WorldWideScience

Sample records for cabs

  1. Human Factors Guidelines for the Evaluation of the Locomotive Cab

    Science.gov (United States)

    1995-09-01

    This document presents human factors guidelines for the evaluation of the locomotive cab. These guidelines are part of : an effort to evaluate working conditions and safety in the locomotive cab. The guidelines will serve as a decision : making tool ...

  2. Engaging with Community Advisory Boards (CABs) in Lusaka Zambia: perspectives from the research team and CAB members.

    Science.gov (United States)

    Mwinga, Alwyn; Moodley, Keymanthri

    2015-06-03

    The use of a Community Advisory Board (CAB) is one method of ensuring community engagement in community based research. To identify the process used to constitute CABs in Zambia, this paper draws on the perspectives of both research team members and CAB members from research groups who used CABs in Lusaka. Enabling and restricting factors impacting on the functioning of the CAB were identified. All studies approved by the University of Zambia Bioethics Research Committee (UBNZABREC) from 2008 - 2012 were reviewed to identify those studies that were likely to include a CAB. Eight teams with studies that included a CAB were identified. For each of these studies, consent was obtained to conduct an informal interview with a research team member and to obtain contact details for one CAB member. In total 14 interviews were conducted with 8 research team members and 6 CAB members from 12-30 August 2013. Identification of potential CAB members from the community and their participation in developing the terms of reference for CABs was perceived to have contributed to the success of the CAB. Due to the trust that the community had in members of their community the CABs were then in a stronger position to influence community participation in the research. Training of CAB members was identified as a factor that enhanced the functioning of a CAB. Lack of commitment and low literacy levels of CAB members posed a threat to the role of the CAB. Although compensation in the form of a stipend was not provided, CAB members were provided with transport reimbursements for attending meetings. Selection of CAB members from within the community contributed to community confidence in the CAB, enhancing its ability to act as an effective link between study team and community. This contributed positively to the conduct of the study and enhanced community awareness and acceptance of the research. However, establishment of study specific CABs has the potential to compromise CAB independence

  3. 49 CFR 229.121 - Locomotive cab noise.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locomotive cab noise. 229.121 Section 229.121... § 229.121 Locomotive cab noise. (a) Performance standards for locomotives. (1) When tested for static noise in accordance with paragraph (a)(3) of this section, all locomotives of each design or model that...

  4. Green Cabs vs. Uber in New York City

    DEFF Research Database (Denmark)

    Korsholm Poulsen, Lasse; Dekkers, Daan; Wagenaar, Nicolaas

    2016-01-01

    This paper reports on the process and outcomes of big data analytics of ride records for Green cabs and Uber in the outer boroughs of New York City (NYC), USA. Uber is a new entrant to the taxi market in NYC and is rapidly eating away market share from the NYC Taxi & Limousine Commission's (NYCTLC......) Yellow and Green cabs. The problem investigated revolves around where exactly Green cabs are losing market share to Uber outside Manhattan and what, if any, measures can be taken to preserve market share? Two datasets were included in the analysis including all rides of Green cabs and Uber respectively...... from April-September 2014 in New York excluding Manhattan and NYC's two airports. Tableau was used as the visual analytics tool, and PostgreSQL in combination with PostGIS was used as the data processing engine. Our findings show that the performance of Green cabs in isolated zip codes differ...

  5. Highly Flexible Protein-Peptide Docking Using CABS-Dock.

    Science.gov (United States)

    Ciemny, Maciej Paweł; Kurcinski, Mateusz; Kozak, Konrad Jakub; Kolinski, Andrzej; Kmiecik, Sebastian

    2017-01-01

    Protein-peptide molecular docking is a difficult modeling problem. It is even more challenging when significant conformational changes that may occur during the binding process need to be predicted. In this chapter, we demonstrate the capabilities and features of the CABS-dock server for flexible protein-peptide docking. CABS-dock allows highly efficient modeling of full peptide flexibility and significant flexibility of a protein receptor. During CABS-dock docking, the peptide folding and binding process is explicitly simulated and no information about the peptide binding site or its structure is used. This chapter presents a successful CABS-dock use for docking a potentially therapeutic peptide to a protein target. Moreover, simulation contact maps, a new CABS-dock feature, are described and applied to the docking test case. Finally, a tutorial for running CABS-dock from the command line or command line scripts is provided. The CABS-dock web server is available from http://biocomp.chem.uw.edu.pl/CABSdock/ .

  6. Clean Cities case study : Barwood Cab Fleet study summary

    Science.gov (United States)

    1999-05-21

    Barwood Cab Fleet Study Summary is the second in a new series called 'Alternative Fuel Information Case Studies', designed to present real-world experiences with alternative fuels to fleet managers and other industry stakeholders.

  7. Cab technology integration laboratory demonstration with moving map technology

    Science.gov (United States)

    2013-03-31

    A human performance study was conducted at the John A. Volpe National Transportation Systems Center (Volpe Center) using a locomotive research simulatorthe Cab Technology Integration Laboratory (CTIL)that was acquired by the Federal Railroad Ad...

  8. Two transcription factors, CabA and CabR, are independently involved in multilevel regulation of the biosynthetic gene cluster encoding the novel aminocoumarin, cacibiocin.

    Science.gov (United States)

    Wolański, Marcin; Łebkowski, Tomasz; Kois-Ostrowska, Agnieszka; Zettler, Judith; Apel, Alexander K; Jakimowicz, Dagmara; Zakrzewska-Czerwińska, Jolanta

    2016-04-01

    Aminocoumarins are potent antibiotics belonging to a relatively small group of secondary metabolites produced by actinomycetes. Genome mining of Catenulispora acidiphila has recently led to the discovery of a gene cluster responsible for biosynthesis of novel aminocoumarins, cacibiocins. However, regulation of the expression of this novel gene cluster has not yet been analyzed. In this study, we identify transcriptional regulators of the cacibiocin gene cluster. Using a heterologous expression system, we show that the CabA and CabR proteins encoded by cabA and cabR genes in the cacibiocin gene cluster control the expression of genes involved in the biosynthesis, modification, regulation, and potentially, efflux/resistance of cacibiocins. CabA positively regulates the expression of cabH (the first gene in the cabHIYJKL operon) and cabhal genes encoding key enzymes responsible for the biosynthesis and halogenation of the aminocoumarin moiety, respectively. We provide evidence that CabA is a direct inducer of cacibiocin production, whereas the second transcriptional factor, CabR, is involved in the negative regulation of its own gene and cabT-the latter of which encodes a putative cacibiocin transporter. We also demonstrate that CabR activity is negatively regulated in vitro by aminocoumarin compounds, suggesting the existence of analogous regulation in vivo. Finally, we propose a model of multilevel regulation of gene transcription in the cacibiocin gene cluster by CabA and CabR.

  9. The cabABC Operon Essential for Biofilm and Rugose Colony Development in Vibrio vulnificus.

    Directory of Open Access Journals (Sweden)

    Jin Hwan Park

    2015-09-01

    Full Text Available A transcriptome analysis identified Vibrio vulnificus cabABC genes which were preferentially expressed in biofilms. The cabABC genes were transcribed as a single operon. The cabA gene was induced by elevated 3',5'-cyclic diguanylic acid (c-di-GMP and encoded a calcium-binding protein CabA. Comparison of the biofilms produced by the cabA mutant and its parent strain JN111 in microtiter plates using crystal-violet staining demonstrated that CabA contributed to biofilm formation in a calcium-dependent manner under elevated c-di-GMP conditions. Genetic and biochemical analyses revealed that CabA was secreted to the cell exterior through functional CabB and CabC, distributed throughout the biofilm matrix, and produced as the biofilm matured. These results, together with the observation that CabA also contributes to the development of rugose colony morphology, indicated that CabA is a matrix-associated protein required for maturation, rather than adhesion involved in the initial attachment, of biofilms. Microscopic comparison of the structure of biofilms produced by JN111 and the cabA mutant demonstrated that CabA is an extracellular matrix component essential for the development of the mature biofilm structures in flow cells and on oyster shells. Exogenously providing purified CabA restored the biofilm- and rugose colony-forming abilities of the cabA mutant when calcium was available. Circular dichroism and size exclusion analyses revealed that calcium binding induces CabA conformational changes which may lead to multimerization. Extracellular complementation experiments revealed that CabA can assemble a functional matrix only when exopolysaccharides coexist. Consequently, the combined results suggested that CabA is a structural protein of the extracellular matrix and multimerizes to a conformation functional in building robust biofilms, which may render V. vulnificus to survive in hostile environments and reach a concentrated infective dose.

  10. The cabABC Operon Essential for Biofilm and Rugose Colony Development in Vibrio vulnificus

    Science.gov (United States)

    Park, Jin Hwan; Jo, Youmi; Jang, Song Yee; Kwon, Haenaem; Irie, Yasuhiko; Parsek, Matthew R.; Kim, Myung Hee; Choi, Sang Ho

    2015-01-01

    A transcriptome analysis identified Vibrio vulnificus cabABC genes which were preferentially expressed in biofilms. The cabABC genes were transcribed as a single operon. The cabA gene was induced by elevated 3′,5′-cyclic diguanylic acid (c-di-GMP) and encoded a calcium-binding protein CabA. Comparison of the biofilms produced by the cabA mutant and its parent strain JN111 in microtiter plates using crystal-violet staining demonstrated that CabA contributed to biofilm formation in a calcium-dependent manner under elevated c-di-GMP conditions. Genetic and biochemical analyses revealed that CabA was secreted to the cell exterior through functional CabB and CabC, distributed throughout the biofilm matrix, and produced as the biofilm matured. These results, together with the observation that CabA also contributes to the development of rugose colony morphology, indicated that CabA is a matrix-associated protein required for maturation, rather than adhesion involved in the initial attachment, of biofilms. Microscopic comparison of the structure of biofilms produced by JN111 and the cabA mutant demonstrated that CabA is an extracellular matrix component essential for the development of the mature biofilm structures in flow cells and on oyster shells. Exogenously providing purified CabA restored the biofilm- and rugose colony-forming abilities of the cabA mutant when calcium was available. Circular dichroism and size exclusion analyses revealed that calcium binding induces CabA conformational changes which may lead to multimerization. Extracellular complementation experiments revealed that CabA can assemble a functional matrix only when exopolysaccharides coexist. Consequently, the combined results suggested that CabA is a structural protein of the extracellular matrix and multimerizes to a conformation functional in building robust biofilms, which may render V. vulnificus to survive in hostile environments and reach a concentrated infective dose. PMID:26406498

  11. Consortium for Algal Biofuel Commercialization (CAB-COMM) Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Mayfield, Stephen P. [Univ. of California, San Diego, CA (United States)

    2015-12-04

    The Consortium for Algal Biofuel Commercialization (CAB-Comm) was established in 2010 to conduct research to enable commercial viability of alternative liquid fuels produced from algal biomass. The main objective of CAB-Comm was to dramatically improve the viability of algae as a source of liquid fuels to meet US energy needs, by addressing several significant barriers to economic viability. To achieve this goal, CAB-Comm took a diverse set of approaches on three key aspects of the algal biofuels value chain: crop protection; nutrient utilization and recycling; and the development of genetic tools. These projects have been undertaken as collaboration between six academic institutions and two industrial partners: University of California, San Diego; Scripps Institution of Oceanography; University of Nebraska, Lincoln; Rutgers University; University of California, Davis; Johns Hopkins University; Sapphire Energy; and Life Technologies.

  12. Clean Cities Case Study: Barwood Cab Fleet Study Summary

    Energy Technology Data Exchange (ETDEWEB)

    Whalen, P.

    1999-05-21

    Barwood Cab Fleet Study Summary is the second in a new series called ''Alternative Fuel Information Case Studies,'' designed to present real-world experiences with alternative fuels to fleet managers and other industry stakeholders.

  13. Low frequency sound reproduction in irregular rooms using CABS (Control Acoustic Bass System)

    DEFF Research Database (Denmark)

    Celestinos, Adrian; Nielsen, Sofus Birkedal

    2011-01-01

    of an irregular room model using the FDTD (Finite Difference Time Domain) method has been presented. CABS has been simulated in the irregular room model. Measurements of CABS in a real irregular room have been performed. The performance of CABS was affected by the irregular shape of the room due to the corner...

  14. Assessment of Proposed Cab Glass Coating for FAA Control Towers

    Science.gov (United States)

    2015-11-16

    Government’s approval or disapproval of its ideas or findings. i Standard Form 298 (Rev. 8-98) Prescribed by ANSI Std. Z39-18 REPORT...droplets from rain in such a way that one would expect improved visibility through the coated windows. 15. SUBJECT TERMS Cab glass, coatings...distribution of water droplets from rain (left is uncoated, right is coated

  15. Field assessment of enclosed cab filtration system performance using particle counting measurements.

    Science.gov (United States)

    Organiscak, John A; Cecala, Andrew B; Noll, James D

    2013-01-01

    Enclosed cab filtration systems are typically used on mobile mining equipment to reduce miners' exposure to airborne dust generated during mining operations. The National Institute for Occupational Safety and Health (NIOSH) Office of Mine Safety and Health Research (OMSHR) has recently worked with a mining equipment manufacturer to examine a new cab filtration system design for underground industrial minerals equipment. This cab filtration system uses a combination of three particulate filters to reduce equipment operators' exposure to dust and diesel particulates present in underground industrial mineral mines. NIOSH initially examined this cab filtration system using a two-instrument particle counting method at the equipment company's manufacturing shop facility to assess several alternative filters. This cab filtration system design was further studied on several pieces of equipment during a two- to seven-month period at two underground limestone mines. The two-instrument particle counting method was used outside the underground mine at the end of the production shifts to regularly test the cabs' long-term protection factor performance with particulates present in the ambient air. This particle counting method showed that three of the four cabs achieved protection factors greater than 1,000 during the field studies. The fourth cab did not perform at this level because it had a damaged filter in the system. The particle counting measurements of submicron particles present in the ambient air were shown to be a timely and useful quantification method in assessing cab performance during these field studies.

  16. Operators' perception of comfort in two tractor cabs.

    Science.gov (United States)

    Ferrari, E; Cavallo, E

    2013-01-01

    Workspace characteristics affect the perceived comfort level of the operator and uncomfortable working conditions have been found to have a negative impact on productivity and safety. The comfort of the operator is increasingly recognized by manufacturers as a product's added value. Comfort can positively distinguish a product and increase its competitiveness. The concept of comfort is controversial, and a clear operational definition is missing. Nevertheless, it is widely accepted that comfort is a subjective phenomenon that can be evaluated by the final users. In this study, comfort aspects of the tractor workspace interior (i.e., the cab) were investigated. Users with various levels of expertise and two medium-power utility tractors of different brands were used in a 2 x 2 mixed-factorial experimental design. Participants were involved in a dynamic assessment of the cabs, and their opinions about the different workspaces were collected through a questionnaire. Additionally, objective measurements were taken on both tractors, and subjective data were compared with objective data. Results indicate significant differences in terms of the ease of locating and operating the controls (i.e., rear-mounted three-point linkage, hydraulic system, and power take-off), the ease of starting the tractor, the ease exiting the cab, the required level of concentration in executing the tasks, the adequacy of lateral visibility from the driving station, and the level of noise at the operator's position. This article provides guidance for improving the comfort of tractor workspace interiors. Agricultural machinery manufactures would benefit from research results, differentiating themselves from competitors.

  17. 49 CFR 238.447 - Train operator's controls and power car cab layout.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Train operator's controls and power car cab layout. 238.447 Section 238.447 Transportation Other Regulations Relating to Transportation (Continued... layout. (a) Train operator controls in the power car cab shall be arranged so as to minimize the chance...

  18. Field Assessment of Enclosed Cab Filtration System Performance Using Particle Counting Measurements

    Science.gov (United States)

    Organiscak, John A.; Cecala, Andrew B.; Noll, James D.

    2015-01-01

    Enclosed cab filtration systems are typically used on mobile mining equipment to reduce miners’ exposure to airborne dust generated during mining operations. The National Institute for Occupational Safety and Health (NIOSH) Office of Mine Safety and Health Research (OMSHR) has recently worked with a mining equipment manufacturer to examine a new cab filtration system design for underground industrial minerals equipment. This cab filtration system uses a combination of three particulate filters to reduce equipment operators’ exposure to dust and diesel particulates present in underground industrial mineral mines. NIOSH initially examined this cab filtration system using a two-instrument particle counting method at the equipment company’s manufacturing shop facility to assess several alternative filters. This cab filtration system design was further studied on several pieces of equipment during a two- to seven-month period at two underground limestone mines. The two-instrument particle counting method was used outside the underground mine at the end of the production shifts to regularly test the cabs’ long-term protection factor performance with particulates present in the ambient air. This particle counting method showed that three of the four cabs achieved protection factors greater than 1,000 during the field studies. The fourth cab did not perform at this level because it had a damaged filter in the system. The particle counting measurements of submicron particles present in the ambient air were shown to be a timely and useful quantification method in assessing cab performance during these field studies. PMID:23915268

  19. 30 CFR 75.1710 - Canopies or cabs; diesel-powered and electric face equipment.

    Science.gov (United States)

    2010-07-01

    ...-powered and electric face equipment, including shuttle cars, be provided with substantially constructed... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Canopies or cabs; diesel-powered and electric... Miscellaneous § 75.1710 Canopies or cabs; diesel-powered and electric face equipment. In any coal mine where the...

  20. 49 CFR 236.566 - Locomotive of each train operating in train stop, train control or cab signal territory; equipped.

    Science.gov (United States)

    2010-10-01

    ..., train control or cab signal territory; equipped. 236.566 Section 236.566 Transportation Other... train stop, train control or cab signal territory; equipped. The locomotive from which brakes are controlled, of each train operating in automatic train stop, train control, or cab signal territory shall be...

  1. 78 FR 13754 - Notice of Receipt of Petition for Decision That Nonconforming 2004 Ford F-150 Crew Cab Trucks...

    Science.gov (United States)

    2013-02-28

    ... Nonconforming 2004 Ford F-150 Crew Cab Trucks Manufactured for Sale in the Mexican Market Are Eligible for... a petition for a decision that 2004 Ford F-150 Crew Cab trucks manufactured for sale in the Mexican... 2004 Ford F-150 Crew Cab truck) and they are capable of being readily altered to conform to the...

  2. Center for Advanced Biofuel Systems (CABS) Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Kutchan, Toni M. [Donald Danforth Plant Science Center, St. Louis, MO (United States)

    2015-12-02

    One of the great challenges facing current and future generations is how to meet growing energy demands in an environmentally sustainable manner. Renewable energy sources, including wind, geothermal, solar, hydroelectric, and biofuel energy systems, are rapidly being developed as sustainable alternatives to fossil fuels. Biofuels are particularly attractive to the U.S., given its vast agricultural resources. The first generation of biofuel systems was based on fermentation of sugars to produce ethanol, typically from food crops. Subsequent generations of biofuel systems, including those included in the CABS project, will build upon the experiences learned from those early research results and will have improved production efficiencies, reduced environmental impacts and decreased reliance on food crops. Thermodynamic models predict that the next generations of biofuel systems will yield three- to five-fold more recoverable energy products. To address the technological challenges necessary to develop enhanced biofuel systems, greater understanding of the non-equilibrium processes involved in solar energy conversion and the channeling of reduced carbon into biofuel products must be developed. The objective of the proposed Center for Advanced Biofuel Systems (CABS) was to increase the thermodynamic and kinetic efficiency of select plant- and algal-based fuel production systems using rational metabolic engineering approaches grounded in modern systems biology. The overall strategy was to increase the efficiency of solar energy conversion into oils and other specialty biofuel components by channeling metabolic flux toward products using advanced catalysts and sensible design:1) employing novel protein catalysts that increase the thermodynamic and kinetic efficiencies of photosynthesis and oil biosynthesis; 2) engineering metabolic networks to enhance acetyl-CoA production and its channeling towards lipid synthesis; and 3) engineering new metabolic networks for the

  3. Role of extracellular matrix protein CabA in resistance of Vibrio vulnificus biofilms to decontamination strategies.

    Science.gov (United States)

    Park, Jin Hwan; Lee, Byungho; Jo, Youmi; Choi, Sang Ho

    2016-11-07

    Biofilms are recalcitrant and raise safety problems in the food industry. In this study, the role of CabA, an extracellular matrix protein, in the resistance of the biofilms of Vibrio vulnificus, a foodborne pathogen, to decontamination strategies was investigated. Biofilms of the cabA mutant revealed reduced resistance to detachment by vibration and disinfection by sodium hypochlorite compared to the biofilms of the parental wild type in vitro. The reduced resistance of the cabA mutant biofilms was complemented by introducing a recombinant cabA, indicating that the reduced resistance of the cabA mutant biofilms is caused by the inactivation of cabA. The expression of cabA was induced in cells bound to oyster, the primary vehicle of the pathogen. The cabA mutant biofilms on oyster are defective in biomass and resistance to detachment and disinfection. The bacterial cells in the wild-type biofilms are clustered by filaments which are not apparent in the cabA mutant biofilms. The combined results indicated that CabA contributes to the structural integrity of V. vulnificus biofilms possibly by forming filaments in the matrix and thus rendering the biofilms robust, suggesting that CabA could be a target to control V. vulnificus biofilms on oyster. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Prototype design and test of a collision protection system for cab car engineers.

    Science.gov (United States)

    2014-12-01

    Advancements in the design of rail cars can : potentially prevent the structural collapse of : space occupied by a cab car engineer : during a train collision. With adequate : survival space maintained, the next : crashworthiness objective is to mini...

  5. Prototype design of a collision protection system for cab car engineers - fabrication and test.

    Science.gov (United States)

    2015-06-01

    Advancements in the structural crashworthiness of passenger rail cars now make it possible to preserve the compartmentalized : space occupied by a cab car engineer during a train collision. In order to translate this additional protection into improv...

  6. 49 CFR 236.512 - Cab signal indication when locomotive enters block where restrictive conditions obtain.

    Science.gov (United States)

    2010-10-01

    ... where restrictive conditions obtain. 236.512 Section 236.512 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES... Systems Standards § 236.512 Cab signal indication when locomotive enters block where restrictive...

  7. Biological Control of White Rot in Garlic Using Burkholderia pyrrocinia CAB08106-4

    Directory of Open Access Journals (Sweden)

    Kwang Seop Han

    2013-03-01

    Full Text Available White rot caused by Sclerotium cepivorum was reported to be severe soil-born disease on garlic. Disease progress of white rot of garlic (Allium sativum L. was investigated during the growing season of 2009 to 2011 at Taean and Seosan areas. The white rot disease on bulb began to occur from late April and peaked in late May. The antifungal bacteria, Burkholderia pyrrocinia CAB08106-4 was tested in field bioassay for suppression of white rot disease. As a result of the nucleotide sequence of the gene 16S rRNA, CAB008106-4 strain used in this study has been identified as B. pyrrocinia. B. pyrrocinia CAB080106-4 isolate suppressed the white rot with 69.6% control efficacy in field test. These results suggested that B. pyrrocinia CAB08106-4 isolate could be an effective biological control agent against white rot of garlic.

  8. Experimental investigation and performance analysis of inertia properties measurement for heavy truck cab

    Directory of Open Access Journals (Sweden)

    Tianjun Zhu

    2015-11-01

    Full Text Available An experimental investigation and performance analysis of inertia properties measurement for heavy truck cab is presented. This method is specifically intended for measuring the inertia properties of irregular rigid bodies, and it has the potential to be applied to the measurement of the inertia properties of vehicle bodies, such as the cab, engine, and gearbox. This article, based on CATARC moment of inertia measurement system test rig, develops an accurate measuring method to identify inertia parameters of heavy truck cab. First, corresponding tests are carried out, and the lever principle and moments of inertia parallel theorem are employed to calculate and analyse the test results, which leads to the accurate value of inertia parameters. Second, the performance analysis of the proposed method is verified through the measurement error analysis. As a result, the proposed method shows high accuracy, which provides an experimental basis for accurate inertia parameter measurement of heavy truck cab.

  9. Towards a covariance matrix of CAB model parameters for H(H2O

    Directory of Open Access Journals (Sweden)

    Scotta Juan Pablo

    2017-01-01

    Full Text Available Preliminary results on the uncertainties of hydrogen into light water thermal scattering law of the CAB model are presented. It was done through a coupling between the nuclear data code CONRAD and the molecular dynamic simulations code GROMACS. The Generalized Least Square method was used to adjust the model parameters on evaluated data and generate covariance matrices between the CAB model parameters.

  10. Potential air toxics hot spots in truck terminals and cabs.

    Science.gov (United States)

    Smith, Thomas J; Davis, Mary E; Hart, Jaime E; Blicharz, Andrew; Laden, Francine; Garshick, Eric

    2012-12-01

    Hot spots are areas where concentrations of one or more air toxics--organic vapors or particulate matter (PM)--are expected to be elevated. The U.S. Environmental Protection Agency's (EPA*) screening values for air toxics were used in our definition of hot spots. According to the EPA, a screening value "is used to indicate a concentration of a chemical in the air to which a person could be continually exposed for a lifetime ... and which would be unlikely to result in a deleterious effect (either cancer or noncancer health effects)" (U.S. EPA 2006). Our characterization of volatile organic compounds (VOCs; namely 18 hydrocarbons, methyl tert-butyl ether [MTBE], acetone, and aldehydes) was added onto our ongoing National Cancer Institute-funded study of lung cancer and particulate pollutant concentrations (PM with an aerodynamic diameter parks; downwind areas affected by upwind and terminal sources; and the loading docks and mechanic shops within terminal as well as the interior of cabs of trucks being driven on city, suburban, and rural streets and on highways. In Phase 1 of our study, 15 truck terminals across the United States were each visited for five consecutive days. During these site visits, sorbent tubes were used to collect 12-hour integrated samples of hydrocarbons and aldehydes from upwind and downwind fence-line locations as well as inside truck cabs. Meteorologic data and extensive site information were collected with each sample. In Phase 2, repeat visits to six terminals were conducted to test the stability of concentrations across time and judge the representativeness of our previous measurements. During the repeat site visits, the sampling procedure was expanded to include real-time sampling for total hydrocarbon (HC) and PM2.5 at the terminal upwind and downwind sites and inside the truck cabs, two additional monitors in the yard for four-quadrant sampling to better characterize the influence of wind, and indoor sampling in the loading dock and

  11. A simple turbidimetric method for monitoring the inhibition of tRNA-dependent amidotransferase GatCAB.

    Science.gov (United States)

    Chatani, Miho; Tanaka, Michiko; Nakamura, Akiyoshi; Takesue, Nobuchika; Tanaka, Isao; Asano, Kozo

    2010-02-01

    In eubacteria that lack glutaminyl-tRNA synthetase (GlnRS), a tRNA-dependent amidotransferase (GatCAB) recognizes mischarged Glu-tRNA(Gln) and converts it into Gln-tRNA(Gln). An inhibitor specific for GatCAB could therefore act as an antibiotic with a novel mode of action against multidrug-resistant bacteria such as Staphylococcus strains. However, there is no rapid, simple and efficient screening method for specifically monitoring the inhibition of GatCAB activity. We have focused on developing a simple system for monitoring the inhibition of GatCAB activity using Escherichia coli Top10 co-expressing the ndGluRS and GatCAB genes from Staphylococcus aureus Mu50. First, growth repression was confirmed by introducing ndgluRS from S. aureus Mu50 into E. coli. Then, we verified that co-expression of the gatCAB operon alleviated growth repression in the host E. coli. The screening system consisted of these two transformants and non-expressing E. coli Top10. The transformant harbors both ndGluRS gene and GatCAB operon could be co-expressed in the presence and in the absence of chemical compound of interest. Since there is no inhibitor that inactivates GatCAB activity, we expressed two inactive GatCAB deletion variants, GatCAB(Delta10) and GatCAB(DeltaCHD) together with ndGluRS in E. coli Top10. The expressed E. coli showed repressed growth as well as ndGluRS expressed. These results indicate that if GatCAB activity is inhibited in this co-expressed E. coli, the inhibition can be monitored by the decrease in O.D. of the co-expressed E. coli. Copyright 2009 Elsevier B.V. All rights reserved.

  12. Mapping Chinese Agricultural and Allied Sciences Journals Indexed in CAB Abstracts Database

    Directory of Open Access Journals (Sweden)

    Arundhati Kaushik

    2013-06-01

    Full Text Available CAB Abstracts published by CABI (Centre for Agriculture and Biosciences International is the premier database for agricultural and allied sciences literature. The purpose of this study is to determine the extent of index coverage in CAB Abstracts and to identify the core journals in the field of agricultural and allied sciences published in China. The study depicts the trend of Chinese agricultural and allied sciences journals, which is successfully proving a gateway of the agricultural research in China to merge into the main stream of the world.

  13. STRATEGI BRI SYARIAH CAB. KENDARI UNTUK MENGATASI GAGAL BAYAR PADA PROGRAM PEMBIAYAAN USAHA MIKRO

    Directory of Open Access Journals (Sweden)

    Turmudi Turmudi

    2016-05-01

      Abstrak Penelitian ini merupakan penelitian kualitatif deskriftif yang bertujuan mengetahui strategi yang dilakukan BRI Syariah Cab. Kendari untuk mencegah serta mengatasi gagal bayar nasabah pembiayaan usaha mikro. Data yang diperoleh pada penelitian ini melalui observasi, wawancara serta studi dokumen. BRI Syariah Cab. Kendari memiliki program pembiayaan bagi pengusaha mikro yang diberi nama Mikro 25iB, Mikro 75iB serta Mikro 500iB. Penerapan prinsip kehati-hatian pada pembiayaan usaha mikro dimulai ketika calon debitur mengajukan permohonan pembiayaan yakni dengan mengikuti persyaratan administratif yang sudah ditentukan BRI Syaraiah Cab. Kendari kemudian dianalisa mengenai character, capacity, capital, collateral, kondisi dan Syariah untuk mencegah risiko adanya nasabah yang mengalami masalah dalam pembayaran pembiayaan (wanprestatie. Upaya penyelamatan pembiayaan BRI Syariah Cab. Kendari yaitu 1 melalui program rescheduling, reconditioning, ataupun restructuring 2 Penyelesaian pembiayaan bermasalah melalui proses pengadilan dilakukan apabila pihak debitur sengaja tidak mau membayar sehingga tidak ada keinginan untuk melunasi kewajibannya, atau apabila proses penyelesaian di luar pengadilan tidak membawa hasil seperti yang diharapkan. Kata kunci: Pembiayaan Usaha Mikro, Pembiayaan Bermasalah, Prinsip Kehati-hatian Bank.

  14. U.S. truck driver anthropometric study and multivariate anthropometric models for cab designs.

    Science.gov (United States)

    Guan, Jinhua; Hsiao, Hongwei; Bradtmiller, Bruce; Kau, Tsui-Ying; Reed, Matthew R; Jahns, Steven K; Loczi, Josef; Hardee, H Lenora; Piamonte, Dominic Paul T

    2012-10-01

    This study presents data from a large-scale anthropometric study of U.S. truck drivers and the multivariate anthropometric models developed for the design of next-generation truck cabs. Up-to-date anthropometric information of the U.S. truck driver population is needed for the design of safe and ergonomically efficient truck cabs. We collected 35 anthropometric dimensions for 1,950 truck drivers (1,779 males and 171 females) across the continental United States using a sampling plan designed to capture the appropriate ethnic, gender, and age distributions of the truck driver population. Truck drivers are heavier than the U.S.general population, with a difference in mean body weight of 13.5 kg for males and 15.4 kg for females. They are also different in physique from the U.S. general population. In addition, the current truck drivers are heavier and different in physique compared to their counterparts of 25 to 30 years ago. The data obtained in this study provide more accurate anthropometric information for cab designs than do the current U.S. general population data or truck driver data collected 25 to 30 years ago. Multivariate anthropometric models, spanning 95% of the current truck driver population on the basis of a set of 12 anthropometric measurements, have been developed to facilitate future cab designs. The up-to-date truck driver anthropometric data and multivariate anthropometric models will benefit the design of future truck cabs which, in turn, will help promote the safety and health of the U.S. truck drivers.

  15. Modeling of protein-peptide interactions using the CABS-dock web server for binding site search and flexible docking.

    Science.gov (United States)

    Blaszczyk, Maciej; Kurcinski, Mateusz; Kouza, Maksim; Wieteska, Lukasz; Debinski, Aleksander; Kolinski, Andrzej; Kmiecik, Sebastian

    2016-01-15

    Protein-peptide interactions play essential functional roles in living organisms and their structural characterization is a hot subject of current experimental and theoretical research. Computational modeling of the structure of protein-peptide interactions is usually divided into two stages: prediction of the binding site at a protein receptor surface, and then docking (and modeling) the peptide structure into the known binding site. This paper presents a comprehensive CABS-dock method for the simultaneous search of binding sites and flexible protein-peptide docking, available as a user's friendly web server. We present example CABS-dock results obtained in the default CABS-dock mode and using its advanced options that enable the user to increase the range of flexibility for chosen receptor fragments or to exclude user-selected binding modes from docking search. Furthermore, we demonstrate a strategy to improve CABS-dock performance by assessing the quality of models with classical molecular dynamics. Finally, we discuss the promising extensions and applications of the CABS-dock method and provide a tutorial appendix for the convenient analysis and visualization of CABS-dock results. The CABS-dock web server is freely available at http://biocomp.chem.uw.edu.pl/CABSdock/. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  16. A simple turbidimetric method for monitoring the inhibition of tRNA-dependent amidotransferase GatCAB

    OpenAIRE

    Chatani, Miho; Tanaka, Michiko; Nakamura, Akiyoshi; Takesue, Nobuchika; Tanaka, Isao; ASANO, Kozo

    2010-01-01

    In eubacteria that lack glutaminyl-tRNA synthetase (GlnRS), a tRNA-dependent amidotransferase (GatCAB) recognizes mischarged Glu-tRNA^[Gln] and converts it into Gln-tRNA^[Gln]. An inhibitor specific for GatCAB could therefore act as an antibiotic with a novel mode of action against multidrug-resistant bacteria such as Staphylococcus strains. However, there is no rapid, simple and efficient screening method for specifically monitoring the inhibition of GatCAB activity. We have focused on devel...

  17. Modal analysis of a truck cab using the least squares complex exponent test method

    Directory of Open Access Journals (Sweden)

    Pingqing Fan

    2015-03-01

    Full Text Available This article introduces the basic theory of modal analysis. The modal testing system is established for a developing truck body. Using a pseudo-random excitation signal along the x, y, and z directions, the modal test is carried out to obtain the dynamic performance by multi-point excitations. The transfer function set is obtained by averaging all transfer functions, and the set is processed by order selection to get 28 order modes. Fitting modal parameters and normalizing modal mass can gain natural frequencies and vibration modes of cab. Then, the modal analysis of truck cab is calculated based on the finite element method, and the results are compared with the test results. The improved measures are put forward to enhance the local stiffness, avoid modal coupling, and reduce vibration noise. So, this article supplies a reference for the dynamic test for the large body.

  18. Low frequency sound reproduction in irregular rooms using CABS (Control Acoustic Bass System)

    DEFF Research Database (Denmark)

    Celestinos, Adrian; Nielsen, Sofus Birkedal

    2011-01-01

    loudspeakers well positioned at the end of the room a virtual array is formed propagating plane waves along the length of the room in one direction. This will correct the sound field distribution in the room. When plane wave arrives to the end wall two more loudspeakers have to be placed connected......Early investigations on low frequency sound reproduction in rectangular rooms using CABS (Controlled Acoustic Bass System) have shown good results on simulations and measurements in real rooms. CABS takes the advantage of having a rectangular room with parallel walls. By using two low frequency...... with the same signal in counter phase and with a delay corresponding to approximately the length of the room. This is to cancel the reflection and maintain the plane wave propagating along the room. Real life rooms are not necessary rectangular and can be of different shapes. In this paper simulations...

  19. Low frequency sound field control for loudspeakers in rectangular rooms using CABS (Controlled Acoustical Bass System)

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2010-01-01

    Rectangular rooms are the most common shape for sound reproduction, but at low frequencies the reflections from the boundaries of the room cause large spatial variations in the sound pressure level.  Variations up to 30 dB are normal, not only at the room modes, but basically at all frequencies....... As sound propagates in time, it seems natural that the problems can best be analyzed and solved in the time domain. A time based room correction system named CABS (Controlled Acoustical Bass System) has been developed for sound reproduction in rectangular listening rooms. It can control the sound...... distribution in the room at low frequencies by using multiple loudspeakers together with an optimal placement of the loudspeakers.  At low frequencies CABS will create a plane wave from the front wall loudspeakers which will be absorbed by additional loudspeakers at the rear wall giving an almost homogeneous...

  20. Electro-deposition painting process improvement of cab truck by Six Sigma concept

    Science.gov (United States)

    Kawitu, Kitiya; Chutima, Parames

    2017-06-01

    The case study company is a manufacturer of trucks and currently facing a high rework cost due to the thickness of the electro-deposited paint (EDP) of the truck cab is lower than standard. In addition, the process capability is very low. The Six Sigma concept consisting of 5 phases (DMAIC) is applied to determine new parameter settings for each significant controllable factor. After the improvement, EDP thickness of the truck cab increases from 17.88μ to 20μ (i.e. standard = 20 ± 3μ). Moreover, the process capability indexes (Cp and Cpk) are increased from 0.9 to 1.43, and from 0.27 to 1.43, respectively. This improvement could save the rework cost about 1.6M THB per year.

