4x44K. Gene modulating effects were observed in kidney at both time periods after treatment with Cd-SiNPs. The number of differentially expressed genes being 139 and 153 at the post exposure days 7 and 30, respectively. Renal gene expression changes were also observed in the kidney of CdCl 2 -treated rats with a total of 253 and 70 probes modulated at 7 and 30 days, respectively. Analysis of renal gene expression profiles at day 7 indicated in both Cd-SiNP and CdCl 2 groups downregulation of several cluster genes linked to immune function, oxidative stress, and inflammation processes. Differing from day 7, the majority of cluster gene categories modified by nanoparticles in kidney 30 days after dosing were genes implicated in cell regulation and apoptosis. Modest renal gene expression changes were observed at day 30 in rats treated with CdCl 2 . These results indicate that kidney may be a susceptible target for subtle long-lasting molecular alterations produced by cadmium nanoparticles locally instilled in the lung.

  10. Synthesis of cadmium chalcogenide nanotubes at room temperature

    KAUST Repository

    Pan, Jun

    2012-10-01

    Cadmium chalcogenide (CdE, E=S, Se, Te) polycrystalline nanotubes have been synthesized from precursor of CdS/cadmium thiolate complex at room temperature. The precursor was hydrothermally synthesized at 180 °C using thioglycolic acid (TGA) and cadmium acetate as starting materials. The transformation from the rod-like precursor of CdS/cadmium thiolate complex to CdS, CdSe and CdTe nanotubes were performed under constant stirring at room temperature in aqueous solution containing S 2-, Se 2- and Te 2-, respectively. The nanotube diameter can be controlled from 150 to 400 nm related to the dimension of templates. The XRD patterns show the cadmium chalcogenide nanotubes all corresponding to face-centered cubic structure. © 2012 Elsevier B.V. All rights reserved.

  11. Synthesis of cadmium chalcogenide nanotubes at room temperature

    KAUST Repository

    Pan, Jun; Qian, Yitai

    2012-01-01

    Cadmium chalcogenide (CdE, E=S, Se, Te) polycrystalline nanotubes have been synthesized from precursor of CdS/cadmium thiolate complex at room temperature. The precursor was hydrothermally synthesized at 180 °C using thioglycolic acid (TGA) and cadmium acetate as starting materials. The transformation from the rod-like precursor of CdS/cadmium thiolate complex to CdS, CdSe and CdTe nanotubes were performed under constant stirring at room temperature in aqueous solution containing S 2-, Se 2- and Te 2-, respectively. The nanotube diameter can be controlled from 150 to 400 nm related to the dimension of templates. The XRD patterns show the cadmium chalcogenide nanotubes all corresponding to face-centered cubic structure. © 2012 Elsevier B.V. All rights reserved.

  12. Selective extraction-photometric determination of cadmium by basic dyes

    Energy Technology Data Exchange (ETDEWEB)

    Kish, P P; Balog, J S [Uzhgorodskij Gosudarstvennyj Univ. (Ukrainian SSR)

    1979-12-01

    Two variants of selective extraction-photometric determination of cadmium with basic dyes have been developed. In the first one, cadmium is extracted as the iodide by a tributyl phosphate solution in benzene from aqueous solutions containing 0.1 M KI (pH 6-10). Then the cadmium is transformed into a coloured ion associate by treatment of the extracts with Malachite Green in the presence of iodide ions. In the second case, the extract is equilibrated with an equeous solutions of Rhodamine B in the presence of KBr. In this variant, the cadmium is transformed into an anionic iodide-bromide complex which reacts with Rhodamine B cations to form an ion associate. Procedures have been developed of selective extraction-photometric determination of cadmium in sulphur, indium-gallium and zinc concentrates, Zn-As-Cd-Se and Zn-As-Cd-Te films, Cd-S-In and Ga-Sb-Cd-Te alloys.

  13. Effect of cadmium chloride on hepatic lipid peroxidation in mice

    DEFF Research Database (Denmark)

    Andersen, H R; Andersen, O

    1988-01-01

    Intraperitoneal administration of cadmium chloride to 8-12 weeks old CBA-mice enhanced hepatic lipid peroxidation. A positive correlation between cadmium chloride dose and level of peroxidation was observed in both male and female mice. A sex-related difference in mortality was not observed...... but at a dose of 25 mumol CdCl2/kg the level of hepatic lipid peroxidation was higher in male mice than in female mice. The hepatic lipid peroxidation was not increased above the control level in 3 weeks old mice, while 6 weeks old mice responded with increased peroxidation as did 8-12 weeks old mice....... The mortality after an acute toxic dose of cadmium chloride was the same in the three age groups. Pretreatment of mice with several low intraperitoneal doses of cadmium chloride alleviated cadmium induced mortality and lipid peroxidation. The results demonstrate both age dependency and a protective effect...

  14. Effect of cadmium on lung lysosomal enzymes in vitro

    International Nuclear Information System (INIS)

    Giri, S.N.; Hollinger, M.A.

    1995-01-01

    Labilization of lysosomal enzymes is often associated with the general process of inflammation. The present study investigated the effect of the pneumotoxin cadmium on the release and activity of two lung lysosomal enzymes. Incubation of rat lung lysosomes with cadmium resulted in the release of β-glucuronidase but not acid phosphatase. The failure to ''release'' acid phosphatase appears to be the result of a direct inhibitory effect of cadmium on this enzyme. The K I for cadmium was determined to be 26.3 μM. The differential effect of cadmium on these two lysosomal enzymes suggests that caution should be exercised in selecting the appropriate enzyme marker for assessing lysosomal fragility in the presence of this toxicant. Furthermore, the differential basal release rate of the two enzymes from lung lysosomes may reflect the cellular heterogeneity of the lung. (orig.)

  15. Effect of pregnancy on cadmium-treated rats

    Energy Technology Data Exchange (ETDEWEB)

    Takizama, Y. (Akita Univ. School of Medicine, Japan); Nakamura, I.; Kurayama, R.; Hirasawa, F.; Kawai, K.

    1982-01-01

    It is well known that itai-itai disease with the osteopathy is broken out among multiparas, 40 years of age and up Japanese residents. In this paper we described an experimental study of effect of pregnancy on cadmium treated rats. Female mature rats were administered drinking water containing 50 and 200 ppm cadmium as CdCl/sub 2/. During 180 days of the experiment, three times of pregnancy were succesful, though slight depression of body weight gain was noticed in the 200 ppm group. The cadmium was accumulated in the kidneys, liver and bone proportionally to the amount of cadmium administered. No significant change was recognized in serum calcium, phosphorus and alkaline phosphatase levels after 180 days. Though cadmium 200 ppm treated rats showed slight histological lesions in the proximal convoluted tubules of the kidney, there appeared to be no osteomalacia including excess formation of osteoid tissue.

  16. Different transport mechanisms for cadmium and mercury in Caco-2 cells: inhibition of Cd uptake by Hg without evidence for reciprocal effects

    International Nuclear Information System (INIS)

    Aduayom, Ismaeel; Campbell, Peter G.C.; Denizeau, Francine; Jumarie, Catherine

    2003-01-01

    Cadmium/Hg interactions have been studied in the TC7 clone of the enterocytic-like Caco-2 cells to test the hypothesis that these metals may compete for intestinal transport. Comparison of the kinetic parameter values for 203 Hg(II) and 109 Cd(II) uptake in a serum-free medium revealed that Hg is accumulated much more rapidly and to higher concentrations. The very rapid uptake/binding step and the initial uptake rate of 109 Cd were both significantly inhibited by an excess of unlabeled Cd or Hg (apparent K i for Hg of 9.3 ± 1.2 μM) without reciprocal effects. 109 Cadmium uptake was highly sensitive to temperature and a significant fraction of accumulation (12%) was EDTA extractable. 203 Hg uptake remained insensitive to temperature or the EDTA washing procedure. However, the uptake of both tracers was half-decreased when an excess of the respective unlabeled metal was added in the stop solution, suggesting an exchange mechanism for adsorption. Cell pretreatment with N-ethylmaleimide (NEM) led to a 30% decrease or a 73% increase in the 3-min specific transport of 109 Cd when NEM was still present in or removed from the uptake medium, respectively. NEM had no effect on 203 Hg uptake. Overall our results suggest the involvement of a saturable specific mechanism for Cd, which is highly sensitive to inhibition by Hg and NEM under some conditions, and a nonspecific passive diffusion for Hg. The Hg- or NEM-induced inhibition of Cd uptake likely involves a thiol-mediated reaction, but our results suggest that NEM pretreatment may activate other cellular mechanisms leading to a stimulatory effect

  17. High expression of CD109 antigen regulates the phenotype of cancer stem-like cells/cancer-initiating cells in the novel epithelioid sarcoma cell line ESX and is related to poor prognosis of soft tissue sarcoma.

    Directory of Open Access Journals (Sweden)

    Makoto Emori

    Full Text Available Epithelioid sarcoma (ES is a relatively rare, highly malignant soft tissue sarcoma. The mainstay of treatment is resection or amputation. Currently other therapeutic options available for this disease are limited. Therefore, a novel therapeutic option needs to be developed. In the present study, we established a new human ES cell line (ESX and analyzed the characteristics of its cancer stem-like cells/cancer-initiating cells (CSCs/CICs based on ALDH1 activity. We demonstrated that a subpopulation of ESX cells with high ALDH1 activity (ALDH(high cells correlated with enhanced clonogenic ability, sphere-formation ability, and invasiveness in vitro and showed higher tumorigenicity in vivo. Next, using gene expression profiling, we identified CD109, a GPI-anchored protein upregulated in the ALDH(high cells. CD109 mRNA was highly expressed in various sarcoma cell lines, but weakly expressed in normal adult tissues. CD109-positive cells in ESX predominantly formed spheres in culture, whereas siCD109 reduced ALDH1 expression and inhibited the cell proliferation in vitro. Subsequently, we evaluated the expression of CD109 protein in 80 clinical specimens of soft tissue sarcoma. We found a strong correlation between CD109 protein expression and the prognosis (P = 0.009. In conclusion, CD109 might be a CSC/CIC marker in epithelioid sarcoma. Moreover, CD109 is a promising prognostic biomarker and a molecular target of cancer therapy for sarcomas including ES.