  1. CAB-DWTM for 5 μm trace-width deposition of solar cell metallization top-contacts

    Energy Technology Data Exchange (ETDEWEB)

    Justin Hoey; Drew Thompson; Matt Robinson; Zakaria Mahmud; Orven F. Swenson; Iskander S. Akhatov; Douglas L. Schulz

    2009-06-08

    This paper reviews methods for creating solar cell grid contacts and explores how cell efficiency can be increased using CAB-DW{trademark}. Specifically, the efficiency of p-i-n structure solar cells built in-house with 90 {micro}m sputtered lines and 5 {micro}m CAB-DW lines were compared. Preliminary results of the comparison show a marked improvement in solar cell efficiency using CAB-DW. In addition to this, a theoretical and experimental analysis of the dynamics of particle impaction on a substrate (i.e. whether particle stick or bounce) will be discussed including how this analysis may lead to further improvement of CAB-DW.

  2. Sleeper Cab Climate Control Load Reduction for Long-Haul Truck Rest Period Idling

    Energy Technology Data Exchange (ETDEWEB)

    Lustbader, J. A.; Kreutzer, C.; Adelman, S.; Yeakel, S.; Zehme, J.

    2015-04-29

    Annual fuel use for long-haul truck rest period idling is estimated at 667 million gallons in the United States. The U.S. Department of Energy’s National Renewable Energy Laboratory’s CoolCab project aims to reduce heating, ventilating, and air conditioning (HVAC) loads and resulting fuel use from rest period idling by working closely with industry to design efficient long-haul truck climate control systems while maintaining occupant comfort. Enhancing the thermal performance of cab/sleepers will enable smaller, lighter, and more cost-effective idle reduction solutions. In order for candidate idle reduction technologies to be implemented at the original equipment manufacturer and fleet level, their effectiveness must be quantified. To address this need, a number of promising candidate technologies were evaluated through experimentation and modeling to determine their effectiveness in reducing rest period HVAC loads. For this study, load reduction strategies were grouped into the focus areas of solar envelope, occupant environment, and conductive pathways. The technologies selected for a complete-cab package of technologies were “ultra-white” paint, advanced insulation, and advanced curtains. To measure the impact of these technologies, a nationally-averaged solar-weighted reflectivity long-haul truck paint color was determined and applied to the baseline test vehicle. Using the complete-cab package of technologies, electrical energy consumption for long-haul truck daytime rest period air conditioning was reduced by at least 35% for summer weather conditions in Colorado. The National Renewable Energy Laboratory's CoolCalc model was then used to extrapolate the performance of the thermal load reduction technologies nationally for 161 major U.S. cities using typical weather conditions for each location over an entire year.

  3. Pesticide aerosol characteristics in the vicinity of an agricultural vehicle cab during application.

    Science.gov (United States)

    Bémer, Denis; Fismes, Joelle; Subra, Isabelle; Blachère, Veronique; Protois, Jean-Claude

    2007-07-01

    Pesticide spraying for crop protection leads to the formation of a mist of droplets, part of which is dispersed into the atmosphere. The characteristics of this aerosol, namely its particle size distribution and concentration, were measured during five campaigns involving cereal crop growing, wine grape culture, and orcharding. The measurement method incorporated a tracer product (fluorescein) with the treatment product; the pesticide aerosol concentration was then deduced from the tracer concentration. This method was validated by comparing the pesticide concentration determined by tracing with the concentration determined by direct measurement of the active substance of the pesticide. Concentration was measured using sampling filters, and particle size distribution was measured using cascade impactors. Instruments were mounted on an agricultural vehicle cab to optimize aerosol characterization, and then the cab's confinement efficiency was determined. Aerosols analyzed were fine, featuring mass median diameters between 4 microm and 15 microm; they are therefore highly dispersive. Their concentration is sufficiently high to justify operator protection by an efficient, filtered-air, pressurized cab, especially in wine grape culture and orcharding, which are the sectors where the highest pesticide transfers have been observed.

  4. Conceptual design study for an advanced cab and visual system, volume 1

    Science.gov (United States)

    Rue, R. J.; Cyrus, M. L.; Garnett, T. A.; Nachbor, J. W.; Seery, J. A.; Starr, R. L.

    1980-01-01

    A conceptual design study was conducted to define requirements for an advanced cab and visual system. The rotorcraft system integration simulator is for engineering studies in the area of mission associated vehicle handling qualities. Principally a technology survey and assessment of existing and proposed simulator visual display systems, image generation systems, modular cab designs, and simulator control station designs were performed and are discussed. State of the art survey data were used to synthesize a set of preliminary visual display system concepts of which five candidate display configurations were selected for further evaluation. Basic display concepts incorporated in these configurations included: real image projection, using either periscopes, fiber optic bundles, or scanned laser optics; and virtual imaging with helmet mounted displays. These display concepts were integrated in the study with a simulator cab concept employing a modular base for aircraft controls, crew seating, and instrumentation (or other) displays. A simple concept to induce vibration in the various modules was developed and is described. Results of evaluations and trade offs related to the candidate system concepts are given, along with a suggested weighting scheme for numerically comparing visual system performance characteristics.

  5. Vehicle design influences whole body vibration exposures: effect of the location of the front axle relative to the cab.

    Science.gov (United States)

    Blood, Ryan P; Rynell, Patrik W; Johnson, Peter W

    2011-06-01

    Using a repeated measure design, this study compared differences in whole body vibration (WBV) exposures among 13 drivers who drove a truck with the cab over the front axle (cab-over design) and a truck with the cab situated behind the front axle (non-cab-over design). The drivers drove both trucks over a standardized route that comprised three distinct segments: a freeway segment, a city street segment with stop-and-go driving (traffic lights), and a city street segment without traffic lights. A portable WBV data acquisition system collected tri-axial time-weighted and raw WBV data per ISO 2631-1 and 2631-5 standards. Simultaneous global positioning system (GPS) data were also collected to compare vehicle speeds. The GPS data indicated that there were no speed differences between the two vehicles. However, average and impulsive z-axis vibration levels were significantly higher for the cab-over design than for the non-cab-over design. In addition, significant WBV exposure differences between road types were found, with the freeway segments having the lowest exposures and the city street segments without traffic lights having the highest exposures. Vehicle type and the associated WBV exposures should be considered when purchasing vehicles to be used by full-time professional vehicle operators.

  6. Determinants of tobacco use and prevalence of oral precancerous lesions in cab drivers in Bengaluru City, India

    Directory of Open Access Journals (Sweden)

    Punith Shetty

    2017-01-01

    Full Text Available Background: Tobacco is a most important risk factor for various types of cancer as well as some noncommunicable disease. Around 34.6% of Indian population consume tobacco. The tobacco consumption is higher in some vulnerable population such as drivers, daily wage laborers, and policemen. Tobacco consumption is known to cause oral cancers, and screening for oral cancer in these individuals is known to reduce mortality from cancer. The study was designed to assess the determinants of tobacco use and the prevalence of oral precancerous lesions in cab drivers. Methods: This is a cross-sectional study among cab drivers at prepaid taxi counters in Bengaluru city. A total of 450 cab drivers were enrolled in the study, of which 225 cab drivers were interviewed during morning hours and remaining half at night time using a semi-structured questionnaire. All were screened for oral cancer/precancerous lesions. Results: Nearly 70.88% of cab drivers were consuming tobacco in any form. Long working hours, working at night, and family members consuming tobacco were significant risk factors for tobacco use among cab drivers. Forty-eight drivers were detected to have oral precancerous lesions. Conclusions: It was very evident that long hours of driving and infrequent shifts played a greater role in acquiring the habit. Behavioral counseling and new laws need to be formed to limit the working hours in drivers to have an effective tobacco control.

  7. A novel biomarker associated with distress in humans: calcium-binding protein, spermatid-specific 1 (CABS1).

    Science.gov (United States)

    Ritz, Thomas; Rosenfield, David; St Laurent, Chris D; Trueba, Ana F; Werchan, Chelsey A; Vogel, Pia D; Auchus, Richard J; Reyes-Serratos, Eduardo; Befus, A Dean

    2017-06-01

    Calcium-binding protein spermatid-specific 1 (CABS1) is expressed in the human submandibular gland and has an anti-inflammatory motif similar to that in submandibular rat 1 in rats. Here, we investigate CABS1 in human saliva and its association with psychological and physiological distress and inflammation in humans. Volunteers participated across three studies: 1) weekly baseline measures; 2) a psychosocial speech and mental arithmetic stressor under evaluative threat; and 3) during academic exam stress. Salivary samples were analyzed for CABS1 and cortisol. Additional measures included questionnaires of perceived stress and negative affect; exhaled nitric oxide; respiration and cardiac activity; lung function; and salivary and nasal inflammatory markers. We identified a CABS1 immunoreactive band at 27 kDa in all participants and additional molecular mass forms in some participants. One week temporal stability of the 27-kDa band was satisfactory (test-retest reliability estimate = 0.62-0.86). Acute stress increased intensity of 18, 27, and 55 kDa bands; 27-kDa increases were associated with more negative affect and lower heart rate, sympathetic activity, respiration rate, and minute ventilation. In both acute and academic stress, changes in 27 kDa were positively associated with salivary cortisol. The 27-kDa band was also positively associated with VEGF and salivary leukotriene B4 levels. Participants with low molecular weight CABS1 bands showed reduced habitual stress and negative affect in response to acute stress. CABS1 is readily detected in human saliva and is associated with psychological and physiological indicators of stress. The role of CABS1 in inflammatory processes, stress, and stress resilience requires careful study. Copyright © 2017 the American Physiological Society.

  8. CABS-dock web server for the flexible docking of peptides to proteins without prior knowledge of the binding site.

    Science.gov (United States)

    Kurcinski, Mateusz; Jamroz, Michal; Blaszczyk, Maciej; Kolinski, Andrzej; Kmiecik, Sebastian

    2015-07-01

    Protein-peptide interactions play a key role in cell functions. Their structural characterization, though challenging, is important for the discovery of new drugs. The CABS-dock web server provides an interface for modeling protein-peptide interactions using a highly efficient protocol for the flexible docking of peptides to proteins. While other docking algorithms require pre-defined localization of the binding site, CABS-dock does not require such knowledge. Given a protein receptor structure and a peptide sequence (and starting from random conformations and positions of the peptide), CABS-dock performs simulation search for the binding site allowing for full flexibility of the peptide and small fluctuations of the receptor backbone. This protocol was extensively tested over the largest dataset of non-redundant protein-peptide interactions available to date (including bound and unbound docking cases). For over 80% of bound and unbound dataset cases, we obtained models with high or medium accuracy (sufficient for practical applications). Additionally, as optional features, CABS-dock can exclude user-selected binding modes from docking search or to increase the level of flexibility for chosen receptor fragments. CABS-dock is freely available as a web server at http://biocomp.chem.uw.edu.pl/CABSdock. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

  9. A New Universal Second-Order Filter using Configurable Analog Building Blocks (CABs for Filed-Programmable Analogue Arrays

    Directory of Open Access Journals (Sweden)

    M. T. Abuelma'atti

    2011-06-01

    Full Text Available In this paper, the design of a universal second-order filter using configurable analog blocks (CABs for field programmable analog arrays is presented. The configurable blocks are capable of performing integration, differentiation, amplification, log, anti-log, add and negate functions. To maintain high frequency operation, the programmability and configurability of the blocks are achieved by digitally modifying the block's biasing conditions. Using at most four CABs, this article shows that it is possible to design a versatile second-order filter realizing all the standard five filter functions; lowpass, highpass, bandpass, notch and allpass. SPICE simulation results using practical bipolar junction transistor (BJT parameters confirm the feasibility of using the CABs in designing second-order filters.

  10. Ergonomics in drivers' cabs on open-cast mining machines; Ergonomie bei Fuehrerstaenden auf Tagebaugeraeten

    Energy Technology Data Exchange (ETDEWEB)

    Vater, L. [Ergonomie/Gefahrstoffe, Vattenfall Europe Mining AG, Senftenberg (Germany)

    2004-08-12

    Ergonomically designed driver's cabs also contribute directly to the increase in safety at work. In the course of the electrical re-design of the open-cast mining machines new drivers' cabs, which eliminate ergonomic deficits, were used. Other important aspects in addition to the improvements in the environmental factors noise, vibration and dust, are in particular the visibility conditions, visualisation of process data and monitoring as well as operating concepts. Taking into account the different types of machine drivers' cabs with a modified basic design and bearing design are used. Optimisation of the installation of the monitors and the basic structuring of the control panels was carried out. In addition to the increase in the effectiveness of control another aim is to minimise faulty operation by the driver when changing machines frequently. (orig.)

  11. Assessment of cognitive function in patients with stress-related exhaustion using the Cognitive Assessment Battery (CAB).

    Science.gov (United States)

    Ellbin, Susanne; Engen, Nina; Jonsdottir, Ingibjörg H; Nordlund, Arto I K

    2017-11-05

    The health care system is facing an increased number of patients seeking care for burnout/stress-related exhaustion. One of the core features of this condition is cognitive impairment-effective and easy tools are needed to assess cognition in this patient group. Our objective was to determine whether the Cognitive Assessment Battery (CAB) could be used for this purpose. Ninety-three patients diagnosed with exhaustion disorder (ED) and 111 controls were included in the study and tested with CAB. CAB consists of six short tests covering the cognitive domains speed and attention, episodic memory, visuospatial, language, and executive functions. The patients also completed questionnaires on subjective memory problems, degree of burnout, anxiety, and depression. The patients performed worse than the controls on four tests of speed and attention, language, and executive function. Subjective memory problems, degree of burnout, and anxiety did not influence cognitive performance, only degree of depression influenced performance negatively on an executive test. CAB is a useful instrument for rapid, comprehensive screening of cognitive status in patients with stress-related exhaustion. Using it, we confirmed the most replicated findings regarding cognitive impairments in patients with stress-related exhaustion.

  12. CAB Contribution to HARMONI: The first light spectrograph of the E-ELT

    Science.gov (United States)

    Piqueras López, J.; Arribas, S.; Calcines, A.

    2017-03-01

    HARMONI (High Angular Resolution Monolithic Optical and Near-infrared Integral field spectrograph) is a visible and near-infrared (0.47 to 2.45 μm) integral field spectrograph selected as a first-light instrument for the European Extremely Large Telescope (E-ELT). With four spatial scales (60, 20, 10 and 4 mas) and a wide range of spectral resolving powers (R=3500, 7500, 20000), HARMONI will allow scientists to address many of the E-ELT science cases. The HARMONI Consortium is led by the University of Oxford, and is also formed by the UK Astronomy Technology Centre (UKATC, Edinburgh, UK), Centre de Recherche Astrophysique de Lyon (CRAL), Laboratoire d'Astrophysique de Marseille (LAM), Instituto de Astrofísica de Canarias (IAC, Spain) and the Centro de Astrobiología (CAB INTA-CSIC, Spain). We summarize here the current status of the project, and describe the participation of CAB to design and manufacture two of the instrument sub-systems: the calibration unit and the secondary guiding module. The calibration unit will simulate the optical output of the telescope, and provide the functionality needed to illuminate the focal plane in such a way that the following type of data can be obtained: data aimed at removing the instrumental signature from the raw data and to convert the data into a data product that uses physical units, data required for monitoring the status of the instrument, and data required for calibrating the secondary guiding subsystem. The secondary guiding subsystem basic requirement is to provide knowledge (relative or absolute) of the location of the science focal plane on timescales of a few seconds and longer (up to months), with an accuracy of 2mas or 0.1x the input FWHM (at H/K bands), whichever is greater. The subsystem should achieve this level performance for different observation modes, e.g. no- AO, GLAO and LTAO modes.

  13. Comparison of MERV 16 and HEPA filters for cab filtration of underground mining equipment.

    Science.gov (United States)

    Cecala, A B; Organiscak, J A; Noll, J D; Zimmer, J A

    2016-08-01

    Significant strides have been made in optimizing the design of filtration and pressurization systems used on the enclosed cabs of mobile mining equipment to reduce respirable dust and provide the best air quality to the equipment operators. Considering all of the advances made in this area, one aspect that still needed to be evaluated was a comparison of the efficiencies of the different filters used in these systems. As high-efficiency particulate arrestance (HEPA) filters provide the highest filtering efficiency, the general assumption would be that they would also provide the greatest level of protection to workers. Researchers for the U.S. National Institute for Occupational Safety and Health (NIOSH) speculated, based upon a previous laboratory study, that filters with minimum efficiency reporting value, or MERV rating, of 16 may be a more appropriate choice than HEPA filters in most cases for the mining industry. A study was therefore performed comparing HEPA and MERV 16 filters on two kinds of underground limestone mining equipment, a roof bolter and a face drill, to evaluate this theory. Testing showed that, at the 95-percent confidence level, there was no statistical difference between the efficiencies of the two types of filters on the two kinds of mining equipment. As the MERV 16 filters were less restrictive, provided greater airflow and cab pressurization, cost less and required less-frequent replacement than the HEPA filters, the MERV 16 filters were concluded to be the optimal choice for both the roof bolter and the face drill in this comparative-analysis case study. Another key finding of this study is the substantial improvement in the effectiveness of filtration and pressurization systems when using a final filter design.

  14. STUDY OF TRANSMISSION LINES EFFECT ON THE SYSTEM OPERATIONON OF CONTINUOUS AUTOMATIC CAB SIGNALLING

    Directory of Open Access Journals (Sweden)

    O. O. Hololobova

    2014-10-01

    Full Text Available Purpose. To conduct an effect research of the electromagnetic field of high-voltage transmission lines (HVTL (750 kV, 50 Hz on the track circuits and continuous automatic cab signalling (CACS with a signal current of 50 Hz in the areas of convergence and intersection with the transmission lines and to propose possible methods to improve noise immunity of CACS. Methodology. The measurements were performed both by means of car-laboratory and directly on rail lines. During the study the electric field strength in the range of industrial frequency directly under the transmission lines and at the distance from it to the railway lines was measured, as well as the time dependence of CACS codes with signal current frequency of 50 Hz directly under the transmission lines and at a distance from it in the absence of the train and its passing. Findings. The root causes analysis of CACS faults and failures was carried out. The effect of the electromagnetic field of high-voltage transmission lines (750 kV, 50 Hz on the track circuit and CACS with signal current of 50 Hz in the areas of convergence and intersection with the transmission line was investigated. Possible methods to improve noise immunity of CACS were considered. Originality. The effect research of transmission lines (750 kV on the operation of the automatic cab signalling on spans Prishib-Burchatsk and Privolnoye-Yelizarovo, Pridneprovsk railway in places of oblique railroads crossing and transmission lines (750 kV, 50 Hz was conducted. Electric field strength in the range of industrial frequency directly under the transmission lines and at a distance from it to the railway line, as well as the time dependences of ALSN codes with signal current frequency of 50 Hz directly under the transmission lines and at a distance from it in the absence of the train and as its passing were measured. It was found that CACS codes in track circuits under transmission lines are strongly distorted, as strength

  15. Rediseño de la unidad de tracción para el iCab2

    OpenAIRE

    Asís González, José

    2011-01-01

    Este proyecto tenía como objetivo el rediseño de la unidad de tracción para la plataforma iCab2. Para ello se plantearon y se consiguieron los siguientes objetivos: • Introducción de mejoras al diseño de la unidad de tracción, que añaden funcionalidades y evitan errores de diseño de la versión anterior. • Fabricación de varias placas del módulo de potencia, con la idea de integrarlas en la versión del iCab1 y como repuestos para el futuro. • Fabricación de un cableado que hiciera más accesibl...

  16. Biochemical indicators of nutritional status and dietary intake in Costa Rican Cabécar Indian adolescents.

    Science.gov (United States)

    Monge-Rojas, Rafael; Barrantes, Mauro; Holst, Ileana; Nuñez-Rivas, Hilda; Alfaro, Thelma; Rodríguez, Sara; Cunningham, Lowella; Cambronero, Priscilla; Salazar, Lisbeth; Herrmann, F H

    2005-03-01

    The purpose of this study was to determine the blood levels of selected nutritional status indicators and the dietary intake of Costa Rican Cabécar Indians aged 10 to 16 years. The results showed that 65% of the adolescents had an adequate body mass index (BMI) for their age, and 32% had a BMI 10 micromol/L (29%), and homozygous mutation of methylenetetrahydrofolate reductase (MTHFR) (49%). The diet was poor, being high in saturated fat and low in polyunsaturated fat, fiber, and several micronutrients. The dietary intakes of more than 55% of the adolescents did not meet 50% of the estimated average requirements (EAR) for zinc, vitamin A, vitamin C, vitamin B12, vitamin B2, and folate. Furthermore, a high prevalence of parasitosis was found (68%). Our results show an adolescent Cabécar population with a mosaic of nutritional deficiencies and cardiovascular risk factors.

  17. "Dammed Taxi Cab"--How Silent Communication in Questionnaires Can Be Understood and Used to Give Voice to Children's Experiences

    Science.gov (United States)

    Alerby, E.; Kostenius, C.

    2011-01-01

    "Dammed taxi cab"--a 12-year-old boy wrote these words in the margins of a questionnaire, and within this paper they will serve as a point of departure for the discussion of the use of questionnaires as a way to voice children's experiences. The overall aim of this paper is to enable understanding of and discuss the use of questionnaires as a way…

  18. Impacts of Luminosity in the Cab at Night on the Dynamic Distance of Visual Cognition

    Directory of Open Access Journals (Sweden)

    Weihua Zhao

    2014-02-01

    Full Text Available Suddenly encountering light sources at night will reduce drivers' dynamic distance of visual cognition. In order to investigate the law of quantitative changes of the visual recognition distance under the conditions of different speeds and different environmental luminosity around drivers, calibration experiments were conducted on an actual road. And on the basis of the data set from the experiments, using the method of curved surface regression analysis, the function models describing the rule of the visual recognition distance changing with the environmental luminosity around drivers and running speeds were established. The models were effective via statistical tests. Furthermore, combined with the automobile braking distance, the reaction time allowed for drivers and the critical speeds were analyzed then. Verification tests were also designed to test the established function model. Results showed that as the environmental luminosity around drivers increases, vision recognition distance decreases; as vehicle speed increases, vision recognition distance decreases. Therefore, the sudden showing-up light sources will affect the environmental luminosity in the cab and lead to the reduction in the visual recognition distance as well as the reaction time for drivers. In this circumstance, drivers must control the speed lower than the critical speed to avoid collision.

  19. Computational analysis of ammonia transfer along two intramolecular tunnels in Staphylococcus aureus glutamine-dependent amidotransferase (GatCAB).

    Science.gov (United States)

    Dewage, Sajeewa Walimuni; Cisneros, G Andrés

    2015-03-05

    Most bacteria and all archaea misacylate the tRNAs corresponding to Asn and Gln with Asp and Glu (Asp-tRNA(Asn) and Glu-tRNA(Gln)).The GatCAB enzyme of most bacteria converts misacylated Glu-tRNA(Gln) to Gln-tRNA(Gln) in order to enable the incorporation of glutamine during protein synthesis. The conversion process involves the intramolecular transfer of ammonia between two spatially separated active sites. This study presents a computational analysis of the two putative intramolecular tunnels that have been suggested to describe the ammonia transfer between the two active sites. Molecular dynamics simulations have been performed for wild-type GatCAB of S. aureus and its mutants: T175(A)V, K88(B)R, E125(B)D, and E125(B)Q. The two tunnels have been analyzed in terms of free energy of ammonia transfer along them. The probability of occurrence of each type of tunnel and the variation of the probability for wild-type GatCAB and its mutants is also discussed.

  20. A protocol for CABS-dock protein-peptide docking driven by side-chain contact information.

    Science.gov (United States)

    Kurcinski, Mateusz; Blaszczyk, Maciej; Ciemny, Maciej Pawel; Kolinski, Andrzej; Kmiecik, Sebastian

    2017-08-18

    The characterization of protein-peptide interactions is a challenge for computational molecular docking. Protein-peptide docking tools face at least two major difficulties: (1) efficient sampling of large-scale conformational changes induced by binding and (2) selection of the best models from a large set of predicted structures. In this paper, we merge an efficient sampling technique with external information about side-chain contacts to sample and select the best possible models. In this paper we test a new protocol that uses information about side-chain contacts in CABS-dock protein-peptide docking. As shown in our recent studies, CABS-dock enables efficient modeling of large-scale conformational changes without knowledge about the binding site. However, the resulting set of binding sites and poses is in many cases highly diverse and difficult to score. As we demonstrate here, information about a single side-chain contact can significantly improve the prediction accuracy. Importantly, the imposed constraints for side-chain contacts are quite soft. Therefore, the developed protocol does not require precise contact information and ensures large-scale peptide flexibility in the broad contact area. The demonstrated protocol provides the extension of the CABS-dock method that can be practically used in the structure prediction of protein-peptide complexes guided by the knowledge of the binding interface.

  1. Complete genome sequence of the biocontrol strain Pseudomonas protegens Cab57 discovered in Japan reveals strain-specific diversity of this species.

    Science.gov (United States)

    Takeuchi, Kasumi; Noda, Naomi; Someya, Nobutaka

    2014-01-01

    The biocontrol strain Pseudomonas sp. Cab57 was isolated from the rhizosphere of shepherd's purse growing in a field in Hokkaido by screening the antibiotic producers. The whole genome sequence of this strain was obtained by paired-end and whole-genome shotgun sequencing, and the gaps between the contigs were closed using gap-spanning PCR products. The P. sp. Cab57 genome is organized into a single circular chromosome with 6,827,892 bp, 63.3% G+C content, and 6,186 predicted protein-coding sequences. Based on 16S rRNA gene analysis and whole genome analysis, strain Cab57 was identified as P. protegens. As reported in P. protegens CHA0 and Pf-5, four gene clusters (phl, prn, plt, and hcn) encoding the typical antibiotic metabolites and the reported genes associated with Gac/Rsm signal transduction pathway of these strains are fully conserved in the Cab57 genome. Actually strain Cab57 exhibited typical Gac/Rsm activities and antibiotic production, and these activities were enhanced by knocking out the retS gene (for a sensor kinase acting as an antagonist of GacS). Two large segments (79 and 115 kb) lacking in the Cab57 genome, as compared with the Pf-5 genome, accounted for the majority of the difference (247 kb) between these genomes. One of these segments was the complete rhizoxin analog biosynthesis gene cluster (ca. 79 kb) and another one was the 115-kb mobile genomic island. A whole genome comparison of those relative strains revealed that each strain has unique gene clusters involved in metabolism such as nitrite/nitrate assimilation, which was identified in the Cab57 genome. These findings suggest that P. protegens is a ubiquitous bacterium that controls its biocontrol traits while building up strain-specific genomic repertoires for the biosynthesis of secondary metabolites and niche adaptation.

  2. Controlled Acoustic Bass System (CABS) A Method to Achieve Uniform Sound Field Distribution at Low Frequencies in Rectangular Rooms

    DEFF Research Database (Denmark)

    Celestinos, Adrian; Nielsen, Sofus Birkedal

    2008-01-01

    ), is introduced. The system utilizes front loudspeakers and extra loudspeakers on the opposite wall of the room processed to cancel out the rear-wall reflections, which effectively conveys a more uniform sound field. The system works in the time domain and presents good performance over the loudspeaker low......The sound field produced by loudspeakers at low frequencies in small- and medium-size rectangular listening rooms is highly nonuniform due to the multiple reflections and diffractions of sound on the walls and different objects in the room. A new method, called controlled acoustic bass system (CABS...

  3. Crash simulation of the new MAN truck cab family; Crashsimulation der neuen Fahrerhausbaureihe der MAN Nutzfahrzeuge AG

    Energy Technology Data Exchange (ETDEWEB)

    Riebeck, L. [MAN Nutzfahrzeuge AG, Muenchen (Germany)

    2000-07-01

    Attainment of a high level of safety for the occupants of trucks entails first and foremost the prevention of accidents by technical and other means. Because of the vehicle masses involved and the associated energy conversions collisions between trucks and massive obstrucles or collisions between one truck and another constitute a particular challenge. Data on real accidents shows that most of the collisions with serious consequences for the occupants are rear-end collisions. The basis for minimising the consequences of accidents is that the cab ensures an adequate survival space. The measures necessary for this can be ascertained in advance by crash simulation. The simulations performed show that beside an adequate basic rigidity the design of the cab mounts is of great importance. Comparison of the results of simulation with the tests performed reveals a high degree of correlation. Elaborate and cost-intensive test series and unsuccessful tests were therefore avoided. Not only must the cab structure be optimised, but also the retention system consisting of the seat with integrated belt tightener and airbag. Here the design of the seat pushes calculation to its limits. As a result of the high structural acceleration rates (>100 g), for example, vibrations may arise in the detent systems which consequently fail because teeth break off. (orig.) [German] Die Realisierung eines hohen Sicherheitsniveaus fuer die Insassen von Nutzfahrzeugen bedeutet zunaechst die Vermeidung von Unfaellen durch technische und andere Massnahmen. Kollisionen von Nutzfahrzeugen mit massiven Hindernissen oder Kollisionen untereinander stellen aufgrund der Fahrzeugmassen mit den damit verbundenen grossen Energieumsaetze eine besondere Herausforderung dar. Das reale Unfallgeschehen zeigt, dass es sich beim ueberwiegenden Teil der fuer die Lkw-Insassen folgenschweren Kollisionen um Auffahrunfaelle handelt. Grundlage fuer die Unfallfolgenminimierung ist, dass das Fahrerhaus einen ausreichenden

  4. 49 CFR Appendix F to Part 238 - Alternative Dynamic Performance Requirements for Front End Structures of Cab Cars and MU Locomotives

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Alternative Dynamic Performance Requirements for... TRANSPORTATION PASSENGER EQUIPMENT SAFETY STANDARDS Pt. 238, App. F Appendix F to Part 238—Alternative Dynamic... and allow for the application of dynamic performance criteria to cab cars and MU locomotives as an...

  5. The Gravita 10BB. A modular locomotive with a central cab; Modulare Mittelfuehrerhaus-Lokomotive Gravita 10BB

    Energy Technology Data Exchange (ETDEWEB)

    Klaua, Ulf; Brunkert, Daniel; Wolfgram, Dieter [Voith Turbo Lokomotivtechnik GmbH und Co. KG, Kiel (Germany)

    2009-05-15

    The consistent development of the Gravita family of locomotives has made it possible for the first time for train operating companies to benefit from the advantage of a high degree of modularity in the market segment of locomotives with central cabs. They can choose from a broad range of specifications offered to select the locomotive that best suits their transport needs and thereby provide the optimum economic response to competitors using the roads. The authors take the example of the Gravita 10BB to illustrate the family's various modules. The unfaltering aim of the development from the very beginning has been to reduce complexity. Particular importance has been attached to achieving the benefits customers want in terms of ease of operation and maintainability. (orig.)

  6. Simulation of Air Entrapment and Resin Curing During Manufacturing of Composite Cab Front by Resin Transfer Moulding Process

    Directory of Open Access Journals (Sweden)

    Kuppusamy Raghu Raja Pandiyan

    2017-09-01

    Full Text Available Mould filling and subsequent curing are the significant processing stages involved in the production of a composite component through Resin Transfer Moulding (RTM fabrication technique. Dry spot formation and air entrapment during filling stage caused by improper design of filling conditions and locations that lead to undesired filling patterns resulting in defective RTM parts. Proper placement of inlet ports and exit vents as well as by adjustment of filling conditions can alleviate the problems during the mould filling stage. The temperature profile used to polymerize the resin must be carefully chosen to reduce the cure time. Instead of trial and error methods that are expensive, time consuming, and non-optimal, we propose a simulation-based optimization strategy for a composite cab front component to reduce the air entrapment and cure stage optimization. In order to be effective, the optimization strategy requires an accurate simulation of the process utilizing submodels to describe the raw material characteristics. Cure reaction kinetics and chemo-rheology were the submodels developed empirically for an unsaturated polyester resin using experimental data. The simulations were performed using commercial software PAM RTM 2008, developed by ESI Technologies. Simulation results show that the use of increase in injection pressure at the inlet filling conditions greatly reduce the air entrapped. For the cab front, the alteration of injection pressure with proper timing of vent opening reduced the air entrapped during mould filling stage. Similarly, the curing simulation results show that the use of higher mould temperatures effectively decreases the cure time as expected.

  7. Measuring the performance of attention networks with the Dalhousie Computerized Attention Battery (DalCAB: Methodology and reliability in healthy adults

    Directory of Open Access Journals (Sweden)

    Stephanie Anne Holland Jones

    2016-06-01

    Full Text Available Attention is an important, multifaceted cognitive domain that has been linked to three distinct, yet interacting, networks: alerting, orienting, and executive control. The measurement of attention and deficits of attention within these networks is critical to the assessment of many neurological and psychiatric conditions in both research and clinical settings. The Dalhousie Computerized Attention Battery (DalCAB was created to assess attentional functions related to the three attention networks using a range of tasks including: simple reaction time, go/no-go, choice reaction time, dual task, flanker, item and location working memory and visual search. The current study provides preliminary normative data, test-retest reliability (intraclass correlations and practice effects in DalCAB performance 24-hours after baseline for healthy young adults (n = 96, 18-31 years. Performance on the DalCAB tasks demonstrated Good to Excellent test-retest reliability for mean reaction time, while accuracy and difference measures (e.g., switch costs, interference effects and working memory load effects were most reliable for tasks that require more extensive cognitive processing (e.g., choice reaction time, flanker, dual task, and conjunction search. Practice effects were common and pronounced at the 24-hour interval. In addition, performance related to specific within-task parameters of the DalCAB sub-tests provides preliminary support for future formal assessment of the convergent validity of our interpretation of the DalCAB as a potential clinical and research assessment tool for measuring aspects of attention related to the alerting, orienting and executive control networks.Keywords: computerized assessment; attention; orienting; alerting; executive function

  8. Active low frequency sound field control in a listening room using CABS (Controlled Acoustic Bass System) will also reduce the sound transmitted to neighbour rooms

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2012-01-01

    is possible at modal frequencies. For that reason the modal frequencies in the source room will also have big impact on the transmission to neighbour rooms. These low frequency resonance frequencies are very audible in the source room but also in neighbour rooms as a booming bass. CABS (Controlled Acoustic......Sound in rooms and transmission of sound between rooms gives the biggest problems at low frequencies. Rooms with rectangular boundaries have strong resonance frequencies and will give big spatial variations in sound pressure level (SPL) in the source room, and an increase in SPL of 20 dB at a wall...... Bass System) is a time based room correction system for reproduced sound using loudspeakers. The system can remove room modes at low frequencies, by active cancelling the reflection from at the rear wall to a normal stereo setup. Measurements in a source room using CABS and in two neighbour rooms have...

  9. The Chlamydomonas reinhardtii LI818 gene represents a distant relative of the cabI/II genes that is regulated during the cell cycle and in response to illumination.

    Science.gov (United States)

    Savard, F; Richard, C; Guertin, M

    1996-11-01

    In the green unicellular alga Chlamydomonas reinhardtii, as in higher plants, the expression of the genes encoding the chlorophyll a/b-binding (CAB) polypeptides associated with photosystem I (PSI) and photosystem II (PSII) is regulated by endogenous (circadian clock) and exogenous signals (light and temperature). The circadian clock ensures that the oscillation in the levels of the different cab mRNAs is continuously kept in phase with light/dark (LD) cycles and is maximal by the middle of the day. On the other hand, light controls the amplitude of the oscillations. We report here the cloning and characterization of the C. reinhardtii LI818 gene, which identifies a CAB-related polypeptide and whose expression is regulated quite differently from the cab I/II genes. We show: (1) that in LD synchronized Chlamydomonas cells LI818 mRNA accumulation is subject to dual regulation that involves separable regulation by light and an endogenous oscillator; (2) that LI818 mRNA is fully expressed several hours before the cab I/II mRNAs and that the latter accumulate concomitantly; (3) that blocking the electron flow through PSII using DCMU prevents cells from accumulating cab I/II mRNAs but not LI818 mRNA and (4) that the accumulation of LI818 mRNA is abolished by blocking cytoplasmic protein synthesis, suggesting that these regulatory mechanisms are mediated by labile proteins.

  10. In-vivo identification of direct electron transfer from Shewanella oneidensis MR-1 to electrodes via outer-membrane OmcA-MtrCAB protein complexes

    Energy Technology Data Exchange (ETDEWEB)

    Okamoto, Akihiro [Department of Applied Chemistry, School of Engineering, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-8656 (Japan); Nakamura, Ryuhei, E-mail: nakamura@light.t.u-tokyo.ac.jp [Department of Applied Chemistry, School of Engineering, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-8656 (Japan); Hashimoto, Kazuhito, E-mail: hashimoto@light.t.u-tokyo.ac.jp [Department of Applied Chemistry, School of Engineering, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-8656 (Japan); ERATO/JST, HASHIMOTO Light Energy Conversion Project (Japan)

    2011-06-30

    Graphical abstract: . Display Omitted Highlights: > Monolayer biofilm of Shewanella cells was prepared on an ITO electrode. > Extracellular electron transfer (EET) process was examined with series of mutants. > Direct ET was confirmed with outer-membrane-bound OmcA-MtrCAB complex. > The EET process was not prominently influenced by capsular polysaccharide. - Abstract: The direct electron-transfer (DET) property of Shewanella bacteria has not been resolved in detail due to the complexity of in vivo electrochemistry in whole-cell systems. Here, we report the in vivo assignment of the redox signal indicative of the DET property in biofilms of Shewanella oneidensis MR-1 by cyclic voltammetry (CV) with a series of mutants and a chemical marking technique. The CV measurements of monolayer biofilms formed by deletion mutants of c-type cytochromes ({Delta}mtrA, {Delta}mtrB, {Delta}mtrC/{Delta}omcA, and {Delta}cymA), and pilin ({Delta}pilD), capsular polysaccharide ({Delta}SO3177) and menaquinone ({Delta}menD) biosynthetic proteins demonstrated that the electrochemical redox signal with a midpoint potential at 50 mV (vs. SHE) was due to an outer-membrane-bound OmcA-MtrCAB protein complex of decaheme cytochromes, and did not involve either inner-membrane-bound CymA protein or secreted menaquinone. Using the specific binding affinity of nitric monoxide for the heme groups of c-type cytochromes, we further confirmed this conclusion. The heterogeneous standard rate constant for the DET process was estimated to be 300 {+-} 10 s{sup -1}, which was two orders of magnitude higher than that previously reported for the electron shuttling process via riboflavin. Experiments using a mutant unable to produce capsular polysaccharide ({Delta}SO3177) revealed that the DET property of the OmcA-MtrCAB complex was not influenced by insulating and hydrophilic extracellular polysaccharide. Accordingly, under physiological conditions, S. oneidensis MR-1 utilizes a high density of outer

  11. The Four-Tier Continuum of Academic and Behavioral Support (4T-CABS) Model: An Integrated Model for Medical Student Success.