  18. Long non-coding RNAs as novel expression signatures modulate DNA damage and repair in cadmium toxicology

    Science.gov (United States)

    Zhou, Zhiheng; Liu, Haibai; Wang, Caixia; Lu, Qian; Huang, Qinhai; Zheng, Chanjiao; Lei, Yixiong

    2015-10-01

    Increasing evidence suggests that long non-coding RNAs (lncRNAs) are involved in a variety of physiological and pathophysiological processes. Our study was to investigate whether lncRNAs as novel expression signatures are able to modulate DNA damage and repair in cadmium(Cd) toxicity. There were aberrant expression profiles of lncRNAs in 35th Cd-induced cells as compared to untreated 16HBE cells. siRNA-mediated knockdown of ENST00000414355 inhibited the growth of DNA-damaged cells and decreased the expressions of DNA-damage related genes (ATM, ATR and ATRIP), while increased the expressions of DNA-repair related genes (DDB1, DDB2, OGG1, ERCC1, MSH2, RAD50, XRCC1 and BARD1). Cadmium increased ENST00000414355 expression in the lung of Cd-exposed rats in a dose-dependent manner. A significant positive correlation was observed between blood ENST00000414355 expression and urinary/blood Cd concentrations, and there were significant correlations of lncRNA-ENST00000414355 expression with the expressions of target genes in the lung of Cd-exposed rats and the blood of Cd exposed workers. These results indicate that some lncRNAs are aberrantly expressed in Cd-treated 16HBE cells. lncRNA-ENST00000414355 may serve as a signature for DNA damage and repair related to the epigenetic mechanisms underlying the cadmium toxicity and become a novel biomarker of cadmium toxicity.

  19. Levels of arsenic, cadmium, lead and mercury in the branchial plate and muscle tissue of mobulid rays

    International Nuclear Information System (INIS)

    Ooi, Michelle S.M.; Townsend, Kathy A.; Bennett, Michael B.; Richardson, Anthony J.; Fernando, Daniel; Villa, Cesar A.; Gaus, Caroline

    2015-01-01

    Highlights: • Branchial plate and muscle tissue from mobulid rays were analysed for certain metals. • Mean concentrations of cadmium in Mobula japanica were above the EC ML. • Mean inorganic arsenic concentration in Mobula japanica muscle equalled the FSANZ ML. • Mean concentration of lead in Manta alfredi muscle tissue exceeded EC and Codex MLs. • There were significant correlations between the types of tissues for some metals. - Abstract: Mobulid rays are targeted in fisheries for their branchial plates, for use in Chinese medicine. Branchial plate and muscle tissue from Mobula japanica were collected from fish markets in Sri Lanka, and muscle tissue biopsies from Manta alfredi in Australia. These were analysed for arsenic, cadmium, lead and mercury and compared to maximum levels (MLs) set by Food Standards Australia and New Zealand (FSANZ), European Commission (EC) and Codex Alimentarius Commission. The estimated intake for a vulnerable human age group was compared to minimal risk levels set by the Agency for Toxic Substances and Disease Registry. The mean inorganic arsenic concentration in M. japanica muscle was equivalent to the FSANZ ML while cadmium exceeded the EC ML. The mean concentration of lead in M. alfredi muscle tissue exceeded EC and Codex MLs. There were significant positive linear correlations between branchial plate and muscle tissue concentrations for arsenic, cadmium and lead

  20. Cadmium purification with a vibrating reactor

    International Nuclear Information System (INIS)

    Torres, N.; Esna-Ashari, M.; Biallas, H.; Kangas, K.

    1986-01-01

    While electrolytically producing zinc from sulfide concentrates, purification is the most significant step. Impurities such as Co, Sn, Ge, Ni and Sb can cause extensive redissolution of the electrodeposited zinc, thus diminishing current efficiency. Other metals, particularly cadmium, lead and copper, can negatively affect zinc properties by deposition on the cathode. It is standard practice to use atomized zinc dust as a reducing agent in the purification process, either alone or combined with additives. In conventional operations, special facilities are necessary to produce zinc dust in an amount close to 8wt% of cathode production. This paper examines a technique which makes use of zinc granules instead of dust

  1. Electromechanical properties of polycrystalline cadmium pyroniobate

    International Nuclear Information System (INIS)

    Isupov, V.A.; Tarasova, G.I.

    1983-01-01

    Temperature dependences of electromechanical properties (piezoelectric modulus, elastic pliability, mechanical high quality and dielectric permittivity) as well as thermal expansion of polycristalline samples of Cd 2 Nb 2 O 7 cadmium pyroniobate are investigated. On curves obtained a considerable number of maxima is observed which when electric field applied to samples shiff, αin in strength or weaken, appear or disappear. A part of these maxima undoubtedly is related to phase transitions. Some of them are manifested probably only when the electric field of sufficient value is applied. A part of maxima possibly is related to domain-relaxation processes

  2. Valence electron momentum distributions in cadmium

    International Nuclear Information System (INIS)

    Frost, L.; Weigold, E.; Mitroy, J.

    1982-08-01

    The valence 5s and 4d electron momentum distributions in cadmium have been measured using noncoplanar symmetric (e, 2e) electron coincidence spectroscopy at a total energy of 1200eV. They are in close agreement with Hartree-Fock momentum distributions both in shape and relative magnitudes. Some satellite lines of very low intensity have been detected. A CI calculation of the Cd ground state and several Cd + ion states has been carried out to predict cross reactions for the ground state and various satellite transitions. The predictions are in agreement with the data

  3. Ethanol dehydration on doped cadmium oxide

    International Nuclear Information System (INIS)

    Abd El-Salaam, K.M.

    1975-01-01

    The vapour phase catalytic dehydration of ethanol over Fe impregnated cadmium oxide was investigated between 200-450 0 C in atmospheric pressure. Electron transfer mechanisms involved in adsorption and catalytic dehydration reaction were investigated. The change in electrical conductivity of the catalyst resulting from calcination, adsorption and surface reaction processes were studied. Adsorption conductivity at low temperature ( 0 C) indicates that ethanol adsorbs as an electron donor. A mechanism of creation of interstitial Cd atoms responsible for the catalytic dehydration of ethanol on the catalyst surface was suggested. (orig.) [de

  4. Fast-neutron scattering from elemental cadmium

    International Nuclear Information System (INIS)

    Smith, A.B.; Guenther, P.T.

    1982-07-01

    Neutron differential-elastic-scattering cross sections of elemental cadmium are measured from approx. = 1.5 to 4.0 MeV at incident-neutron energy intervals of 50 to 200 keV and at 10 to 20 scattering angles distributed between approx. = 20 and 160 degrees. Concurrently, lumped-level neutron inelastic-excitation cross sections are measured. The experimental results are used to deduce parameters of an optical-statistical model that is descriptive of the observables and are compared with corresponding quantities given in ENDF/B-V

  5. Cadmium induced changes in cell organelles: An ultrastructural study using cadmium sensitive and resistant muntjac fibroblast cell lines

    Energy Technology Data Exchange (ETDEWEB)

    Ord, M.J.; Chibber, R.; Bouffler, S.D.

    1988-09-01

    A detailed electron microscopy study of cadmium sensitive and resistant muntjac fibroblast cell lines has identified a wide range of intracellular damage following exposure to cadmium. Damaged organelles included cell membrane, mitochondria, Golgi cisternae and tubular network, chromatin, nucleoli, microfilaments and ribosomes. Although cell membrane damage was generally the earliest indication of adverse cadmium action, particularly with continuous cadmium exposures, cells could tolerate extensive membrane loss. Mitochondrial distortion and some damage to Golgi was also tolerated. The turning point at which cadmium became lethal was generally marked by a cascade of events which included damage to both nuclear and cytoplasmic components. These results for fibroblasts are discussed and compared with damage reported in other types of cells.

  6. Impact of cadmium, cobalt and nickel on sequence-specific DNA binding of p63 and p73 in vitro and in cells

    International Nuclear Information System (INIS)

    Adámik, Matej; Bažantová, Pavla; Navrátilová, Lucie; Polášková, Alena; Pečinka, Petr; Holaňová, Lucie; Tichý, Vlastimil; Brázdová, Marie

    2015-01-01

    Highlights: • DNA binding of p53 family core domains is inhibited by cadmium, cobalt and nickel. • Binding to DNA protects p53 family core domains from metal induced inhibition. • Cadmium, cobalt and nickel induced inhibition was reverted by EDTA in vitro. - Abstract: Site-specific DNA recognition and binding activity belong to common attributes of all three members of tumor suppressor p53 family proteins: p53, p63 and p73. It was previously shown that heavy metals can affect p53 conformation, sequence-specific binding and suppress p53 response to DNA damage. Here we report for the first time that cadmium, nickel and cobalt, which have already been shown to disturb various DNA repair mechanisms, can also influence p63 and p73 sequence-specific DNA binding activity and transactivation of p53 family target genes. Based on results of electrophoretic mobility shift assay and luciferase reporter assay, we conclude that cadmium inhibits sequence-specific binding of all three core domains to p53 consensus sequences and abolishes transactivation of several promoters (e.g. BAX and MDM2) by 50 μM concentrations. In the presence of specific DNA, all p53 family core domains were partially protected against loss of DNA binding activity due to cadmium treatment. Effective cadmium concentration to abolish DNA–protein interactions was about two times higher for p63 and p73 proteins than for p53. Furthermore, we detected partial reversibility of cadmium inhibition for all p53 family members by EDTA. DTT was able to reverse cadmium inhibition only for p53 and p73. Nickel and cobalt abolished DNA–p53 interaction at sub-millimolar concentrations while inhibition of p63 and p73 DNA binding was observed at millimolar concentrations. In summary, cadmium strongly inhibits p53, p63 and p73 DNA binding in vitro and in cells in comparison to nickel and cobalt. The role of cadmium inhibition of p53 tumor suppressor family in carcinogenesis is discussed