    Science.gov (United States)

    Stegers-Jager, Karen M; Cohen-Schotanus, Janke; Themmen, Axel P N

    2017-11-01

    Not all students cope successfully with the demands of medical school, and students' struggles may result in study delay or dropout. To prevent these outcomes, medical schools need to identify students who are experiencing academic difficul ties and provide them with timely interventions through access to support programs. Although the importance of early identification and intervention is well recognized, less is known about successful strategies for identifying and supporting struggling students.Building on the literature and their own empirical findings, the authors propose an integrated, school-wide model for medical student success comprising a continuum of academic and behavioral support. This Four-Tier Continuum of Academic and Behavioral Support (4T-CABS) model focuses on improving both academic and behavioral outcomes by offering support for students at four levels, which range from adequate instruction for all, to targeted small-group interventions, to individualized support, and also include exit support for students who might be better off in another degree program. Additionally, medical schools should provide both academic and behavioral support; set high, yet realistic expectations and clearly communicate these to students; and intervene early, which requires timely identification of at-risk students who would benefit from the different types and tiers of support. Finally, interventions should be evidence based and fit the needs of the identified groups of students. The authors argue that adopting the core principles of the 4T-CABS model will enable medical schools to maximize academic engagement and performance for all students.

  12. Low frequency sound field control in rectangular listening rooms using CABS (Controlled Acoustic Bass System) will also reduce sound transmission to neighbor rooms

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2011-01-01

    from the rear wall, and thereby leaving only the plane wave in the room. With a room size of (7.8 x 4.1 x 2.8) m. it is possible to prevent modal frequencies up to 100 Hz. An investigation has shown that the sound transmitted to a neighbour room also will be reduced if CABS is used. The principle......Sound reproduction is often taking place in small and medium sized rectangular rooms. As rectangular rooms have 3 pairs of parallel walls the reflections at especially low frequencies will cause up to 30 dB spatial variations of the sound pressure level in the room. This will take place not only...... at resonance frequencies, but more or less at all frequencies. A time based room correction system named CABS (Controlled Acoustic Bass System) has been developed and is able to create a homogeneous sound field in the whole room at low frequencies by proper placement of multiple loudspeakers. A normal setup...

  13. Three-axial evaluation of whole-body vibration in agricultural telehandlers: The effects of an active cab-suspension system.

    Science.gov (United States)

    Caffaro, Federica; Preti, Christian; Micheletti Cremasco, Margherita; Cavallo, Eugenio

    2017-10-01

    Agricultural and earth-moving machinery operators are particularly exposed to whole-body vibration (WBV), which has severe effects on health and affects comfort and performance. Few studies have investigated vibrational safety and comfort issues in telescopic handlers. These vehicles are widespread in many off-road applications-such as construction, agriculture, and mining-used to handle loads and to lift persons and equipment. This study investigated the effects of an active hydro-pneumatic cab-suspension system fitted to a telehandler on a driver's vibration exposure along the x-, y-, and z-axes, through both objective and subjective assessments. Sixteen healthy professional telehandler drivers took part in the study. Objective measurements were acquired at the operator's seat, and subjective ratings were taken while participants drove the telehandler with either a deactivated or activated suspension system at 12 kph on an ISO 5008 smooth track. The results showed that the activation of the cab-suspension system reduced the root-mean-square acceleration along the x- and z-axes (p =.038 and p =.000, respectively). Moreover, the frequency analysis showed a reduction in the acceleration along the z-axis in the range of 2-25 Hz (p suspension systems are discussed.

  14. Acercamiento al proceso de socialización de la población infantil cabécar de chirripó

    Directory of Open Access Journals (Sweden)

    Watson Soto, Hannia

    2015-05-01

    Full Text Available Este artículo es producto de la investigación “Acercamiento al proceso de socialización de la población infantil cabécar de Chirripó”, que se desarrolló desde el Instituto de Investigación en Educación (INIE. La Universidad de Costa Rica como institución pública de educación superior, ha venido asumiendo la responsabilidad de contribuir a través de sus diferentes ámbitos de trabajo, en la resolución de necesidades de la comunidad nacional para la búsqueda de mejores condiciones de vida de todas las personas que la habitan, es así como en los últimos años ha generado reflexiones sobre la urgencia de generar procesos educativos con pertinencia cultural en las comunidades cabécares de Chirripó, este trabajo pretende aportar en este sentido. Para ello se recurre al estudio de los procesos de socialización de este grupo étnico para identificar las prácticas de crianza propias que les permiten construir y resignificar su identidad cultural, las cuales se concluye deben ser consideradas en la educación inicial formal para generar procesos educativos pertinentes y significativos.

  15. Low frequency sound field control in rectangular listening rooms using CABS (Controlled Acoustic Bass System) will also reduce sound transmission to neighbor rooms

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2011-01-01

    at resonance frequencies, but more or less at all frequencies. A time based room correction system named CABS (Controlled Acoustic Bass System) has been developed and is able to create a homogeneous sound field in the whole room at low frequencies by proper placement of multiple loudspeakers. A normal setup......Sound reproduction is often taking place in small and medium sized rectangular rooms. As rectangular rooms have 3 pairs of parallel walls the reflections at especially low frequencies will cause up to 30 dB spatial variations of the sound pressure level in the room. This will take place not only...... from the rear wall, and thereby leaving only the plane wave in the room. With a room size of (7.8 x 4.1 x 2.8) m. it is possible to prevent modal frequencies up to 100 Hz. An investigation has shown that the sound transmitted to a neighbour room also will be reduced if CABS is used. The principle...

  16. The novel dopamine D3 receptor antagonists/partial agonists CAB2-015 and BAK4-54 inhibit oxycodone-taking and oxycodone-seeking behavior in rats.

    Science.gov (United States)

    You, Zhi-Bing; Gao, Jun-Tao; Bi, Guo-Hua; He, Yi; Boateng, Comfort; Cao, Jianjing; Gardner, Eliot L; Newman, Amy Hauck; Xi, Zheng-Xiong

    2017-11-01

    The use of prescription opioid analgesics, particularly oxycodone, has dramatically increased, and parallels escalated opioid abuse and drug-related deaths worldwide. Understanding the molecular mechanisms underlying the development of opioid dependence and expanding treatment options to counter prescription opioid abuse has become a critical public health matter. In the present study, we first evaluated the reinforcing effects of oxycodone in a rat model of self-administration and then explored the potential utility of two novel high affinity dopamine D3 receptor (D3R) antagonists/partial agonists, CAB2-015 and BAK4-54, for treatment of prescription opioid abuse and dependence. We found that rats acquired oxycodone self-administration rapidly within a range of unit doses that was similar to that for heroin, confirming that oxycodone has significant abuse potential. Strikingly, pretreatment with either CAB2-015 or BAK4-54 (0.4-10 mg/kg, i.p.) dose-dependently decreased oxycodone self-administration, and shifted the oxycodone dose-response curve downward. Repeated pretreatment with CAB2-015 or BAK4-54 (0.4-4 mg/kg) facilitated extinction and inhibited oxycodone-induced reinstatement of drug-seeking behavior. In addition, pretreatment with CAB2-015 or BAK4-54 (4-10 mg/kg) also dose-dependently decreased oxycodone-enhanced locomotor activity, but only CAB2-015 decreased oral sucrose self-administration. These data suggest that D3R antagonists may be suitable alternatives or adjunctive to opioid-based medications currently used clinically in treating opioid addiction and that the D3R-selective ligands (CAB2-015 or BAK4-54) provide new lead molecules for development. Published by Elsevier Ltd.

  17. Color evaluation of seventeen European unifloral honey types by means of spectrophotometrically determined CIE L*Cab*h(ab)° chromaticity coordinates.

    Science.gov (United States)

    Tuberoso, Carlo Ignazio Giovanni; Jerković, Igor; Sarais, Giorgia; Congiu, Francesca; Marijanović, Zvonimir; Kuś, Piotr Marek

    2014-02-15

    CIE (Commission Internationale de l'Eclairage) L(*)Cab(*)h(ab)° color coordinates for 305 samples of 17 unifloral honeys types (asphodel, buckwheat, black locust, sweet chestnut, citrus, eucalyptus, Garland thorn, honeydew, heather, lime, mint, rapeseed, sage, strawberry tree, sulla flower, savory and thistle) from different geographic locations in Europe were spectrophotometrically assessed and statistically evaluated. Preliminary separation of unifloral honeys was obtained by means of L(*)-C(ab)(*) color coordination correlation. Hierarchical Cluster Analysis (HCA) revealed an expected segregation of the honeys types according to their chromatic characteristics. Principal Component Analysis (PCA) allowed to obtain a more defined distinction of the 17 unifloral honey types, particularly when using 3D graphics. CIE L(*)C(ab)(*)hab(*) color coordinates were useful for the identification of several honey types. The proposed method represents a simple and efficient procedure that can be used as a basis for the authentication of unifloral honeys worldwide. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. The Design and Implementation of Smart Monitoring System for Large-Scale Railway Maintenance Equipment Cab Based on ZigBee Wireless Sensor Network

    Directory of Open Access Journals (Sweden)

    Hairui Wang

    2014-06-01

    Full Text Available In recent years, organizations use IEEE 802.15.4 and ZigBee technology to deliver solution in variety areas including home environment monitoring. ZigBee technology has advantages on low-cost, low power consumption and self-forming. With the rapid expansion of the Internet, there is the requirement for remote monitoring large-scale railway maintenance equipment cab. This paper discusses the disadvantages of the existing smart monitoring system, and proposes a solution. A ZigBee wireless sensor network smart monitoring system and Wi-Fi network is integrated through a home gateway to increase the system flexibility. At the same time the home gateway cooperated with a pre- processing system provide a flexible user interface, and the security and safety of the smart monitoring system. To testify the efficiency of the proposed system, the temperature and humidity sensors and light sensors have developed and evaluated in the smart monitoring system.

  19. Pesticide application practices, pest knowledge, and cost-benefits of plantain production in the Bribri-Cabécar Indigenous Territories, Costa Rica.

    Science.gov (United States)

    Polidoro, Beth A; Dahlquist, Ruth M; Castillo, Luisa E; Morra, Matthew J; Somarriba, Eduardo; Bosque-Pérez, Nilsa A

    2008-09-01

    The use of pesticides in the cultivation of cash crops such as banana and plantain is increasing, in Costa Rica and worldwide. Agrochemical use and occupational and environmental exposures in export banana production have been documented in some parts of Central America. However, the extent of agrochemical use, agricultural pest knowledge, and economic components in plantain production are largely unknown in Costa Rica, especially in remote, high-poverty areas such as the Bribri-Cabécar Indigenous Territories. Our objective was to integrate a rapid rural appraisal of indigenous farmer pesticide application practices and pest knowledge with a cost-benefit analysis of plantain production in the Bribri-Cabécar Indigenous Territories, for the development of better agricultural management practices and improved regulatory infrastructure. Interviews conducted with 75 households in 5 indigenous communities showed that over 60% of participants grew plantain with agrochemicals. Of these plantain farmers, over 97% used the insecticide chlorpyrifos, and 84% applied nematicides, 64% herbicides, and 22% fungicides, with only 31% of participants reporting the use of some type of protective clothing during application. The banana weevil (Cosmopolites sordidus Germar) was ranked as the most important agricultural pest by 85% of participants, yet only 28% could associate the adult and larval form. A cost-benefit analysis conducted with a separate group of 26 plantain farmers identified several national markets and one export market for plantain production in the Indigenous Territories. Yearly income averaged US$6200/ha and yearly expenses averaged US$1872/ha, with an average cost-benefit ratio of 3.67 for plantain farmers. Farmers applied an average of 9.7 kg a.i./ha/yr of pesticide products and 375 kg/ha/yr of fertilizer, but those who sold their fruit to the national markets applied more nematicides, herbicides, and fertilizers than those who sold primarily to export markets

  20. Biochemical characterization of recombinant β-carbonic anhydrase (PgiCAb) identified in the genome of the oral pathogenic bacterium Porphyromonas gingivalis.

    Science.gov (United States)

    Del Prete, Sonia; Vullo, Daniela; De Luca, Viviana; AlOthman, Zeid; Osman, Sameh M; Supuran, Claudiu T; Capasso, Clemente

    2015-06-01

    Carbonic anhydrases (CAs, EC 4.2.1.1) belonging to the α-, β-, γ-, δ- and ζ-CAs are ubiquitous metalloenzymes present in prokaryotes and eukaryotes. CAs started to be investigated in detail only recently in pathogenic bacteria, in the search for antibiotics with a novel mechanism of action, since it has been demonstrated that in many such organisms they are essential for the life cycle of the organism. CA inhibition leads to growth impairment or growth defects in several pathogenic bacteria. The microbiota of the human oral mucosa consists of a myriad of bacterial species, Porphyromonas gingivalis being one of them and the major pathogen responsible for the development of chronic periodontitis. The genome of P. gingivalis encodes for a β- and a γ-CAs. Recently, our group purified the recombinant γ-CA (named PgiCA) which was shown to possess a significant catalytic activity for the reaction that converts CO2 to bicarbonate and protons, with a kcat of 4.1 × 10(5 )s(-1) and a kcat/Km of 5.4 × 10(7 )M(-1 )× s(-1). We have also investigated its inhibition profile with a range of inorganic anions such as thiocyanate, cyanide, azide, hydrogen sulfide, sulfamate and trithiocarbonate. Here, we describe the cloning, purification and kinetic parameters of the other class of CA identified in the genome of P. gingivalis, the β-CA, named PgiCAb. This enzyme has a good catalytic activity, with a kcat of 2.8 × 10(5 )s(-1) and a kcat/Km of 1.5 × 10(7 )M(-1 )× s(-1). PgiCAb was also inhibited by the clinically used sulfonamide acetazolamide, with an inhibition constant of 214 nM. The role of CAs as possible virulence factors of P. gingivalis is poorly understood at the moment but their good catalytic activity and the fact that they might be inhibited by a large number of compounds, which may pave the way for finding inhibitors with antibacterial activity that may elucidate these phenomena and lead to novel antibiotics.

  1. The small CAB-like proteins of the cyanobacterium Synechocystis sp. PCC 6803: their involvement in chlorophyll biogenesis for Photosystem II.

    Science.gov (United States)

    Hernandez-Prieto, Miguel A; Tibiletti, Tania; Abasova, Leyla; Kirilovsky, Diana; Vass, Imre; Funk, Christiane

    2011-09-01

    The five small CAB-like proteins (ScpA-E) of the cyanobacterium Synechocystis sp. PCC 6803 belong to the family of stress-induced light-harvesting-like proteins, but are constitutively expressed in a mutant deficient of Photosystem I (PSI). Using absorption, fluorescence and thermoluminescence measurements this PSI-less strain was compared with a mutant, in which all SCPs were additionally deleted. Depletion of SCPs led to structural rearrangements in Photosystem II (PSII): less photosystems were assembled; and in these, the Q(B) site was modified. Despite the lower amount of PSII, the SCP-deficient cells contained the same amount of phycobilisomes (PBS) as the control. Although the excess PBS were functionally disconnected, their fluorescence was quenched under high irradiance by the activated Orange Carotenoid Protein (OCP). Additionally the amount of OCP, but not of the iron-stress induced protein (isiA), was higher in this SCP-depleted mutant compared with the control. As previously described, the lack of SCPs affects the chlorophyll biosynthesis (Vavilin, D., Brune, D. C., Vermaas, W. (2005) Biochim Biophys Acta 1708, 91-101). We demonstrate that chlorophyll synthesis is required for efficient PSII repair and that it is partly impaired in the absence of SCPs. At the same time, the amount of chlorophyll also seems to influence the expression of ScpC and ScpD. 2011 Elsevier B.V. All rights reserved.

  2. Melatonin promotes adventitious root regeneration in in vitro shoot tip explants of the commercial sweet cherry rootstocks CAB-6P (Prunus cerasus L.), Gisela 6 (P. cerasus × P. canescens), and MxM 60 (P. avium × P. mahaleb).

    Science.gov (United States)

    Sarropoulou, Virginia N; Therios, Ioannis N; Dimassi-Theriou, Kortessa N

    2012-01-01

    The objectives of this study were to test the effects of melatonin (N-acetyl-5-methoxytryptamine), a natural compound of edible plants on the rooting of certain commercial sweet cherry rootstocks. Shoot tip explants from previous in vitro cultures of the cherry rootstocks CAB-6P (Prunus cerasus L.), Gisela 6 (P. cerasus × P. canescens), and M × M 60 (P. avium × P. mahaleb) were included in the experiment. The effect of indole-3-acetic acid (IAA) and indole-3-butyric acid (IBA) alone or in combination with melatonin was tested concerning their rooting potential. Seven concentrations of melatonin (0, 0.05, 0.1, 0.5, 1, 5, and 10 μM) alone or in combination with 5.71 μM of IAA or 4.92 μM of IBA were tested. For each rootstock, 21 treatments were included. The explants were grown in glass tubes containing 10 mL of substrate. The parameters measured include rooting percentage, number of roots per rooted explant, root length, and callus formation. The data presented in this study show that melatonin has a rooting promoting effect at a low concentration but a growth inhibitory effect at high concentrations. In the absence of auxin, 1 μM melatonin had auxinic response concerning the number and length of roots, but 10 μM melatonin was inhibitory to rooting in all the tested rootstocks. The final conclusion of this experiment is that exogenously applied melatonin acted as a rooting promoter and its action was similar to that of IAA. © 2011 John Wiley & Sons A/S.

  3. Barwood CNG Cab Fleet Study: Final Results

    Energy Technology Data Exchange (ETDEWEB)

    Whalen, P.; Kelly, K.; John, M.

    1999-05-03

    This report describes a fleet study conducted over a 12-month period to evaluate the operation of dedicated compress natural gas (CNG) Ford Crown Victoria sedans in a taxicab fleet. In the study, we assess the performance and reliability of the vehicles and the cost of operating the CNG vehicles compared to gasoline vehicles. The study results reveal that the CNG vehicles operated by this fleet offer both economic and environmental advantages. The total operating costs of the CNG vehicles were about 25% lower than those of the gasoline vehicles. The CNG vehicles performed as well as the gasoline vehicles, and were just as reliable. Barwood representatives and drivers have come to consider the CNG vehicles an asset to their business and to the air quality of the local community.

  4. Astrobiology with Robotic Telescopes at CAB

    Directory of Open Access Journals (Sweden)

    Luis Cuesta

    2010-01-01

    Full Text Available The key objectives of RTRCAB are the identification of new exoplanets and especially the characterization of the known exoplanets by observing photometric and systematic monitoring of their transits. These telescopes, equipped with advanced technology, optimized control programs, and optical and technical characteristics adequate for this purpose, are ideal to make the observations that are required to carry out these programs. The achievement of these goals is ensured by the existence of three separated geographical stations. In this sense, there are several planned missions that have the same objectives among their scientific goals, like Kepler, CoRoT, GAIA, and PLATO.

  5. Projeto de cabine de unidade mecânica de auxílio à colheita da cana-de-açúcar (unimac cana com base na ergonomia Cab design for a sugar cane harvesting machine based on ergonomics principles

    Directory of Open Access Journals (Sweden)

    Emanuel Antonio Barreto

    2013-05-01

    Full Text Available A mecanização da colheita da cana-de-açúcar parece ser o caminho para solução dos problemas decorrentes dos impactos ambientais das queimadas e do trabalho extremamente fatigante na colheita manual. Por outro lado, a mecanização total da colheita levaria milhares de trabalhadores ao desemprego. Para minimizar os impactos ambientais e manter parte desses empregos, a Agricef e a Unicamp estão desenvolvendo o projeto da unidade mecânica de auxílio à colheita da cana-de-açúcar (UNIMAC CANA, baseado em um conceito alternativo representado pela mecanização parcial da colheita, que está em fase de prototipagem. Particularmente, esta pesquisa teve como objetivo o dimensionamento da cabine desse dispositivo e o posicionamento de seus comandos e painéis, com base nas características antropométricas do operador brasileiro. Utilizou-se a metodologia projetual orientada pela preocupação com aspectos ergonômicos. As alternativas de projeto geradas através de quadros morfológicos culminaram no dimensionamento da cabine da máquina com sua disposição de comandos, painel e assento, de modo a acomodar o operador de forma segura e confortável. Através de simulação do campo visual do operador, concluiu-se que a cabine, adotando posição móvel em relação à maquina, seria uma opção viável de projeto nos atributos conforto e dirigibilidade.Sugar cane harvesting mechanization seems to be the solution for the problems related to the environment impact of sugar cane burning and to facilitate manual harvesting, which also is a extremely hard task. By the other way, full harvest mechanization would lead to a massive unemployment. To minimize environment impact and keep some of the harvesting jobs, Unicamp and Agricef are designing and building a harvesting machine that represents an alternative concept due to it partial harvesting mechanization. The main objective of this research is the design of the cab for this machine and the

  6. Slow Thinking and Deep Learning: Tversky and Kahneman's Taxi Cabs

    Science.gov (United States)

    Bedwell, Mike

    2015-01-01

    This article is based on classroom application of a problem story constructed by Amos Tversky in the 1970s. His intention was to evaluate human beings' intuitions about statistical inference. The problem was revisited by his colleague, the Nobel Prize winner Daniel Kahneman. The aim of this article is to show how popular science textbooks can…

  7. Signal Transduction Pathways that Regulate CAB Gene Expression

    Energy Technology Data Exchange (ETDEWEB)

    Chory, Joanne

    2006-01-16

    The process of chloroplast differentiation, involves the coordinate regulation of many nuclear and chloroplast genes. The cues for the initiation of this developmental program are both extrinsic (e.g., light) and intrinsic (cell-type and plastid signals). During this project period, we utilized a molecular genetic approach to select for Arabidopsis mutants that did not respond properly to environmental light conditions, as well as mutants that were unable to perceive plastid damage. These latter mutants, called gun mutants, define two retrograde signaling pathways that regulate nuclear gene expression in response to chloroplasts. A major finding was to identify a signal from chloroplasts that regulates nuclear gene transcription. This signal is the build-up of Mg-Protoporphyrin IX, a key intermediate of the chlorophyll biosynthetic pathway. The signaling pathways downstream of this signal are currently being studied. Completion of this project has provided an increased understanding of the input signals and retrograde signaling pathways that control nuclear gene expression in response to the functional state of chloroplasts. These studies should ultimately influence our abilities to manipulate plant growth and development, and will aid in the understanding of the developmental control of photosynthesis.

  8. Signal Transduction Pathways that Regulate CAB Gene Expression

    Energy Technology Data Exchange (ETDEWEB)

    Chory, Joanne

    2004-12-31

    The process of chloroplast differentiation, involves the coordinate regulation of many nuclear and chloroplast genes. The cues for the initiation of this developmental program are both extrinsic (e.g., light) and intrinsic (cell-type and plastid signals). During this project period, we utilized a molecular genetic approach to select for Arabidopsis mutants that did not respond properly to environmental light conditions, as well as mutants that were unable to perceive plastid damage. These latter mutants, called gun mutants, define two retrograde signaling pathways that regulate nuclear gene expression in response to chloroplasts. A major finding was to identify a signal from chloroplasts that regulates nuclear gene transcription. This signal is the build-up of Mg-Protoporphyrin IX, a key intermediate of the chlorophyll biosynthetic pathway. The signaling pathways downstream of this signal are currently being studied. Completion of this project has provided an increased understanding of the input signals and retrograde signaling pathways that control nuclear gene expression in response to the functional state of chloroplasts. These studies should ultimately influence our abilities to manipulate plant growth and development, and will aid in the understanding of the developmental control of photosynthesis.

  9. Echolocation caBs of twenty southern African bat species

    African Journals Online (AJOL)

    Morrison 1998; O'Farrell & Miller 1997; O'Farrell, Miller &. Gannon I 999a; Vaughan, Jones, & Harris 1997a), as well as to investigate the relationship between echolocation, flight morphology and foraging ecology (Fenton, Gaudet & Leon- ard 1983: Fenton 1985; 1986; Aldridge & Rautenbach 1987;. Norberg & Rayner 1987 ...

  10. Learning the CA-Bs: Resuscitation Training at Rwanda Military ...

    African Journals Online (AJOL)

    Abstract. Background There is a lack of trained staff to respond to critically ill patients and cardiac and respiratory arrests in a health facility in Rwanda. This lack of human resources can lead to poor patient outcomes. Therefore, innovative strategies to provide the best and most appropriate patient care, with limited ...

  11. Elucidating the Role of cAb1 and the Abi-Family of cAB1 Target Proteins in Cancer Development and Progression

    Science.gov (United States)

    2000-07-01

    Photoshop 5.0. Photography of some lower mag- cut on a Reichert Jung cryostat, mounted on CSS-100 nification images was performed with a Wild Photo...4 Schools marked " advertisement " in accordance with 18 U.S.C. section 1734. Physician-Scientist Program, sponsored by the Lucille P. Markey Charitable...Boehringer payment of page charges. This article must therefore be hereby suended, 5marked " advertisement " in accordance with 18 USC section Mannheim), 5

  12. Analisis Sumber Dan Penggunaan Modal Kerja Pada PT. Bank Tabungan Negara, (Persero) Tbk. Cab. Manado

    OpenAIRE

    MASWATU, A GHAZALI; PELLENG, FRENDY; Tampi, Dolina

    2016-01-01

    - Sources and uses of working capital determines the success of a banking company. Assessment of working capital in principle lead to; current assets, current liabilities and Working Capital Turnover. The purpose of this study was to determine how the implementation of the analysis of sources and uses of working capital at PT. Bank Tabungan Negara, Tbk, . branch Office of Manado. The method used is descriptive method using a quantitative approach to the analysis of financial statements. Data ...

  13. 49 CFR Appendix H to Part 229 - Static Noise Test Protocols-In-Cab Static

    Science.gov (United States)

    2010-10-01

    ... normal operating temperature. (5) The heating, ventilation and air conditioning (HVAC) system or a dedicated heating or air conditioner system must be operating on high, and the vents must be open and... accessible for review for a minimum of three years. All records may be maintained in either written or...

  14. TAXİCAB GEOMETRİ İLE İLGİLİ BAZI SONUÇLAR

    Directory of Open Access Journals (Sweden)

    S. Melike AYDOĞAN

    2011-05-01

    Full Text Available Bu çalışmada ilk olarak, Euclid Geometrisi ile ilgili bazı özellikler ispata girmeksizin verilmektedir. Daha sonra Taxicab geometrinin bazı temel özellikleri incelenmektedir. Son olarak da Taxicab Geometri'nin düzlemde Euclid Geometri'den farklı olduğu gösterilmektedir.

  15. Can the 2014 Comprehensive Agreement on the Bangsamoro (CAB) Succeed in Mindanao Where Previous Agreements Failed?

    Science.gov (United States)

    2015-03-01

    NA:i\\ IIE (S) AND ADDRESS(ES) 8. PERFORiVIING ORGANIZATION Naval Postgraduate School REPORT NUMBER Monterey, CA 93943-5000 9. SPONSORING /MONITORING...8 Rajat Ganguly, “Is Autonomy a Solution or an Obstacle to Resolving Ethno-National Conflicts,” in Autonomy and Ethnic Conflict in South and...2012), 3. 12 Ganguly, “Is Autonomy a Solution ,” 1. 3 effective means for managing regional

  16. OpenStreetCab: Exploiting Taxi Mobility Patterns in New York City to Reduce Commuter Costs

    OpenAIRE

    Salnikov, Vsevolod; Lambiotte, Renaud; Noulas, Anastasios; Mascolo, Cecilia

    2015-01-01

    The rise of Uber as the global alternative taxi operator has attracted a lot of interest recently. Aside from the media headlines which discuss the new phenomenon, e.g. on how it has disrupted the traditional transportation industry, policy makers, economists, citizens and scientists have engaged in a discussion that is centred around the means to integrate the new generation of the sharing economy services in urban ecosystems. In this work, we aim to shed new light on the discussion, by taki...

  17. Risk of serious injury of occupants involved in frontal crashes of cab-over-type trucks.

    Science.gov (United States)

    Jeon, Hyeok-Jin; Kim, Sang-Chul; Shin, Jaeho; Jung, Jae-Yoon; Lee, Kang-Hyun; Lee, Hee-Young; Kim, Ho-Jung

    2017-11-17

    Truck vehicles (TVs) have a different structure and stiffness than non-TVs and are used commercially for transporting goods. This study aimed to analyze whether truck occupants have a greater risk of serious injury than those of other types of vehicles. Crash data were obtained from the Korean In-Depth Data Analysis Study (KIDAS) for calendar years 2011-2016. Vehicles involved in frontal crash were included and classified into TVs and non-TVs (passenger cars and sports utility vehicles). We compared the demographic characteristics and serious injuries by body region between the 2 groups and analyzed factors that contributed to the serious injury severity from frontal crashes. The analysis was based on 884 occupants; 177 (20.0%) were in TVs and 707 (80.0%) were in non-TVs. Non-TVs had more frontal airbags deployments than TVs (50.9% vs. 3.4%, P Truck occupants had more serious LE and abdominal injuries than those of other types of vehicles in frontal crashes. Structural improvement and legislative efforts to develop safety systems are necessary to improve the safety of truck occupants.

  18. The Gravita 10BB locomotive with a central driver's cab

    Energy Technology Data Exchange (ETDEWEB)

    Klaua, Ulf [Voith Turbo Lokomotivtechnik GmbH und Co. KG, Kiel (Germany). Design and Prototype Construction; Brunkert, Daniel [Voith Turbo Lokomotivtechnik GmbH und Co. KG, Kiel (Germany). Gravita Product; Wolfgram, Dieter [Voith Turbo Lokomotivtechnik GmbH und Co. KG, Kiel (Germany). Locomotive Development and Systems Engineering

    2010-09-15

    Once the market had reacted positively to the appearance of the Maxima {sup registered} locomotive family from Voith Turbo Lokomotivtechnik, the company felt encouraged to go ahead with the development of its second locomotive family in the medium-performance segment. (orig.)

  19. 75 FR 1179 - Passenger Equipment Safety Standards; Front End Strength of Cab Cars and Multiple-Unit Locomotives

    Science.gov (United States)

    2010-01-08

    ... views on the preemptive effect of this part. DATES: Effective Date: This final rule is effective March 9... Engineers and Trainmen (BLET); Brotherhood of Maintenance of Way Employes Division; Brotherhood of Railroad... Council for Latin American Advancement;* League of Railway Industry Women;* National Association of...

  20. Electrical transport properties of single-crystal CaB6,SrB6 , and BaB6

    Science.gov (United States)

    Stankiewicz, Jolanta; Rosa, Priscila F. S.; Schlottmann, Pedro; Fisk, Zachary

    2016-09-01

    The electrical resistivity and Hall effect of alkaline-earth-metal hexaboride single crystals are measured as a function of temperature, hydrostatic pressure, and magnetic field. The transport properties vary weakly with the external parameters and are modeled in terms of intrinsic variable-valence defects. These defects can stay either in (1) delocalized shallow levels or in (2) localized levels resonant with the conduction band, which can be neutral or negatively charged. Satisfactory agreement is obtained for electronic transport properties in a broad temperature and pressure range, although fitting the magnetoresistance is less straightforward and a combination of various mechanisms is needed to explain the field and temperature dependences.

  1. 30 CFR 75.1710-1 - Canopies or cabs; self-propelled diesel-powered and electric face equipment; installation...

    Science.gov (United States)

    2010-07-01

    ... and electric face equipment; installation requirements. (a) Except as provided in paragraph (f) of this section, all self-propelled diesel-powered and electric face equipment, including shuttle cars... and electric face equipment; installation requirements. 75.1710-1 Section 75.1710-1 Mineral Resources...

  2. Diálogo sobre a poesia oral na Cabília: entrevista de Mouloud Mammeri a Pierre Bourdieu

    Directory of Open Access Journals (Sweden)

    Pierre Bourdieu

    2006-06-01

    Full Text Available Neste diálogo, Pierre Bourdieu e o etnólogo, escritor e poeta argelino Mouloud Mammeri (1917-1989 exploram e explicam as bases sociais, os usos e o sentido da poesia oral na sociedade e história cabilas. Como filho do penúltimo amusnaw (sábio; bardo de sua tribo, Mammeri estava posicionado de maneira única para situar esse mestre das palavras que atuou na função tradicional de mediador e transportador do conhecimento e manteve-se como a encarnação viva da tamusni (a filosofia prática da excelência berbere, em relação com o marabuto (depositário das sagradas escrituras do Corão e com os camponeses (que compõem seu público principal. Torná-se amusnaw graças a uma eleição e isso requer um duplo aprendizado: primeiro, por osmose em um meio saturado de comércio e disputas verbais (no treinamento de guerra, na assembléia da vila, nos mercados e nas peregrinações e, depois, por meio de um treinamento explícito com um poeta-mestre que orienta uma série de exercícios e provas. Esse processo requer não apenas o domínio de uma variedade de técnicas verbais e de um cânone oratório, mas também implica absorver e encarnar a sabedoria. Jogando com a multidimensionalidade da linguagem, adaptando-a com flexibilidade diante das especificidades de cada situação e público, o bardo cabila era continuamente testado e suas habilidades culturais infinitamente refinadas, até o ponto em que ele não apenas dominasse as regras do ofício, mas também jogasse com elas, trangredindo-as no espírito da tradição a fim de inventar novas figuras retóricas e extrair o máximo de "rendimento" da linguagem. A tamusni emerge assim não apenas como um corpo de conhecimento inerte, desligado da vida e transmitido por si mesmo, mas como uma "ciência prática", constantemente revivida pela e para a prática. O poeta é o porta-voz do grupo que, por meio de seu discernimento cultural e uso técnico da linguagem, aperfeiçoa os valores específicos do grupo, separa coisas que são confusas e, ao iluminar o que é obscuro, mobiliza seu povo.

  3. Inclusión de la Población Indígena Bribri y Cabécar en la Sede Limón

    OpenAIRE

    Alpízar Pereira, Leyla; Artiaga Artiaga, Flor

    2011-01-01

    El presente artículo tiene como objetivo hacer una revisión en torno a la situación de la población indígena de Talamanca en la actualidad y proponer estrategias que faciliten su inclusión en el sistema de educación superior de la Universidad de Costa Rica. Lo anterior, por medio de acciones de promoción y acompañamiento en cada una de las fases del proceso de admisión, ingreso y permanencia dentro de la universidad. Esta propuesta se considera de importancia partiendo del prin...

  4. Transportation-related barriers to care among African American women living with HIV/AIDS: “What you getting out of the cab for?”

    OpenAIRE

    Evans, Shenell D.; Williams, Bryman E.

    2013-01-01

    Transportation-related problems have been consistently reported as barriers to accessing and remaining in HIV medical care, particularly among African American women living in under-resourced areas. With emphasis on the Southern region of the United States, this commentary presents a brief overview of the HIV/AIDS epidemic among African Americans, barriers to remaining in HIV care, and pilot data from a study conducted among African American women living in Mississippi. A small focus group st...

  5. Ecosystem monitoring information collected in Hanna Shoal in the Chukchi Sea for the COMIDA CAB project from August 2012 to August 2013 (NODC Accession 0123220)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains physical, chemical, and biological data collected during research cruises for the Hanna Shoal Ecosystem Study. The study occurred at 138...

  6. Effect of metformin pretreatment on myocardial injury during coronary artery bypass surgery in patients without diabetes (MetCAB): a double-blind, randomised controlled trial

    NARCIS (Netherlands)

    El Messaoudi, S.; Nederlof, R.; Zuurbier, C.J.; Swieten, H.A. van; Pickkers, P.; Noyez, L.; Dieker, H.J.; Coenen, M.J.H.; Donders, A.R.T.; Vos, A.; Rongen, G.A.P.J.M.; Riksen, N.P.

    2015-01-01

    BACKGROUND: During coronary artery bypass graft (CABG) surgery, ischaemia and reperfusion damage myocardial tissue, and increased postoperative plasma troponin concentration is associated with a worse outcome. We investigated whether metformin pretreatment limits cardiac injury, assessed by troponin

  7. Dicty_cDB: VSB813 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3e-09 2 CB970649 |CB970649.1 CAB10004_IIIa_Fa_G05 Cabernet Sauvignon Flower Pre-....1 CAB30006_IIc_Ra_B01 Cabernet Sauvignon Berry Stage I - CAB3 Vitis vinifera cDNA clone CAB30006_IIc_Ra_B01

  8. Dicty_cDB: AFH152 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 80 4e-19 2 CF211274 |CF211274.1 CAB20007_IVa_Ra_C07 Cabernet Sauvignon Flower bloom - CAB2 Vitis vinifera c...DNA clone CAB20007_IVa_Ra_C07 3', mRNA sequence. 78 4e-18 3 CF211191 |CF211191.1 CAB20007_IVa_Fa_C07 Caberne

  9. Dicty_cDB: SSM208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore E Sequences producing significant alignments: (bits) Value N CF211492 |CF211492.1 CAB20007_Ia_Ra_H10 Cab...ernet Sauvignon Flower bloom - CAB2 Vitis vinifera cDNA clone CAB20007_Ia_Ra_H10 3', mRNA sequence. 64 1e-15

  10. Dicty_cDB: VSJ366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 007 1 CB970932 |CB970932.1 CAB10004_IVa_Fa_D03 Cabernet Sauvignon Flower Pre-bloom - CAB1 Vitis vinifera cDN...A clone CAB10004_IVa_Fa_D03 5', mRNA sequence. 52 0.007 1 CB971834 |CB971834.1 CAB10006_IIIa_Fa_E02 Cabernet... 5', mRNA sequence. 52 0.007 1 CB982722 |CB982722.1 CAB70007_IIIb_Fb_H09 Cabernet Sauvignon Berry Post-Verai... CAB30001_IIIb_Fb_A11 Cabernet Sauvignon Berry Stage I - CAB3 Vitis vinifera cDNA clone CAB30001_IIIb_Fb_A11...son - CAB7 Vitis vinifera cDNA clone CAB70007_IIIb_Fb_H09 5', mRNA sequence. 52 0.007 1 CB972451 |CB972451.1

  11. Pengukuran Performansi Supply Chain Berbasis Lima Proses Inti Supply Chain Operations Reference (Scor) Dengan Pendekatan Analytic Network Process (Anp) (Studi Kasus: PT Sang Hyang Seri – Persero, Cab. Pasuruan)

    OpenAIRE

    Sumbayak, Ruth Elnawaty Triscova; Sumantri, Yeni; Yuniarti, Rahmi

    2014-01-01

    PT Sang Hyang Seri (Persero) merupakan perintis dan pelopor USAha perbenihan di Indonesia. Perusahaan ini melakukan pengolahan terhadap gabah kering panen (GKP) menjadi benih bersertifikat, dimana Perusahaan memiliki aktivitas supply chain yang digunakan dalam mengatur aliran barang mulai dari petani sebagai supplier sampai kepada konsumen akhirnya. Dalam supply chain management, proses manajemen kinerja dan perbaikan yang berkelanjutan sangat perlu untuk dilakukan. Untuk menciptakan manajeme...

  12. Management of Aromatase Inhibitor-Associated Bone Loss (AIBL) in postmenopausal women with hormone sensitive breast cancer : Joint position statement of the IOF, CABS, ECTS, IEG, ESCEO IMS, and SIOG

    NARCIS (Netherlands)

    P. Hadji (Peyman); M. Aapro (Matti); J.J. Body (J.); M. Gnant (M.); M.L. Brandi; J-Y. Reginster (Jean-Yves); M.C. Zillikens (Carola); C.-C. Glüer (Claus-C.); de Villiers, T. (Tobie); Baber, R. (Rod); D. Roodman (David); C. Cooper (Charles); B.L. Langdahl (Bente); Palacios, S. (Santiago); J.A. Kanis (John); Al-Daghri, N. (Nasser); X. Nogues (Xavier); E.F. Eriksen (Erik); Kurth, A. (Andreas); R. Rizzoli; Coleman, R.E. (Robert E.)

    2017-01-01

    markdownabstract__Background__ Several guidelines have been reported for bone-directed treatment in women with early breast cancer (EBC) for averting fractures, particularly during aromatase inhibitor (AI) therapy. Recently, a number of studies on additional fracture related risk factors, new

  13. Chemical and benthos data collected from CTD, bottle, and other instruments in the Chukchi Sea in 2009-2010 as part of the Chukchi Sea Offshore Monitoring in Drilling Area - Chemical and Benthos (COMIDA-CAB) project (NODC Accession 0095566)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains physical, chemical, and biological data collected during research cruises for the Chukchi Sea Offshore Monitoring in Drilling Area (Chemical...

  14. A Phase 1 Trial of Cabazitaxel Combined With 188Re-Hydroxyethylidene Diphosphonate in Patients With Metastatic Castration-Resistant Prostate Cancer Who Progressed on or After a Docetaxel-Containing Treatment: The ReCab Trial.

    Science.gov (United States)

    van Dodewaard-de Jong, Joyce M; Bouman-Wammes, Esther W; Bloemendal, Haiko J; Verheul, Henk M W; de Klerk, John M H; van den Eertwegh, Alfons J M

    2017-06-01

    In patients with metastatic castration-resistant prostate cancer (mCRPC), bone-seeking radiopharmaceuticals, such as Re-hydroxyethylidene diphosphonate (HEDP), are effective for pain palliation and have a marked antitumor effect. Cabazitaxel is the standard second-line chemotherapy for mCRPC patients. We performed a phase 1 study investigating the safety and feasibility of the combined treatment with Re-HEDP and cabazitaxel in mCRPC patients. Patients with mCRPC and documented disease progression on or after docetaxel were eligible for inclusion. In both dose levels, cabazitaxel (4 cycles of cabazitaxel 25 mg/m + 2 cycles of cabazitaxel 20 mg/m in level 1, and 6 cycles of cabazitaxel 25 mg/m in level 2) were combined with 2 cycles of Re-HEDP 40 MBq/kg (1.1 mCi/kg) (after the second and fourth cabazitaxel cycles). Three patients were planned for each dose level, expanding to 6 patients in case of a dose-limiting toxicity (DLT). A DLT is defined as any grade 4 toxicity, or grade 3 toxicity delaying the next treatment cycle. Twelve patients were included, of whom 3 had progressive disease before the third cycle of cabazitaxel. In total, 1 DLT occurred (dose level 1) after treatment cycle 6 (Re-HEDP) (thrombopenia grade 3 delaying the next treatment cycle). The cohort was expanded to 6 patients, with no further DLTs. No DLT occurred in dose level 2. The most important adverse events were of hematologic origin, followed by mild fatigue and diarrhea. Combination therapy with cabazitaxel and Re-HEDP is feasible and generally well tolerated with similar hematologic toxicity compared with cabazitaxel monotherapy.

  15. Dicty_cDB: VHD613 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 117 |CB980117.1 CAB70001_IaR_H03 Cabernet Sauvignon Berry Post-Veraison - CAB7 Vi...tis vinifera cDNA clone CAB70001_IaR_H03 3', mRNA sequence. 44 3.4 1 CB980047 |CB980047.1 CAB70001_IaF_H03 Caberne...4 3.4 1 CB979848 |CB979848.1 CAB70001_IIcF_H03 Cabernet Sauvignon Berry Post-Veraison - CAB7 Vitis vinifera

  16. Dicty_cDB: VHA757 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 17 |CB980117.1 CAB70001_IaR_H03 Cabernet Sauvignon Berry Post-Veraison - CAB7 Vitis vinifera cDNA clone CAB7...0001_IaR_H03 3', mRNA sequence. 44 5.0 1 CB980047 |CB980047.1 CAB70001_IaF_H03 Caberne... 5.0 1 CB979848 |CB979848.1 CAB70001_IIcF_H03 Cabernet Sauvignon Berry Post-Veraison - CAB7 Vitis vinifera c

  17. Dicty_cDB: CHR710 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DNA 5, mRNA sequence. 62 2e-05 1 CB980117 |CB980117.1 CAB70001_IaR_H03 Cabernet Sauvignon Berry Post-Veraiso...n - CAB7 Vitis vinifera cDNA clone CAB70001_IaR_H03 3', mRNA sequence. 44 0.015 2 CB979848 |CB979848.1 CAB70001_IIcF_H03 Caberne...one CAB70001_IIcF_H03 5', mRNA sequence. 44 0.018 2 CB980047 |CB980047.1 CAB70001_IaF_H03 Cabernet Sauvignon

  18. Dicty_cDB: SHK804 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3', mRNA sequence. 44 4.1 1 CB980047 |CB980047.1 CAB70001_IaF_H03 Cabernet Sauvignon Berry Post-Veraison - ...848 |CB979848.1 CAB70001_IIcF_H03 Cabernet Sauvignon Berry Post-Veraison - CAB7 Vitis vinifera cDNA clone CA...us vulpecula cDNA clone 1061024540571, mRNA sequence. 44 4.1 1 CB980117 |CB980117.1 CAB70001_IaR_H03 Caber...net Sauvignon Berry Post-Veraison - CAB7 Vitis vinifera cDNA clone CAB70001_IaR_H03

  19. Testing a model of caffeinated alcohol-specific expectancies.

    Science.gov (United States)

    Linden-Carmichael, Ashley N; Lau-Barraco, Cathy; Stamates, Amy L

    2015-08-01

    The present study sought to further understand the association between caffeinated alcoholic beverage (CAB) use and alcohol-related risks. In particular, we focused on the role of two identified expectancies specific to CAB use: intoxication enhancement and avoidance of negative consequences. Although outcome expectancies are consistent predictors of substance use, limited research has examined expectancies related to CAB use and their association with alcohol-related behaviors, such as protecting themselves from alcohol-related harms. Consequently, the present study examined CAB-specific expectancies and protective behavioral strategies (PBS) as mediators of CAB use and negative consequences. Participants were 322 (219 women) college drinkers who completed self-report measures of typical CAB and alcohol use, CAB-specific expectancies, PBS use, and alcohol-related harms. Structural equation modeling revealed, after controlling for typical non-CAB heavy alcohol use, a significant indirect effect of CAB use to alcohol-related problems through avoidance of negative consequences CAB expectancies and PBS use. However, intoxication enhancement expectancies did not mediate this association. Our findings indicate that heavier CAB use was associated with stronger expectations that drinking CABs can help avoid negative consequences. These beliefs were related to using fewer PBS when drinking and a greater likelihood of experiencing problems. Given that these expectancies may be underlying mechanisms of CAB use, their inclusion in existing alcohol interventions may be beneficial. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Dicty_cDB: FC-IC1017 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 50 2e-04 2 CF207340 |CF207340.1 CAB20001_IIa_Ra_F10 Cabernet Sauvignon Flower blo...sequence. 50 2e-04 2 CB980647 |CB980647.1 CAB70003_IIIaF_A07 Cabernet Sauvignon Berry Post-Veraison - CAB7 V...om - CAB2 Vitis vinifera cDNA clone CAB20001_IIa_Ra_F10 3', mRNA sequence. 50 2e-04 2 CB976850 |CB976850.1 CAB40003_IIIa_Fa_D08 Caber...net Sauvignon Berry - CAB4 Vitis vinifera cDNA clone CAB40003_IIIa_Fa_D08 5', mRNA

  1. A Computational fluid dynamics model of viscous coupling of sensory hairs

    DEFF Research Database (Denmark)

    Lewin, Gregory C.; Hallam, John

    2010-01-01

    Abstracts in Anthropology, Academic OneFile, AGRICOLA, Biological Abstracts, BIOSIS, CAB Abstracts, CAB International, Chemical Abstracts Service (CAS), CSA, Current Abstracts, Current Contents/ Life Sciences, EBSCO, Elsevier Biobase, EMBASE, Gale, Global Health, Google Scholar, Health Reference...

  2. Kapak ve İçindekiler

    Directory of Open Access Journals (Sweden)

    Kapak İçindekiler

    2014-09-01

    Full Text Available Zentralblatt MATH, Chemical Abstract, CAB Abstract ve EBSCO Host indeksleri tarafından taranmaktadır. Indexed in Zentralblatt MATH, Chemical Abstract, CAB Abstract and EBSCO Host indexes

  3. "A place at the table:" a qualitative analysis of community board members' experiences with academic HIV/AIDS research

    National Research Council Canada - National Science Library

    Safo, Stella; Cunningham, Chinazo; Beckman, Alice; Haughton, Lorlette; Starrels, Joanna L

    2016-01-01

    ...), but the presence of CABs may be insufficient to optimize academic-community partnerships. We conducted semi-structured interviews with minority members of a CAB partnered with a HIV/AIDS research center and identified three themes...

  4. “A place at the table:” a qualitative analysis of community board members’ experiences with academic HIV/AIDS research

    National Research Council Canada - National Science Library

    Safo, Stella; Cunningham, Chinazo; Beckman, Alice; Haughton, Lorlette; Starrels, Joanna L

    2016-01-01

    ...), but the presence of CABs may be insufficient to optimize academic-community partnerships. Methods We conducted semi-structured interviews with minority members of a CAB partnered with a HIV/AIDS research center and identified three themes...

  5. Dicty_cDB: VFH459 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t US 6562958. 52 6e-06 2 CB971300 |CB971300.1 CAB10005_IIIa_Fa_H08 Cabernet Sauvi...975981 |CB975981.1 CAB40001_IIa_Fa_F09 Cabernet Sauvignon Berry - CAB4 Vitis vinifera cDNA clone CAB40001_II...a_Fa_F09 5', mRNA sequence. 48 1e-05 4 CF511327 |CF511327.1 CAbud0002_IIF_B12 Vitis vinifera cv. caberne

  6. Dicty_cDB: AFJ603 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e. 48 1e-04 2 CF208808 |CF208808.1 CAB20003_Ia_Ra_A08 Cabernet Sauvignon Flower bloom - CAB2 Vitis vinifera ...cDNA clone CAB20003_Ia_Ra_A08 3', mRNA sequence. 48 2e-04 2 CF208719 |CF208719.1 CAB20003_Ia_Fa_A08 Cabernet Sauvignon Flower bloom

  7. Quantifying the foodscape: A systematic review and meta-analysis of the validity of commercially available business data

    OpenAIRE

    Lebel, Alexandre; Daepp, Madeleine I. G.; Block, Jason P.; Walker, Renée; Lalonde, Benoît; Kestens, Yan; Subramanian, S. V.

    2017-01-01

    This paper reviews studies of the validity of commercially available business (CAB) data on food establishments (“the foodscape”), offering a meta-analysis of characteristics associated with CAB quality and a case study evaluating the performance of commonly-used validity indicators describing the foodscape. Existing validation studies report a broad range in CAB data quality, although most studies conclude that CAB quality is “moderate” to “substantial”. We conclude that current studies may ...

  8. Impulsivity and Alcohol Demand in relation to Combined Alcohol and Caffeine Use

    OpenAIRE

    Amlung, Michael; Few, Lauren R.; Howland, Jonathan; Rohsenow, Damaris J.; Metrik, Jane; MacKillop, James

    2013-01-01

    Problematic alcohol use among college students continues to be a prominent concern in the United States, including the growing trend of consuming caffeine with alcoholic beverages (CABs). Epidemiologically, CAB use is associated with incremental risks from drinking, although these relationships could be due to common predisposing factors rather than specifically due to CABs. This study investigated the relationship between CAB use, alcohol misuse, and person-level characteristics including im...

  9. Water demand characteristics of shared water and sanitation ...

    African Journals Online (AJOL)

    The design of the ABRs and septic tanks was based on previous in-house guidelines; however, there are no national water demand guidelines for CABs. CABs do not fit any of the scenarios presented in the SANS 10400 guidelines, as CABs include communal showers, basins, laundry facilities, toilets and urinals.

  10. Promising evidence of impact on road safety by changing at-risk behavior process at Union Pacific

    Science.gov (United States)

    2008-06-01

    Changing At-risk Behavior (CAB) is a safety process that is being conducted at Union Pacifics San Antonio Service Unit with the aim of improving locomotive cab safety related to constraining signals. CAB is an example of a risk reduction method th...

  11. NCBI nr-aa BLAST: CBRC-ATHA-04-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-04-0018 emb|CAB43899.1| cellulose synthase catalytic subunit-like protein... [Arabidopsis thaliana] emb|CAB81317.1| cellulose synthase catalytic subunit-like protein [Arabidopsis thaliana] CAB43899.1 1e-175 99% ...

  12. NCBI nr-aa BLAST: CBRC-ATHA-04-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-04-0019 emb|CAB43899.1| cellulose synthase catalytic subunit-like protein... [Arabidopsis thaliana] emb|CAB81317.1| cellulose synthase catalytic subunit-like protein [Arabidopsis thaliana] CAB43899.1 1e-137 73% ...

  13. Initial development of a measure of expectancies for combinations of alcohol and caffeine: the Caffeine + Alcohol Combined Effects Questionnaire (CACEQ).

    Science.gov (United States)

    MacKillop, James; Howland, Jonathan; Rohsenow, Damaris J; Few, Lauren R; Amlung, Michael T; Metrik, Jane; Calise, Tamara Vehige

    2012-12-01

    Caffeinated alcoholic beverage (CAB) consumption is widespread among young adults in the United States and is associated with increased negative consequences from alcohol. In addition to the direct pharmacological effects of adding caffeine to alcohol, another possible risk mechanism is via socially learned expectancies, which has received very little consideration. The current study conducted an initial psychometric validation of a measure of CAB expectancies to facilitate research in this area. Participants were 409 undergraduate regular drinkers (71% female) who were assessed for alcohol and CAB use, alcohol use/misuse, and expectancies about CABs. The majority (62%) of participants reported CAB experience and 48% reported CAB use in the past month. Participants primarily consumed spontaneously-prepared as opposed to premixed-CABs. More frequent CAB use was significantly positively correlated with levels of alcohol use and misuse. For the expectancy items, exploratory factor analysis revealed two factors that were labeled "Intoxication Enhancement" and "Avoid Negative Consequences." The patterns of expectancies reflected beliefs that CABs enhanced intoxication, but did not protect against negative consequences. The measure was titled the Caffeine + Alcohol Combined Effects Questionnaire (CACEQ). Intoxication enhancement scores were significantly associated with frequency of CAB use, even after adjusting for the role of weekly drinking and alcohol misuse, supporting the convergent validity of the CACEQ. These data provide initial support for the CACEQ and suggest it may be useful for clarifying the role of expectancies in CAB use. Applications for studying the risks associated with CAB use and methodological considerations are discussed.

  14. Dicty_cDB: CFI104 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 07 5, mRNA sequence. 50 2e-05 2 CB971834 |CB971834.1 CAB10006_IIIa_Fa_E02 Caberne...t Sauvignon Flower Pre-bloom - CAB1 Vitis vinifera cDNA clone CAB10006_IIIa_Fa_E02 5', mRNA sequence. 50 3e-

  15. Dicty_cDB: VHP305 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available bernet Sauvignon Flower bloom - CAB2 Vitis vinifera cDNA clone CAB20003_Ia_Ra_A08 3', mRNA sequence. 48 7e-0...VVB047G11 5, mRNA sequence. 48 6e-05 2 CF208808 |CF208808.1 CAB20003_Ia_Ra_A08 Ca

  16. Dicty_cDB: SSM503 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cTOE7E7 5' sequence, mRNA sequence. 76 2e-28 3 CF211085 |CF211085.1 CAB20007_IIa_Fa_H10 Cabernet Sauvignon Flower bloom...11161.1 CAB20007_IIa_Ra_H10 Cabernet Sauvignon Flower bloom - CAB2 Vitis vinifera

  17. Dicty_cDB: AFG603 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ent(1004496-821614) strain AX4, complete sequence. 36 7e-06 11 CF207924 |CF207924.1 CAB20002_IVa_Fa_G07 Cabernet Sauvignon Flower blo...om - CAB2 Vitis vinifera cDNA clone CAB20002_IVa_Fa_G07

  18. NCBI nr-aa BLAST: CBRC-PHAM-01-1625 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1625 emb|CAB42602.1| hyperpolarization-activated cation channel HCN2 [...Homo sapiens] emb|CAB42630.1| hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 [Homo sapiens] CAB42602.1 8e-05 34% ...

  19. NCBI nr-aa BLAST: CBRC-RMAC-14-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-14-0006 emb|CAB42602.1| hyperpolarization-activated cation channel HCN2 [...Homo sapiens] emb|CAB42630.1| hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 [Homo sapiens] CAB42602.1 6e-05 34% ...

  20. NCBI nr-aa BLAST: CBRC-HSAP-15-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-15-0018 emb|CAB42602.1| hyperpolarization-activated cation channel HCN2 [...Homo sapiens] emb|CAB42630.1| hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 [Homo sapiens] CAB42602.1 0.0 94% ...

  1. NCBI nr-aa BLAST: CBRC-ATHA-01-0030 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-01-0030 emb|CAB45965.1| putative reverse transcriptase [Arabidopsis thali...ana] emb|CAB78261.1| putative reverse transcriptase [Arabidopsis thaliana] CAB45965.1 0.0 51% ...

  2. Morphological development of polypropylene in immiscible blends with cellulose acetate butyrate

    Science.gov (United States)

    Isotactic polypropylenes (iPP) with different melt flow indexes were melt blended with cellulose acetate butyrate (CAB) and then prepared into microspheres or nanofibers following a novel process of producing well dispersed CAB/iPP immiscible blends and subsequent removal of the CAB matrix. The morp...

  3. 49 CFR 238.309 - Periodic brake equipment maintenance.

    Science.gov (United States)

    2010-10-01

    ... with other than an AB, ABD, ABDX, 26-C, or equivalent brake system. (e) Cab cars. The brake equipment... schedule: (1) Every 1,476 days for that portion of the cab car brake system using brake valves that are identical to the passenger coach 26-C brake system; (2) Every 1,104 days for that portion of the cab car...

  4. NCBI nr-aa BLAST: CBRC-PTRO-16-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-16-0005 emb|CAB42602.1| hyperpolarization-activated cation channel HCN2 [...Homo sapiens] emb|CAB42630.1| hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 [Homo sapiens] CAB42602.1 0.0 94% ...

  5. Dicty_cDB: VHI867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available for P-type ATPase. 1233 0.0 1 CB980117 |CB980117.1 CAB70001_IaR_H03 Cabernet Sauvignon Berry Post-Veraison ...B979848 |CB979848.1 CAB70001_IIcF_H03 Cabernet Sauvignon Berry Post-Veraison - CAB7 Vitis vinifera cDNA clon...e CAB70001_IIcF_H03 5', mRNA sequence. 44 0.006 2 CB980047 |CB980047.1 CAB70001_IaF_H03 Cabernet Sauvignon B

  6. Dicty_cDB: CHB660 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 971300 |CB971300.1 CAB10005_IIIa_Fa_H08 Cabernet Sauvignon Flower Pre-bloom - CAB1 Vitis vinifera cDNA clone... CAB10005_IIIa_Fa_H08 5', mRNA sequence. 48 0.010 2 CB975981 |CB975981.1 CAB40001_IIa_Fa_F09 Cabernet Sauvig... 48 0.012 2 CF511327 |CF511327.1 CAbud0002_IIF_B12 Vitis vinifera cv. cabernet sauvignon (Clone 8) Bud - CAB

  7. Dicty_cDB: VHP635 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ments: (bits) Value N X98286 |X98286.1 D.discoideum mRNA for P-type ATPase. 702 0.0 2 CB980117 |CB980117.1 CAB70001_IaR_H03 Caberne... CB980047 |CB980047.1 CAB70001_IaF_H03 Cabernet Sauvignon Berry Post-Veraison - C...AB7 Vitis vinifera cDNA clone CAB70001_IaF_H03 5', mRNA sequence. 44 2.2 1 CB979848 |CB979848.1 CAB70001_IIcF_H03 Caberne

  8. Dicty_cDB: SSH725 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ', mRNA sequence. 54 3e-12 2 CF211161 |CF211161.1 CAB20007_IIa_Ra_H10 Cabernet Sauvignon Flower bloom - CAB2...1 CAB20007_IIa_Fa_H10 Cabernet Sauvignon Flower bloom - CAB2 Vitis vinifera cDNA clone CAB20007_IIa_Fa_H10 5...tum cDNA clone cTOE7E7 5' sequence, mRNA sequence. 62 8e-16 2 CF211085 |CF211085.

  9. Dicty_cDB: SHF406 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ibrary Phaseolus vulgaris cDNA 5', mRNA sequence. 32 1.5 3 CB980117 |CB980117.1 CAB70001_IaR_H03 Cabernet Sa...980047 |CB980047.1 CAB70001_IaF_H03 Cabernet Sauvignon Berry Post-Veraison - CAB7... Vitis vinifera cDNA clone CAB70001_IaF_H03 5', mRNA sequence. 44 3.7 1 CB979848 |CB979848.1 CAB70001_IIcF_H03 Caberne

  10. Dicty_cDB: CHL243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 98286 |X98286.1 D.discoideum mRNA for P-type ATPase. 1489 0.0 1 CB980117 |CB980117.1 CAB70001_IaR_H03 Caberne...3 3', mRNA sequence. 44 0.009 2 CB979848 |CB979848.1 CAB70001_IIcF_H03 Cabernet Sauvignon Berry Post-Veraiso...n - CAB7 Vitis vinifera cDNA clone CAB70001_IIcF_H03 5', mRNA sequence. 44 0.011 2 CB980047 |CB980047.1 CAB70001_IaF_H03 Caberne

  11. Dicty_cDB: CHI751 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 86 0.0 2 CB980117 |CB980117.1 CAB70001_IaR_H03 Cabernet Sauvignon Berry Post-Veraison - CAB7 Vitis vinifera ...cDNA clone CAB70001_IaR_H03 3', mRNA sequence. 44 0.021 2 CB979848 |CB979848.1 CAB70001_IIcF_H03 Caberne..., mRNA sequence. 44 0.025 2 CB980047 |CB980047.1 CAB70001_IaF_H03 Cabernet Sauvignon Berry Post-Veraison - C

  12. Dicty_cDB: CHR373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available omosome 3 BAC OSJNBa0091P11 genomic sequence, complete sequence. 46 0.92 1 CB980117 |CB980117.1 CAB70001_IaR_H03 Caberne...nce. 44 3.6 1 CB980047 |CB980047.1 CAB70001_IaF_H03 Cabernet Sauvignon Berry Post-Veraison - CAB7 Vitis vini...fera cDNA clone CAB70001_IaF_H03 5', mRNA sequence. 44 3.6 1 CB979848 |CB979848.1 CAB70001_IIcF_H03 Cabern

  13. Quantifying the foodscape: A systematic review and meta-analysis of the validity of commercially available business data.

    Science.gov (United States)

    Lebel, Alexandre; Daepp, Madeleine I G; Block, Jason P; Walker, Renée; Lalonde, Benoît; Kestens, Yan; Subramanian, S V

    2017-01-01

    This paper reviews studies of the validity of commercially available business (CAB) data on food establishments ("the foodscape"), offering a meta-analysis of characteristics associated with CAB quality and a case study evaluating the performance of commonly-used validity indicators describing the foodscape. Existing validation studies report a broad range in CAB data quality, although most studies conclude that CAB quality is "moderate" to "substantial". We conclude that current studies may underestimate the quality of CAB data. We recommend that future validation studies use density-adjusted and exposure measures to offer a more meaningful characterization of the relationship of data error with spatial exposure.

  14. Dicty_cDB: VFG846 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 26 |CF207326.1 CAB20001_IIa_Ra_E08 Cabernet Sauvignon Flower bloom - CAB2 Vitis vinifera cDNA clone CAB20001..._IIa_Ra_E08 3', mRNA sequence. 50 0.015 1 CB980647 |CB980647.1 CAB70003_IIIaF_A07 Cabernet Sauvignon Berry P...iplex2 Library Vitis vinifera cDNA clone B3CS00RL001F06 3', mRNA sequence. 50 0.015 1 CB976850 |CB976850.1 CAB40003_IIIa_Fa_D08 Caber...net Sauvignon Berry - CAB4 Vitis vinifera cDNA clone CAB

  15. Profiling antibody responses to infections by Chlamydia abortus enables identification of potential virulence factors and candidates for serodiagnosis.

    Directory of Open Access Journals (Sweden)

    Vera Forsbach-Birk

    Full Text Available Enzootic abortion of ewes (EAE due to infection with the obligate intracellular pathogen Chlamydia (C. abortus is an important zoonosis leading to considerable economic loss to agriculture worldwide. The pathogen can be transmitted to humans and may lead to serious infection in pregnant women. Knowledge about epidemiology, clinical course and transmission to humans is hampered by the lack of reliable diagnostic tools. Immunoreactive proteins, which are expressed in infected animals and humans, may serve as novel candidates for diagnostic marker proteins and represent putative virulence factors. In order to broaden the spectrum of immunogenic C. abortus proteins we applied 2D immunoblot analysis and screening of an expression library using human and animal sera. We have identified 48 immunoreactive proteins representing potential diagnostic markers and also putative virulence factors, such as CAB080 (homologue of the "macrophage infectivity potentiator", MIP, CAB167 (homologue of the "translocated actin recruitment protein", TARP, CAB712 (homologue of the "chlamydial protease-like activity factor", CPAF, CAB776 (homologue of the "Polymorphic membrane protein D", PmpD, and the "hypothetical proteins" CAB063, CAB408 and CAB821, which are predicted to be type III secreted. We selected two putative virulence factors for further characterization, i.e. CAB080 (cMIP and CAB063, and studied their expression profiles at transcript and protein levels. Analysis of the subcellular localization of both proteins throughout the developmental cycle revealed CAB063 being the first C. abortus protein shown to be translocated to the host cell nucleus.

  16. Impulsivity and Alcohol Demand in relation to Combined Alcohol and Caffeine Use

    Science.gov (United States)

    Amlung, Michael; Few, Lauren R.; Howland, Jonathan; Rohsenow, Damaris J.; Metrik, Jane; MacKillop, James

    2014-01-01

    Problematic alcohol use among college students continues to be a prominent concern in the United States, including the growing trend of consuming caffeine with alcoholic beverages (CABs). Epidemiologically, CAB use is associated with incremental risks from drinking, although these relationships could be due to common predisposing factors rather than specifically due to CABs. This study investigated the relationship between CAB use, alcohol misuse, and person-level characteristics including impulsive personality traits, delayed reward discounting, and behavioral economic demand for alcohol use. Participants were 273 regularly drinking undergraduate students. Frequency of CAB use was assessed over the past month. A multidimensional assessment of impulsivity included the UPPS-P questionnaire and a validated, questionnaire-based measure of delayed reward discounting. Demand was assessed via a hypothetical alcohol purchase task. Frequency of CAB consumption was significantly higher in males compared to females and was also associated with higher impulsivity on the majority of the UPPS-P subscales, steeper delayed reward discounting, and greater demand for alcohol. Significant correlations between CAB use and both alcohol demand and lack of premeditation remained present after including level of alcohol misuse in partial correlations. In a hierarchical linear regression incorporating demographic, demand, and impulsivity variables, CAB frequency continued to be a significant predictor of hazardous alcohol use. These results suggest that although there are significant associations between CAB consumption and gender, impulsivity, and alcohol demand, CAB use continues to be associated with alcohol misuse after controlling for these variables. PMID:24364537

  17. Long-term outcomes of combined androgen blockade therapy in stage IV prostate cancer.

    Science.gov (United States)

    Matsuoka, Taeko; Kawai, Koji; Kimura, Tomokazu; Kojima, Takahiro; Onozawa, Mizuki; Miyazaki, Jun; Nishiyama, Hiroyuki; Hinotsu, Shiro; Akaza, Hideyuki

    2015-04-01

    To clarify which subset of stage IV prostate cancer patients benefit from combined androgen blockade (CAB) using Japanese nationwide database. A total of 3,752 patients with stage IV disease from the prospective nationwide cohort database of the Japan Study Group of Prostate Cancer (J-CaP) were enrolled. All patients started primary androgen deprivation therapy (PADT) between 2001 and 2003, and the present study was performed using the data set from December 2011. Patients were divided into two groups according to initial treatments: CAB with luteinizing hormone-releasing hormone agonist (LHRH) plus anti-androgen (AA) and non-CAB treatments such as LHRH monotherapy. The overall survival (OS) and cancer-specific survival (CSS) for each group were estimated by the Kaplan-Meier method. A total of 2,967 patients (79.1%) received CAB. Overall, no significant difference was observed in OS and CSS between the CAB group and the non-CAB group. However, CAB resulted in significantly better OS and CSS compared to non-CAB in patients with very high Japan Cancer of the Prostate Risk Assessment (J-CAPRA) scores of ten or greater (P = 0.007 and 0.013, respectively). Multivariate analysis revealed that CAB was an independent predictive factor for better OS (P = 0.013, hazard ratio = 0.83). Based on large-scale nationwide database, as PADT for prostate cancer patients with very high-risk disease, CAB resulted in better OS than other endocrine treatments.

  18. "A place at the table:" a qualitative analysis of community board members' experiences with academic HIV/AIDS research.

    Science.gov (United States)

    Safo, Stella; Cunningham, Chinazo; Beckman, Alice; Haughton, Lorlette; Starrels, Joanna L

    2016-07-11

    Community advisory boards (CAB) are proposed as one mechanism to carry out successful community based participatory research (CBPR), but the presence of CABs may be insufficient to optimize academic-community partnerships. We conducted semi-structured interviews with minority members of a CAB partnered with a HIV/AIDS research center and identified three themes. First, lack of trust in researchers included two subthemes: researchers' lacked respect for community-based organizations' (CBO's) interests and paid inadequate attention to building trust. Second, power imbalance included three subthemes: CAB members felt like inferior "token" members, felt that a lack of communication led to disempowerment, and held preconceived beliefs of researchers that led to perceived power imbalance. Third, CAB members suggested best practices, including using collaborations to build trust, actively allocating power, and sharing tangible research benefits with CBOs. Our findings indicate that CABs must be founded on trust and instilled with power to meet the tenets of CBPR.

  19. The role of community advisory boards in health research: Divergent views in the South African experience.

    Science.gov (United States)

    Reddy, Priscilla; Buchanan, David; Sifunda, Sibusiso; James, Shamagonam; Naidoo, Nasheen

    2010-10-01

    In the light of the growing involvement of community advisory boards (CABs) in health research, this study presents empirical findings of the functions and operations of CABs in HIV/AIDS vaccine trials in South Africa. The individual and focus group interviews with CAB members, principal investigators, research staff, community educators, recruiters, ethics committee members, trial participants and South African AIDS Vaccine Initiative (SAAVI) staff members demonstrated differences in the respondents' perceptions of the roles and responsibilities of CABs. These findings question the roles of the CABs. Are they primarily there to serve and be accountable to the community, or to serve the accomplishment of the research objectives? Four emergent themes are discussed here: purpose; membership and representation; power and authority; sources of support and independence. The CABs' primary purpose carries significant implications for a wide range of issues regarding their functioning. The dual functions of advancing the research and protecting the community appear to be fraught with tension, and require careful reconsideration.

  20. Dicty_cDB: VSD390 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ', mRNA sequence. 36 0.057 2 CB980143 |CB980143.1 CAB70002_IIIaF_C08 Cabernet Sau... CB980214 |CB980214.1 CAB70002_IIIaR_C08 Cabernet Sauvignon Berry Post-Veraison - CAB7 Vitis vinifera cDNA c...0636_A06 Vitis vinifera cv. cabernet sauvignon Stem - CAST Vitis vinifera cDNA clone CAST0003_IVR_A06 3', mR

  1. Efficacy of combined androgen blockade with zoledronic acid treatment in prostate cancer with bone metastasis: the ZABTON-PC (zoledronic acid/androgen blockade trial on prostate cancer) study.

    Science.gov (United States)

    Ueno, Satoru; Mizokami, Atsushi; Fukagai, Takashi; Fujimoto, Naohiro; Oh-Oka, Hitoshi; Kondo, Yukihiro; Arai, Gaku; Ide, Hisamitsu; Horie, Shigeo; Ueki, Osamu; Kawaguchi, Kouhei; Shimamura, Masayoshi; Orito, Matsuo; Ishida, Takeyuki; Ikeda, Daisuke; Namiki, Mikio

    2013-09-01

    Zoledronic acid (ZA) reduces the risk of skeletal-related events (SREs) in castration-resistant prostate cancer (CRPC) with bone metastasis and improves quality of life. It remains unclear when clinicians should initiate ZA treatment. Hormone-naïve patients were randomized to a combined androgen blockade (CAB) group or CAB with ZA group (CAB-ZA) based on Gleason score (GS) or extent of disease. The primary end-point of the study was progression-free survival (PFS) and the secondary end-point was incidence of SREs and bone pain. Thirty-one and 29 patients among 60 enrolled patients were assigned to the CAB group and the CAB-ZA group, respectively. There was no significant difference in PFS between the two groups. Subgroup analyses revealed better PFS in the CAB-ZA group with GS ≥8 (p=0.021). Moreover, incidence of SREs, including bone pain, was lower in the CAB-ZA group (p=0.019). CAB-ZA treatment was found to improve PFS for patients with prostate cancer with high GS. CAB-ZA treatment could be recommended for treatment of patients with prostate cancer.

  2. Prototype Concept Design for U.S. Army Type IIIA Air Traffic Control Tower (ATCT).

    Science.gov (United States)

    1984-10-01

    include the cab’s visual obstructions, remoteness of restroom facil- ities from the cab, inconvenient access to the catwalk, and intrusion of the...0 . u. 5 0 au .. a I a JI VVu~ a . 40 0 Ccs *I V a O k 3k 1,0 ow -e "a sh g.. .0 O -U 3s61 me .h b S 0 S.. k U 15 moba - us 27 0 1 r . . D* 2 t 6 C 0...To minimize visual interface from within the cab, one rear corner column in the control tower will incorporate a downspout. Below the cab module

  3. Coral-Associated Bacteria as a Promising Antibiofilm Agent against Methicillin-Resistant and -Susceptible Staphylococcus aureus Biofilms

    Directory of Open Access Journals (Sweden)

    Shanmugaraj Gowrishankar

    2012-01-01

    Full Text Available The current study deals with the evaluation of two coral-associated bacterial (CAB extracts to inhibit the biofilm synthesis in vitro as well as the virulence production like hemolysin and exopolysaccharide (EPS, and also to assess their ability to modify the adhesion properties, that is cell surface hydrophobicity (CSH of methicillin-resistant (MRSA and -susceptible Staphylococcus aureus (MSSA. Out of nine CAB screened, the ethyl acetate extract of CAB-E2 (Bacillus firmus and CAB-E4 (Vibrio parahemolyticus have shown excellent antibiofilm activity against S. aureus. CAB-E2 reduced the production of EPS (57–79% and hemolysin (43–70%, which ultimately resulted in the significant inhibition of biofilms (80–87% formed by both MRSA and MSSA. Similarly, CAB-E4 was also found to decrease the production of EPS (43–57%, hemolysin (43–57% and biofilms (80–85% of test pathogens. CLSM analysis also proved the antibiofilm efficacy of CAB extracts. Furthermore, the CAB extracts strongly decreased the CSH of S. aureus. Additionally, FT-IR analysis of S. aureus treated with CAB extracts evidenced the reduction in cellular components compared to their respective controls. Thus, the present study reports for the first time, B. firmus—a coral-associated bacterium, as a promising source of antibiofilm agent against the recalcitrant biofilms formed by multidrug resistant S. aureus.