  7. Impact of cadmium, cobalt and nickel on sequence-specific DNA binding of p63 and p73 in vitro and in cells

    Energy Technology Data Exchange (ETDEWEB)

    Adámik, Matej [Institute of Biophysics, Academy of Science of the Czech Republic, v.v.i., Královopolská 135, 612 65 Brno (Czech Republic); Bažantová, Pavla [Institute of Biophysics, Academy of Science of the Czech Republic, v.v.i., Královopolská 135, 612 65 Brno (Czech Republic); Department of Biology and Ecology, Faculty of Science, University of Ostrava, Chittussiho 10, 701 03 Ostrava (Czech Republic); Navrátilová, Lucie; Polášková, Alena [Institute of Biophysics, Academy of Science of the Czech Republic, v.v.i., Královopolská 135, 612 65 Brno (Czech Republic); Pečinka, Petr [Institute of Biophysics, Academy of Science of the Czech Republic, v.v.i., Královopolská 135, 612 65 Brno (Czech Republic); Department of Biology and Ecology, Faculty of Science, University of Ostrava, Chittussiho 10, 701 03 Ostrava (Czech Republic); Holaňová, Lucie [Department of Chemical Drugs, Faculty of Pharmacy, University of Veterinary and Pharmaceutical Sciences, Palackého 1/3, 61242 Brno (Czech Republic); Tichý, Vlastimil [Institute of Biophysics, Academy of Science of the Czech Republic, v.v.i., Královopolská 135, 612 65 Brno (Czech Republic); Brázdová, Marie, E-mail: maruska@ibp.cz [Institute of Biophysics, Academy of Science of the Czech Republic, v.v.i., Královopolská 135, 612 65 Brno (Czech Republic); Department of Chemical Drugs, Faculty of Pharmacy, University of Veterinary and Pharmaceutical Sciences, Palackého 1/3, 61242 Brno (Czech Republic)

    2015-01-02

    Highlights: • DNA binding of p53 family core domains is inhibited by cadmium, cobalt and nickel. • Binding to DNA protects p53 family core domains from metal induced inhibition. • Cadmium, cobalt and nickel induced inhibition was reverted by EDTA in vitro. - Abstract: Site-specific DNA recognition and binding activity belong to common attributes of all three members of tumor suppressor p53 family proteins: p53, p63 and p73. It was previously shown that heavy metals can affect p53 conformation, sequence-specific binding and suppress p53 response to DNA damage. Here we report for the first time that cadmium, nickel and cobalt, which have already been shown to disturb various DNA repair mechanisms, can also influence p63 and p73 sequence-specific DNA binding activity and transactivation of p53 family target genes. Based on results of electrophoretic mobility shift assay and luciferase reporter assay, we conclude that cadmium inhibits sequence-specific binding of all three core domains to p53 consensus sequences and abolishes transactivation of several promoters (e.g. BAX and MDM2) by 50 μM concentrations. In the presence of specific DNA, all p53 family core domains were partially protected against loss of DNA binding activity due to cadmium treatment. Effective cadmium concentration to abolish DNA–protein interactions was about two times higher for p63 and p73 proteins than for p53. Furthermore, we detected partial reversibility of cadmium inhibition for all p53 family members by EDTA. DTT was able to reverse cadmium inhibition only for p53 and p73. Nickel and cobalt abolished DNA–p53 interaction at sub-millimolar concentrations while inhibition of p63 and p73 DNA binding was observed at millimolar concentrations. In summary, cadmium strongly inhibits p53, p63 and p73 DNA binding in vitro and in cells in comparison to nickel and cobalt. The role of cadmium inhibition of p53 tumor suppressor family in carcinogenesis is discussed.

  8. 41 CFR 109-27.5008 - Control of drug substances and potable alcohol.

    Science.gov (United States)

    2010-07-01

    ..., and Guidelines § 109-27.5008 Control of drug substances and potable alcohol. Effective procedures and... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Control of drug substances and potable alcohol. 109-27.5008 Section 109-27.5008 Public Contracts and Property Management...

  9. 30 CFR 250.109 - What documents must I prepare and maintain related to welding?

    Science.gov (United States)

    2010-07-01

    ... related to welding? 250.109 Section 250.109 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF... Performance Standards § 250.109 What documents must I prepare and maintain related to welding? (a) You must submit a Welding Plan to the District Manager before you begin drilling or production activities on a...

  10. 41 CFR 109-38.801 - Obtaining SF 149, U.S. Government National Credit Card.

    Science.gov (United States)

    2010-07-01

    .... Government National Credit Card. 109-38.801 Section 109-38.801 Public Contracts and Property Management..., U.S. Government National Credit Card § 109-38.801 Obtaining SF 149, U.S. Government National Credit Card. DOE offices electing to use national credit cards shall request the assignment of billing address...

  11. 5 CFR 3101.109 - Additional rules for Office of Thrift Supervision employees.

    Science.gov (United States)

    2010-01-01

    ... any disagreement with the issuer that may cast doubt on the covered OTS employee's ability to remain... Supervision employees. 3101.109 Section 3101.109 Administrative Personnel DEPARTMENT OF THE TREASURY SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE DEPARTMENT OF THE TREASURY § 3101.109 Additional...

  12. 33 CFR 100.109 - Winter Harbor Lobster Boat Race, Winter Harbor, ME.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Winter Harbor Lobster Boat Race, Winter Harbor, ME. 100.109 Section 100.109 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY REGATTAS AND MARINE PARADES SAFETY OF LIFE ON NAVIGABLE WATERS § 100.109 Winter Harbor...

  13. 41 CFR 109-40.103-2 - Disqualification and suspension of carriers.

    Science.gov (United States)

    2010-07-01

    ... suspension of carriers. 109-40.103-2 Section 109-40.103-2 Public Contracts and Property Management Federal... AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 40-TRANSPORTATION AND TRAFFIC MANAGEMENT 40.1-General Provision § 109-40.103-2 Disqualification and suspension of carriers. Disqualification and suspension are...

  14. 41 CFR 109-40.305-50 - Negotiations involving national security.

    Science.gov (United States)

    2010-07-01

    ... national security. 109-40.305-50 Section 109-40.305-50 Public Contracts and Property Management Federal... Management § 109-40.305-50 Negotiations involving national security. Title 49 U.S.C., section 10721(b)(2... rate established * * * for transportation provided to the U.S. Government would endanger the National...

  15. 48 CFR 1.109 - Statutory acquisition-related dollar thresholds-adjustment for inflation.

    Science.gov (United States)

    2010-10-01

    ...-related dollar thresholds-adjustment for inflation. 1.109 Section 1.109 Federal Acquisition Regulations..., Issuance 1.109 Statutory acquisition-related dollar thresholds—adjustment for inflation. (a) 41 U.S.C. 431a... the FAR for inflation, except as provided in paragraph (c) of this section. This adjustment is...

  16. 41 CFR 109-38.301-1.53 - Responsibilities of motor vehicle operators.

    Science.gov (United States)

    2010-07-01

    ... motor vehicle operators. 109-38.301-1.53 Section 109-38.301-1.53 Public Contracts and Property... MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.3-Official Use of Government Motor Vehicles § 109-38.301-1.53 Responsibilities of motor vehicle operators...

  17. 41 CFR 109-38.204-50 - Records of exempted motor vehicles.

    Science.gov (United States)

    2010-07-01

    ... motor vehicles. 109-38.204-50 Section 109-38.204-50 Public Contracts and Property Management Federal... AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.2-Registration, Identification, and Exemptions § 109-38.204-50 Records of exempted motor vehicles. The Director, Office of...

  18. 23 CFR 420.109 - What are the requirements for distribution of metropolitan planning funds?

    Science.gov (United States)

    2010-04-01

    ... and Research Funds § 420.109 What are the requirements for distribution of metropolitan planning funds... 23 Highways 1 2010-04-01 2010-04-01 false What are the requirements for distribution of metropolitan planning funds? 420.109 Section 420.109 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF...

  19. 41 CFR 109-45.1003 - Recovery of silver from precious metals bearing materials.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Recovery of silver from precious metals bearing materials. 109-45.1003 Section 109-45.1003 Public Contracts and Property Management... of Precious Metals § 109-45.1003 Recovery of silver from precious metals bearing materials. The...

  20. Study on damage of DNA in mice induced by mercury cadmium and/or lead

    International Nuclear Information System (INIS)

    Hu Xiaopan; Zhou Jianhua; Shi Xijing; Yan Liping

    2004-01-01

    Objective: To explore the joint injury actions of mercury, cadmium and/or lead on DNA in peripheral blood lymphocytes of mice. Methods: The blood specimens were obtained from mice at the 2 day after the peritoneal injections. DNA damages were determined by single cell gel electrophoresis (SCGE) and 3 H-TdR incorporation. Results: Acquired by SCGE technique, tail movement of DNA in mercury-cadmium-lead group was significantly greater than that in the single exposure group, the difference was significant too between mercury-cadmium group and cadmium group, cadmium-lead group and cadmium group. The results of 3 H-TdR incorporation showed: the values of DPM in mercury-cadmium group and cadmium-lead group were lower than that in the single exposure group and the value of DPM lowered more significantly after exposure to mercury-cadmium-lead. Conclusion: The combined effects of mercury, cadmium, lead on DNA damage are more significant. (author)

  1. Effects of diethyldithiocarbamate on the toxicokinetics of cadmium chloride in mice

    DEFF Research Database (Denmark)

    Andersen, O; Nielsen, J B

    1989-01-01

    Diethyldithiocarbamate (DDC) efficiently alleviates the acute toxicity of injected cadmium chloride, but enhances the acute toxicity of orally administered cadmium chloride. Further, DDC induces extensive changes in organ distribution of cadmium, and mobilizes aged cadmium depots. The present study...... investigates effects of DDC on the toxicokinetics of cadmium at lower doses of cadmium than those used in previous studies. During single exposure to subtoxic oral doses of cadmium chloride DDC enhanced intestinal cadmium absorption, both after intraperitoneal and oral administration of DDC. In such acute...... exposure experiments orally administered DDC only slightly changed the relative organ distribution of absorbed cadmium, while intraperitoneal administration of DDC induced extensive changes in organ preference of absorbed cadmium. The relative hepatic and testicular deposition was reduced, while...

  2. Direct examination of cadmium bonding in rat tissues dosed with mine wastes and cadmium-containing solutions

    International Nuclear Information System (INIS)

    Diacomanolis, V.; Ng, J. C.; Sadler, R.; Harris, H. H.; Nomura, M.; Noller, B. N.

    2010-01-01

    Direct examination by XANES and EXAFS of metal bonding in tissue can be demonstrated by examining cadmium uptake and bonding in animal tissue maintained at cryogenic temperatures. XANES at the K-edge of cadmium were collected at the Photon Factory Advanced Ring (PF-AR), NW10A beam line at KEK-Tsukuba-Japan. Rats fed with 1g mine waste containing 8-400 mg/kg cadmium per 200g body weight (b.w.) or dosed by oral gavage with either cadmium chloride solution alone (at 6 mg/kg b.w.) or in combination with other salts (As, Cu or Zn), 5 days/week for 6 weeks, had 0.1-7.5 and 8-86 mg/kg cadmium in the liver or kidney, respectively. Rats given intraperitoneally (ip) or intravenously (iv) 1-4 times with 1 mg/kg b.w. cadmium solution had 30-120 mg/kg cadmium in the liver or kidney. Tissues from rats were kept and transferred at cryogenic temperature and XANES were recorded at 20 K. The spectra for rat liver samples suggested conjugation of cadmium with glutathione or association with the sulfide bond (Cd-S) of proteins and peptides. EXAFS of rat liver fed by Cd and Zn solutions showed that Cd was clearly bound to S ligands with an inter-atomic distance of 2.54 A ring for Cd-S that was similar to cadmium sulfide with an inter-atomic distance of 2.52 A ring for Cd-S. Liver or kidney of rats fed with mine wastes did not give an edge in the XANES spectra indicating little uptake of cadmium by the animals. Longer and higher dosing regimen may be required in order to observe the same Cd-S bond in the rat tissue from mine wastes, including confirmation by EXAFS.

  3. Sources of cadmium exposure among healthy premenopausal women

    International Nuclear Information System (INIS)

    Adams, Scott V.; Newcomb, Polly A.; Shafer, Martin M.; Atkinson, Charlotte; Bowles, Erin J. Aiello; Newton, Katherine M.; Lampe, Johanna W.

    2011-01-01

    Background: Cadmium, a persistent and widespread environmental pollutant, has been associated with kidney function impairment and several diseases. Cigarettes are the dominant source of cadmium exposure among smokers; the primary source of cadmium in non-smokers is food. We investigated sources of cadmium exposure in a sample of healthy women. Methods: In a cross-sectional study, 191 premenopausal women completed a health questionnaire and a food frequency questionnaire. The cadmium content of spot urine samples was measured with inductively-coupled plasma mass spectrometry and normalized to urine creatinine content. Multivariable linear regression was used to estimate the strength of association between smoking habits and, among non-smokers, usual foods consumed and urinary cadmium, adjusted for age, race, multivitamin and supplement use, education, estimated total energy intake, and parity. Results: Geometric mean urine creatinine-normalized cadmium concentration (uCd) of women with any history of cigarette smoking was 0.43 μg/g (95% confidence interval (CI): 0.38-0.48 μg/g) and 0.30 μg/g (0.27-0.33 μg/g) among never-smokers, and increased with pack-years of smoking. Analysis of dietary data among women with no reported history of smoking suggested that regular consumption of eggs, hot cereals, organ meats, tofu, vegetable soups, leafy greens, green salad, and yams was associated with uCd. Consumption of tofu products showed the most robust association with uCd; each weekly serving of tofu was associated with a 22% (95% CI: 11-33%) increase in uCd. Thus, uCd was estimated to be 0.11 μg/g (95% CI: 0.06-0.15 μg/g) higher among women who consumed any tofu than among those who consumed none. Conclusions: Cigarette smoking is likely the most important source of cadmium exposure among smokers. Among non-smokers, consumption of specific foods, notably tofu, is associated with increased urine cadmium concentration. - Research highlights: →Urine cadmium, usual

  4. Sources of cadmium exposure among healthy premenopausal women

    Energy Technology Data Exchange (ETDEWEB)

    Adams, Scott V., E-mail: sadams@fhcrc.org [Fred Hutchinson Cancer Research Center, PO Box 19024, M4-B402, Seattle, WA 98109 (United States); Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States); Newcomb, Polly A. [Fred Hutchinson Cancer Research Center, PO Box 19024, M4-B402, Seattle, WA 98109 (United States); Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States); Shafer, Martin M. [Environmental Chemistry and Technology Program, University of Wisconsin and Wisconsin State Laboratory of Hygiene, Madison, WI (United States); Atkinson, Charlotte [Department of Oral and Dental Science, Bristol Dental School, Bristol (United Kingdom); Bowles, Erin J. Aiello [Group Health Research Institute, Seattle, WA (United States); Newton, Katherine M. [Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States); Group Health Research Institute, Seattle, WA (United States); Lampe, Johanna W. [Fred Hutchinson Cancer Research Center, PO Box 19024, M4-B402, Seattle, WA 98109 (United States); Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States)

    2011-04-01

    Background: Cadmium, a persistent and widespread environmental pollutant, has been associated with kidney function impairment and several diseases. Cigarettes are the dominant source of cadmium exposure among smokers; the primary source of cadmium in non-smokers is food. We investigated sources of cadmium exposure in a sample of healthy women. Methods: In a cross-sectional study, 191 premenopausal women completed a health questionnaire and a food frequency questionnaire. The cadmium content of spot urine samples was measured with inductively-coupled plasma mass spectrometry and normalized to urine creatinine content. Multivariable linear regression was used to estimate the strength of association between smoking habits and, among non-smokers, usual foods consumed and urinary cadmium, adjusted for age, race, multivitamin and supplement use, education, estimated total energy intake, and parity. Results: Geometric mean urine creatinine-normalized cadmium concentration (uCd) of women with any history of cigarette smoking was 0.43 {mu}g/g (95% confidence interval (CI): 0.38-0.48 {mu}g/g) and 0.30 {mu}g/g (0.27-0.33 {mu}g/g) among never-smokers, and increased with pack-years of smoking. Analysis of dietary data among women with no reported history of smoking suggested that regular consumption of eggs, hot cereals, organ meats, tofu, vegetable soups, leafy greens, green salad, and yams was associated with uCd. Consumption of tofu products showed the most robust association with uCd; each weekly serving of tofu was associated with a 22% (95% CI: 11-33%) increase in uCd. Thus, uCd was estimated to be 0.11 {mu}g/g (95% CI: 0.06-0.15 {mu}g/g) higher among women who consumed any tofu than among those who consumed none. Conclusions: Cigarette smoking is likely the most important source of cadmium exposure among smokers. Among non-smokers, consumption of specific foods, notably tofu, is associated with increased urine cadmium concentration. - Research highlights: {yields

  5. New compositions of cadmium selenium nanoparticles and dye molecules with cyclodextrin inclusion complexes

    International Nuclear Information System (INIS)

    Asimov, M.M.; Anufrik, S.S.; Tarkovsky, V.V.; Sazonko, H.H.

    2013-01-01

    Spectroscopic properties of new heterogeneous multicolor compositions based on cadmium selenium (CdSe/ZnS) nano crystal and inclusion complexes of dye molecule with cyclodextrin are presented. Spectral fluorescence of proposed compositions investigated in thin films. Signals from multicolor fluorescence of proposing compositions may be combined to definite spectral codes that could be used for tracking or verification of different objects. Calibration bar of signal within spectral codes guarantee high reliability in practical application of proposed multicolor compositions. Express analysis the size of nanoparticles during their synthesis and purification by spectroscopic methods is suggested. Application of Cyclodextrin molecules as target delivery systems is considered. (authors)

  6. Cadmium, follicle-stimulating hormone, and effects on bone in women age 42-60 years, NHANES III

    Energy Technology Data Exchange (ETDEWEB)

    Gallagher, Carolyn M., E-mail: 2crgallagher@optonline.net [PhD Program in Population Health and Clinical Outcomes Research, Stony Brook University, Health Sciences Center L3-R071, Stony Brook, New York 11794-8338 (United States); Department of Preventive Medicine, Stony Brook University Medical Center, Stony Brook, New York (United States); Moonga, Baljit S. [Stony Brook University School of Dental Medicine, New York (United States); Kovach, John S. [Department of Preventive Medicine, Stony Brook University Medical Center, Stony Brook, New York (United States)