  4. Suppression of mTOR pathway and induction of autophagy-dependent cell death by cabergoline

    Science.gov (United States)

    Cai, Lin; Cai, Yu; Li, Ning; Shang, Han Bing; Le, Wei-Dong; Zhao, Wei Guo; Wu, Zhe Bao

    2015-01-01

    Cabergoline (CAB), the first-line drug for treatment of prolactinomas, is effective in suppressing prolactin hypersecretion, reducing tumor size, and restoring gonadal function. However, mechanisms for CAB-mediated tumor shrinkage are largely unknown. Here we report a novel cytotoxic mechanism for CAB. CAB induced formation of autophagosome in rat pituitary tumor MMQ and GH3 cells at the early stage through inhibiting mTOR pathway, resulting in higher conversion rates of LC3-I to LC3-II, GFP-LC3 aggregation, and increased autophagosome formation. Interestingly, CAB treatment augmented lysosome acidification and resulted in impaired proteolytic degradation within autolysosomes. This blocked the autophagic flux, leading to the accumulation of p62 aggregation and undigested autolysosomes. Knockdown of ATG7, ATG5, or Becn1, could significantly rescue the CAB-mediated cell death of MMQ cells (p < 0.05). CAB-induced autophagy and blockade of autophagy flux participated in antitumoral action in vivo. In conclusion, our study provides evidence that CAB concomitantly induces autophagy and inhibits the autophagic flux, leading to autophagy-dependent cell death. These findings elucidate novel mechanisms for CAB action. PMID:26513171

  5. Country analysis briefs: 1994. Profiles of major world energy producers, consumers, and transport centers

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-05-01

    Country Analysis Briefs: 1994 is a compilation of country profiles prepared by the Energy Markets and Contingency Information Division (EMCID) of the Office of Energy Markets and End Use. EMCID maintains Country Analysis Briefs (CABs) for specific countries or geographical areas that are important to world energy markets. As a general rule, CABs are prepared for all members of the Organization of Petroleum Exporting Countries (OPEC), major non-OPEC oil producers (i.e., the North Sea, Russia), major energy transit areas (i.e., Ukraine), and other areas of current interest to energy analysts and policy makers. As of January 1995, EMCID maintained over 40 CABs, updated on an annual schedule and subject to revision as events warrant. This report includes 25 CABs updated during 1994. All CABs contain a profile section, a map showing the country`s location, and a narrative section. The profile section includes outlines of the country`s economy, energy sector, and environment. The narrative provides further information and discussion of these topics. Some CABs also include a detailed map displaying locations of major oil and gas fields, pipelines, ports, etc. These maps were created as a result of special individual requests and so are not typically a standard feature of the CABs. They are presented here wherever available as a supplement to the information contained in the CABs.

  6. ESTCP Munitions Response: Live Site Demonstration Former Camp Ellis

    Science.gov (United States)

    2014-07-01

    former cantonment area remain unfarmed because the thick concrete slabs used as building foundations are difficult to remove. Tree groves exist in...heated cab improved working conditions and helped minimize the potential for cold-stress injuries.  The cab provided a waterproof location for the

  7. Improved safety culture and labor-management relations attributed to changing at-risk behavior process at Union Pacific.

    Science.gov (United States)

    2009-09-01

    Changing At-Risk Behavior (CAB) is a safety process that is being conducted at Union Pacifics San Antonio Service Unit (SASU) with the aim of improving road and yard safety. CAB is an example of a proactive safety risk-reduction method called Clea...

  8. De invloed van kortere remtijden op de verkeersveiligheid : beschouwingen over een gecombineerd gas- en rempedaal.

    NARCIS (Netherlands)

    Kampen, L.T.B. van & Schoon, C.C.

    1991-01-01

    A combined accelerator-brake pedal in passenger cars is a device that combines the accelerating and braking functions in one pedal. This device is known as the CAB system. The aim of the CAB system is to save the time that is normally spent in moving the foot from the accelerator to the brake pedal.

  9. NCBI nr-aa BLAST: CBRC-CELE-05-0706 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0706 ref|NP_507019.1| C06C6.1 [Caenorhabditis elegans] emb|CAB07561.1|... Hypothetical protein C06C6.1 [Caenorhabditis elegans] emb|CAB07667.1| Hypothetical protein C06C6.1 [Caenorhabditis elegans] NP_507019.1 0.0 94% ...

  10. NCBI nr-aa BLAST: CBRC-CBRE-01-0958 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0958 ref|NP_496808.1| F15D4.7 [Caenorhabditis elegans] emb|CAB02490.2|... Hypothetical protein F15D4.7 [Caenorhabditis elegans] emb|CAB60425.1| Hypothetical protein F15D4.7 [Caenorhabditis elegans] NP_496808.1 0.0 38% ...

  11. NCBI nr-aa BLAST: CBRC-CREM-01-1025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1025 ref|NP_496808.1| F15D4.7 [Caenorhabditis elegans] emb|CAB02490.2|... Hypothetical protein F15D4.7 [Caenorhabditis elegans] emb|CAB60425.1| Hypothetical protein F15D4.7 [Caenorhabditis elegans] NP_496808.1 0.0 33% ...

  12. Train-to-Train Impact Test of Crash-Energy Management Passenger Rail Equipment: Structural Results

    Science.gov (United States)

    2006-01-01

    On March 23, 2006, a full-scale test was conducted on a : passenger rail train retrofitted with newly developed cab end : and non-cab end crush zone designs. This test was conducted : as part of a larger testing program to establish the degree of : e...

  13. Gclust Server: 805 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(204) 267 CAB3 (CHLOROPHYLL A/B BINDING PROTEIN 3); chlorophyll binding 84 1.00e-45...267 Representative annotation CAB3 (CHLOROPHYLL A/B BINDING PROTEIN 3); chlorophyll binding Number of

  14. Caffeinated alcohol use and expectancies for caffeine versus alcohol.

    Science.gov (United States)

    Lau-Barraco, Cathy; Linden, Ashley N

    2014-08-01

    Caffeinated alcoholic beverage (CAB) use is related to alcohol-related risk. Limited research has examined outcome expectancies and CAB consumption. This study tested the predictive utility of caffeine and alcohol expectancies in CAB use outcomes (i.e. quantity, frequency, and alcohol-related harms). Participants were 419 (302 women) alcohol and caffeine users from a mid-sized urban university. Data collection occurred between August 2010 and December 2011. Participants completed measures of caffeine and alcohol expectancies, alcohol problems, alcohol use, and CAB use. Caffeine and alcohol expectancies contributed uniquely to approximately 12% of the variability in quantity, 8% in frequency, and 16% in problems. When examined separately, alcohol expectancies explained approximately 10% to 11% of the variance, whereas caffeine expectancies accounted for 6% of the variance in CAB use quantity. For CAB use frequency, alcohol and caffeine expectancies accounted for about 8% and 4%, respectively. Alcohol expectancies accounted for 12% to 14% of variance, whereas caffeine expectancies accounted for 4% to 6% in alcohol-related harms. CONCLUSIONS/ IMPORTANCE: The present study sought to address a gap in the literature regarding the contributions of expectancies in the prediction of CAB use. Our findings provide support for the predictive utility of both caffeine and alcohol expectancies in accounting for individual variability in CAB use but alcohol expectancies may exert greater impact on use patterns. Inclusion of both types of expectancies in larger theoretical frameworks may be beneficial in gaining a more complete and deeper conceptualization of this risky behavior.

  15. 21 CFR 26.66 - Designation and listing procedures.

    Science.gov (United States)

    2010-04-01

    ... 26.66 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL MUTUAL RECOGNITION OF PHARMACEUTICAL GOOD MANUFACTURING PRACTICE REPORTS, MEDICAL DEVICE QUALITY SYSTEM... confirmation, the inclusion in subpart B of this part of the proposed CAB or CAB's shall take effect; and (d...

  16. Bayesian object-based estimation of LAI and chlorophyll from a simulated Sentinel-2 top-of-atmosphere radiance image

    NARCIS (Netherlands)

    Laurent, V.C.E.; Schaepman, M.E.; Verhoef, W.; Weyermann, J.; Chavez Oyanadel, R.O.

    2014-01-01

    Leaf area index (LAI) and chlorophyll content (Cab) are important vegetation variables which can be monitored using remote sensing (RS). Physically-based approaches have higher transferability and are therefore better suited than empirically-based approaches for estimating LAI and Cab at global

  17. 49 CFR 230.83 - Cylinder cocks.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Cylinder cocks. 230.83 Section 230.83... Tenders Cabs, Warning Signals, Sanders and Lights § 230.83 Cylinder cocks. Each steam locomotive shall be equipped with cylinder cocks which can be operated from the cab of the steam locomotive. All cylinder cocks...

  18. 49 CFR 236.588 - Periodic test.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Periodic test. 236.588 Section 236.588..., Train Control and Cab Signal Systems Inspection and Tests; Locomotive § 236.588 Periodic test. Except as provided in § 236.586, periodic test of the automatic train stop, train control, or cab signal apparatus...

  19. NCBI nr-aa BLAST: CBRC-AGAM-02-0095 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0095 emb|CAB01605.1| UL36 [Bovine herpesvirus 1] emb|CAA06097.1| very ...large virion protein (tegument) [Bovine herpesvirus type 1.1 (strain Cooper)] CAB01605.1 1e-08 28% ...

  20. NCBI nr-aa BLAST: CBRC-TGUT-09-0012 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-09-0012 emb|CAB01605.1| UL36 [Bovine herpesvirus 1] emb|CAA06097.1| very ...large virion protein (tegument) [Bovine herpesvirus type 1.1 (strain Cooper)] CAB01605.1 1e-10 30% ...

  1. 49 CFR 238.403 - Crash energy management.

    Science.gov (United States)

    2010-10-01

    ... operator's cab in each power car; (2) A minimum of an additional 3 MJ shall be absorbed by the power car structure between the operator's cab and the first trailer car; and (3) The end of the first trailer car... resulting from dynamic forces transmitted to occupied volumes. (b) The design of each unit shall consist of...

  2. AcEST: BP918578 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Picea... 94 3e-18 tr|Q9FN48|Q9FN48_ARATH Emb|CAB75797.1 (Extracellular calcium...G D+ Sbjct: 400 FGTTRSGS--QATSR--RLLAGGLDD 421 >tr|Q9FN48|Q9FN48_ARATH Emb|CAB75797.1 (Extracellular calcium

  3. Browse Title Index

    African Journals Online (AJOL)

    Vol 12, No 11 (2013), Building a bi-directional promoter binary vector from the intergenic region of Arabidopsis thaliana cab1 and cab2 divergent genes useful for plant ... Vol 12, No 51 (2013), Cactus (Opuntia ficus indica f. inermis) fruit juice protects against ethanol-induced hematological and biochemical damages in rats ...

  4. 49 CFR 236.513 - Audible indicator.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Audible indicator. 236.513 Section 236.513..., Train Control and Cab Signal Systems Standards § 236.513 Audible indicator. (a) The automatic cab signal... audible indicator will sound continuously until silenced by manual operation of an acknowledging device...

  5. The Role of Army Railroading at the Tactical Level of War

    Science.gov (United States)

    1988-12-01

    man per meter to keep the line operational. 7 4 Repair of bridges and tunnels can require major commitments. The Savone River crossing in Italy...engineers. The system is constructed around a full-sized cab that is mounted on six axles and uses synchronized film projection onto cab windows to provide

  6. Multiphase materials with lignin. VI. Effect of cellulose derivative structure on blend morphology with lignin

    Science.gov (United States)

    Timothy G. Rials; Wolfgang G. Glasser

    1989-01-01

    Polymeric blends of lignin with ethyl cellulose (EC) and cellulose acetate/butyrate (CAB) prepared by solution casting from dioxane. Fracture surface analysis by scanning electron microscopy revealed phase separation when the lignin content exceeded 10% for blends with EC and 5% in the CAB system. While this phase behavior is as predicted for the EC blends, a greater...

  7. 49 CFR 236.516 - Power supply.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Power supply. 236.516 Section 236.516..., Train Control and Cab Signal Systems Standards § 236.516 Power supply. Automatic cab signal, train stop, or train control device hereafter installed shall operate from a separate or isolated power supply...

  8. Dicty_cDB: CFI278 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 489345.1 Sequence 6645 from Patent WO02053728. 52 9e-05 2 CB348865 |CB348865.1 CAB2SG0005_IVbF_D11 Cabernet ...4 |CB971834.1 CAB10006_IIIa_Fa_E02 Cabernet Sauvignon Flower Pre-bloom - CAB1 Vit...mbda Zap II library Beta vulgaris cDNA clone A-14-10, mRNA sequence. 52 0.013 1 CB982722 |CB982722.1 CAB70007_IIIb_Fb_H09 Caberne...', mRNA sequence. 52 0.013 1 CB981893 |CB981893.1 CAB70005_IVaF_D05 Cabernet Sauv

  9. Applications of a plane wave based room correction system for low frequencies using multiple loudspeakers

    DEFF Research Database (Denmark)

    Celestinos, Adrian; Nielsen, Sofus Birkedal

    2008-01-01

    When low frequency sound is radiated inside small listening spaces by loudspeakers, large uniformities occur over the sound field. This is due to the multiple reflection and diffraction of sound on the walls and different objects in the room. A developed system named Controlled Acoustically Bass...... System (CABS) produces uniform sound field at low frequencies. This is performed by utilizing loudspeakers at the front wall and extra loudspeakers at the opposite wall, processed to remove the rear-wall reflection of a rectangular room. Effectiveness of CABS on different room scenarios has been...... evaluated by using a computer simulation program based on the Finite Difference Time Domain Method (FDTD). CABS has been simulated in a small car cabin and in an irregular room. Non-ideal placement of loudspeakers in CABS have been evaluated. The influence of utilizing CABS with different types...

  10. Impulsivity and alcohol demand in relation to combined alcohol and caffeine use.

    Science.gov (United States)

    Amlung, Michael; Few, Lauren R; Howland, Jonathan; Rohsenow, Damaris J; Metrik, Jane; MacKillop, James

    2013-12-01

    Problematic alcohol use among college students continues to be a prominent concern in the United States, including the growing trend of consuming caffeinated alcoholic beverages (CABs). Epidemiologically, CAB use is associated with incremental risks from drinking, although these relationships could be due to common predisposing factors rather than specifically due to CABs. This study investigated the relationship between CAB use, alcohol misuse, and person-level characteristics, including impulsive personality traits, delayed reward discounting, and behavioral economic demand for alcohol use. Participants were 273 regularly drinking undergraduate students. Frequency of CAB use was assessed over the past month. A multidimensional assessment of impulsivity included the UPPS-P questionnaire, which measures positive and negative urgency, premeditation (lack thereof), perseverance (lack thereof), and sensation seeking (Lynam, Smith, Whiteside, & Cyders, 2007), and a validated questionnaire-based measure of delayed reward discounting. Demand was assessed via a hypothetical alcohol purchase task. Frequency of CAB consumption was significantly higher in men than in women and was also associated with higher impulsivity on the majority of the UPPS-P subscales, steeper delayed reward discounting, and greater demand for alcohol. Significant correlations between CAB use and both alcohol demand and lack of premeditation remained present after including level of alcohol misuse in partial correlations. In a hierarchical linear regression incorporating demographic, demand, and impulsivity variables, CAB frequency continued to be a significant predictor of hazardous alcohol use. These results suggest that although there are significant associations between CAB consumption and gender, impulsivity, and alcohol demand, CAB use continues to be associated with alcohol misuse after controlling for these variables.

  11. A daily diary examination of caffeine mixed with alcohol among college students.

    Science.gov (United States)

    Linden-Carmichael, Ashley N; Lau-Barraco, Cathy

    2017-09-01

    Caffeinated alcoholic beverage (CAB) use is associated with a range of substance-related problems. The majority of prior research on CABs is based on cross-sectional and retrospective reports, which do not account for intraindividual differences in use and may be subject to recall biases. The current research used a daily diary, within-subjects design to compare days where individuals simultaneously mixed alcohol with caffeine (CAB days) and days where individuals drank other types of alcohol (non-CAB days) on alcohol use outcomes. These relationships were tested further by examining the impact of the type of mixer (i.e., energy drink or cola-caffeinated). Participants were 122 (73.8% women) heavy drinking, college student CAB users. Mean age was 20.39 (SD = 2.08) years. Students completed a baseline questionnaire and up to 14 consecutive daily surveys about the previous night's drinking behavior. Multilevel modeling results indicated that CAB days were associated with heavier alcohol use, regardless of mixer type. In addition, beyond amount of alcohol consumed the previous night and trait impulsivity, CAB days were linked with more alcohol-related problems, but only when the mixer was an energy drink. CAB days did not differ from non-CAB days on driving or sex after drinking. This study was the first to demonstrate the unique risks posed by simultaneously consuming caffeine and alcohol in a within-subjects, daily diary design. Future research investigating use patterns may benefit from the use of fine-grained approaches in order to provide information relevant for CAB prevention and intervention efforts. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  12. Second attempt of Cabergoline withdrawal in patients with prolactinomas after a failed first attempt : is it worthwhile?

    Directory of Open Access Journals (Sweden)

    Lucio eVilar

    2015-02-01

    Full Text Available Successful discontinuation of cabergoline (CAB treatment has been reported in 31 to 74% of prolactinomas patients treated for at least two years. In contrast, it is not well established whether CAB therapy can be successfully withdrawn after a failed first attempt. This prospective open trial was designed to address this topic and to try to identify possible predictor factors.Among 180 patients with prolactinomas on CAB therapy, the authors selected those who fulfilled very strict criteria, particularly additional CAB therapy for at least 2 years, normalization of serum prolactin (PRL levels following CAB restart, no tumor remnant > 10 mm, no previous pituitary radiotherapy or surgery; and current CAB dose ≤1.0 mg/week. Recurrence was defined as an increase of PRL levels above the upper limit of normal.A total of 34 patients (70.6% female treated with CAB for 24-30 months were recruited. Ten patients (29.4 % remained without evidence of recurrence after 24–26 months of follow-up. Twenty-four patients (70.6% recurred within 15 months (75% within 12 months after drug withdrawal and ~80% were restarted CAB. Median time to recurrence was 10.5 months (range, 3–15. Despite overlapping values, non-recurring patients had significantly lower mean PRL levels before withdrawal. Moreover, the recurrence rate was lower in subjects without visible tumor on pituitary MRI than in those with small remnant tumor (60 vs. 79%, though the difference was not statistically significant (P= 0.20. No other characteristic could be identified as a predictor of successful CAB discontinuation.In conclusion, a second attempt of CAB withdrawal after 2 additional years of therapy may be successful, particularly in patients with lower PRL levels and no visible tumor on pituitary MRI. Close monitoring of PRL level is mandatory, especially within the first year after withdrawal, where most recurrences are detected.

  13. Physical Map Location of the Multicopy Genes Coding for Ammonia Monooxygenase and Hydroxylamine Oxidoreductase in the Ammonia-Oxidizing Bacterium Nitrosomonas sp. Strain ENI-11

    Science.gov (United States)

    Hirota, Ryuichi; Yamagata, Akira; Kato, Junichi; Kuroda, Akio; Ikeda, Tsukasa; Takiguchi, Noboru; Ohtake, Hisao

    2000-01-01

    Pulsed-field gel electrophoresis of PmeI digests of the Nitrosomonas sp. strain ENI-11 chromosome produced four bands ranging from 1,200 to 480 kb in size. Southern hybridizations suggested that a 487-kb PmeI fragment contained two copies of the amoCAB genes, coding for ammonia monooxygenase (designated amoCAB1 and amoCAB2), and three copies of the hao gene, coding for hydroxylamine oxidoreductase (hao1, hao2, and hao3). In this DNA fragment, amoCAB1 and amoCAB2 were about 390 kb apart, while hao1, hao2, and hao3 were separated by at least about 100 kb from each other. Interestingly, hao1 and hao2 were located relatively close to amoCAB1 and amoCAB2, respectively. DNA sequence analysis revealed that hao1 and hao2 shared 160 identical nucleotides immediately upstream of each translation initiation codon. However, hao3 showed only 30% nucleotide identity in the 160-bp corresponding region. PMID:10633121

  14. Protonated form: the potent form of potassium-competitive acid blockers.

    Directory of Open Access Journals (Sweden)

    Hua-Jun Luo

    Full Text Available Potassium-competitive acid blockers (P-CABs are highly safe and active drugs targeting H+,K+-ATPase to cure acid-related gastric diseases. In this study, we for the first time investigate the interaction mechanism between the protonated form of P-CABs and human H+,K+-ATPase using homology modeling, molecular docking, molecular dynamics and binding free energy calculation methods. The results explain why P-CABs have higher activities with higher pKa values or at lower pH. With positive charge, the protonated forms of P-CABs have more competitive advantage to block potassium ion into luminal channel and to bind with H+,K+-ATPase via electrostatic interactions. The binding affinity of the protonated form is more favorable than that of the neutral P-CABs. In particular, Asp139 should be a very important binding site for the protonated form of P-CABs through hydrogen bonds and electrostatic interactions. These findings could promote the rational design of novel P-CABs.

  15. Protonated form: the potent form of potassium-competitive acid blockers.

    Science.gov (United States)

    Luo, Hua-Jun; Deng, Wei-Qiao; Zou, Kun

    2014-01-01

    Potassium-competitive acid blockers (P-CABs) are highly safe and active drugs targeting H+,K+-ATPase to cure acid-related gastric diseases. In this study, we for the first time investigate the interaction mechanism between the protonated form of P-CABs and human H+,K+-ATPase using homology modeling, molecular docking, molecular dynamics and binding free energy calculation methods. The results explain why P-CABs have higher activities with higher pKa values or at lower pH. With positive charge, the protonated forms of P-CABs have more competitive advantage to block potassium ion into luminal channel and to bind with H+,K+-ATPase via electrostatic interactions. The binding affinity of the protonated form is more favorable than that of the neutral P-CABs. In particular, Asp139 should be a very important binding site for the protonated form of P-CABs through hydrogen bonds and electrostatic interactions. These findings could promote the rational design of novel P-CABs.

  16. Anti prostate cancer using PEGylated bombesin containing, cabazitaxel loading nano-sized drug delivery system.

    Science.gov (United States)

    Chen, Wenjun; Guo, Miao; Wang, Shuli

    2016-12-01

    Prostate cancer (PCa) is the second most-frequently diagnosed cancer in men. Cabazitaxel was approved for the treatment of patients with hormone-refractory metastatic prostate cancer previously treated with a docetaxel-containing regimen. In this study, bombesin (BN), a ligand reported to specifically target GRP overexpressing prostate tumor, was applied for the construction of lipid-polymer hybrid nanoparticles (LPNs), and used for the targeted delivery of cabazitaxel (CAB) to prostate cancer. BN-polyethylene glycol-1,2-Distearoyl-sn-glycero-3-phosphoethanolamine (BN-PEG-DSPE) was synthesized. CAB loaded, BN-PEG-DSPE contained LPNs (BN-CAB-LPNs) were prepared. Their particle size, zeta potential and drug encapsulation efficiency (EE) were evaluated. In vitro cytotoxicity study of BN-CAB-LPNs was tested in LNCaP human prostatic cancer cell line (LNCaP cells). In vivo anti-tumor efficacy of the carriers was evaluated on mice bearing prostate cancer model. The optimum BN-CAB-LPNs formulations had a particle size of 184.9 nm and a 26.5 mV positive surface charge. The growth of LNCaP cells in vitro was obviously inhibited. BN-CAB-LPNs also displayed better anti-tumor activity than the other formulations in vivo. The results demonstrated that BN-CAB-LPNs can sufficiently deliver CAB to the cancer cells and enhance the anti-tumor capacity. Thus, BN-CAB-LPNs can be proved to be a superior nanomedicine which can achieve better therapeutic efficacy of prostate tumor.

  17. Highly Scalable Trip Grouping for Large Scale Collective Transportation Systems

    DEFF Research Database (Denmark)

    Gidofalvi, Gyozo; Pedersen, Torben Bach; Risch, Tore

    2008-01-01

    Transportation-related problems, like road congestion, parking, and pollution, are increasing in most cities. In order to reduce traffic, recent work has proposed methods for vehicle sharing, for example for sharing cabs by grouping "closeby" cab requests and thus minimizing transportation cost...... and utilizing cab space. However, the methods published so far do not scale to large data volumes, which is necessary to facilitate large-scale collective transportation systems, e.g., ride-sharing systems for large cities. This paper presents highly scalable trip grouping algorithms, which generalize previous...

  18. AcEST: BP917265 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sponse regulator-like PRR... 53 1e-09 tr|Q84XQ7|Q84XQ7_BRARP Timing of CAB expression 1-like protein (... 51...XT9_VITVI Chromosome chr15 scaffold_37, whole genom... 47 1e-08 tr|Q56TL2|Q56TL2_CASSA Timing of CAB express...omologue OS... 47 1e-07 tr|Q6UEI7|Q6UEI7_MESCR Timing of CAB expression 1 OS=Mese...AEQRPRIKGQFVRRE 131 LAEQRPR+KGQFVR++ Sbjct: 609 LAEQRPRVKGQFVRQD 624 >tr|Q84XQ7|Q84XQ7_BRARP Timing

  19. The use of caffeinated alcoholic beverages among underage drinkers: results of a national survey.

    Science.gov (United States)

    Kponee, Kalé Z; Siegel, Michael; Jernigan, David H

    2014-01-01

    The mixing of alcoholic beverages with caffeine has been identified as a public health problem among college students; however, little is known about the consumption of such drinks among younger adolescents. We estimated the prevalence of caffeinated alcoholic beverage (CAB) use among a wide age range of underage drinkers, examined differences in traditional (i.e. self-mixed alcoholic beverages with soda, coffee and tea) and non-traditional CAB use (pre-mixed caffeinated alcoholic beverages or self-mixed alcoholic beverages with energy drinks or energy shots) among underage drinkers by age and other demographic characteristics, and examined differences in hazardous drinking behavior between CAB and non-CAB users. We used an existing Internet panel maintained by Knowledge Networks, Inc. to assess the use of pre-mixed and self-mixed CABs in the past 30 days among a national sample of 1031 youth drinkers age 13-20. We conducted logistic regression analyses to estimate the relationship between traditional and non-traditional CAB use and risky drinking behavior as well as adverse outcomes of drinking, while controlling for age, gender, race/ethnicity, income, and general risk-taking (seat belt use). The overall prevalence of CAB use in the sample of underage drinkers was 52.4% (95% confidence interval [CI], 47.4%-57.4%). CAB prevalence was 48.4% among 13-15 year-old drinkers, 45.3% among 16-18 year-old drinkers, and 58.4% among 19-20 year-old drinkers. After controlling for other variables, we found a continuum of risk with non-traditional CAB use most significantly associated with binge drinking (odds ratio [OR]=6.3), fighting (OR=4.4), and alcohol-related injuries (OR=5.6). The problem of caffeinated alcoholic beverage use is not restricted to college-aged youth. The prevalence of CAB use among underage drinkers is higher than previously thought and begins in early adolescence. Adolescents who consume CABs, and particularly non-traditional CABs, are at increased risk

  20. AcEST: DK952039 [AcEST

    Lifescience Database Archive (English)

    Full Text Available romosome chr17 scaffold_12, whole genom... 86 2e-15 tr|Q56TL2|Q56TL2_CASSA Timing of CAB expression 1 protei...ld_3, whole genome ... 80 1e-13 tr|Q84XQ7|Q84XQ7_BRARP Timing of CAB expression 1...-like protein (... 79 3e-13 tr|Q2PEF2|Q2PEF2_LEMGI Pseudo-response regulator 95 homologue OS... 79 3e-13 tr|Q6UEI7|Q6UEI7_MESCR Timin...PRVRGQFVRK 488 >tr|Q56TL2|Q56TL2_CASSA Timing of CAB expression 1 protein OS=Castanea sativa GN=TOC1 PE=2 SV...QNVY 714 >tr|Q84XQ7|Q84XQ7_BRARP Timing of CAB expression 1-like protein (Fragmen

  1. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available regulator for glyoxylate bypass [Streptomyces ... coelicolor A3(2)] emb|CAB60165.1| transcriptional ... ... ... regulator for glyoxylate bypass [Streptomyces coelicolor ... A3(2)] ... Length = 240

  2. Prototype design of an engineer collision protection system

    Science.gov (United States)

    2012-04-17

    This research program was sponsored by the Federal Railroad Administration (FRA) Office of Research and Development in support of the advancement of improved safety standards for passenger rail vehicles. In a train collision, the cab or locomotive en...

  3. Filmes ultrafinos de ésteres de celulose: preparo, caracterização e imobilização de proteínas Ultrathin cellulose ester films: preparation, characterization and protein immobilization

    Directory of Open Access Journals (Sweden)

    Jorge Amim Jr.

    2010-01-01

    Full Text Available In this study cellulose acetate butyrate (CAB and carboxymehtylcellulose acetate butyrate (CMCAB films adsorbed onto silicon wafers were characterized by means of ellipsometry, atomic force microscopy (AFM, sum frequency generation spectroscopy (SFG and contact angle measurements. The adsorption behavior of lysozyme (LIS or bovine serum albumin (BSA onto CAB and CMCAB films was investigated. The amounts of adsorbed LIS or BSA onto CMCAB films were more pronounced than those onto CAB films due to the presence of carboxymethyl group in the CMCAB structure. Besides, the adsorption of BSA molecules on CMCAB films was more favored than that of LIS molecules. Antimicrobial effect of LIS bound to CAB or CMCAB layers was evaluated using Micrococcus luteus as substrate.

  4. Dicty_cDB: VHA711 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IASMA L1 HindIII BAC library Vitis vinifera genomic, genomic survey sequence. 44 0.010 2 CB980117 |CB980117.1 CAB70001_IaR_H03 Cabern...DNA clone CAB70001_IaR_H03 3', mRNA sequence. 44 0.011 2 CB979848 |CB979848.1 CAB70001_IIcF_H03 Cabernet Sau...CB980047 |CB980047.1 CAB70001_IaF_H03 Cabernet Sauvignon Berry Post-Veraison - CA...lone ENTAV 115. 38 0.014 2 CT502850 |CT502850.1 A BAC library has been constructed from cultivar Cabernet Sa

  5. Dicty_cDB: CFF367 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available esculentum cDNA clone cLED28D14, mRNA sequence. 48 0.14 1 CB978867 |CB978867.1 CAB40006_IVa_Ra_B06 Cabernet ...CB978798.1 CAB40006_IVa_Fa_B06 Cabernet Sauvignon Berry - CAB4 Vitis vinifera cDN...A clone CAB40006_IVa_Fa_B06 5', mRNA sequence. 48 0.14 1 CB342417 |CB342417.1 CA32EN0003_IIaF_B08 Cabernet S...CB342483.1 CA32EN0003_IIaR_B08 Cabernet Sauvignon Leaf - CA32EN Vitis vinifera cDNA clone CA32EN0003_IIaR_B0

  6. Using cognitive task analysis to inform issues in human systems integration in railroad operations

    Science.gov (United States)

    2013-05-23

    U.S. Railroad operations are undergoing rapid changes involving the introduction of new technologies such as positive train control (PTC), energy management systems (EMS), and electronically controlled pneumatic (ECP) brakes in the locomotive cab. To...

  7. 75 FR 61386 - Emergency Escape Breathing Apparatus Standards

    Science.gov (United States)

    2010-10-05

    ... Noise Exposure'' to ``Occupational Safety and Health in the Locomotive Cab'' and by making other... and vibration resistance resulting from such testing. Assuming a 50- percent duty life cycle, the...

  8. Determination of the capability of common bean “amachamiento” (Aphelenchoides besseyi Christie) of being seed-transmitted

    National Research Council Canada - National Science Library

    Néstor Felipe Chaves-Barrantes; Juan Carlos Hernández-Fonseca; Carlos Manuel Araya-Fernández

    2015-01-01

    .... During 2007 and 2008, seeds were collected from nematode-infested common bean plants (cv. Cabécar) previously showing characteristic symptoms, in commercial plantations of the Brunca region of Costa Rica...

  9. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    Abstracted by: Bioline International, African Journals online (AJOL), Index Copernicus, African Index Medicus (WHO), Excerpta medica. (EMBASE), CAB Abstracts, SCOPUS, Global Health Abstracts, Asian Science Index, Index Veterinarius. INTRODUCTION. In Homo sapiens, reproduction is initiated by the mating of a.

  10. Geological, biological, and chemical data for Benthic Sediment Baseline Study of Mobile Bay from 3 Apr 1980 to 26 Aug 1981 (NODC Accession 0117430)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Abstract: Beginning in late 1979, the Alabama Coastal Area Board (CAB) funded a series of baseline surveys on the coastal resources of Alabama, from which they could...

  11. (SNP) markers

    African Journals Online (AJOL)

    SAM

    2014-05-21

    May 21, 2014 ... These accessions had been originally introduced from international germplasm collections. The multilocus SNP profiles ... the SNP profiles of reference trees maintained in the international cacao collections. The comparison ...... CAB International, CABI Publishing, Wallingford, Oxfordshire. Buckler ES ...

  12. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available exulose 3,5-Epimerase) Structure ... From Mycobacterium Tuberculosis And Inhibitor Design. ... ...ture ... From Mycobacterium Tuberculosis And Inhibitor Design. ... The Apo Structure. emb|CAB0

  13. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available exulose 3,5-Epimerase) Structure ... From Mycobacterium Tuberculosis And Inhibitor Design. ... ...ture ... From Mycobacterium Tuberculosis And Inhibitor Design. ... The Apo Structure. emb|CAB0

  14. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available exulose 3,5-Epimerase) Structure ... From Mycobacterium Tuberculosis And Inhibitor Design. ... ...ture ... From Mycobacterium Tuberculosis And Inhibitor Design. ... The Apo Structure. emb|CAB0

  15. 77 FR 58608 - Railroad Safety Advisory Committee (RSAC); Working Group Activity Update

    Science.gov (United States)

    2012-09-21

    ... on the success of the ETF in developing a set of alternative technical criteria and procedures for..., cab cars, multiple-unit (MU) locomotives, and coach cars. The equipment addressed may be used in any...

  16. 76 FR 72997 - Railroad Safety Advisory Committee (RSAC); Working Group Activity Update

    Science.gov (United States)

    2011-11-28

    ... success of the ETF in developing a set of alternative technical criteria and procedures for evaluating the..., cab cars, multiple-unit (MU) locomotives, and coach cars. The equipment addressed may be used in any...

  17. 75 FR 76070 - Railroad Safety Advisory Committee (RSAC); Working Group Activity Update

    Science.gov (United States)

    2010-12-07

    .../downloads/safety/RSAC_REPORT-%209-16-10.pdf . (Engineering Task Force II) To build on the success of the ETF..., cab cars, multiple-unit (MU) locomotives, and coach cars. The equipment addressed may be used in any...

  18. 78 FR 54629 - Consumer Advisory Board meeting

    Science.gov (United States)

    2013-09-05

    ... From the Federal Register Online via the Government Publishing Office CONSUMER FINANCIAL PROTECTION BUREAU Consumer Advisory Board meeting AGENCY: Bureau of Consumer Financial Protection. ACTION... Consumer Advisory Board (``CAB'' or ``Board'') of the Consumer Financial Protection Bureau (Bureau). The...

  19. Biological Data for Biological Baseline Studies of Mobile Bay: Benthic Fauna 1980-1981 (NODC Accession 0116100)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Beginning in late 1979, the Alabama Coastal Area Board (CAB) funded a series of baseline surveys on the coastal resources of Alabama, from which they could develop a...

  20. Antiulcer Effects of Melatonin in Wistar Rats

    African Journals Online (AJOL)

    Dr Olaleye

    Bioline International, African Journals Online (AJOL), Index Copernicus, African Index Medicus (WHO), Excerpta medica (EMBASE), CAB. Abstracts, SCOPUS, Global Health Abstracts, Asian Science Index, Index Veterinarius. INTRODUCTION. Melatonin is an endogenous hormone synthesized and released by the pineal ...

  1. Muscle oxygenation, EMG, and cardiovascular responses for cabin attendants vs. controls

    DEFF Research Database (Denmark)

    Sandfeld, Jesper; Larsen, Lisbeth Højkjær; Crenshaw, Albert Guy

    2013-01-01

    The goal was to investigate the effect of acute moderate hypobaric exposure on the physiological responses to sustained contractions (local) and light to moderate dynamic exercise (systemic) for cabin attendants (CAB) and a matched control group (CON)....

  2. Wheels in the Head: Ridesharing as Monitored Performance

    National Research Council Canada - National Science Library

    Donald N Anderson

    2016-01-01

      For-profit "ridesharing" services (or soft cabs) offer on-demand rides much like taxicabs, but are distinguished by an affective framing which emphasizes that drivers are "friends with cars, on demand" rather than "cabdrivers...