    2010-01-15

    Background: Increased body burden of environmental cadmium has been associated with greater risk of decreased bone mineral density (BMD) and osteoporosis in middle-aged and older women, and an inverse relationship has been reported between follicle-stimulating hormone (FSH) and BMD in middle-aged women; however, the relationships between cadmium and FSH are uncertain, and the associations of each with bone loss have not been analyzed in a single population. Objectives: The objective of this study was to evaluate the associations between creatinine-adjusted urinary cadmium (UCd) and FSH levels, and the associations between UCd and FSH with BMD and osteoporosis, in postmenopausal and perimenopausal women aged 42-60 years. Methods: Data were obtained from the Third National Health Examination and Nutrition Survey, 1988-1994 (NHANES III). Outcomes evaluated were serum FSH levels, femoral bone mineral density measured by dual energy X-ray absorptiometry, and osteoporosis indicated by femoral BMD cutoffs based on the international standard. Urinary cadmium levels were analyzed for association with these outcomes, and FSH levels analyzed for association with bone effects, using multiple regression. Subset analysis was conducted by a dichotomous measure of body mass index (BMI) to proxy higher and lower adipose-synthesized estrogen effects. Results: UCd was associated with increased serum FSH in perimenopausal women with high BMI (n=642; {beta}=0.45; p{<=}0.05; R{sup 2}=0.35) and low BMI (n=408; {beta}=0.61; p{<=}0.01; R{sup 2}=0.34). Among perimenopausal women with high BMI, BMD was inversely related to UCd ({beta}=-0.04; p{<=}0.05) and FSH ({beta}=-0.03; p{<=}0.05). In postmenopausal women with low BMI, an incremental increase in FSH was associated with 2.78 greater odds for osteoporosis (109 with and 706 without) (OR=2.78; 95% CI=1.43, 5.42; p{<=}0.01). Conclusion: Long-term cadmium exposure at environmental levels is associated with increased serum FSH, and both FSH

  7. Physiological response of Arundo donax to cadmium stress by Fourier transform infrared spectroscopy

    Science.gov (United States)

    Yu, Shunhui; Sheng, Li; Zhang, Chunyan; Deng, Hongping

    2018-06-01

    The present paper deals with the physiological response of the changes in chemical contents of the root, stem and leaf of Arundo donax seedlings stressed by excess cadmium using Fourier transform infrared spectroscopy technique, cadmium accumulation in plant by atomic absorption spectroscopy were tested after different concentrations cadmium stress. The results showed that low cadmium concentrations (spectroscopy technique for the non-invasive and rapid monitoring of the plants stressed with heavy metals, Arundo donax is suitable for phytoremediation of cadmium -contaminated wetland.

  8. Cadmium determination in Lentinus edodes mushroom species

    Directory of Open Access Journals (Sweden)

    Vera Akiko Maihara

    2012-09-01

    Full Text Available Many studies have drawn attention to the occurrence and concentration of toxic elements found in the fruiting body of mushrooms. Some edible mushroom species are known to accumulate high levels of inorganic contaminants, mainly cadmium, mercury, and lead. There are about 2,000 known edible mushroom species, but only 25 of them are cultivated and used as food. In Brazil, the most marketed and consumed mushroom species are Agaricus bisporus, known as Paris champignon, Lentinus edodes, or Shitake and Pleurotus sp, also called Shimeji or Hiratake. In this study, the concentration of cadmium was determined in Lentinus edodes mushrooms from different cities in São Paulo state and some samples imported from Japan and China. The analyses were performed by graphite furnace atomic absorption spectrometry after HNO3-H2O2 digestion. The results showed a lower concentration of Cd in the mushrooms cultivated in São Paulo (0.0079 to 0.023 mg.kg-1 in natura than that of the mushrooms cultivated abroad (0.125 to 0.212 mg.kg-1 in natura. Although there is no tolerance limit for Cd in mushrooms in Brazil, the results show that Lentinus edodes mushrooms can be safely consumed.

  9. Biliary excretion of cadmium in rat. III. Effects of chelating agents and change in intracellular thiol content on billiary transport and tissue distribution of cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Cherian, M.G.

    1980-03-01

    The effects of changes in sulfur-containing intracellular ligands on biliary excretion of cadmium were studied in rats. Injection of zinc or copper salts 24 h before intravenous injection of /sup 109/CdCl/sub 2/ (1 mg/kg Cd) decreased biliary excretion of Cd. Pretreatment with cysteine (25 mg/kg) had a similar effect. Depletion of intracellular thiol by injection of diethylmaleate had little effect. The effect of chelating agents on the pharmacokinetics of Cd depended on time of administration of the agents after exposure to Cd. When chelating agents were administered 1/2 h after Cd injection (before the synthesis of metallothionein), the thiol-containing agents (2,3-dimercapto-1-propanol (BAL), DL-penicillamine, N-acetylpenicillamine, and dithioerythritol increased the biliary excretion of Cd, while the carboxyl-containing ones (EDTA and nitrilotriacetate) increased the urinary excretion of Cd. BAL was the most effective chelating agent, but there was also an increase in the renal concentration of Cd. However, when these chelating agents were administered 24 h after Cd injection (after the synthesis of metallothionein), only BAL increased the biliary excretion of Cd. Renal and hepatic Cd concentrations decreased concurrently after BAL treatment.

  10. Mobility, bioavailability, and toxic effects of cadmium in soil samples

    International Nuclear Information System (INIS)

    Prokop, Z.; Cupr, P.; Zlevorova-Zlamalikova V.; Komarek, J.; Dusek, L.; Holoubek, I.

    2003-01-01

    Total concentration is not a reliable indicator of metal mobility or bioavailability in soils. The physicochemical form determines the behavior of metals in soils and hence the toxicity toward terrestrial biota. The main objectives of this study were the application and comparison of three approaches for the evaluation of cadmium behavior in soil samples. The mobility and bioavailability of cadmium in five selected soil samples were evaluated using equilibrium speciation (Windermere humic aqueous mode (WHAM)), extraction procedures (Milli-Q water, DMSO, and DTPA), and a number of bioassays (Microtox, growth inhibition test, contact toxicity test, and respiration). The mobility, represented by the water-extractable fraction corresponded well with the amount of cadmium in the soil solution, calculate using the WHAM (r 2 =0.96, P<0.001). The results of the ecotoxicologica evaluation, which represent the bioavailable fraction of cadmium, correlated well with DTPA extractability and also with the concentration of free cadmium ion, which is recognized as the most bioavailable metal form. The results of the WHAM as well as the results of extraction experiments showed a strong binding of cadmium to organic matter and a weak sorption of cadmium to clay minerals

  11. Bacterial bioremediation of aquatic cadmium 11 of area of Pakistan

    International Nuclear Information System (INIS)

    Mahmood, T.; Malik, S. A.; Javed, M.; Qamar, I.

    2005-01-01

    Cadmium Cd/sup +2/ pollution arises mainly from contamination of minerals used in agriculture and from industrial process. The usual situation is of large volume of soil and H/sub 2/O that are contaminated with low but significant concentration of Cd/sup +2/. Cadmium is one of the most dangerous heavy metal both to human health and aquatic ecosystem. Microorganisms have developed different strategies to regulate uptake and to detoxify heavy metals viz; by different mechanisms i.e. by adsorption to cell surface, by intercellular accumulation, precipitation, biosynthesis of metallothioneins to volatile compounds. Microcosm experiments in chemostat incubated at 20 deg. C showed that Cadmium Contamination does not greatly affect bacterial communities in cultures contaminated with up to 1mg CdI/sup -1/. acterial productivity remains unchanged and Cadmium- resistant strains arise quickly and in great number. The cadmium accumulation by bacteria depend on the bacterial productivity. The free bacteria can accumulate up to 1200 ppm Cadmium Where as the adhering bacteria concentrate up to 6100 ppm. At a steady state, 11-29% Cadmium is removed from the water phase of cultures. This paper includes Cd (II) removal by Bacteria from waste water of Wah Cantonment Pakistan. (author)

  12. Gravimetric determination of cadmium with o-phenanthroline and iodide

    International Nuclear Information System (INIS)

    Yoshida, Hitoshi; Mizuno, Kazunori; Taga, Mitsuhiko; Hikime, Seiichiro

    1976-01-01

    Cadmium forms insoluble mixed ligand complex with o-phenanthroline and iodide ions. By using the complex a new gravimetric method for the determination of cadmium was investigated. The recommended analytical procedure is as follows: Adjust pH value of a solution containing 5 to 45 mg cadmium to 4 with 3 M acetic acid-sodium acetate buffer solution. Add over threefold moles of potassium iodide to the solution and heat to just before boiling. To the solution add 0.1% ascorbic acid solution and then 0.1 M o-phenanthroline solution drop by drop in excess with stirring, and cool the mixture to room temperature. Filter the precipitates and wash first with 0.01% potassium iodide solution and then with water. Dry the precipitates at 110 0 C for two hours and weigh as Cd(o-phen) 2 I 2 (I). The gravimetric factor of the complex for cadmium is 0.1547. Chemical composition of the precipitate is variable when o-phenanthroline is added less than twofold moles to cadmium. Adding the o-phenanthroline solution 2.4-fold moles against cadmium, the ternary complex (I) precipitates quantitatively. Though a large excess of iodide ion in the solution contaminated the precipitate, the contamination was avoided when precipitation was carryed out at high temperature and in the presence of ascorbic acid. By the presented procedure 5 to 45 mg of cadmium are determined with a standard deviation of 0 C. (JPN)

  13. Blood cadmium concentration and lipid profile in Korean adults

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kisok [Department of Public Health, Keimyung University, 1000 Shindang-dong, Daegu 704-701 (Korea, Republic of)

    2012-01-15

    Although animal experiments have shown that cadmium exposure induces alterations in lipid profiles, no epidemiological study of this relationship has been performed. The objective of this study was to evaluate the association between blood cadmium concentration and blood lipid levels in Korean adults. A cross-sectional study comprising participants (n=3903) aged 20 years or older from the 2005, 2008, and 2009 Korea National Health and Nutrition Examination Surveys was conducted. Demographic characteristics and dietary intake were obtained from the participants by questionnaire, and cadmium and lipid levels were determined by analysis of blood samples. After adjusting for demographic and dietary factors, blood concentration of cadmium was positively associated with the risk of low high-density lipoprotein cholesterol (HDL-C) in a dose-dependent manner (p for trend <0.001). In addition, the odds ratios (ORs) of a high triglyceride to HDL-C ratio was significantly increased in the high blood cadmium groups [OR=1.36; 95% confidence interval (CI), 1.03-1.79 for fourth quintile and OR=1.41; 95% CI, 1.07-1.86 for fifth quintile] compared with the lowest quintile group. However, high blood cadmium was not associated with a risk of high total cholesterol, high low-density lipoprotein cholesterol, or high triglycerides. These data suggest that an increased cadmium body burden increases the risk of dyslipidemia, mainly due to the increased risk of low HDL-C and the high ratio of triglycerides to HDL-C.

  14. Cadmium, mercury, and lead in kidney cortex of living kidney donors: Impact of different exposure sources,

    Energy Technology Data Exchange (ETDEWEB)

    Barregard, Lars, E-mail: lars.barregard@amm.gu.se [Department of Occupational and Environmental Medicine, Sahlgrenska University Hospital and University of Gothenburg, P.O. Box 414, SE 405 30 Gothenburg (Sweden); Fabricius-Lagging, Elisabeth [Department of Nephrology, Sahlgrenska University Hospital and Boras Hospital (Sweden); Lundh, Thomas [Department of Occupational and Environmental Medicine, Lund University Hospital and Lund University (Sweden); Moelne, Johan [Department of Clinical Pathology, Sahlgrenska University Hospital and University of Gothenburg (Sweden); Wallin, Maria [Department of Occupational and Environmental Medicine, Sahlgrenska University Hospital and University of Gothenburg, P.O. Box 414, SE 405 30 Gothenburg (Sweden); Olausson, Michael [Department of Transplantation and Liver Surgery, Sahlgrenska University Hospital and University of Gothenburg (Sweden); Modigh, Cecilia; Sallsten, Gerd [Department of Occupational and Environmental Medicine, Sahlgrenska University Hospital and University of Gothenburg, P.O. Box 414, SE 405 30 Gothenburg (Sweden)

    2010-01-15

    Background: Most current knowledge on kidney concentrations of nephrotoxic metals like cadmium (Cd), mercury (Hg), or lead (Pb) comes from autopsy studies. Assessment of metal concentrations in kidney biopsies from living subjects can be combined with information about exposure sources like smoking, diet, and occupation supplied by the biopsied subjects themselves. Objectives: To determine kidney concentrations of Cd, Hg, and Pb in living kidney donors, and assess associations with common exposure sources and background factors. Methods: Metal concentrations were determined in 109 living kidney donors aged 24-70 years (median 51), using inductively coupled plasma-mass spectrometry (Cd and Pb) and cold vapor atomic fluorescence spectrometry (Hg). Smoking habits, occupation, dental amalgam, fish consumption, and iron stores were evaluated. Results: The median kidney concentrations were 12.9 {mu}g/g (wet weight) for cadmium, 0.21 {mu}g/g for mercury, and 0.08 {mu}g/g for lead. Kidney Cd increased by 3.9 {mu}g/g for a 10 year increase in age, and by 3.7 {mu}g/g for an extra 10 pack-years of smoking. Levels in non-smokers were similar to those found in the 1970s. Low iron stores (low serum ferritin) in women increased kidney Cd by 4.5 {mu}g/g. Kidney Hg increased by 6% for every additional amalgam surface, but was not associated with fish consumption. Lead was unaffected by the background factors surveyed. Conclusions: In Sweden, kidney Cd levels have decreased due to less smoking, while the impact of diet seems unchanged. Dental amalgam is the main determinant of kidney Hg. Kidney Pb levels are very low due to decreased exposure.

  15. Cadmium, mercury, and lead in kidney cortex of living kidney donors: Impact of different exposure sources,

    International Nuclear Information System (INIS)

    Barregard, Lars; Fabricius-Lagging, Elisabeth; Lundh, Thomas; Moelne, Johan; Wallin, Maria; Olausson, Michael; Modigh, Cecilia; Sallsten, Gerd

    2010-01-01

    Background: Most current knowledge on kidney concentrations of nephrotoxic metals like cadmium (Cd), mercury (Hg), or lead (Pb) comes from autopsy studies. Assessment of metal concentrations in kidney biopsies from living subjects can be combined with information about exposure sources like smoking, diet, and occupation supplied by the biopsied subjects themselves. Objectives: To determine kidney concentrations of Cd, Hg, and Pb in living kidney donors, and assess associations with common exposure sources and background factors. Methods: Metal concentrations were determined in 109 living kidney donors aged 24-70 years (median 51), using inductively coupled plasma-mass spectrometry (Cd and Pb) and cold vapor atomic fluorescence spectrometry (Hg). Smoking habits, occupation, dental amalgam, fish consumption, and iron stores were evaluated. Results: The median kidney concentrations were 12.9 μg/g (wet weight) for cadmium, 0.21 μg/g for mercury, and 0.08 μg/g for lead. Kidney Cd increased by 3.9 μg/g for a 10 year increase in age, and by 3.7 μg/g for an extra 10 pack-years of smoking. Levels in non-smokers were similar to those found in the 1970s. Low iron stores (low serum ferritin) in women increased kidney Cd by 4.5 μg/g. Kidney Hg increased by 6% for every additional amalgam surface, but was not associated with fish consumption. Lead was unaffected by the background factors surveyed. Conclusions: In Sweden, kidney Cd levels have decreased due to less smoking, while the impact of diet seems unchanged. Dental amalgam is the main determinant of kidney Hg. Kidney Pb levels are very low due to decreased exposure.

  16. Impairment induced by chronic occupational cadmium exposure during brazing process

    International Nuclear Information System (INIS)

    Anwar, S.M.; Aly, M.M.

    2002-01-01

    Cadmium (CD) is considered a metal of the 20 th century to which all inhabitants of develop societies are exposed. Long-term occupational and environmental exposure to CD often results in renal dysfunction as the kidney is considered the critical target organ. The aim of this work was to evalutate both resporatory and renal manifestations induced by occupational exposure to CD compounds during brazing process, and suggesting a protocol for prevention and control for CD- induced health effects. This study was conducted on 20 males occupationally exposed workers. They are divided into two groups: Group-1 included (10) exposed smokers and group-2 included (10) exposed non-smokers. Results of both groups were compared with those of 10 healthy age and sex matched non-smokers. All subjects were subjected to detailed history taking and laboratory investigations including blood and urinary CD, liver profile (SGOT, SGPT and alkline phosphates), kindey function tests (blood urea, creatinine and urinary beta 2 - microglobulin). The level of Cd in the atmosphere of the work plase air was also assessed to detect the degree of exposure as it was about 6 times greater than thesave level (1 mu /m 3 ). (1) This study demonstrated elevation levels of blood CD, urea, creatinine and urinary CD and beta 2 -microglobulin for both exposed worker groups than the controls. In additions no appreciable were noted for liver function tests, although the levels fell within normal range

  17. Dietary Cadmium Intake and Its Effects on Kidneys

    Directory of Open Access Journals (Sweden)

    Soisungwan Satarug

    2018-03-01

    Full Text Available Cadmium (Cd is a food-chain contaminant that has high rates of soil-to-plant transference. This phenomenon makes dietary Cd intake unavoidable. Although long-term Cd intake impacts many organ systems, the kidney has long been considered to be a critical target of its toxicity. This review addresses how measurements of Cd intake levels and its effects on kidneys have traditionally been made. These measurements underpin the derivation of our current toxicity threshold limit and tolerable intake levels for Cd. The metal transporters that mediate absorption of Cd in the gastrointestinal tract are summarized together with glomerular filtration of Cd and its sequestration by the kidneys. The contribution of age differences, gender, and smoking status to Cd accumulation in lungs, liver, and kidneys are highlighted. The basis for use of urinary Cd excretion to reflect body burden is discussed together with the use of urinary N-acetyl-β-d-glucosaminidase (NAG and β2-microglobulin (β2-MG levels to quantify its toxicity. The associations of Cd with the development of chronic kidney disease and hypertension, reduced weight gain, and zinc reabsorption are highlighted. In addition, the review addresses how urinary Cd threshold levels have been derived from human population data and their utility as a warning sign of impending kidney malfunction.

  18. Electrodialytic removal of cadmium from straw combustion fly ash

    DEFF Research Database (Denmark)

    Hansen, Henrik K.; Ottosen, Lisbeth M.; Villumsen, Arne

    2004-01-01

    Fly ash from straw combustion contains valuable nutrients when returned to agricultural soils. In many instances, however, this fly ash may contain heavy metals, such as cadmium, at levels which often exceed the limits given by the Danish legislation. Thus before utilizing the nutrients, cadmium...... must be removed from these ashes. The use of an electrodialytic remediation method to remove cadmium from fly ash arising from straw combustion and containing 11.2 mg Cd kg$+-1$/ DM (dry matter) was accessed. After 36 days of remediation at a constant current density of 5.6 mA cm$+-2$/ more than 97...

  19. Reactions of organic zinc- and cadmium elementoxides with ethylene oxide

    International Nuclear Information System (INIS)

    Dodonov, V.A.; Krasnov, Yu.N.

    1980-01-01

    Studied are reactions of triphenylmethoxy, -triphenylsiloxyethylzinc and -cadmium with ethylene oxide in ratio of 1:1. Reactions have been carried out in tolyene solutions in ampules sealed in argon atmosphere. It is found that interaction of triphenylsiloxy-, triphenylmethoxyethylcadmium and triphenylsiloxyethylzinc with ethylene oxide occurs at the metal-carbon bond with formation of implantation products. Triphenylmethoxyethylzinc reacts with ethylene oxide both at the metal-carbon and metal-oxygen bonds. Alkoxytriphenylsiloxyderivatives of zinc and cadmium are thermally instable and decompose under the conditions of reaction (130 deg C) with migration of phenyl group from silicon to zinc or cadmium, giving alkoxyphenylderivative and with bensene splitting out

  20. Determination of cadmium in aluminium by atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Batistoni, D.A.; Erlijman, L.H.