  3. Changes in photosynthesis and activities of enzymes involved in ...

    African Journals Online (AJOL)

    tolerance, respectively were used to investigate the oxygen consumption rate of photosystem I, the oxygen evolution rate of photosystem II, cab transcript levels, and activities of enzymes involved in photosynthetic carbon reduction cycle.

  4. Shared-Ride Taxi Service in Boston, MA

    Science.gov (United States)

    1985-03-01

    This report presents an evaluation of the Boston Shared-Ride Taxi Demonstration. The City of Boston's Traffic and Parking Department, the project grantee, designed a shared-ride service for Boston's Allston-Brighton neighborhood; Boston Cab Associati...

  5. Efficacy of Cabazitaxel Treatment in Metastatic Castration Resistant Prostate Cancer in Second and Later Lines. An Experience from Two German Centers.

    Science.gov (United States)

    Zschäbitz, Stefanie; Vallet, Sonia; Hadaschik, Boris; Debatin, Daniel; Fuxius, Stefan; Karcher, Andreas; Pahernik, Sascha; Spath, Cathleen; Duensing, Stefan; Jäger, Dirk; Hohenfellner, Markus; Grüllich, Carsten

    2017-01-01

    Purpose: Several new treatment options for patients with metastatic castration resistant prostate cancer (mCRPC) have been approved within the last years - among them cabazitaxel (CAB), abiraterone acetate, enzalutamide, and radium-223. The aim of this study was to assess factors predictive for efficacy of CAB. Methods: We analyzed all patients with mCRPC treated with CAB at our institutions between 2011 and 2016. Data were retrieved retrospectively from the electronical patient chart. Results: 69 patients received CAB (26.1% 2nd line, 36.2% 3rd line, 37.3% >3rd line). Median overall survival (OS) on CAB was 10.0 months (95%CI 7.1-12.9). Median progression free survival (PFS) on CAB was 3.9 months (95%CI 3.0-4.8). There were no differences in OS and PFS regarding treatment line of CAB (2nd vs. higher; 2nd/3rd vs. higher). Duration of remission on 1st line treatment (> 6 months vs. CAB treatment (4.1 months vs. 3.0 months (95%CI 3.0-5.2; 2.2-3.8); p=0.021). Patients with visceral metastases had a shorter PFS (3.0 months; 95%CI 2.6-3.3) and OS (8.7 months; 95%CI 5.9-11.5) on CAB compared to patients who had bone and/or lymph node lesions only (PFS: 5.8 months; 95%CI 3.2-8.4; p=0.014; OS: 11.7 months; 95%CI 7.5-15.9; p=0.042). Conclusions: Results from our patient cohort suggest that a longer PFS to any 1st line treatment for mCRPC is correlated with a longer PFS to CAB for any later line treatment. Patients with nodal and bone metastases only had a significantly superior PFS and OS with CAB treatment than patients with visceral metastases.

  6. Using community advisory boards to reduce environmental barriers to health in American Indian communities, Wisconsin, 2007-2012.

    Science.gov (United States)

    Adams, Alexandra K; Scott, Jamie R; Prince, Ron; Williamson, Amy

    2014-09-18

    American Indian communities have a high prevalence of chronic diseases including diabetes, obesity, cardiovascular disease, and cancer. Innovative community-based approaches are needed to identify, prioritize, and create sustainable interventions to reduce environmental barriers to healthy lifestyles and ultimately improve health. Healthy Children, Strong Families was a family-based and community-based intervention to increase healthy lifestyles on Wisconsin American Indian reservations. This intervention arose from a long-standing partnership between University of Wisconsin researchers and 3 of these American Indian communities. In each community, community advisory boards (CABs) were established by the residents and university partners. CAB meetings were open and held at various times and locations to increase member participation. CABs featured continual, snowball recruitment; internal and external expert consultation; and coordination with standing tribal committees. Meetings initially focused on understanding community supports for and barriers to healthy lifestyles but quickly turned toward community action for change. CAB interventions decreased environmental barriers to health at each site and improved options for healthy lifestyle choices. Over 5 years, 71 CAB meetings occurred with a total of 1,070 participants. Successful CAB interventions included planting community gardens and an apple orchard, conducting gardening and canning workshops, instituting food-related policies and dog control regulations, building an environmentally friendly playground, and providing access to recreational facilities. The CABs are now self-sustaining. CABs can be highly effective action teams capable of improving community environments. Our experience shows that academic researchers can partner with community residents to generate programs and policies that will expand access to local food, increase people's choices for engaging in physical activity, and encourage local

  7. Research on Secondary Impact Safety of Train Driver based on THUMS Dummy

    OpenAIRE

    Wang Wenbin; Ji Jiawei; Yue Zhitao; Zhang Dongdong; Tian Honglei; Zhao Hongwei

    2016-01-01

    Based on biomechanical Total Human Model for Safety (THUMS) dummy and traditional rigid dummy, the train driver injury of secondary impact in railway crash events is analyzed and the results are compared. The results of THUMS dummy are more detail and comprehensive to describe the injury of train driver. It could be applied to the safety research of crashworthiness of train driver cab in future. The driver injury is serious and needed to be optimized the parameter of cab console to reduce inj...

  8. PASSIVE SAFETY OF HIGH-SPEED PASSENGER TRAINS AT ACCIDENT COLLISIONS ON 1520 MM GAUGE RAILWAYS

    Directory of Open Access Journals (Sweden)

    Maryna SOBOLEVSKA

    2017-04-01

    Full Text Available The fundamental principles of the passive protection concept of high-speed passenger trains at accident collisions on 1520 mm gauge railways have been developed. The scientific methodology and mathematical models for the analysis of plastic deformation of cab frame elements and energy-absorbing devices (EAD at an impact have been developed. The cab frame and EAD for a new-generation locomotive have been designed. The EAD prototype crash test has been carried out.

  9. Prevention of aggregation and renaturation of carbonic anhydrase via weak association with octadecyl- or azobenzene-modified poly(acrylate) derivatives.

    Science.gov (United States)

    Martin, Nicolas; Ruchmann, Juliette; Tribet, Christophe

    2015-01-01

    The prevention of aggregation during renaturation of urea-denatured carbonic anhydrase B (CAB) via hydrophobic and Coulomb association with anionic polymers was studied in mixed solutions of CAB and amphiphilic poly(acrylate) copolymers. The polymers were derivatives of a parent poly(acrylic acid) randomly grafted with hydrophobic side groups (either 3 mol % octadecyl group, or 1-5 mol % alkylamidoazobenzene photoresponsive groups). CAB:polymer complexes were characterized by light scattering and fluorescence correlation spectroscopy in aqueous buffers (pH 7.75 or 5.9). Circular dichroism and enzyme activity assays enabled us to study the kinetics of renaturation. All copolymers, including the hydrophilic PAA parent chain, provided a remarkable protective effect against CAB aggregation during renaturation, and most of them (but not the octadecyl-modified one) markedly enhanced the regain of activity as compared to CAB alone. The significant role of Coulomb binding in renaturation and comparatively the lack of efficacy of hydrophobic association was highlighted by measurements of activity regain before and after in situ dissociation of hydrophobic complexes (achieved by phototriggering the polarity of azobenzene-modified polymers under exposure to UV light). In the presence of polymers (CAB:polymer of 1:1 w/w ratio) at concentration ∼0.6 g L(-1), the radii of the largest complexes were similar to the radii of the copolymers alone, suggesting that the binding of CAB involves one or a few polymer chain(s). These complexes dissociated by dilution (0.01 g L(-1)). It is concluded that prevention of irreversible aggregation and activity recovery were achieved when marginally stable complexes are formed. Reaching a balanced stability of the complex plays the main role in CAB renaturation, irrespective of the nature of the binding (by Coulomb association, with or without contribution of hydrophobic association).

  10. Human calumenin localizes to the secretory pathway and is secreted to the medium

    DEFF Research Database (Denmark)

    Vorum, H; Hager, H; Christensen, Birgitte Mønster

    1999-01-01

    Calumenin belongs to a family of multiple EF-hand proteins that include reticulocalbin, ERC-55, and Cab45. Reticulocalbin and ERC-55 localize to the ER due to a C-terminal HDEL retrieval signal. Cab45 contains a HEEF C-terminal sequence and is localized to the Golgi apparatus. The murine homologu......, suggesting that the glycosylated protein has been further modified in the Golgi apparatus and secreted to the medium. Udgivelsesdato: 1999-May-1...

  11. AcEST: DK958483 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tr|A7PGK4|A7PGK4_VITVI Chromosome chr17 scaffold_16, whole genom... 70 2e-10 tr|Q9FN48|Q9FN48_ARATH Emb|CAB757...QTTKLIQEAKPIASSTVET 188 Query: 633 IISADPLFI 659 I +A+P I Sbjct: 189 ISTAEPTVI 197 >tr|Q9FN48|Q9FN48_ARATH Emb|CAB757

  12. Magnetic properties (Communication arising): Parasitic ferromagnetism in a hexaboride?

    Science.gov (United States)

    Matsubayashi, K.; Maki, M.; Tsuzuki, T.; Nishioka, T.; Sato, N. K.

    2002-11-01

    Surprisingly for a compound with no magnetic element, Young et al. have observed ferromagnetism in calcium hexaboride (CaB6) doped with lanthanum (La) - the system has a ferromagnetic Curie temperature as high as 600 K, which is comparable to that of transition-metal ferromagnets such as iron (Fe). Here we show that high-temperature ferromagnetism in this CaB6 system is not intrinsic but that it is instead due to alien phases of iron and boride.

  13. Epidemiology, microbiology and mortality associated with community-acquired bacteremia in northeast Thailand: a multicenter surveillance study.

    Directory of Open Access Journals (Sweden)

    Manas Kanoksil

    Full Text Available BACKGROUND: National statistics in developing countries are likely to underestimate deaths due to bacterial infections. Here, we calculated mortality associated with community-acquired bacteremia (CAB in a developing country using routinely available databases. METHODS/PRINCIPAL FINDINGS: Information was obtained from the microbiology and hospital database of 10 provincial hospitals in northeast Thailand, and compared with the national death registry from the Ministry of Interior, Thailand for the period between 2004 and 2010. CAB was defined in patients who had pathogenic organisms isolated from blood taken within 2 days of hospital admission without a prior inpatient episode in the preceding 30 days. A total of 15,251 CAB patients identified, of which 5,722 (37.5% died within 30 days of admission. The incidence rate of CAB between 2004 and 2010 increased from 16.7 to 38.1 per 100,000 people per year, and the mortality rate associated with CAB increased from 6.9 to 13.7 per 100,000 people per year. In 2010, the mortality rate associated with CAB was lower than that from respiratory tract infection, but higher than HIV disease or tuberculosis. The most common causes of CAB were Escherichia coli (23.1%, Burkholderia pseudomallei (19.3%, and Staphylococcus aureus (8.2%. There was an increase in the proportion of Extended-Spectrum Beta-Lactamases (ESBL producing E. coli and Klebsiella pneumoniae over time. CONCLUSIONS: This study has demonstrated that national statistics on causes of death in developing countries could be improved by integrating information from readily available databases. CAB is neglected as an important cause of death, and specific prevention and intervention is urgently required to reduce its incidence and mortality.

  14. Equilibrium partitioning of macromolecules in confining geometries: Improved universality with a new molecular size parameter

    DEFF Research Database (Denmark)

    Wang, Yanwei; Peters, Günther H.J.; Hansen, Flemming Yssing

    2008-01-01

    structures (CABS), allows the computation of equilibrium partition coefficients as a function of confinement size solely based on a single sampling of the configuration space of a macromolecule in bulk. Superior in computational speed to previous computational methods, CABS is capable of handling slits...... parameter for characterization of spatial confinement effects on macromolecules. Results for the equilibrium partition coefficient in the weak confinement regime depend only on the ratio ofR-s to the confinement size regardless of molecular details....

  15. Activity of cabazitaxel after docetaxel and abiraterone acetate therapy in patients with castration-resistant prostate cancer.

    Science.gov (United States)

    Sella, Avishay; Sella, Tal; Peer, Avivit; Berger, Raanan; Frank, Stephen Jay; Gez, Eli; Sharide, David; Hayat, Henry; Hanovich, Ekaterina; Kovel, Svetlana; Rosenbaum, Eli; Neiman, Victoria; Keizman, Daniel

    2014-12-01

    Cabazitaxel and AA have been approved by the US Food and Drug Administration for use after docetaxel in mCRPC. Recently, CAB appeared to be active when given after AA. AA is capable of inducing AR splice variants that confer ligand-independent AR transactivation. Because microtubule-targeting agents impair AR nuclear transport and activity, we raised concerns about CAB efficacy after AA failure in mCRPC. One hundred thirty mCRPC patients received AA after docetaxel treatment in compassionate programs. Of them, 24 (18.4%) subsequently received CAB. We retrospectively reviewed their data using conventional methods. Twenty-four patients received a median of 4 (range, 1-13) CAB cycles. Nineteen (79.1%) of them received primary prophylaxis with growth factors. Median patient characteristics were: age 65 (range, 57-85) years; Gleason score: 8 (range, 6-10); and PSA: 128.1 (range, 0.01-1700) ng/mL. A PSA response (≥ 50% decrease from baseline) occurred in 6 (31.5%) of 19 evaluable patients (95% confidence interval [CI], 11.8-54.2%). CAB therapy obtained a partial response in 2 of the 13 (15.3%) evaluable patients (95% CI, 2.9-45.4%). Median survival from initiation of CAB was 8.2 (95% CI, 3.34-13.05) months, from AA 16.1 (95% CI, 11.56-20.64) and from docetaxel 32.0 (95% CI, 11.56-39.69). A limited number of patients with mCRPC received CAB after docetaxel and AA treatment. In this selected population, CAB was active. Copyright © 2014 Elsevier Inc. All rights reserved.

  16. Mechanical and thermal properties of eco-friendly poly(propylene carbonate)/cellulose acetate butyrate blends.

    Science.gov (United States)

    Xing, Chenyang; Wang, Hengti; Hu, Qiaoqiao; Xu, Fenfen; Cao, Xiaojun; You, Jichun; Li, Yongjin

    2013-02-15

    The eco-friendly poly(propylene carbonate) (PPC)/cellulose acetate butyrate (CAB) blends were prepared by melt-blending in a batch mixer for the first time. PPC and CAB were partially miscible because of the drastically shifted glass transition temperatures of both PPC and CAB, which originated from the specific interactions between carbonyl groups and hydroxyl groups. The incorporation of CAB into PPC matrix enhanced not only tensile strength and modulus of PPC dramatically, but also improved heat resistance and thermal stability of PPC significantly. The tensile strength and the modulus of PPC/CAB=50/50 blend are 27.7 MPa and 1.24 GPa, which are 21 times and 28 times higher than those of the unmodified PPC, respectively. Moreover, the elongation at break of PPC/CAB=50/50 blend is as high as 117%. In addition, the obtained blends exhibited good transparency, which is very important for the package materials. The results in this work pave new possibility for the massive application of eco-friendly polymer materials. Copyright © 2012 Elsevier Ltd. All rights reserved.

  17. A Light-Responsive Self-Assembly Formed by a Cationic Azobenzene Derivative and SDS as a Drug Delivery System.

    Science.gov (United States)

    Geng, Shengyong; Wang, Yuzhu; Wang, Liping; Kouyama, Tsutomu; Gotoh, Toshiaki; Wada, Satoshi; Wang, Jin-Ye

    2017-01-04

    The structure of a self-assembly formed from a cationic azobenzene derivative, 4-cholesterocarbonyl-4'-(N,N,N-triethylamine butyloxyl bromide) azobenzene (CAB) and surfactant sodium dodecyl sulfate (SDS) in aqueous solution was studied by cryo-TEM and synchrotron radiation small-angle X-ray scattering (SAXS). Both unilamellar and multilamellar vesicles could be observed. CAB in vesicles were capable to undergo reversible trans-to-cis isomerization upon UV or visible light irradiation. The structural change upon UV light irradiation could be catched by SAXS, which demonstrated that the interlamellar spacing of the cis-multilamellar vesicles increased by 0.2-0.3 nm. Based on this microstructural change, the release of rhodamine B (RhB) and doxorubicin (DOX) could be triggered by UV irradiation. When incubated NIH 3T3 cells and Bel 7402 cells with DOX-loaded CAB/SDS vesicles, UV irradiation induced DOX release decreased the viability of both cell lines significantly compared with the non-irradiated cells. The in vitro experiment indicated that CAB/SDS vesicles had high efficiency to deliver loaded molecules into cells. The in vivo experiment showed that CAB/SDS vesicles not only have high drug delivery efficiency into rat retinas, but also could maintain high drug concentration for a longer time. CAB/SDS catanionic vesicles may find potential applications as a smart drug delivery system for controlled release by light.

  18. “A place at the table:” a qualitative analysis of community board members’ experiences with academic HIV/AIDS research

    Directory of Open Access Journals (Sweden)

    Stella Safo

    2016-07-01

    Full Text Available Abstract Background Community advisory boards (CAB are proposed as one mechanism to carry out successful community based participatory research (CBPR, but the presence of CABs may be insufficient to optimize academic-community partnerships. Methods We conducted semi-structured interviews with minority members of a CAB partnered with a HIV/AIDS research center and identified three themes. Results First, lack of trust in researchers included two subthemes: researchers’ lacked respect for community-based organizations’ (CBO’s interests and paid inadequate attention to building trust. Second, power imbalance included three subthemes: CAB members felt like inferior “token” members, felt that a lack of communication led to disempowerment, and held preconceived beliefs of researchers that led to perceived power imbalance. Third, CAB members suggested best practices, including using collaborations to build trust, actively allocating power, and sharing tangible research benefits with CBOs. Conclusions Our findings indicate that CABs must be founded on trust and instilled with power to meet the tenets of CBPR.

  19. A Light-Responsive Self-Assembly Formed by a Cationic Azobenzene Derivative and SDS as a Drug Delivery System

    Science.gov (United States)

    Geng, Shengyong; Wang, Yuzhu; Wang, Liping; Kouyama, Tsutomu; Gotoh, Toshiaki; Wada, Satoshi; Wang, Jin-Ye

    2017-01-01

    The structure of a self-assembly formed from a cationic azobenzene derivative, 4-cholesterocarbonyl-4‧-(N,N,N-triethylamine butyloxyl bromide) azobenzene (CAB) and surfactant sodium dodecyl sulfate (SDS) in aqueous solution was studied by cryo-TEM and synchrotron radiation small-angle X-ray scattering (SAXS). Both unilamellar and multilamellar vesicles could be observed. CAB in vesicles were capable to undergo reversible trans-to-cis isomerization upon UV or visible light irradiation. The structural change upon UV light irradiation could be catched by SAXS, which demonstrated that the interlamellar spacing of the cis-multilamellar vesicles increased by 0.2-0.3 nm. Based on this microstructural change, the release of rhodamine B (RhB) and doxorubicin (DOX) could be triggered by UV irradiation. When incubated NIH 3T3 cells and Bel 7402 cells with DOX-loaded CAB/SDS vesicles, UV irradiation induced DOX release decreased the viability of both cell lines significantly compared with the non-irradiated cells. The in vitro experiment indicated that CAB/SDS vesicles had high efficiency to deliver loaded molecules into cells. The in vivo experiment showed that CAB/SDS vesicles not only have high drug delivery efficiency into rat retinas, but also could maintain high drug concentration for a longer time. CAB/SDS catanionic vesicles may find potential applications as a smart drug delivery system for controlled release by light.

  20. Meta-analysis of interleukin 6, 8, and 10 between off-pump and on-pump coronary artery bypass groups.

    Science.gov (United States)

    Meng, Fanbo; Ma, Jianghong; Wang, Wei; Lin, Baisong

    2017-05-20

    This study aimed to evaluate the role of off-pump coronary artery bypass (CAB) surgery on the decrease of postoperative inflammatory responses in patients. We systematically searched databases of PubMed and Embase to select the related studies. Interleukin (IL) 6, 8, and 10 were used as outcomes and pooled analysis was performed using R 3.12 software. Standardized mean differences (SMDs) and their 95% confidence intervals (95% CIs) were considered as effect estimates. A total of 27 studies, including 1340 participants, were recruited in this meta-analysis. The pooled analyses showed that postoperative concentration of IL-10 at 12 hours was significantly lower in off-pump CAB group compared to on-pump CAB group (SMD = -1.3640, 95% CI = -2.0086--0.7193). However, no significant differences were found in pre and postoperative concentrations of IL-6 and 8 between off-pump and on-pump CAB groups. These results suggest that there is no advantage of off-pump CAB surgery in the reduction of inflammation compared to on-pump CAB surgery.

  1. Outcomes associated with conventional versus lipid-based formulations of amphotericin B in propensity-matched groups

    Directory of Open Access Journals (Sweden)

    Campbell RS

    2013-10-01

    Full Text Available Rebecca S Campbell,1 Paresh Chaudhari,2 Harlen D Hays,1 Robert J Taylor,1 Brian H Nathanson,3 Samuel A Bozzette,1 David Horn4 1Cerner Research, Culver City, CA, USA; 2Astellas Scientific and Medical Affairs, Inc., Northbrook, IL, USA; 3OptiStatim, LLC, Longmeadow, MA, USA; 4David Horn LLC, Doylestown, PA, USA Background: Lipid-based formulations of amphotericin B (LF-AMB are indicated for treatment of invasive fungal infections in patients intolerant to conventional amphotericin B (CAB or with refractory infections. Physicians still may choose to administer CAB to such patients. We described the use of CAB and LF-AMB in this population and quantified differences in post-amphotericin B length of stay (LOS among survivors and hospital mortality in matched patients. Methods: Data were extracted from Health Facts (Cerner Corporation, Kansas City, MO, USA for a retrospective cohort analysis. Inpatients aged ≥18 years with evidence of fungal infection and with orders for LF-AMB or CAB on  ≥2 days from January 2001 to June 2010 were identified. Patients were required to have renal insufficiency or other relative contraindications to use of CAB, exposure to nephrotoxic agents, or evidence of a CAB-refractory infection. Multilevel (hierarchical mixed-effects logistic regression was used to determine factors associated with initial exposure to LF-AMB versus CAB. Multivariate adjustment of outcomes was done using propensity score matching. Results: 655 patients were identified: 322 patients initiated therapy with CAB and 333 initiated treatment with LF-AMB. Compared to those initiating CAB, patients initiating LF-AMB had greater acuity and underlying disease severity. In unadjusted analyses, hospital mortality was significantly higher in the LF-AMB group (32.2% versus 23.7%; P = 0.02. After propensity score matching and covariate adjustment, mortality equalized and observed differences in LOS after amphotericin B initiation decreased. Conclusion

  2. Caffeinated and non-caffeinated alcohol use and indirect aggression: The impact of self-regulation.

    Science.gov (United States)

    Sheehan, Brynn E; Linden-Carmichael, Ashley N; Lau-Barraco, Cathy

    2016-07-01

    Research shows that heavier alcohol use is associated with physical aggression. Scant research has examined the way in which alcohol relates to other forms of aggression, such as indirect aggression (e.g., malicious humor, social exclusion). Given the possible negative consequences of indirect aggression and the limited evidence suggesting alcohol use can elicit indirectly aggressive responses, research is needed to further investigate the association between drinking behavior and indirect aggression. Additionally, specific alcoholic beverages, such as caffeinated alcoholic beverages (CABs; e.g., Red Bull and vodka), may potentiate aggression above the influence of typical use, and thus warrant examination with regard to indirect aggression. One factor that may impact the strength of the alcohol-indirect aggression and CAB-indirect aggression relationships is one's level of self-regulation. Consequently, our study examined the relationships between (1) alcohol use and indirect aggression, (2) CAB use and indirect aggression, and (3) self-regulation as a moderator. Participants were 733 (67.6% female) undergraduate students who reported their CAB and alcohol use, self-regulation, and aggressive behaviors. Results revealed that heavier alcohol use was associated with more frequent indirect aggression after controlling for dispositional aggression. Heavier CAB use was related to more frequent indirect aggression after accounting for typical use and dispositional aggression. Self-regulation moderated these associations such that for those with lower self-regulation, greater alcohol and CAB consumption was associated with greater indirect aggression. Our findings suggest that heavier alcohol and CAB consumption may be risk factors for engaging in indirect aggression and this risk is impacted by one's regulatory control. Copyright © 2016 Elsevier Ltd. All rights reserved.

  3. Caffeinated and Non-caffeinated Alcohol Use and Indirect Aggression: The Impact of Self-regulation

    Science.gov (United States)

    Sheehan, Brynn E.; Linden-Carmichael, Ashley N.; Lau-Barraco, Cathy

    2016-01-01

    Research shows that heavier alcohol use is associated with physical aggression. Scant research has examined the way in which alcohol relates to other forms of aggression, such as indirect aggression (e.g., malicious humor, social exclusion). Given the possible negative consequences of indirect aggression and the limited evidence suggesting alcohol use can elicit indirectly aggressive responses, research is needed to further investigate the association between drinking behavior and indirect aggression. Additionally, specific alcoholic beverages, such as caffeinated alcoholic beverages (CABs; e.g., Red Bull and vodka), may potentiate aggression above the influence of typical use, thus warrant examination with regard to indirect aggression. One factor that may impact the strength of the alcohol-indirect aggression and CAB-indirect aggression relationships is one's level of self-regulation. Consequently, our study examined the relationships between (1) alcohol use and indirect aggression, (2) CAB use and indirect aggression, and (3) self-regulation as a moderator. Participants were 733 (67.6% female) undergraduate students who reported their CAB and alcohol use, self-regulation, and aggressive behaviors. Results revealed that heavier alcohol use was associated with more frequent indirect aggression after controlling for dispositional aggression. Heavier CAB use was related to more frequent indirect aggression after accounting for typical use and dispositional aggression. Self-regulation moderated these associations such that for those with lower self-regulation, greater alcohol and CAB consumption was associated with greater indirect aggression. Our findings suggest that heavier alcohol and CAB consumption may be risk factors for engaging in indirect aggression and this risk is impacted by one's regulatory control. PMID:26905765

  4. Citizen advisory boards: An empirical model for choosing goals and methods

    Energy Technology Data Exchange (ETDEWEB)

    Kunsberg, P.

    1994-12-01

    This is a study of Citizen Advisory Boards (CABS) undertaken for the Department of Energy (DOE) to draw practical insights from the accumulated experience of CAB members and agency officials who have worked with these boards over many years. Hence the main research tool is in-depth interviews of these individuals. In addition, the study relies on field observations of CABs at work, historical documentation of individual boards, and a large body of academic, professional, and government literature. The DOE is in the process of establishing Site Specific Advisory Boards (SSABs) at most of its major facilities in order to provide for community involvement in the DOE environmental restoration and environmental management programs, but these boards initiated by DOE do not yet have enough of a track-record for a study of this type. Consequently, the study focused on CABs at six other federal agencies which have had substantial experience with boards that are similar in composition and purpose to the SSABs. The study examined common problem that confront virtually every CAB in its organization and its decision-making process. For example, each board faces difficult issues in defining its goals and representational responsibilities, selection of members, selection of issues, reaching agreement on recommendations to the parent agency, getting responsive action from the parent agency, and evaluating the board`s success over time. An effort was made to identify solutions or best approaches to these fundamental problems such that the recommended approach has broad application to citizen advisory boards concerned with environmental issues. The conclusions of the study are summarized in a model which incorporates the optimal approaches discovered with respect to each of the critical issues. While acknowledging that the particular circumstances of a CAB may call for individual variations, the model provides a fairly comprehensive description of recommended features of a CAB.

  5. An economic evaluation of voriconazole versus amphotericin B for the treatment of invasive aspergillosis in Canada.

    Science.gov (United States)

    Rotstein, Coleman; Laverdière, Michel; Marciniak, Anne; Ali, Farzad

    2004-09-01

    Invasive aspergillosis (IA) is a serious fungal infection that affects immunocompromised patients. The Global Comparative Aspergillosis study demonstrated that voriconazole, a new broad-spectrum triazole, had better responses and improved survival compared with conventional amphotericin B deoxycholate (CAB) and other licensed antifungal therapy (OLAT) for the treatment of definite or probable aspergillosis. To compare costs and outcomes of voriconazole and CAB for the treatment of definite or probable aspergillosis in Canada. A cost-consequence decision tree model was designed to reflect the treatment pathways used in clinical practice when using voriconazole or CAB as primary therapy for IA. Therapy included initial treatment with either voriconazole or CAB and then switched to an OLAT in the event of an inadequate response, severe toxicity or intolerance. The principal data source used was the Global Comparative Aspergillosis study. The total cost of voriconazole when compared with CAB as initial therapy for IA was $38,319 versus $42,495 per patient, respectively, representing a 9.8% cost reduction for each patient treated with voriconazole. The higher mean cost in the CAB arm was primarily due to the high proportion of patients (73.7%) who were switched to an OLAT due to severe side effects or an inadequate response. Treating with voriconazole was a dominant strategy. The number of patients that had to be treated with voriconazole instead of CAB to save one additional life was eight. Voriconazole as primary treatment for IA increased the chances of successful treatment, improved survival and may represent a potential cost saving strategy in Canada.

  6. Exploring researchers' experiences of working with a researcher-driven, population-specific community advisory board in a South African schizophrenia genomics study.

    Science.gov (United States)

    Campbell, Megan M; Susser, Ezra; de Vries, Jantina; Baldinger, Adam; Sibeko, Goodman; Mndini, Michael M; Mqulwana, Sibonile G; Ntola, Odwa A; Ramesar, Raj S; Stein, Dan J

    2015-07-02

    Community engagement within biomedical research is broadly defined as a collaborative relationship between a research team and a group of individuals targeted for research. A Community Advisory Board (CAB) is one mechanism of engaging the community. Within genomics research CABs may be particularly relevant due to the potential implications of research findings drawn from individual participants on the larger communities they represent. Within such research, CABs seek to meet instrumental goals such as protecting research participants and their community from research-related risks, as well as intrinsic goals such as promoting the respect of participants and their community. However, successful community engagement depends on the degree to which CABs legitimately represent and engage with communities targeted for research. Currently, there is little literature describing the use of CABs in genomics research taking place in developing countries, and even less in the field of genomics research relating to mental illness. The aim of this article is to describe and consider the contributions made by a researcher-driven, population-specific CAB in a genomics of schizophrenia research project taking place in South Africa, from the perspective of the research team. Four broad discussion topics emerged during the CAB meetings namely: 1) informed consent procedures, 2) recruitment strategies, 3) patient illness beliefs and stigma experiences, and 4) specific ethical concerns relating to the project. The authors consider these discussions in terms of their contributions to instrumental and intrinsic goals of community engagement. The CAB gave valuable input on the consent processes and materials, recruitment strategies and suggested ways of minimizing the potential for stigma and discrimination. All of these contributions were of an instrumental nature, and helped improve the way in which the research took place. In addition, and perhaps more importantly, the CAB made a

  7. The predatory bacterium Bdellovibrio bacteriovorus aspartyl-tRNA synthetase recognizes tRNAAsn as a substrate.

    Directory of Open Access Journals (Sweden)

    Ariel Alperstein

    Full Text Available The predatory bacterium Bdellovibrio bacteriovorus preys on other Gram-negative bacteria and was predicted to be an asparagine auxotroph. However, despite encoding asparaginyl-tRNA synthetase and glutaminyl-tRNA synthetase, B. bacteriovorus also contains the amidotransferase GatCAB. Deinococcus radiodurans, and Thermus thermophilus also encode both of these aminoacyl-tRNA synthetases with GatCAB. Both also code for a second aspartyl-tRNA synthetase and use the additional aspartyl-tRNA synthetase with GatCAB to synthesize asparagine on tRNAAsn. Unlike those two bacteria, B. bacteriovorus encodes only one aspartyl-tRNA synthetase. Here we demonstrate the lone B. bacteriovorus aspartyl-tRNA synthetase catalyzes aspartyl-tRNAAsn formation that GatCAB can then amidate to asparaginyl-tRNAAsn. This non-discriminating aspartyl-tRNA synthetase with GatCAB thus provides B. bacteriovorus a second route for Asn-tRNAAsn formation with the asparagine synthesized in a tRNA-dependent manner. Thus, in contrast to a previous prediction, B. bacteriovorus codes for a biosynthetic route for asparagine. Analysis of bacterial genomes suggests a significant number of other bacteria may also code for both routes for Asn-tRNAAsn synthesis with only a limited number encoding a second aspartyl-tRNA synthetase.

  8. Improvement of CO2/N2 separation performance by polymer matrix cellulose acetate butyrate

    Science.gov (United States)

    Lee, R. J.; Jawad, Z. A.; Ahmad, A. L.; Ngo, J. Q.; Chua, H. B.

    2017-06-01

    With the rapid development of modern civilization, carbon dioxide (CO2) is produced in large quantities and mainly generated from industrial sectors. The gas emission is the major contributor to global warming. To address this issue, the membrane technology is implemented for the CO2 removal, due to the energy efficiency and economic advantages presented. Cellulose acetate butyrate (CAB) is selected as the polymeric material, due to the excellent film-forming properties and capable of developing a defect-free layer of neat membrane. This study described the fabrication development of CAB using a wet phase inversion method with different casting conditions. Where the composition of the casting solutions (3-5 wt %) and solvent evaporation time (4-6 min) were determined. The outcomes of these dominant parameters were then used to determine the best CAB membrane for CO2/Nitrogen (N2) separation and supported by the characterization i.e. scanning electron micrograph. Gas permeation measurements showed satisfactory performance for CAB membrane fabricated with 5 min evaporation time and 4 wt% polymer composition (M2). Where, its permeance and selectivity are 120.19 GPU and 3.17, respectively. In summary, this study showed a brief outlined of the future direction and perspective of CAB membrane for CO2/N2 separation.

  9. Hippocampal volume and cingulum bundle fractional anisotropy are independently associated with verbal memory in older adults.

    Science.gov (United States)

    Ezzati, Ali; Katz, Mindy J; Lipton, Michael L; Zimmerman, Molly E; Lipton, Richard B

    2016-09-01

    The objective of this study was to investigate the relationship of medial temporal lobe and posterior cingulate cortex (PCC) volumetrics as well as fractional anisotropy of the cingulum angular bundle (CAB) and the cingulum cingulate gyrus (CCG) bundle to performance on measures of verbal memory in non-demented older adults. The participants were 100 non-demented adults over the age of 70 years from the Einstein Aging Study. Volumetric data were estimated from T1-weighted images. The entire cingulum was reconstructed using diffusion tensor MRI and probabilistic tractography. Association between verbal episodic memory and MRI measures including volume of hippocampus (HIP), entorhinal cortex (ERC), PCC and fractional anisotropy of CAB and CCG bundle were modeled using linear regression. Relationships between atrophy of these structures and regional cingulum fractional anisotropy were also explored. Decreased HIP volume on the left and decreased fractional anisotropy of left CAB were associated with lower memory performance. Volume changes in ERC, PCC and CCG disruption were not associated with memory performance. In regression models, left HIP volume and left CAB-FA were each independently associated with episodic memory. The results suggest that microstructural changes in the left CAB and decreased left HIP volume independently influence episodic memory performance in older adults without dementia. The importance of these findings in age and illness-related memory decline require additional exploration.

  10. Transparent Blend of Poly(Methylmethacrylate/Cellulose Acetate Butyrate for the Protection from Ultraviolet

    Directory of Open Access Journals (Sweden)

    Raouf Mahmood Raouf

    2016-04-01

    Full Text Available The use of transparent polymers as an alternative to glass has become widespread. However, the direct exposure of these materials to climatic conditions of sunlight and heat decrease the lifetime cost of these products. The aim of this study was to minimize the harm caused by ultraviolet (UV radiation exposure to transparent poly(methylmethacrylate (PMMA, which usually leads to changes in the physical and chemical properties of these materials and reduced performance. This was achieved using environmentally friendly cellulose acetate butyrate (CAB. The optical, morphological, and thermal properties of CAB blended with transparent PMMA was studied using UV-VIS spectrophotometry, scanning electron microscopy, X-ray diffraction, dynamic mechanical analysis, and thermal gravimetric analysis. The results show that CAB was able to reduce the effects of UV radiation by making PMMA more transparent to UV light, thereby preventing the negative effects of trapped radiation within the compositional structure, while maintaining the amorphous structure of the blend. The results also show that CAB blended with PMMA led to some properties commensurate with the requirements of research in terms of a slight increase in the value of the modulus and the glass transition temperature for the PMMA/CAB blend.

  11. Cine Club

    CERN Multimedia

    Cine Club

    2015-01-01

    Thursday 19 February 2015 at 20:00 CERN Council Chamber Mystery Train     Directed by Jim Jarmusch - USA, 1989, 110 minutes A Japanese couple obsessed with 1950s America goes to Memphis because the male half of the couple emulates Carl Perkins. Chance encounters link three different stories in the city, with the common thread being the seedy hotel where they are all staying. Original version English; French subtitles   Thursday 26 February 2015 at 20:00 CERN Council Chamber Night on Earth     Directed by Jim Jarmusch - USA, 1991, 129 minutes A collection of five stories involving cab drivers in five different cities. Los Angeles - A talent agent for the movies discovers her cab driver would be perfect to cast, but the cabbie is reluctant to give up her solid cab driver's career. New York - An immigrant cab driver is continually lost in a city and culture he doesn't understand. Paris - A blind girl takes a ride with a cab driv...

  12. [Antigen retrieval by microwave oven with buffer of citric acid].