    1978-12-01

    A direct method for the determination of cadmium in elemental aluminium is described. Metal samples are dissolved in diluted hydrochloric acid and cadmium is determined by atomic absorption spectrometry in an air-acetylene flame. Interference by non-specific absorption observed at the analytical wavelength incorrected for by means of a non-absorbing line emitted by the hollow-cathode lamp. Relatively large amounts of arsenic do not interfere. The minimun determinable concentration of cadmium for this procedure is 2-3 ppm, expressed on aluminium basis. (author) [es

  1. Slow recombination centers in cadmium selenide monocrystalline films

    International Nuclear Information System (INIS)

    Smyntyna, V.A.

    1983-01-01

    As a result of annealing when concentration of selenium Vacancies decreases due to their diffusion towards the surface, show recombination K-centers begin to influence the photoelectric properties of monocrystalline cadmium selenide layers. Energy levels of K-centers are located by 0.23-0.25 eV over the valent zone ceiling. The nature of K-centers is determined by the presence in the cadmium selenide layer structure of intrisic defects-cadmium vacancies in contrast to r-centers of slow recombination which are bound with impurities in a semiconductor material

  2. Removal of cadmium and cyanide from aqueous solutions through electrodialysis

    Directory of Open Access Journals (Sweden)

    Marder Luciano

    2003-01-01

    Full Text Available The discharge of galvanic industry wastewaters containing heavy metals and cyanide is one of the largest sources of water pollution. The use of the electrodialysis technique for the treatment of a synthetic wastewater containing approximately 0.0089 mol L-1 cadmium and 0.081 mol L-1 cyanide was studied using a five-compartment electrodialysis cell. The results demonstrate that the removal of cadmium and cyanide depends on the applied current density and it is limited by the precipitation of cadmium on the cation-exchange membrane in the diluate central cell compartment.

  3. Heme oxygenase-1-mediated autophagy protects against pulmonary endothelial cell death and development of emphysema in cadmium-treated mice

    Science.gov (United States)

    Surolia, Ranu; Karki, Suman; Kim, Hyunki; Yu, Zhihong; Kulkarni, Tejaswini; Mirov, Sergey B.; Carter, A. Brent; Rowe, Steven M.; Matalon, Sadis; Thannickal, Victor J.; Agarwal, Anupam

    2015-01-01

    Pulmonary exposure to cadmium, a major component of cigarette smoke, has a dramatic impact on lung function and the development of emphysema. Cigarette smoke exposure induces heme oxygenase-1 (HO-1), a cytoprotective enzyme. In this study, we employed a truncated mouse model of emphysema by intratracheal instillation of cadmium (CdCl2) solution (0.025% per 1 mg/kg body wt) in HO-1+/+, HO-1−/−, and overexpressing humanized HO-1 bacterial artificial chromosome (hHO-1BAC) mice. We evaluated the role of HO-1 in cadmium-induced emphysema in mice by analyzing histopathology, micro-computed tomography scans, and lung function tests. CdCl2-exposed HO-1−/− mice exhibited more severe emphysema compared with HO-1+/+ or hHO-1BAC mice. Loss of pulmonary endothelial cells (PECs) from the alveolar capillary membrane is recognized to be a target in emphysema. PECs from HO-1+/+, HO-1−/−, and hHO-1BAC were employed to define the underlying molecular mechanism for the protection from emphysema by HO-1. Electron microscopy, expression of autophagic markers (microtubule-associated protein 1B-light chain 3 II, autophagy protein 5, and Beclin1) and apoptotic marker (cleaved caspase 3) suggested induction of autophagy and apoptosis in PECs after CdCl2 treatment. CdCl2-treated HO-1−/− PECs exhibited downregulation of autophagic markers and significantly increased cleaved caspase 3 expression and activity (∼4-fold higher). Moreover, hHO-1BAC PECs demonstrated upregulated autophagy and absence of cleaved caspase 3 expression or activity. Pretreatment of HO-1+/+ PECs with rapamycin induced autophagy and resulted in reduced cell death upon cadmium treatment. Induction of autophagy following CdCl2 treatment was found to be protective from apoptotic cell death. HO-1 induced protective autophagy in PECs and mitigated cadmium-induced emphysema. PMID:26071551

  4. Heme oxygenase-1-mediated autophagy protects against pulmonary endothelial cell death and development of emphysema in cadmium-treated mice.

    Science.gov (United States)

    Surolia, Ranu; Karki, Suman; Kim, Hyunki; Yu, Zhihong; Kulkarni, Tejaswini; Mirov, Sergey B; Carter, A Brent; Rowe, Steven M; Matalon, Sadis; Thannickal, Victor J; Agarwal, Anupam; Antony, Veena B

    2015-08-01

    Pulmonary exposure to cadmium, a major component of cigarette smoke, has a dramatic impact on lung function and the development of emphysema. Cigarette smoke exposure induces heme oxygenase-1 (HO-1), a cytoprotective enzyme. In this study, we employed a truncated mouse model of emphysema by intratracheal instillation of cadmium (CdCl2) solution (0.025% per 1 mg/kg body wt) in HO-1(+/+), HO-1(-/-), and overexpressing humanized HO-1 bacterial artificial chromosome (hHO-1BAC) mice. We evaluated the role of HO-1 in cadmium-induced emphysema in mice by analyzing histopathology, micro-computed tomography scans, and lung function tests. CdCl2-exposed HO-1(-/-) mice exhibited more severe emphysema compared with HO-1(+/+) or hHO-1BAC mice. Loss of pulmonary endothelial cells (PECs) from the alveolar capillary membrane is recognized to be a target in emphysema. PECs from HO-1(+/+), HO-1(-/-), and hHO-1BAC were employed to define the underlying molecular mechanism for the protection from emphysema by HO-1. Electron microscopy, expression of autophagic markers (microtubule-associated protein 1B-light chain 3 II, autophagy protein 5, and Beclin1) and apoptotic marker (cleaved caspase 3) suggested induction of autophagy and apoptosis in PECs after CdCl2 treatment. CdCl2-treated HO-1(-/-) PECs exhibited downregulation of autophagic markers and significantly increased cleaved caspase 3 expression and activity (∼4-fold higher). Moreover, hHO-1BAC PECs demonstrated upregulated autophagy and absence of cleaved caspase 3 expression or activity. Pretreatment of HO-1(+/+) PECs with rapamycin induced autophagy and resulted in reduced cell death upon cadmium treatment. Induction of autophagy following CdCl2 treatment was found to be protective from apoptotic cell death. HO-1 induced protective autophagy in PECs and mitigated cadmium-induced emphysema. Copyright © 2015 the American Physiological Society.

  5. Inclusion free cadmium zinc tellurium and cadmium tellurium crystals and associated growth method

    Science.gov (United States)

    Bolotnikov, Aleskey E [South Setauket, NY; James, Ralph B [Ridge, NY

    2010-07-20

    The present disclosure provides systems and methods for crystal growth of cadmium zinc tellurium (CZT) and cadmium tellurium (CdTe) crystals with an inverted growth reactor chamber. The inverted growth reactor chamber enables growth of single, large, high purity CZT and CdTe crystals that can be used, for example, in X-ray and gamma detection, substrates for infrared detectors, or the like. The inverted growth reactor chamber enables reductions in the presence of Te inclusions, which are recognized as an important limiting factor in using CZT or CdTe as radiation detectors. The inverted growth reactor chamber can be utilized with existing crystal growth techniques such as the Bridgman crystal growth mechanism and the like. In an exemplary embodiment, the inverted growth reactor chamber is a U-shaped ampoule.

  6. Exposure dose response relationships of the freshwater bivalve Hyridella australis to cadmium spiked sediments

    International Nuclear Information System (INIS)

    Marasinghe Wadige, Chamani P.M.; Maher, William A.; Taylor, Anne M.; Krikowa, Frank

    2014-01-01

    Highlights: • The exposure–dose–response approach was used to assess cadmium exposure and toxicity. • Accumulated cadmium in H. australis reflected the sediment cadmium exposure. • Spill over of cadmium into the biologically active pool was observed. • Increased cadmium resulted in measurable biological effects. • H. australis has the potential to be a cadmium biomonitor in freshwater environments. - Abstract: To understand how benthic biota may respond to the additive or antagonistic effects of metal mixtures in the environment it is first necessary to examine their responses to the individual metals. In this context, laboratory controlled single metal-spiked sediment toxicity tests are useful to assess this. The exposure–dose–response relationships of Hyridella australis to cadmium-spiked sediments were, therefore, investigated in laboratory microcosms. H. australis was exposed to individual cadmium spiked sediments (<0.05 (control), 4 ± 0.3 (low) and 15 ± 1 (high) μg/g dry mass) for 28 days. Dose was measured as cadmium accumulation in whole soft body and individual tissues at weekly intervals over the exposure period. Dose was further examined as sub-cellular localisation of cadmium in hepatopancreas tissues. The biological responses in terms of enzymatic and cellular biomarkers were measured in hepatopancreas tissues at day 28. H. australis accumulated cadmium from spiked sediments with an 8-fold (low exposure organisms) and 16-fold (high exposure organisms) increase at day 28 compared to control organisms. The accumulated tissue cadmium concentrations reflected the sediment cadmium exposure at day 28. Cadmium accumulation in high exposure organisms was inversely related to the tissue calcium concentrations. Gills of H. australis showed significantly higher cadmium accumulation than the other tissues. Accumulated cadmium in biologically active and biologically detoxified metal pools was not significantly different in cadmium exposed

  7. Low cadmium (LCD), a novel gene related to cadmium tolerance and accumulation in rice

    OpenAIRE

    Shimo, Hugo; Ishimaru, Yasuhiro; An, Gynheung; Yamakawa, Takashi; Nakanishi, Hiromi; Nishizawa, Naoko K.

    2011-01-01

    The contamination of food crops by cadmium (Cd) is a major concern in food production because it can reduce crop yields and threaten human health. In this study, knockout rice plants (Oryza sativa) tagged with the gene trap vector pGA2707 were screened for Cd tolerance, and the tolerant line lcd was obtained. The lcd mutant showed tolerance to Cd on agar plates and in hydroponic culture during early plant development. Metal concentration measurements in hydroponically grown plants revealed si...