    Science.gov (United States)

    Pellicer, E M; Sundblad, A

    1994-01-01

    Microwave oven (mwo) is used to stimulate tissue fixation and to retrieve antigens damaged by fixation. Heavy metal salt solutions, water, and citric acid buffer (cab) have been suggested for this purpose. A serie of tumors treated with cab and phosphate-buffered saline (pbs) with mwo were studied immunohistochemically with 24 antibodies. Controls were treated in the same way, except for microwaving. The antibodies were directed against antigens of the following tumors: breast and prostate carcinoma, carcinoid, lymphoma and melanoma. The results showed that cab enhanced the immunoreactivity of the following antigens: estrogen receptors (AMAC), progesterone receptors (Novocastra), HMB45, vimentin, leukocyte common antigen, PCNA, p53, MIB-1 (Ki-67) and prostatic specific antigen. The antigens that did not improve their immunoreactivity, when compared with the control series were: factor VIII, keratin, Leu 22, L26, neuron-specific enolase, CEA, chromogranin, HBME-1, smooth muscle actin and EMA. Microwaving equally improved protein S100 and desmin either with cab or pbs. The only antigen that improved with pbs was actin. The results with B72.3 and NKI/C3 were poor and not reliable. In conclusion microwaving with cab enhances the immunoreactivity of the antibodies mentioned above leading to an increase in sensibility without loosing specificity.

  13. CoolCalc: A Long-Haul Truck Thermal Load Estimation Tool

    Energy Technology Data Exchange (ETDEWEB)

    Lustbader, J. A.; Rugh, J. P.; Rister, B. R.; Venson, T. S.

    2011-01-01

    In the United States, intercity long-haul trucks idle approximately 1,800 hrs annually for sleeper cab hotel loads, consuming 838 million gallons of diesel fuel per year. The objective of the CoolCab project is to work closely with industry to design efficient thermal management systems for long-haul trucks that keep the cab comfortable with minimized engine idling. Truck engine idling isprimarily done to heat or cool the cab/sleeper, keep the fuel warm in cold weather, and keep the engine warm for cold temperature startup. Reducing the thermal load on the cab/sleeper will decrease air conditioning system requirements, improve efficiency, and help reduce fuel use. CoolCalc is an easy-to-use, simplified, physics-based HVAC load estimation tool that requires no meshing, hasflexible geometry, excludes unnecessary detail, and is less time-intensive than more detailed computer-aided engineering modeling approaches. It is intended for rapid trade-off studies, technology impact estimation, and preliminary HVAC sizing design and to complement more detailed and expensive CAE tools by exploring and identifying regions of interest in the design space. This paper describesthe CoolCalc tool, provides outdoor long-haul truck thermal testing results, shows validation using these test results, and discusses future applications of the tool.

  14. Intelligent Shuttle Management and Routing Algorithm

    Science.gov (United States)

    Thomas, Toshen M.; Subashanthini, S.

    2017-11-01

    Nowadays, most of the big Universities and campuses have Shuttle cabs running in them to cater the transportational needs of the students and faculties. While some shuttle services ask for a meagre sum to be paid for the usage, no digital payment system is onboard these vehicles to go truly cashless. Even more troublesome is the fact that sometimes during the day, some of these cabs run with bare number of passengers, which can result in unwanted budget loss to the shuttle operator. The main purpose of this paper is to create a system with two types of applications: A web portal and an Android app, to digitize the Shuttle cab industry. This system can be used for digital cashless payment feature, tracking passengers, tracking cabs and more importantly, manage the number of shuttle cabs in every route to maximize profit. This project is built upon an ASP.NET website connected to a cloud service along with an Android app that tracks and reads the passengers ID using an attached barcode reader along with the current GPS coordinates, and sends these data to the cloud for processing using the phone’s internet connectivity.

  15. The propagation characteristics of circular Airy beam with low-pass filtering modification

    Science.gov (United States)

    Zheng, Guoliang; Deng, Xiangquan; Xu, Shixiang; Wu, Qingyang

    2017-02-01

    The propagation characteristics of the circular Airy beam (CAB) modified with low-pass filtering is investigated in details in this paper. Based on a modification of the angular spectrum of CAB, we get a new kind of CAB constructed with low frequency spectrum, which is called "LCAB" for short. A suitable low-pass filter is introduced to cut off the high frequency angular spectrum and maintain the low frequency domain mainly affecting the front light rings of CAB. Two apodization parameters are employed to optimize the low-pass filtering, which influence the propagation characteristic of the LCAB. Fortunately, the abruptly autofocusing property, the most important property of CAB, is still maintained in LCAB. What is more, the initial ring number and the focal spot length can be controlled by adjusting the two apodization parameters. If the two apodization parameters are appropriately chosen, one can form an elegant optical needle which plays an important role in optical manipulations. The numerical results show that the less front light rings are, the longer the optical needle is. It should be noted that the width of the optical needle will increase as long as the length increases, and lead to the decline of the maximum intensity of the optical needle.

  16. Pregnancy and tumor outcomes in infertile women with macroprolactinoma on cabergoline therapy.

    Science.gov (United States)

    Rastogi, Ashu; Bhadada, Sanjay K; Bhansali, Anil

    2017-04-01

    Hyperprolactinemia and prolactinomas cause infertility in significant number of women. But, pregnancy may lead to post-partum remission of hyperprolactinemia. The data on pregnancy and tumor outcome in women with macroprolactinoma conceiving on Cabergoline (CAB) therapy is increasing but still less than with Bromocriptine. We studied the incidence of fetal malformations, hyperprolactinemia and tumor course after gestation in infertile women harboring macroprolactinoma, who conceived on CAB therapy during the year 2005-2015. The cohort was divided into two groups based on the continuation of CAB therapy during gestation (Group A) or not (Group B). Forty-eight pregnancies in 33 women were recorded. CAB was continued throughout gestation in 25 pregnancies (Group A). The incidence of missed abortion (8.3%), still birth (4.2%) and low birth weight (7.7%) were not different in two groups. Neural tube defects were observed in 3 pregnancies (all in Group A). Post-partum, recurrence of hyperprolactinemia was observed in 64.6% and 60.9% (p = 0.8) of women in group A and B, respectively. Cabergoline was restarted after 60% and 60.9% (p = 0.9) pregnancies in the two groups in view of symptomatic hyperprolactinemia and/or persistence of macroadenoma. Post-partum, recurrence of hyperprolactinemia is common in spite of significant tumor reduction in infertile women with macroprolactinoma. Continuation of CAB during gestation does not influence the post-pregnancy recurrence of hyperprolactinemia or tumor remission.

  17. Disease stress detection on citrus using a leaf optical model and field spectroscopy

    Science.gov (United States)

    Badnakhe, Mrunalini R.; Durbha, Surya; Adinarayana, J.

    2015-10-01

    As citrus is progressively contributing to horticultural production, wealth and economy of a country, it is necessary to understand the factors impacting citrus production. Gummosis is one of the most serious diseases causing considerable loss of overall citrus production and yield quality. A qualitative and quantitative analysis of citrus leaf biochemical properties are necessary to monitor the crop health, disease /pest stress and production. Total leaf chlorophyll content (Cab) represents one of the key biochemical factors which contributes in water, carbon, and energy exchange processes. Photosynthesis process in citrus will be disturbed as gummosis disease life cycle progresses. It is important to study Cab to evaluate the photosynthesis rate and disease stress. In this study the potential of Radiative Transfer (RT) PROSPECT model to retrieve Cab in citrus orchards was undertaken at different sites. The main goal is to evaluate the relationship between Cab and gummosis disease stress for citrus at various phenological stages. Inversion of PROSPECT model on measured hyperspectral data is carried out to extract the leaf level parameters influencing the disease. This model was inverted with the ground truth hyperspectral reading. The testing was separately initiated for healthy and infected plant leaves. This can lead to understand the disease stress on citrus leaves. For accuracy, raw spectra are filtered and processed which is an input parameter for Inversion PROSPECT model. Here, retrieved Cab content was correlated with gummosis disease stress in terms of oozing with R2 = 0.6021 and RMSE= 0.481272.

  18. In-Hospital and Long-Term Prognosis after Myocardial Infarction in Patients with Prior Coronary Artery Bypass Surgery; 19-Year Experience

    Directory of Open Access Journals (Sweden)

    Predrag M. Mitrovic

    2009-01-01

    Full Text Available To present a 19-year experience of the prognosis of patients with acute myocardial infarction (AMI and prior coronary artery bypass surgery (CABS, 748 patients with AMI after prior CABS (postbypass group and a control group of 1080 patients with AMI, but without prior CABS, were analyzed. All indexes of infarct size were lower in the postbypass group. There was more ventricular fibrillation in the postbypass group. In-hospital mortality was similar (p = 0.3675. In the follow-up period, postbypass patients had more heart failure, recurrent CABS, reinfarction, and unstable angina than did control patients. Cumulative survival was better in the control group than in the postbypass group (p = 0.0403. Multiple logistic regression model showed that previous angina (p = 0.0005, diabetes (p = 0.0058, and age (p = 0.0102 were independent predictor factors for survival. Use of digitalis and diuretics, together with previous angina, also influenced survival (p = 0.0092, as well as male gender, older patients, and diabetes together (p = 0.0420. Patients with AMI after prior CABS had smaller infarct, but more reinfarction, reoperation, heart failure, and angina. Previous angina, diabetes, and age, independently, as well as use of digitalis and diuretics together with angina, and male gender, older patients, and diabetes together, influenced a worse survival rate in these patients.

  19. Design and Analysis of a Novel Centrifugal Braking Device for a Mechanical Antilock Braking System.

    Science.gov (United States)

    Yang, Cheng-Ping; Yang, Ming-Shien; Liu, Tyng

    2015-06-01

    A new concept for a mechanical antilock braking system (ABS) with a centrifugal braking device (CBD), termed a centrifugal ABS (C-ABS), is presented and developed in this paper. This new CBD functions as a brake in which the output braking torque adjusts itself depending on the speed of the output rotation. First, the structure and mechanical models of the entire braking system are introduced and established. Second, a numerical computer program for simulating the operation of the system is developed. The characteristics of the system can be easily identified and can be designed with better performance by using this program to studying the effects of different design parameters. Finally, the difference in the braking performance between the C-ABS and the braking system with or without a traditional ABS is discussed. The simulation results indicate that the C-ABS can prevent the wheel from locking even if excessive operating force is provided while still maintaining acceptable braking performance.

  20. Pet dogs and child physical activity: the role of child-dog attachment.

    Science.gov (United States)

    Gadomski, A M; Scribani, M B; Krupa, N; Jenkins, P

    2017-10-01

    Dog ownership has been associated with increased physical activity in children which in turn may mitigate childhood obesity. To measure the association between child-dog attachment and child physical activity and screen time. Cross-sectional study including 370 children (ages 4-10) who had pet dogs in the home. Parents completed the DartScreen, a web-based screener, before a well-child visit. Screener domains included child body mass index (BMI), physical activity, screen time and dog-related questions. The Companion Animal Bonding Scale (CABS) was used to measure child attachment to the dog. Clinic nurses weighed and measured the children. Associations between CABS, BMI z-score, screen time and physical activity were estimated. CABS was strongly associated with time spent being active with the dog (F = 22.81, p dog is associated with increased child physical activity. © 2016 World Obesity Federation.

  1. Time based room correction system for low frequencies using multiple loudspeakers

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2007-01-01

      Improving sound from loudspeakers in a room is a big issue. We are facing a rather complicated and serious problem, as one can experience very big variations in sound pressure level - up to 30 dB - in a room, especially at low frequencies. An innovative way of looking at the problem in the time......-domain by the construction of a finite-difference time-domain approximation program (FDTD) has lead to a novel and simple solution also working in the time-domain called Controlled Acoustically Bass System (CABS). Working in the time-domain CABS includes additional cancelling loudspeakers at the back wall in order to remove...... the back wall reflection. The system has first been simulated with surprisingly good results and later implemented maintaining good performance. CABS is able to give a homogeneous sound pressure level in the whole room at low frequencies. A DSP system consisting of both hardware and software has been made...

  2. Global Transcriptome Analysis of Combined Abiotic Stress Signaling Genes Unravels Key Players in Oryza sativa L.: An In silico Approach

    Directory of Open Access Journals (Sweden)

    Pandiyan Muthuramalingam

    2017-05-01

    Full Text Available Combined abiotic stress (CAbS affects the field grown plants simultaneously. The multigenic and quantitative nature of uncontrollable abiotic stresses complicates the process of understanding the stress response by plants. Considering this, we analyzed the CAbS response of C3 model plant, Oryza sativa by meta-analysis. The datasets of commonly expressed genes by drought, salinity, submergence, metal, natural expression, biotic, and abiotic stresses were data mined through publically accessible transcriptomic abiotic stress (AbS responsive datasets. Of which 1,175, 12,821, and 42,877 genes were commonly expressed in meta differential, individual differential, and unchanged expressions respectively. Highly regulated 100 differentially expressed AbS genes were derived through integrative meta-analysis of expression data (INMEX. Of this 30 genes were identified from AbS gene families through expression atlas that were computationally analyzed for their physicochemical properties. All AbS genes were physically mapped against O. sativa genome. Comparative mapping of these genes demonstrated the orthologous relationship with related C4 panicoid genome. In silico expression analysis of these genes showed differential expression patterns in different developmental tissues. Protein–protein interaction of these genes, represented the complexity of AbS. Computational expression profiling of candidate genes in response to multiple stresses suggested the putative involvement of OS05G0350900, OS02G0612700, OS05G0104200, OS03G0596200, OS12G0225900, OS07G0152000, OS08G0119500, OS06G0594700, and Os01g0393100 in CAbS. These potential candidate genes need to be studied further to decipher their functional roles in AbS dynamics.

  3. A new approach in gastroretentive drug delivery system using cholestyramine.

    Science.gov (United States)

    Umamaheshwari, R B; Jain, Subheet; Jain, N K

    2003-01-01

    We prepared cellulose acetate butyrate (CAB)-coated cholestyramine microcapsules as a intragastric floating drug delivery system endowed with floating ability due to the carbon dioxide generation when exposed to the gastric fluid. The microcapsules also have a mucoadhesive property. Ion-exchange resin particles can be loaded with bicarbonate followed by acetohydroxamic acid (AHA) and coated with CAB by emulsion solvent evaporation method. The drug concentration was monitored to maintain the floating property and minimum effective concentration. The effect of CAB: drug-resin ratio (2:1, 4:1, 6:1 w/w) on the particle size, floating time, and drug release was determined. Cholestyramine microcapsules were characterized for shape, surface characteristics, and size distribution; cholestyramine/acetohydroxamic acid interactions inside microcapsules were investigated by X-ray diffractometry. The buoyancy time of CAB-coated formulations was better than that of uncoated resin particles. Also, a longer floating time was observed with a higher polymer:drug resin complex ratio (6:1). With increasing coating thickness the particle size was increased but drug release rate was decreased. The drug release rate was higher in simulated gastric fluid (SGF) than in simulated intestinal fluid (SIF). The in vivo mucoadhesion studies were performed with rhodamine-isothiocyanate (RITC) by fluorescent probe method. The amount of CAB-coated cholestyramine microcapsules that remained in the stomach was slightly lower than that of uncoated resin particles. Cholestyramine microcapsules were distributed throughout the stomach and exhibited prolonged gastric residence via mucoadhesion. These results suggest that CAB-coated microcapsules could be a floating as well as a mucoadhesive drug delivery system. Thus, it has promise in the treatment of Helicobacter pylori.

  4. Effect of cation-anion balance in feed on urine pH in rabbits in comparison with other species.

    Science.gov (United States)

    Heer, F; Dobenecker, B; Kienzle, E

    2017-12-01

    In the present investigation, the impact of diet composition on urine pH in rabbits was compared with previous studies on rabbits, cats, dogs, pigs and horses. A total of 13 dwarf rabbits were fed six different diets with a cation-anion balance (CAB) between -39 and +320 mmol/kg dry matter (DM) using ammonium chloride (NH4 Cl) as an acidifier. CAB was calculated as follows: CAB (mmol/kg DM) = 49.9*Ca + 82.3*Mg +43.5*Na + 25.6*K - 59*P - 62.4*S - 28.2*Cl; minerals in g/kg DM. Urine, faeces and blood were collected. Urine pH ranged from 5.26 ± 0.22 at a CAB of -39 mmol/kg DM to 8.56 ± 0.24 at a CAB of +320 mmol/kg DM. A low CAB in the feed reduced blood pH and blood base excess significantly. Renal excretion of Ca, P, Na and Mg and water was significantly higher in rabbits eating acidifying diets. In comparison with other species, rabbits reacted to acidifying diets in a similar way as cats, dogs and pigs. Rabbits on a mildly alkalizing diet, however, had a trend to higher urine pH than other monogastric species on such diets (cats, dogs, pigs, horses). Journal of Animal Physiology and Animal Nutrition © 2017 Blackwell Verlag GmbH.

  5. The Role of elF4E Activity in Breast Cancer

    Science.gov (United States)

    2011-08-01

    CAB, Sabine VS, Macaskill EJ, Bartlett JMS, Dixon JM, McElwaine JN, Hughes TA (2011) Response to mTOR inhibition: activity of eIF4E predicts...Ingram N, Madhok B, Hanby AM, Suleman CAB, Sabine VS, Macaskill EJ, Bartlett JMS, Dixon JM, McElwaine JN & Hughes TA (2011) Response to mTOR...phorylation on eIF4E, using a formula previously derived from regression modelling of individual contributions of each component to prognosis in a large

  6. Research on Secondary Impact Safety of Train Driver based on THUMS Dummy

    Directory of Open Access Journals (Sweden)

    Wang Wenbin

    2016-01-01

    Full Text Available Based on biomechanical Total Human Model for Safety (THUMS dummy and traditional rigid dummy, the train driver injury of secondary impact in railway crash events is analyzed and the results are compared. The results of THUMS dummy are more detail and comprehensive to describe the injury of train driver. It could be applied to the safety research of crashworthiness of train driver cab in future. The driver injury is serious and needed to be optimized the parameter of cab console to reduce injury risk for the driver in the next work.

  7. Molecular bases and photobiological consequences of light intensity adaptation in photosynthetic organisms

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Y-B.; Durnford, D.; Koblizek, M.; Falkowski, P. G.

    2003-02-10

    By applying a combination of light transitions, uncouplers, and inhibitors of photosynthetic electron transport inhibitors we modulate the redox poise of many components in the plastid and examine the pattern of expression of cab1 gene. This gene encodes the major light harvesting protein that services photosystem II. While our results have confirmed our own previous finding that light intensity regulation of cab1 gene expression is signaled by the redox state of the PQ pool, we have also identified additional sensor(s) located in the PET chain.

  8. Reports of Signal Corps Units Engaged in the Sicilian Campaign (Operation Husky)

    Science.gov (United States)

    1943-01-01

    DOT. S1G T & f 0?P» CONSTEIICTIOa OFF. SUPPLY OFFICER ASST. COBST. OFF. OFF. I.10TOR TRAMS . OFFo ’MSG. CEN. OFF. ASST, RDO. OFF a R/l OFF...HOW RIZBDs OTS SMAEL CABS CAN FOLLOW EB&IMEHTS THBW TEBRAIH WHICH IS IMPRACTICABLE FOR LARGE 1- 1 VSHICLM a 01J1 GAM S*OIiOW THE 0& Ol’HSW CON...THE 1/4=TOH CAB CAM LAY WIHE WHERE A 21/2-TON TRUCK CAHKOT GET THROUSHe I,, THAT am SIGHAL COMPACT BE ALLOWED OHLY CIS TC~3 IN PLACE OF 0?H>J

  9. Advances of evolutionary computation methods and operators

    CERN Document Server

    Cuevas, Erik; Oliva Navarro, Diego Alberto

    2016-01-01

    The goal of this book is to present advances that discuss alternative Evolutionary Computation (EC) developments and non-conventional operators which have proved to be effective in the solution of several complex problems. The book has been structured so that each chapter can be read independently from the others. The book contains nine chapters with the following themes: 1) Introduction, 2) the Social Spider Optimization (SSO), 3) the States of Matter Search (SMS), 4) the collective animal behavior (CAB) algorithm, 5) the Allostatic Optimization (AO) method, 6) the Locust Search (LS) algorithm, 7) the Adaptive Population with Reduced Evaluations (APRE) method, 8) the multimodal CAB, 9) the constrained SSO method.

  10. The Seminal Literature of Anthrax Research

    Science.gov (United States)

    2007-05-01

    readily accessible in the open literature, tend to be cited highly, and represent the foundation of the CAB ap- proach. Application of CAB to three...Schuchat, A., and Hajjeh, R.A. 2002. Opening a Bacillus anthracis-containing envelope, Capitol Hill, Washington, DC: The public health response. Emerg...A., Shieh, W.J., Siegal, L., Swerdlow, D.L., Tenover, F.C., Traeger, M., Ward, J.W., Weisfuse, I., Wiersma , S., Yeskey, K., Zaki, S., Ashford, D.A

  11. ANÁLISIS BIBLIOMÉTRICO DE LA PRODUCCIÓN SISTEMÁTICA EN AMÉRICA LATINA

    Directory of Open Access Journals (Sweden)

    LAYLA MICHÁN

    2011-01-01

    Full Text Available Presento la investigación sobre las bases de datos bibliográficas Biosis, CAB, Periódica, SCI, Scopus y Zoological Record . Se estudian características para identificar cuáles y cuántas es necesario utilizar para tener la información más representativa. De 1.363 revistas analizadas, el 36,5% se encuentra en más de una base de datos y el 63,46% se registra solo en una. Zoological Record contiene 63.421 documentos, Biosis 19.079, CAB 14.363, Periódica 11.185, SCI 3.257 y Scopus 916. CAB y ZR son las más antiguas, el promedio de artículos publicados por año para Biosis fue de 6.417, ZR 433, Periódica 361, CAB 145, SCI 91 y Scopus 30. El análisis de redes muestra mayor relación entre Biosis y SCI, que comparten 16% de títulos, CAB y Biosis comparten 15%, Biosis y ZR 14%, y CAB y ZR 11%. Un análisis de parsimonia muestra que Biosis y SCI comparten más revistas y Periódica tiene más revistas exclusivas (285. Periódica publicó el 24,6% de artículos con descripciones de nuevos taxones y un promedio de 90 al año, CAB 54,6% con promedio de 82 y ZR 72,9% con 322. Ninguna de las bases de datos cumple con las características suficientes empleadas como fuente de información única, es conveniente utilizar distintas combinaciones de acuerdo con las necesidades informativas. Biosis tiene la información más exhaustiva sobre cualquier taxón actual, Zoological Record y CAB tienen una cobertura temporal amplia e incluyen principalmente animales o plantas, respectivamente. SCI tiene el mayor número de documentos en revistas de corriente principal, con referencias, citas e indicadores bibliométricos. Periódica cuenta con mayor cantidad de documentos y cobertura temporal más amplia sobre lo publicado en América Latina. El cladograma obtenido por el análisis de parsimonia resultó ser una herramienta de visualización ideal para representar las características principales de las bases de datos.

  12. Loco for Four Loko: Regulating Caffeinated Alcoholic Beverages

    OpenAIRE

    Kan, Jennifer Yince

    2011-01-01

    Young people across the nation have been going loco for Four Loko, a caffeinated alcoholic beverage (CAB) that some college students have dubbed “blackout in a can.” Just a few months ago, the Food and Drug Administration (FDA) issued warning letters to four CAB manufacturers—including Phusion Projects, the maker of Four Loko—notifying them that the caffeine added to their alcoholic beverages was an “unsafe food additive.” However, for various reasons FDA’s approach to the situation appears...

  13. Protein-peptide molecular docking with large-scale conformational changes: the p53-MDM2 interaction

    OpenAIRE

    Maciej Pawel Ciemny; Aleksander Debinski; Marta Paczkowska; Andrzej Kolinski; Mateusz Kurcinski; Sebastian Kmiecik

    2016-01-01

    Protein-peptide interactions are often associated with large-scale conformational changes that are difficult to study either by classical molecular modeling or by experiment. Recently, we have developed the CABS-dock method for flexible protein-peptide docking that enables large-scale rearrangements of the protein chain. In this study, we use CABS-dock to investigate the binding of the p53-MDM2 complex, an element of the cell cycle regulation system crucial for anti-cancer drug design. Experi...

  14. Morphological characteristics and egg production of forced-moult ...

    African Journals Online (AJOL)

    Owner

    Poultry production in warm wet humid climate. Macmillan Publishers Ltd. London. pp. 118-129. Rose SP (1997). Principles of Poultry Science. CAB. International. Wallingford. UK. pp. 44-61. Spearman RIC (1971). Integumentary system. In: Physiology and. Biochemistry of the domestic fowl. Vol.2. Bell, DJ and Freeman BM.

  15. 49 CFR 399.207 - Truck and truck-tractor access requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Truck and truck-tractor access requirements. 399... Vehicles § 399.207 Truck and truck-tractor access requirements. (a) General rule. Any person entering or exiting the cab or accessing the rear portion of a high profile COE truck or truck-tractor shall be...

  16. Tannase Production by Solid State Fermentation of Cashew Apple Bagasse

    Science.gov (United States)

    Podrigues, Tigressa H. S.; Dantas, Maria Alcilene A.; Pinto, Gustavo A. S.; Gonçalves, Luciana R. B.

    The ability of Aspergillus oryzae for the production of tannase by solid state fermentation was investigated using cashew apple bagasse (CAB) as substrate. The effect of initial water content was studied and maximum enzyme production was obtained when 60 mL of water was added to 100.0 g of CAB. The fungal strain was able to grow on CAB without any supplementation but a low enzyme activity was obtained, 0.576 U/g of dry substrate (gds). Optimization of process parameters such as supplementation with tannic acid, phosphorous, and different organic and inorganic nitrogen sources was studied. The addition of tannic acid affected the enzyme production and maximum tannase activity (2.40 U/gds) was obtained with 2.5% (w/w) supplementation. Supplementation with ammonium nitrate, peptone, and yeast extract exerted no influence on tannase production. Ammonium sulphate improved the enzyme production in 3.75-fold compared with control. Based on the experimental results, CAB is a promising substrate for solid state fermentation, enabling A. oryzae growth and the production of tannase, with a maximum activity of 3.42 U/gds and enzyme productivity of 128.5×10-3 U·gds -1·h-1.

  17. SwissProt search result: AK100530 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100530 J023101H04 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 7e-15 ...

  18. SwissProt search result: AK111828 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111828 J023064H19 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 8e-72 ...

  19. SwissProt search result: AK120648 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK120648 J013155K09 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 5e-17 ...

  20. SwissProt search result: AK120059 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK120059 J013001E13 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 2e-24 ...

  1. SwissProt search result: AK101165 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK101165 J033028D10 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 1e-16 ...

  2. SwissProt search result: AK105815 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105815 001-203-C10 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Tim...ing of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 5e-11 ...

  3. SwissProt search result: AK065276 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065276 J013002L12 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 6e-17 ...

  4. SwissProt search result: AK073624 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK073624 J033048G07 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 1e-16 ...

  5. SwissProt search result: AK111864 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111864 J033025G23 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 1e-16 ...

  6. SwissProt search result: AK121136 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121136 J023077E22 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 5e-21 ...

  7. SwissProt search result: AK066112 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK066112 J013051N02 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 5e-22 ...

  8. SwissProt search result: AK067728 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK067728 J013116P12 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 7e-24 ...

  9. SwissProt search result: AK067314 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK067314 J013102G21 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 7e-24 ...

  10. SwissProt search result: AK102959 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK102959 J033115H14 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 1e-16 ...

  11. SwissProt search result: AK099581 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK099581 J013040N16 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 6e-17 ...

  12. SwissProt search result: AK059514 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059514 001-029-B09 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Tim...ing of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 4e-22 ...

  13. SwissProt search result: AK072736 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072736 J023139D11 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 8e-11 ...

  14. SwissProt search result: AK111899 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111899 J023034P21 (Q9LKL2) Two-component response regulator-like APRR1 (Pseudo-response regulator 1) (Timi...ng of CAB expression 1) (ABI3-interacting protein 1) APRR1_ARATH 1e-16 ...

  15. Download this PDF file

    African Journals Online (AJOL)

    Dr Olaleye

    2017-12-23

    Dec 23, 2017 ... Bioline International, African Journals online (AJOL), Index Copernicus, African Index Medicus (WHO), Excerpta medica. (EMBASE), CAB Abstracts ... books, monographs, dissertations and theses, through which researchers ... and, unlike books, journal articles take a relatively short time to publish. Finally ...

  16. Fulltext PDF

    Indian Academy of Sciences (India)

    founding of the city of Rome. So the years were counted 1,2,3 ... AVC CAb Vrbe ... countries the date of some religious festivals is decided even now. The Romans started the year in the month of. March .... 1752; surprisingly 'Scotland being a Roman Catholic country adopted the reform in 1600 itself. Japan accepted the ...

  17. Protein-peptide molecular docking with large-scale conformational changes: the p53-MDM2 interaction

    Science.gov (United States)

    Ciemny, Maciej Pawel; Debinski, Aleksander; Paczkowska, Marta; Kolinski, Andrzej; Kurcinski, Mateusz; Kmiecik, Sebastian

    2016-12-01

    Protein-peptide interactions are often associated with large-scale conformational changes that are difficult to study either by classical molecular modeling or by experiment. Recently, we have developed the CABS-dock method for flexible protein-peptide docking that enables large-scale rearrangements of the protein chain. In this study, we use CABS-dock to investigate the binding of the p53-MDM2 complex, an element of the cell cycle regulation system crucial for anti-cancer drug design. Experimental data suggest that p53-MDM2 binding is affected by significant rearrangements of a lid region - the N-terminal highly flexible MDM2 fragment; however, the details are not clear. The large size of the highly flexible MDM2 fragments makes p53-MDM2 intractable for exhaustive binding dynamics studies using atomistic models. We performed extensive dynamics simulations using the CABS-dock method, including large-scale structural rearrangements of MDM2 flexible regions. Without a priori knowledge of the p53 peptide structure or its binding site, we obtained near-native models of the p53-MDM2 complex. The simulation results match well the experimental data and provide new insights into the possible role of the lid fragment in p53 binding. The presented case study demonstrates that CABS-dock methodology opens up new opportunities for protein-peptide docking with large-scale changes of the protein receptor structure.

  18. Building a bi-directional promoter binary vector from the intergenic ...

    African Journals Online (AJOL)

    ajl

    2013-03-13

    Mar 13, 2013 ... African Journal of Biotechnology Vol. 12(11), pp. 1203-1208, 13 March, ... issue in plant genetic engineering and in this report we show their use in Medicago and tomato. Key words: Arabidopsis cab genes, .... and 1 uL restriction enzyme and product visualized using standard gel electrophoresis. Glycerol ...

  19. 49 CFR 227.121 - Recordkeeping.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad Operating... person's representative upon written authorization by such employee; (iii) Make exposure measurement... were present in the locomotive cab during the given run and/or who work in the same yard; and (iv) Make...

  20. Adhesive bonding of wood treated with ACQ and copper azole preservatives

    Science.gov (United States)

    Linda F. Lorenz; Charles Frihart

    2006-01-01

    Treated wood has generally been more difficult to bond than untreated wood for a variety of reasons. Alkaline copper quat (ACQ) and copper azole (CA-B), the most prominent substitutes for chromated copper arsenate (CCA), are difficult to bond consistently. Using a phenol-resorcinol- formaldehyde (PRF) adhesive formulated for bonding to CCA-treated wood, we examined the...

  1. ORF Alignment: NC_000868 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available abyssi (strain Orsay) ... sp|Q9UZC9|MRE11_PYRAB DNA double-strand break re... NC_000868 gi|14521424 >1ii7A 1 329 11 340 4e-97 ... emb|CAB50130.1| Rad32/mre11 DNA r...pair ... protein mre11 ... Length = 330 ... Query: 11 ... IKFAHLADVHLGYEQFNRSQRAEEFAKAFEDAIKICVDEKVD

  2. 49 CFR 236.526 - Roadway element not functioning properly.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING THE INSTALLATION... Train Stop, Train Control and Cab Signal Systems Rules and Instructions; Roadway § 236.526 Roadway... roadway element shall be caused manually to display its most restrictive aspect until such element has...

  3. 49 CFR 236.528 - Restrictive condition resulting from open hand-operated switch; requirement.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Restrictive condition resulting from open hand... Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES, STANDARDS, AND... SYSTEMS, DEVICES, AND APPLIANCES Automatic Train Stop, Train Control and Cab Signal Systems Rules and...

  4. 49 CFR 236.504 - Operation interconnected with automatic block-signal system.

    Science.gov (United States)

    2010-10-01

    ... (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS... of the engineer to acknowledge or obey a restrictive wayside signal or a more restrictive cab signal... engineer to acknowledge a restrictive wayside signal will cause the intermittent inductive automatic train...

  5. 49 CFR 236.502 - Automatic brake application, initiation by restrictive block conditions stopping distance in...

    Science.gov (United States)

    2010-10-01

    ... restrictive block conditions stopping distance in advance. 236.502 Section 236.502 Transportation Other... TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING THE INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR... Cab Signal Systems Standards § 236.502 Automatic brake application, initiation by restrictive block...

  6. Complement system proteins which interact with C3b or C4b A superfamily of structurally related proteins

    DEFF Research Database (Denmark)

    Reid, K B M; Bentley, D R; Campbell, R D

    1986-01-01

    Recent cDNA sequencing data has allowed the prediction of the entire amino acid sequences of complement components factor B and C2, the complement control proteins factor H and C4b-binding protein and a partial sequence for the Cab/C4b receptor CR1. These proteins all contain internal repeating u...

  7. Effects of prolonged UV-B exposure in plants

    African Journals Online (AJOL)

    STORAGESEVER

    2008-12-29

    Dec 29, 2008 ... carcinogenic consequences of UV-irradiation (Longstreth et al., 1995), and increased ... in skin cancer, skin ageing and cataracts in human populations are .... binding protein (Lhcb or cab), a decline in total RNA enzyme activity and the .... possibility of electron transport being an initial event in. CRY1 signal ...

  8. Guía de los beneficiaros de subvenciones para el uso de las bases ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Corey Piccioni

    Bases de datos EBSCO: • Academic Search Complete. • Business Source Premier. • CAB Abstracts. • EconLit. • Fuente Académica. • LISTA. • MEDLINE. • Public Affairs Index. • SocINDEX. IDRC Discovery Service permite buscar en el contenido de las bases de datos externas de manera simultánea con las bases de datos.

  9. Download this PDF file

    African Journals Online (AJOL)

    1995) in three agro-ecological zones in Nigeria to study their rcaetion to cassava anthracnose disease (CAB), caused by Colletolriçhum ... disease was recorded in lbadan and Owerri, making them good sites for scrcening cassava for anthracnose remstanee. .... maintained as disease—free tissue cultures in a screenhouse.

  10. Mineralization and N-use efficiency of tree legume prunings from ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-09-17

    Sep 17, 2008 ... Synchrony of nutrient release and plant demand: Litter quality, soil environment and farmer management options. Pp. 215-227. In: Cadisch G, Giller KE (eds),. Driven by nature: plant litter quality and decomposition. CAB. International. Wallingford, UK. Terminghoff EJM, Houba VJG, van Vark W, Gaikhorst ...

  11. Pseudomonas sax genes overcome aliphatic isothiocyanate-mediated non-host resistance in Arabidopsis

    Science.gov (United States)

    Jun Fan; Casey Crooks; Gary Creissen; Lionel Hill; Shirley Fairhurst; Peter Doerner; Chris Lamb

    2011-01-01

    Most plant-microbe interactions do not result in disease; natural products restrict non-host pathogens. We found that sulforaphane (4-methylsulfinylbutyl isothiocyanate), a natural product derived from aliphatic glucosinolates, inhibits growth in Arabidopsis of non-host Pseudomonas bacteria in planta. Multiple sax genes (saxCAB/F/D/G) were identified in Pseudomonas...

  12. 76 FR 76762 - Notice of Lodging of Consent Decree Under the Clean Air Act

    Science.gov (United States)

    2011-12-08

    ... v. Jack M. Levine & Son, Inc., Civil Action No. 1:11-cv-00480-CAB, was lodged with the United States... (``CAA'') against Jack M. Levine & Son, Inc. (``Defendant'') relating to Defendant's Cleveland, Ohio... should refer to United States v. Jack M. Levine & Son, Inc., D.J. Ref. 90-5-2-1-09789. The Decree may be...

  13. Dimensions of Air Traffic Control Tower Information Needs: From Information Requests to Display Design

    Science.gov (United States)

    Durso, Francis T.; Johnson, Brian R.; Crutchfield, Jerry M.

    2010-01-01

    In an effort to determine the information needs of tower air traffic controllers, instructors from the Federal Aviation Administration's Academy in Oklahoma City were asked to control traffic in a high-fidelity tower cab simulator. Information requests were made apparent by eliminating access to standard tower information sources. Instead,…

  14. Advising in austerity reflections on challenging times for advice agencies

    CERN Document Server

    Kirwan, Samuel

    2016-01-01

    Advising in austerity provides a lively and thought-provoking account of the conditions, consequences and challenges of advice work in the UK. It examines how advisors negotiate the private troubles of those who come to Citizens Advice Bureaux (CAB) and construct ways forward.

  15. 21 CFR 26.76 - Confidentiality.

    Science.gov (United States)

    2010-04-01

    ... financial information, or information that relates to an ongoing investigation. (c) A party or a CAB may... OF PHARMACEUTICAL GOOD MANUFACTURING PRACTICE REPORTS, MEDICAL DEVICE QUALITY SYSTEM AUDIT REPORTS... under its laws, the confidentiality of information exchanged under this part. (b) In particular, neither...

  16. to view fulltext PDF

    Indian Academy of Sciences (India)

    Unknown

    This is the second of a series on genetics of some larger mammals. The pig was first, and the cow and horse have now appeared as the third and fourth in the series. I reviewed The genetics of the pig here (J. Genet. 1999, 78, 175), and must apologize for an error in con- founding two local publishers: CAB International, who.