  8. An association between urinary cadmium and urinary stone disease in persons living in cadmium-contaminated villages in northwestern Thailand: A population study

    International Nuclear Information System (INIS)

    Swaddiwudhipong, Witaya; Mahasakpan, Pranee; Limpatanachote, Pisit; Krintratun, Somyot

    2011-01-01

    Excessive urinary calcium excretion is the major risk of urinary stone formation. Very few population studies have been performed to determine the relationship between environmental cadmium exposure and urinary stone disease. This population-based study examined an association between urinary cadmium excretion, a good biomarker of long-term cadmium exposure, and prevalence of urinary stones in persons aged 15 years and older, who lived in the 12 cadmium-contaminated villages in the Mae Sot District, Tak Province, northwestern Thailand. A total of 6748 persons were interviewed and screened for urinary cadmium and urinary stone disease in 2009. To test a correlation between urinary excretion of cadmium and calcium, we measured urinary calcium content in 1492 persons, who lived in 3 villages randomly selected from the 12 contaminated villages. The rate of urinary stones significantly increased from 4.3% among persons in the lowest quartile of urinary cadmium to 11.3% in the highest quartile. An increase in stone prevalence with increasing urinary cadmium levels was similarly observed in both genders. Multiple logistic regression analysis revealed a positive association between urinary cadmium levels and stone prevalence, after adjusting for other co-variables. The urinary calcium excretion significantly increased with increasing urinary cadmium levels in both genders, after adjusting for other co-variables. Elevated calciuria induced by cadmium might increase the risk of urinary stone formation in this environmentally exposed population. - Research highlights: → Excessive calciuria is the major risk of urinary stone formation. → We examine cadmium-exposed persons for urinary cadmium, calcium, and stones. → The rate of urinary stones increases with increasing urinary cadmium. → Urinary calcium excretion increases with increasing urinary cadmium. → Elevated calciuria induced by cadmium may increase the risk of urinary stones.

  9. Quantitative in vivo elemental analysis using X-ray fluorescence and scattering techniques. Applications to cadmium, lead and bone mineral

    International Nuclear Information System (INIS)

    Nilsson, Ulf.

    1994-05-01

    The X-ray fluorescence technique for in vivo determination of cadmium concentration in the human body has been considerably improved so that the minimum concentration now is 10 μg/g for a skin-organ distance of 50 mm and a measurement time of 30 minutes. The technique has been used for measurements of cadmium in the kidney cortex of 60 non-occupationally exposed persons, showing twice the concentration (26±9 μg/g) in a sub-group of frequent tobacco smokers compared with a group of non-smokers (10±11 μg/g). Concentrations of lead in the skeleton of 112 persons have been measured at three bone sites (finger bone, tibia, heel bone) using in vivo XRF techniques either based on Co-57 or Cd-109 sources. There was a good correlation between lead levels at the three bone sites as well as to cumulative exposure index. However, the association between the amount of chelatable lead and measured bone lead levels was poor. The retention of lead in the skeleton of 14 retired workers, now studied for up to 18 years after retirement, shows a half-time of 16 years. 43 refs

  10. Evaluation of liquid metal embrittlement of stainless steel 304 by cadmium and cadmium-aluminum solutions

    International Nuclear Information System (INIS)

    Iyer, N.C.; Peacock, H.B.; Thomas, J.K.; Begley, J.A.

    1994-01-01

    The susceptibility of stainless steel 304 (SS304) to liquid metal embrittlement (LME) by cadmium (Cd) and cadmium-aluminum (Cd-Al) solutions was examined as part of a failure evaluation for SS304-clad cadmium reactor safety rods which had been exposed to elevated temperatures. The safety rod test data and destructive examination of the specimens indicated that LME was not the failure mode. The available literature data also suggest that austenitic stainless steels are not particularly susceptible to LME by Cd or Cd-Al solutions. However, the literature data is not conclusive and an experimental study was therefore conducted to examine the susceptibility of SS304 to LME by Cd and Cd-Al solutions. Temperatures from 325 to 600 C and strain rates from 1x10 -6 to 5x10 -5 s -1 were of interest in this evaluation. Tensile tests carried out in molten Cd-Al and Cd solutions over these temperatures and strain rates with both smooth bar and notched specimens showed no evidence of LME. U-bend tests conducted in liquid Cd at 500 and 600 C also showed no evidence of LME. It is concluded that SS304 is not subject to LME by Cd or Cd-Al solutions over the range of temperatures and strain rates of interest. ((orig.))

  11. Polarographic studies on the nature of cadmium in scallop, oyster, and lobster

    Energy Technology Data Exchange (ETDEWEB)

    Chou, C L; Uthe, J F; Zook, E G

    1978-04-01

    Free and bound forms of cadmium were determined in raw shellfish by use of differential pulse polarography and atomic absorption spectrophotometry. Free cadmium is defined by its polarographic peak potential of -0.62 +- 0.02 V (saturated calomel electrode) in solvent washed ammonium sulfate extracts. Bound cadmium was determined by subtracting the free cadmium from the total cadmium present in the meat. Both scallop (various species) and American lobster (Homarus americanus) muscle tissues contain no free cadmium. Oyster (various species), on the other hand, had a considerable percentage (approximately 50%) of its total cadmium present as free cadmium, a phenomena as yet unexplained. The detection limit for free cadmium is approximately 0.05 ..mu..g/g raw tissue.

  12. Study of soil pollution by cadmium in Qatina region

    International Nuclear Information System (INIS)

    Bargouth, G.; Johar, Y.; Ashkar, I.

    2005-01-01

    Heavy metals such as cadmium are specify to form complex compounds in soils make it difficulty to be absorbed from plants, but if prevailing circumstances changeability in soil and make these elements in absorbed actionable case to the plants, direct threatening upon of polluted soil with such elements will begin, and appears on plants, animals and humans. Holding comprehensive environmental evaluation on the agricultural soil field according to the prevailing circumstances in the transplanting zone, considered as important environmental practical stage in reducing environmental cadmium problems risk. Accordingly, we look to terming and controlling environment either to manage a soil pollution problem existed, or prophecy with circumstances lowers upon cadmium concentrations in the environment system (soil-plant) in order not to occurs environmental cadmium problems in the field soil futurity. (author)

  13. Influence of diethyldithiocarbamate on cadmium and copper toxicity ...

    African Journals Online (AJOL)

    drinie

    Abstract. Toxic effects of two heavy metals, cadmium (Cd) and copper (Cu), and a fungicide, .... mining 50% morbid concentrations (MC50) and 50% inhibition .... WHITTON B and SHEHATA F (1982) Influence of cobalt, nickel, copper.

  14. Adsorption kinetics of cadmium and lead by chitosan

    African Journals Online (AJOL)

    STORAGESEVER

    2010-04-26

    Apr 26, 2010 ... The lead and cadmium adsorption kinetic behavior could not be described using the Langmuir ... by chemical or by physical adsorption (Dean and Dixon,. 1992 ... phate fertilizer burning fuels, cement production, mining.

  15. Evaluation of cadmium bioaccumulation and translocation by Hopea ...

    African Journals Online (AJOL)

    parisa

    2012-04-10

    Apr 10, 2012 ... 6Faculty of Resource Science and Technology, Universiti Malaysia Sarawak, Sarawak, Malaysia. Accepted 19 December, 2011. Cadmium (Cd) contamination has an adverse effect on soil productivity and ...... J. Food, Agric.

  16. EFFECTS OF CADMIUM ON THE REPRODUCTIVE AXIS OF JAPANESE MEDAKA

    Science.gov (United States)

    Cadmium (Cd) is a ubquitous element and a significant inorganic pollutant that has previously been found to bioaccumulate in reproductive organs of fish and disrupt important endocrine processes, especially those involved in synthesis, release and metabolism of hormones. Clearly,...

  17. Model for cadmium transport and distribution in CHO cells

    Energy Technology Data Exchange (ETDEWEB)

    Hayden, T.L.; Turner, J.E.; Williams, M.W.; Cook, J.S.; Hsie, A.W.

    1982-01-01

    A compartmental model is developed to study the transport and distribution of cadmium in Chinese hamster ovary (CHO) cells. Of central importance to the model is the role played by sequestering components which bind free Cd/sup 2 +/ ions. The most important of these is a low-molecular-weight protein, metallothionein, which is produced by the cells in response to an increase in the cellular concentration of Cd/sup 2 +/. Monte Carlo techniques are used to generate a stochastic model based on existing experimental data describing the intracellular transport of cadmium between different compartments. This approach provides an alternative to the usual numerical solution of differential-delay equations that arise in deterministic models. Our model suggests subcellular structures which may be responsible for the accumulation of cadmium and, hence, could account for cadmium detoxification. 4 figures, 1 table.

  18. nitrosoguanidine-induced cadmium resistant mutants of Aspergillus

    Indian Academy of Sciences (India)

    Unknown

    nitrosoguanidine-induced cadmium resistant mutants of. Aspergillus niger. SAMAR ... gens and UV irradiation to study transportation of cad- mium ion through cell ..... Rowley W S 1993 Yeast bZib proteins mediate pleiotropic drug and metal ...

  19. Assessment of Copper, Cadmium and Lead in Organical Matrix

    International Nuclear Information System (INIS)

    Gutierrez, Ariel

    2000-08-01

    In this report the electrochemical method of differential pulse anode voltametry redisolution voltametry is used to quantitative assessment of copper, cadmium and lead in solution. The methodology is described in the preparation of samples for measurement

  20. Soil biogeochemistry, plant physiology and phytoremediation of cadmium contaminated soils

    Science.gov (United States)

    Cadmium (Cd) loading in soil and the environment has been accelerated worldwide due to enhanced industrialization and intensified agricultural production, particularly in the developing countries. Soil Cd pollution, resulting from both anthropogenic and geogenic sources, has posed an increasing chal...