  17. Artery Bypass Grafting

    African Journals Online (AJOL)

    Unknown

    nary artery disease (CAD) was coronary artery bypass graft (CAB G) using a segment of saphenous vein interposed between the ascend- ing aorta and the coronary artery distal to the obstructing lesion. This was performed by David Sabiston of Duke University in 1962. With the use of the recently developed technique of ...

  18. 78 FR 76191 - Operational Tests and Inspections for Compliance With Maximum Authorized Train Speeds and Other...

    Science.gov (United States)

    2013-12-16

    ..., including a control cab locomotive in the lead position, and a conventional locomotive at the rear of the... December 6, the derailment has resulted in four fatalities and more than 60 reported injuries. As is... movement authority is being restricted, during radio conversations with other employees or job briefings...

  19. Dicty_cDB: VFJ586 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 14146 |CF214146.1 CGF1000813_B02 Vitis vinifera cv. cabernet sauvignon Stem - CAST Vitis vinifera cDNA clone... CAST0007_IVF_B02 5', mRNA sequence. 52 0.011 1 CB970932 |CB970932.1 CAB10004_IVa_Fa_D03 Cabernet Sauvignon

  20. Trends in literature on new oilseed crops and related species: Seeking evidence of increasing or waning interest

    Science.gov (United States)

    Bibliographic records on eight new crop species Camelina, Crambe, Cuphea, Physaria, Limnanthes, Stokesia, Thlaspi, and Vernonia from Agricola, CAB Abstracts, Scopus, and Web of Science were analyzed for historical and recent trends in the areas of research, author distribution, and quantity and impa...

  1. 49 CFR 238.425 - Electrical system.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Electrical system. 238.425 Section 238.425... Equipment § 238.425 Electrical system. (a) Circuit protection. (1) The main propulsion power line shall be.... (b) Main battery system. (1) The main batteries shall be isolated from the cab and passenger seating...

  2. 29 CFR 1910.901-1910.999 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... resistance .106(d)(3)(ii) Cabs: Cranes .179(c), (o)(2); 180(i)(3) Derricks .181(j)(6) Cadmium .252(c)(9...); .220 National Electrical Code .309 Nitrous Oxide .114 Noise Exposure .98 Nonionizing Radiation .98... Dates .98, .149 Labor Camps .142 Marking Physical Hazards .144 Noise Exposure .95 Physical Hazards...

  3. Descriptive systematic review of sub-Saharan African studies on the ...

    African Journals Online (AJOL)

    The purpose of this review was to identify and assess studies that have quantified the association between alcohol consumption and HIV infection in sub-Saharan Africa. PubMed, CAB Abstracts and article references were searched to identify studies published in English between 2000 and 2008 that reported relative ...

  4. NCBI nr-aa BLAST: CBRC-DSIM-04-0030 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-04-0030 ref|NP_001011594.1| G-protein coupled receptor [Apis mellifera] e...mb|CAB76374.1| G-protein coupled receptor [Apis mellifera] gb|ABI94393.1| tyramine receptor [Apis mellifera]... gb|ABI94394.1| tyramine receptor [Apis mellifera] NP_001011594.1 2e-61 36% ...

  5. NCBI nr-aa BLAST: CBRC-CREM-01-0535 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-0535 ref|NP_492273.1| F16D3.7 [Caenorhabditis elegans] emb|CAB01500.1|... Hypothetical protein F16D3.7 [Caenorhabditis elegans] emb|CAA16515.1| Hypothetical protein F16D3.7 [Caenorhabditis elegans] NP_492273.1 0.0 83% ...

  6. NCBI nr-aa BLAST: CBRC-MMUR-01-0557 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0557 ref|NP_510481.1| hypothetical protein F45B8.3 [Caenorhabditis elegans...] emb|CAB05726.2| C. elegans protein F45B8.3, confirmed by transcript evidence [Caenorhabditis elegans] NP_510481.1 8e-04 30% ...

  7. NCBI nr-aa BLAST: CBRC-CELE-02-0102 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-02-0102 ref|NP_495888.2| T07D4.1 [Caenorhabditis elegans] emb|CAA90404.3|... Hypothetical protein T07D4.1 [Caenorhabditis elegans] emb|CAB76411.2| Hypothetical protein T07D4.1 [Caenorhabditis elegans] NP_495888.2 0.0 89% ...

  8. NCBI nr-aa BLAST: CBRC-CELE-04-0119 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-04-0119 ref|NP_001040957.1| JC8.12a [Caenorhabditis elegans] gb|AAK49908....1| JC8.12-like protein [Caenorhabditis elegans] emb|CAB54268.2| Hypothetical protein JC8.12a [Caenorhabditis elegans] NP_001040957.1 1e-175 100% ...

  9. NCBI nr-aa BLAST: CBRC-CBRE-01-0098 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0098 ref|NP_507941.2| B0250.9 [Caenorhabditis elegans] gb|AAQ14296.1|A...F264764_1 sterol reductase [Caenorhabditis elegans] emb|CAB03797.2| Hypothetical protein B0250.9 [Caenorhabditis elegans] NP_507941.2 2e-59 81% ...

  10. NCBI nr-aa BLAST: CBRC-CBRE-01-0902 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-0902 ref|NP_001040957.1| JC8.12a [Caenorhabditis elegans] gb|AAK49908....1| JC8.12-like protein [Caenorhabditis elegans] emb|CAB54268.2| Hypothetical protein JC8.12a [Caenorhabditis elegans] NP_001040957.1 2e-80 67% ...

  11. NCBI nr-aa BLAST: CBRC-CREM-01-1184 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1184 ref|NP_001040957.1| JC8.12a [Caenorhabditis elegans] gb|AAK49908....1| JC8.12-like protein [Caenorhabditis elegans] emb|CAB54268.2| Hypothetical protein JC8.12a [Caenorhabditis elegans] NP_001040957.1 1e-121 70% ...

  12. NCBI nr-aa BLAST: CBRC-CREM-01-1287 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1287 ref|NP_001040957.1| JC8.12a [Caenorhabditis elegans] gb|AAK49908....1| JC8.12-like protein [Caenorhabditis elegans] emb|CAB54268.2| Hypothetical protein JC8.12a [Caenorhabditis elegans] NP_001040957.1 1e-119 71% ...

  13. NCBI nr-aa BLAST: CBRC-CBRE-01-1159 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CBRE-01-1159 ref|NP_492273.1| F16D3.7 [Caenorhabditis elegans] emb|CAB01500.1|... Hypothetical protein F16D3.7 [Caenorhabditis elegans] emb|CAA16515.1| Hypothetical protein F16D3.7 [Caenorhabditis elegans] NP_492273.1 0.0 77% ...

  14. Train-to-train impact test of crash energy management passenger rail equipment.

    Science.gov (United States)

    2007-02-01

    On March 23, 2006, a full-scale test was conducted on a passenger rail train retrofitted with newly developed cab and coach car crush zone designs. This test was conducted as part of a larger testing program to establish the degree of enhanced perfor...

  15. Preparations for a train-to-train impact test of crash-energy management passenger rail equipment

    Science.gov (United States)

    2005-03-16

    Preparations are ongoing for a full-scale train-to-train : impact test of crash-energy management (CEM) equipment, : during which a cab car-led passenger consist, initially moving : at 30 mph, will impact a standing locomotive-led consist. The : coll...

  16. Train-to-Train Impact Test of Crash-Energy Management Passenger Rail Equipment: Occupant Experiments

    Science.gov (United States)

    2006-11-06

    As part of an ongoing passenger rail crashworthiness effort, : a full-scale impact test of a train with crash energy management : (CEM) passenger cars was conducted on March 23, 2006. In : this test, a train made up of a CEM cab car, four CEM coach :...

  17. The influence of annealing temperature and heating rate on thermoluminescence properties of nanocrystalline calcium borate powder

    Science.gov (United States)

    Tengku Kamarnl Bahri, T. N. H.; Hussin, R.; Ahmad, N. E.

    2017-10-01

    We have reported the influence of annealing temperature and heating rate on thermoluminescence (TL) properties of nanocrystalline calcium borate, CaB2O4, powder synthesized by solution combustion method. Powder X-ray diffraction experiments were carried out on CaB2O4 to get the crystal phase and size. The samples were annealed using the TLD oven and exposed to cobalt-60 source. TL glow curves were measured and recorded using a Harshaw model 3500 TLD reader. The crystal phase confirmed one major phase of CaB2O4 with 27 nm in size. CaB2O4 has a simple glow curve with only one and a well defined peak at around 150 °C. TL intensity was higher after annealing the material before irradiation which indicated the importance of annealing. It was found that an annealing temperature at 300 °C for one hour and the heating rate of 10 °C s-1 was the best procedure to produce high TL intensity.

  18. 49 CFR 230.46 - Badge plates.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.46 Badge plates. A metal badge plate showing the allowed steam pressure shall be attached to the boiler backhead in the cab. If boiler backhead is lagged, the lagging and jacket shall be cut away so...

  19. Dicty_cDB: Contig-U16520-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 74 2e-32 5 ( ES492301 ) BIG_AF_116 Brine Shrimp diapaused embryos (cysts)... 76 4e-32 5 ( BG321590 ) Ds01_...... 82 1e-23 4 ( CB974163 ) CAB30004_IIa_Ra_E08 Cabernet Sauvignon Berry Stag... 86 1e-23 3 ( ES492571 ) BIG_AF_386 Brine

  20. NCBI nr-aa BLAST: CBRC-CINT-01-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0105 ref|NP_001011594.1| G-protein coupled receptor [Apis mellifera] e...mb|CAB76374.1| G-protein coupled receptor [Apis mellifera] gb|ABI94393.1| tyramine receptor [Apis mellifera]... gb|ABI94394.1| tyramine receptor [Apis mellifera] NP_001011594.1 0.002 25% ...

  1. Antithrombin III for critically ill patients

    DEFF Research Database (Denmark)

    Allingstrup, Mikkel; Wetterslev, Jørn; Ravn, Frederikke B

    2016-01-01

    PURPOSE: Antithrombin III (AT III) is an anticoagulant with anti-inflammatory properties. We assessed the benefits and harms of AT III in critically ill patients. METHODS: We searched from inception to 27 August 2015 in CENTRAL, MEDLINE, EMBASE, CAB, BIOSIS and CINAHL. We included randomized cont...

  2. Automated Spray Pothole Patching Truck

    OpenAIRE

    ECT Team, Purdue

    2007-01-01

    The RA-300 patcher, manufactured by Rosco Manufacturing, Madison, S.D., is a fully automated spray patching road maintenance vehicle, which fills potholes and cracks on the road. A operator can control all patching functions with the control panel and joystick from the safety and comfort of the truck cab.

  3. 49 CFR 236.531 - Trip arm; height and distance from rail.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Trip arm; height and distance from rail. 236.531... Train Stop, Train Control and Cab Signal Systems Rules and Instructions; Roadway § 236.531 Trip arm; height and distance from rail. Trip arm of automatic train stop device when in the stop position shall be...

  4. Optimized Hyper Beamforming of Linear Antenna Arrays Using Collective Animal Behaviour

    Directory of Open Access Journals (Sweden)

    Gopi Ram

    2013-01-01

    Full Text Available A novel optimization technique which is developed on mimicking the collective animal behaviour (CAB is applied for the optimal design of hyper beamforming of linear antenna arrays. Hyper beamforming is based on sum and difference beam patterns of the array, each raised to the power of a hyperbeam exponent parameter. The optimized hyperbeam is achieved by optimization of current excitation weights and uniform interelement spacing. As compared to conventional hyper beamforming of linear antenna array, real coded genetic algorithm (RGA, particle swarm optimization (PSO, and differential evolution (DE applied to the hyper beam of the same array can achieve reduction in sidelobe level (SLL and same or less first null beam width (FNBW, keeping the same value of hyperbeam exponent. Again, further reductions of sidelobe level (SLL and first null beam width (FNBW have been achieved by the proposed collective animal behaviour (CAB algorithm. CAB finds near global optimal solution unlike RGA, PSO, and DE in the present problem. The above comparative optimization is illustrated through 10-, 14-, and 20-element linear antenna arrays to establish the optimization efficacy of CAB.

  5. Optimized hyper beamforming of linear antenna arrays using collective animal behaviour.

    Science.gov (United States)

    Ram, Gopi; Mandal, Durbadal; Kar, Rajib; Ghoshal, Sakti Prasad

    2013-01-01

    A novel optimization technique which is developed on mimicking the collective animal behaviour (CAB) is applied for the optimal design of hyper beamforming of linear antenna arrays. Hyper beamforming is based on sum and difference beam patterns of the array, each raised to the power of a hyperbeam exponent parameter. The optimized hyperbeam is achieved by optimization of current excitation weights and uniform interelement spacing. As compared to conventional hyper beamforming of linear antenna array, real coded genetic algorithm (RGA), particle swarm optimization (PSO), and differential evolution (DE) applied to the hyper beam of the same array can achieve reduction in sidelobe level (SLL) and same or less first null beam width (FNBW), keeping the same value of hyperbeam exponent. Again, further reductions of sidelobe level (SLL) and first null beam width (FNBW) have been achieved by the proposed collective animal behaviour (CAB) algorithm. CAB finds near global optimal solution unlike RGA, PSO, and DE in the present problem. The above comparative optimization is illustrated through 10-, 14-, and 20-element linear antenna arrays to establish the optimization efficacy of CAB.

  6. 49 CFR 236.563 - Delay time.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Delay time. 236.563 Section 236.563 Transportation... Cab Signal Systems Rules and Instructions; Locomotives § 236.563 Delay time. Delay time of automatic... requirements of § 236.24 shall take into consideration the delay time. ...

  7. 30 CFR 75.523-1 - Deenergization of self-propelled electric face equipment installation requirements.

    Science.gov (United States)

    2010-07-01

    ... section, be provided with a device that will quickly deenergize the tramming motors of the equipment in... constructed cab which meets the requirements of this part, shall not be required to be provided with a device that will quickly deenergize the tramming motors of the equipment in the event of an emergency. (c) An...

  8. Multisensor Approaches for Determining Deflections of the Vertical.

    Science.gov (United States)

    1983-01-01

    Laboratories I3. NMBNER OF PAGES Fort Belvoir, VA 22060 ___________ 54. MONITORING AGENCY NAME & ADORIESS(I1 different tram Controling Office) 1S. SECURITY...na ) Ra = covariance of aa Cab = covariance of a and b given measurements of c, d,Ide and e. - _ A.2 SEQUENTIAL COLLOCATION FORMULAS In Table A-2 the

  9. InterProScan Result: FS732771 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS732771 FS732771_1_ORF1 CAB84C2D8D3B4984 SUPERFAMILY SSF103473 MFS general substra...te transporter 3.8e-15 T IPR016196 Major facilitator superfamily, general substrate transporter ...

  10. The US Intelligence Community’s Five Year Strategic Human Capital Plan. An Annex to the US National Intelligence Strategy

    Science.gov (United States)

    2006-06-22

    military and civilian members of the Intelligence Community in 16 separate elements of six different cab- inet departments, is set forth on the pages that...WMD) and Proliferation The development of dangerous weapons (biologi- cal and chemical as well as nuclear) and delivery systems constitutes the second

  11. The U.S. Intelligence Community’s Five Year Strategic Human Capital Plan

    Science.gov (United States)

    2006-06-22

    of the Intelligence Community in 16 separate elements of six different cab- inet departments, is set forth on the pages that follow. • Setting the...development of dangerous weapons (biologi- cal and chemical as well as nuclear) and delivery systems constitutes the second major threat to the safety

  12. Morphology Evolution of Polypropylene in Immiscible Polymer Blends for Fabrication of Nanofibers

    Science.gov (United States)

    Immiscible blends of cellulose acetate butyrate (CAB) and isotactic polypropylenes (iPPs) with different melting index were extruded through a two-strand rod die. The extrudates were hot-drawn at the die exit at different draw ratios by controlling the drawing speed. The morphologies of iPP fibers e...

  13. Searching the veterinary literature: a comparison of the coverage of veterinary journals by nine bibliographic databases.

    Science.gov (United States)

    Grindlay, Douglas J C; Brennan, Marnie L; Dean, Rachel S

    2012-01-01

    A thorough search of the literature to find the best evidence is central to the practice of evidence-based veterinary medicine. This requires knowing which databases to search to maximize journal coverage. The aim of the present study was to compare the coverage of active veterinary journals by nine bibliographic databases to inform future systematic reviews and other evidence-based searches. Coverage was assessed using lists of included journals produced by the database providers. For 121 active veterinary journals in the "Basic List of Veterinary Medical Serials, Third Edition," the percentage coverage was the highest for Scopus (98.3%) and CAB Abstracts (97.5%). For an extensive list of 1,139 journals with significant veterinary content compiled from a variety of sources, coverage was much greater in CAB Abstracts (90.2%) than in any other database, the next highest coverage being in Scopus (58.3%). The maximum coverage of the extensive journal list that could be obtained in a search without including CAB Abstracts was 69.8%. It was concluded that to maximize journal coverage and avoid missing potentially relevant evidence, CAB Abstracts should be included in any veterinary literature search.

  14. Notes on some insect galls associated with Solanum plants in South ...

    African Journals Online (AJOL)

    1990-12-18

    Dec 18, 1990 ... ANNECKE, D.P. & MORAN, V.C. 1982. Insects and mites of cultivated plants in South Africa. Butterworths, Durban. 383 pp. BOUeEK, Z. 1988. Australasian Chalcidoidea (Hymenoptera) a biosystematic revision of genera of fourteen families, with a reclassification of species. C.A.B. International, Wallingford.

  15. 21 CFR 26.68 - Withdrawal of listed conformity assessment bodies.

    Science.gov (United States)

    2010-04-01

    .... 26.68 Section 26.68 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL MUTUAL RECOGNITION OF PHARMACEUTICAL GOOD MANUFACTURING PRACTICE REPORTS, MEDICAL DEVICE... the CAB shall take effect; (d) In the event the other party opposes the proposal to withdraw by...

  16. 75 FR 51525 - Railroad Safety Advisory Committee (RSAC); Working Group Activity Update

    Science.gov (United States)

    2010-08-20

    ... high-speed rail projects planned in California and Florida. The next meeting of the Working Group is... and occupant protection safety recommendations for high-speed passenger trains. The re-tasked ETF may... addressed, including conventional locomotives, high-speed power cars, cab cars, multiple-unit (MU...

  17. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21218662 >1cxqA 5 133 141 282 2e-06 ... ref|NP_624441.1| putative noncomposite... transposon transposase [Streptomyces ... coelicolor A3(2)] emb|CAB52910.1| putative noncomposite... ... transposon transposase [Streptomyces coelicolor A3(2)] ... pir||T36996 probable noncomposite

  18. Review and analysis of selected databases and subject headings with regard to wood sciences and technology

    OpenAIRE

    Bartol, Tomaž

    2007-01-01

    End-users should be able to identify the most relevant scientific and technical information resources. They must understand database structure, query techniques, controlled dictionaries, terminology and indexing schemes. In the present article, we review principal characteristics of the following information systems: bibliographic databases (Agricola, Agris, Cab Abstracts (CABI), Compendex, Inspec, Iconda, statistical collections Eurostat and Faostat, and technical standards and patents ISO a...

  19. Complete androgen blockade safely allows for delay of cytotoxic chemotherapy in castration refractory prostate cancer

    Directory of Open Access Journals (Sweden)

    Rafael A. Kaliks

    2010-06-01

    Full Text Available PURPOSE: Complete androgen blockade (CAB does not prolong overall survival (OS in patients with castration refractory prostate cancer (CRPC. Although there is variable clinical benefit with second-line hormone manipulation, we do not know which patients might benefit the most. OBJECTIVES: To identify clinical predictors of benefit of complete androgen blockade. MATERIALS AND METHODS: We reviewed the records for 54 patients who received treatment with CAB in the setting of disease progression despite castration. We evaluated progression-free survival (PFS and OS according to PSA at diagnosis, Gleason scores, age, testosterone level, and duration of prior disease control during castration in first line treatment. RESULTS: Among 54 patients who received CAB, the median PFS was 9 months (CI 4.3-13.7 and OS was 36 months (CI 24-48. We did not find an effect of PSA at diagnosis (p = 0.32, Gleason score (p = 0.91, age (p = 0.69 or disease control during castration (p = 0.87 on PFS or OS. Thirty-four patients subsequently received chemotherapy, with a mean OS of 21 months (CI 16.4-25.5, median not reached. CONCLUSION: Age, Gleason score, PSA at diagnosis and length of disease control with castration did not affect PFS or OS. In the absence of predictors of benefit, CAB should still be considered in CRPC.

  20. Ce3+-sensitized red Mn2+ luminescence in calcium aluminoborate phosphor material

    Science.gov (United States)

    Puchalska, M.; Zych, E.

    2017-12-01

    Ce3+ doped and Ce3+,Mn2+ co-doped calcium aluminoborate (CAB) phosphors were synthesised by solid-state reaction method and their optical properties were studied. X-ray powder diffraction, SEM and TEM studies indicated the crystallization of the main trigonal CaAl2B2O7 phase and the presence of an additional non-crystalline phase. It was also observed that increasing dopant concentration promotes phase separation. Hence, both series of phosphors demonstrated the changes in luminescence properties via activator concentration variation. Upon UV excitation (λex = 310 nm) Ce3+ doped and Ce3+,Mn2+ co-doped materials yielded intensive blue and pinkish luminescence, respectively. The spectra of CAB:Ce3+ samples showed a broad emission band due to 5d→4f transition of Ce3+, which broadened and shifted to longer wavelengths with increasing dopant content. Mn2+ co-doping caused appearance of another broad-band emission with a maximum of 680 nm, resulting from the 4T1(4G) →6A1(6S) transition of Mn2+. Detailed analysis of the emission and excitation spectra as well as decay time traces as a function of dopant concentration showed that efficient resonant energy transfer mainly occurs between Ce3+ and Mn2+ incorporated in the non-crystalline phase in CAB material. The estimated values of energy transfer efficiency of CAB:Ce3+(3%),Mn2+(4%) is close to 52%.

  1. Diagnosing Microbiologically Influenced Corrosion: A State-of-the-Art Review

    Science.gov (United States)

    2006-11-01

    pm.47 certain types of bacteria (to have unique characteris- tics. Geiser . ei al., found that puts in Type 316L stain- tons5 3 and cannot be. used to...J. Welz. J. Tverberg. Mater. P’erfornm. 37 (1998): p. 66. Biodeterluration VI (London. UK.: CAB International). p. 567. 59. M. Geiser . R. Avel. Z

  2. The effect of magnesium oxide supple- mentation on the fertility of ...

    African Journals Online (AJOL)

    Ed. Hacker,. J.B. CAB Farnham Royal, UK, p259. McDOWELL, L.R., CONRAD, J.H., ELLIS, G.L. &. LOOSLI, J.K., 1983. Minerals for Grazing Ruminants in. Tropical Regions. Univ. of Florida, Gainesville. MILLER, W.J., 1979. Dairy Cattle Feeding and Nutrition. Academic Press, New York. PICKARD, D.W., 1986. Minerals and ...

  3. NCBI nr-aa BLAST: CBRC-PMAR-01-0503 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0503 ref|NP_001011594.1| G-protein coupled receptor [Apis mellifera] e...mb|CAB76374.1| G-protein coupled receptor [Apis mellifera] gb|ABI94393.1| tyramine receptor [Apis mellifera]... gb|ABI94394.1| tyramine receptor [Apis mellifera] NP_001011594.1 3e-43 32% ...

  4. NCBI nr-aa BLAST: CBRC-CELE-06-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-06-0037 ref|NP_001011594.1| G-protein coupled receptor [Apis mellifera] e...mb|CAB76374.1| G-protein coupled receptor [Apis mellifera] gb|ABI94393.1| tyramine receptor [Apis mellifera]... gb|ABI94394.1| tyramine receptor [Apis mellifera] NP_001011594.1 2e-38 29% ...

  5. 49 CFR 393.209 - Steering wheel systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Steering wheel systems. 393.209 Section 393.209... NECESSARY FOR SAFE OPERATION Frames, Cab and Body Components, Wheels, Steering, and Suspension Systems § 393.209 Steering wheel systems. (a) The steering wheel shall be secured and must not have any spokes...

  6. NCBI nr-aa BLAST: CBRC-BTAU-01-2424 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2424 ref|NP_389715.1| plipastatin synthetase [Bacillus subtilis subsp....lus subtilis] emb|CAB13716.1| plipastatin synthetase [Bacillus subtilis subsp. subtilis str. 168] NP_389715.1 0.28 27% ...

  7. NCBI nr-aa BLAST: CBRC-BTAU-01-2696 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2696 ref|NP_389715.1| plipastatin synthetase [Bacillus subtilis subsp....lus subtilis] emb|CAB13716.1| plipastatin synthetase [Bacillus subtilis subsp. subtilis str. 168] NP_389715.1 1.5 28% ...

  8. 49 CFR 565.25 - Content requirements.

    Science.gov (United States)

    2010-10-01

    ... Decipherable Passenger car: Line, series, body type, engine type and restraint system type. Multipurpose..., series, chassis, cab type, engine type, brake system and gross vehicle weight rating. Bus: Model or line, series, body type, engine type, and brake system. Trailer, including trailer kits and incomplete trailer...

  9. Download this PDF file

    African Journals Online (AJOL)

    hence poor nutrition arise from attempt by farmers and feed producers to minimise production cost by inadequate feeding of birds, poor feed formulation, processing, storage and administration (CAB, 1983) If the down trend in poultry business is to be contained, the need to ascertain quality of commercial feeds relative to ...

  10. 49 CFR 393.207 - Suspension systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Suspension systems. 393.207 Section 393.207... NECESSARY FOR SAFE OPERATION Frames, Cab and Body Components, Wheels, Steering, and Suspension Systems § 393.207 Suspension systems. (a) Axles. No axle positioning part shall be cracked, broken, loose or missing...

  11. Coupled canopy-atmosphere modelling for radiance-based estimation of vegetation properties

    NARCIS (Netherlands)

    Laurent, V.C.E.

    2013-01-01

    Vegetation is an important component of the Earth’s biosphere and therefore plays a crucial role in the carbon exchange of terrestrial ecosystems. Vegetation variables, such as leaf area index (LAI) and leaf chlorophyll content (Cab), can be monitored at global scale using remote sensing (RS).

  12. Effects of woody elements on simulated canopy reflectance: implications for forest chlorophyll content retrieval

    NARCIS (Netherlands)

    Verrelst, J.; Schaepman, M.E.; Malenovsky, Z.; Clevers, J.G.P.W.

    2010-01-01

    An important bio-indicator of actual plant health status, the foliar content of chlorophyll a and b (Cab), can be estimated using imaging spectroscopy. For forest canopies, however, the relationship between the spectral response and leaf chemistry is confounded by factors such as background (e.g.

  13. Airborne, All the Way, 3D From the Sky: Approach for an Air Drop Capable, Medium Tactical Vehicle

    Science.gov (United States)

    2015-11-01

    2015 58 I thought if the Department of Defense (DoD) can print in that size in concrete , why not a 6x4-foot truck cab? With the Detroit Auto Show in...chosen for the LVAD, we may even avoid painting altogether. Some plastics are translucent , which allows the adding of color pellets to achieve olive drab

  14. Resuscitation Training at Rwanda Military Hospital

    African Journals Online (AJOL)

    Learning the C-A-Bs: Resuscitation Training at Rwanda Military Hospital. Kathryn Norgang1, Auni Idi Muhire1, Sarah Howrath1. 1Rwanda Military Hospital, Rwanda. Background. There is a lack of trained staff to respond to critically ill patients and cardiac and respiratory arrests in a health facility in Rwanda. This lack of ...

  15. 49 CFR 236.587 - Departure test.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Departure test. 236.587 Section 236.587..., Train Control and Cab Signal Systems Inspection and Tests; Locomotive § 236.587 Departure test. (a) The...: (1) Operation over track elements; (2) Operation over test circuit; (3) Use of portable test...

  16. Antimicrobial-Resistant Bacteremia in the Elderly: Risk of Previous Hospitalization

    Directory of Open Access Journals (Sweden)

    Yung-Cheng Su

    2017-03-01

    Conclusion: Our study showed that the risk of CAB in elderly due to ESBLs-producing E. coli/K. pneumoniae was highly associated with history of recent hospital admissions, and the effect can be prolonged up to 360 days after discharge.

  17. 40 CFR 1033.115 - Other requirements.

    Science.gov (United States)

    2010-07-01

    ... modifications. Otherwise, you must apply the same injection timing and intake air cooling strategies in hotel... brakes or starter system, or to recharge the locomotive battery. (iii) To perform necessary maintenance... idle to heat or cool the cab, provided such heating or cooling is necessary. (h) Power meters. Tier 1...

  18. A computational-level explanation of the speed of goal inference

    NARCIS (Netherlands)

    Blokpoel, M.; Kwisthout, J.H.P.; Weide, Th.P. van der; Wareham, H.T.; Rooij, I.J.E.I. van

    2013-01-01

    The ability to understand the goals that drive another person's actions is an important social and cognitive skill. This is no trivial task, because any given action may in principle be explained by different possible goals (e.g., one may wave ones arm to hail a cab or to swat a mosquito). To select

  19. Afrique Science: Revue Internationale des Sciences et Technologie ...

    African Journals Online (AJOL)

    Utilisation du Système d'Information Géographique (SIG) pour la restructuration du Sud-Est de la ville de Porto-Novo, Bénin · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CAB Tohozin, OD Guedegbe, 62-72 ...

  20. The Civil Reserve Air Fleet. The Past, First Use, and the Future

    Science.gov (United States)

    1994-04-01

    time this concept surfaced officially. The Civil Aeronautics Act of 1938, not only created the Civil Aeronautics Board (CAB) which would exercise broad...War College, 22 February 1993. 24 12. Donn P. Kegel , Improving the Civil Reserve Air Fleet (CRAF) Program. Carlisle Barracks, PA., Army War College

  1. Journal of Medicine in the Tropics: Editorial Policies

    African Journals Online (AJOL)

    ... and improve the health status of man in the tropics. The Journal of Medicine in the Tropics is indexed by African Index Medicus. (International Index to African Health Literature) visit: http://indexmedicus.afro.who.int. It recently became indexed in the CAB ABSTRACTS and GLOBAL HEALTH databases by CABI Publishing, ...

  2. Airports, Hotel, and Ground Transportation Information | Division of Cancer Prevention

    Science.gov (United States)

    Airports in and near Washington, DC Reagan National (DCA)  Approximate 30 minute drive from Rockville* Has its own Metro stop on the blue and yellow lines in Virginia NOTE: This airport may be the closest and easiest option if not renting a car or do not want to pay for an airport cab/shuttle.   Dulles International (IAD) |

  3. Investigating the Catalytic Growth of Carbon Nanotubes with In Situ Raman Monitoring

    Science.gov (United States)

    2015-06-01

    Oil Gas Sci Technol- Revue de l’IFP 2009;64(1):11–24. [24] Moteki T, Murakami Y, Noda S, Maruyama S, Okubo T. Zeolite surface as a catalyst support...water molecules between the hydrophilic surface and the hydrophobic nanotubes embedded in the hydrophobic polymer (CAB). The peeled layer floating

  4. Ground Water Issue: Phytoremediation of Contaminated Soil and Ground Water at Hazardous Waste Sites

    Science.gov (United States)

    2001-02-01

    Heavy Metals. CAB International, New York, NY, pp. 1-14. Brooks, R.R. 1998b. Phytochemistry of hyperaccumulators. In R.R. Brooks (ed.), Plants...strips grown in riparian zones for biomass production and nonpoint source pollution control. Ph.D. Thesis , University of Iowa, Iowa City, IA. Licht

  5. ANÁLISIS BIBLIOMÉTRICO DE LA PRODUCCIÓN TAXONÓMICA EN AMÉRICA LATINA

    Directory of Open Access Journals (Sweden)

    Michán Aguirre Layla

    2011-08-01

    Full Text Available Presento la investigación sobre las seis bases de datos bibliográficas especializadas con mayor cantidad de información sobre sistemática de América Latina: Biosis, CAB, Periódica, SCI, Scopus y Zoological Record. Se caracterizan y se compara su contenido, cobertura temporal, tipológica, geográfica, temática, tipo de acceso y la descripción de nuevos taxones, para identificar cuáles y cuántas es necesario utilizar para tener la información más representativa. De las 1 363 revistas analizadas, el 36.5% se encuentra en más de una base de datos y el 63.46% se registran solo en una. Zoological Record contiene 63 421 documentos, Biosis 19 079, CAB 14 363, Periódica 11 185, SCI 3257 y Scopus 916. CAB y ZR son las más antiguas, el promedio de artículos publicados por año fue para Biosis de 6 417, ZR 433, Periódica 361, CAB 145, SCI 91 y Scopus 30. De acuerdo con el análisis de redes, las relaciones más fuertes se dan entre Biosis y SCI, que comparten al menos 16% de títulos, CAB y Biosis comparten el 15%, Biosis y ZR el 14% y CAB y ZR el 11%. Con base en un análisis de parsimonia basado en las revistas compartidas, se deduce que las más relacionadas son Biosis y SCI, Periódica tiene la cifra mayor de revistas exclusivas (285. Periódica publicó 24.6% de artículos con descripciones de nuevos taxones y un promedio de 90 al año, CAB 54.6% con promedio de 82 y ZR 72.9% con 322. Ninguna de las bases de datos cumple con las características suficientes para ser utilizada como fuente de información única, es conveniente utilizar distintas combinaciones de acuerdo con las necesidades informativas. Biosis tiene la información más exhaustiva sobre cualquier taxón actual, Zoological Record y CAB tienen una cobertura temporal amplia e incluyen principalmente animales o plantas, respectivamente. SCI tiene el mayor número de documentos en revistas de corriente principal, con referencias, citas e indicadores bibliométricos. Peri

  6. ANÁLISIS BIBLIOMÉTRICO DE LA PRODUCCIÓN SISTEMÁTICA EN AMÉRICA LATINA Bibliometric Analysis of Systematics Production in Latin America

    Directory of Open Access Journals (Sweden)

    LAYLA MICHÁN

    2011-08-01

    Full Text Available Presento la investigación sobre las bases de datos bibliográficas Biosis, CAB, Periódica, SCI, Scopus y Zoological Record. Se estudian características para identificar cuáles y cuántas es necesario utilizar para tener la información más representativa. De 1.363 revistas analizadas, el 36,5% se encuentra en más de una base de datos y el 63,46% se registra solo en una. Zoological Record contiene 63.421 documentos, Biosis 19.079, CAB 14.363, Periódica 11.185, SCI 3.257 y Scopus 916. CAB y ZR son las más antiguas, el promedio de artículos publicados por año para Biosis fue de 6.417, ZR 433, Periódica 361, CAB 145, SCI 91 y Scopus 30. El análisis de redes muestra mayor relación entre Biosis y SCI, que comparten 16% de títulos, CAB y Biosis comparten 15%, Biosis y ZR 14%, y CAB y ZR 11%. Un análisis de parsimonia muestra que Biosis y SCI comparten más revistas y Periódica tiene más revistas exclusivas (285. Periódica publicó el 24,6% de artículos con descripciones de nuevos taxones y un promedio de 90 al año, CAB 54,6% con promedio de 82 y ZR 72,9% con 322. Ninguna de las bases de datos cumple con las características suficientes empleadas como fuente de información única, es conveniente utilizar distintas combinaciones de acuerdo con las necesidades informativas. Biosis tiene la información más exhaustiva sobre cualquier taxón actual, Zoological Record y CAB tienen una cobertura temporal amplia e incluyen principalmente animales o plantas, respectivamente. SCI tiene el mayor número de documentos en revistas de corriente principal, con referencias, citas e indicadores bibliométricos. Periódica cuenta con mayor cantidad de documentos y cobertura temporal más amplia sobre lo publicado en América Latina. El cladograma obtenido por el análisis de parsimonia resultó ser una herramienta de visualización ideal para representar las características principales de las bases de datos.I compare six bibliographic databases

  7. Agro-morphological characterization of the Turkish lentil landraces

    African Journals Online (AJOL)

    STORAGESEVER

    2009-09-01

    Sep 1, 2009 ... Hawtin G (eds) Lentils. CAB, Slough, UK, pp. 15-38. Duvick DN (1984). Genetic diversity in major farm crops on the farm and in reverse. Eco. Bot. 38: 151-178. Erskine W, Witcombe JR (1984). Lentil gemplazm catalog, Aleppo,. Syria: International Center for Agricultural Research in the Dry Areas. (ICARDA).

  8. NCBI nr-aa BLAST: CBRC-OLAT-26-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-26-0022 ref|NP_045371.1| envelope glycoprotein I [Bovine herpesvirus 1] e...mb|CAA06146.1| glycoprotein I [Bovine herpesvirus type 1.1 (strain Cooper)] emb|CAB10890.1| glycoprotein I [Bovine herpesvirus 1] NP_045371.1 0.28 34% ...

  9. The Balloon Foot ; A Rare Presentation Of Congenital Constricting ...

    African Journals Online (AJOL)

    We present a case of a rare manifestation of congenital constricting annular band (CAB) in the lower extremity resulting in a severe excessive swelling of the foot which we have termed Balloon foot. The ballooned foot is caused by a progressive deepening of the circumferential constriction into the soft tissue of the lower ...

  10. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    observed that the curcumin therapy significantly reversed the depression-like behaviour induced by. Abstracted by: Bioline International, African Journals online (AJOL), Index. Copernicus, African Index Medicus (WHO), Excerpta medica. (EMBASE), CAB Abstracts, SCOPUS, Global Health. Abstracts, Asian Science Index, ...

  11. EST Table: FY015520 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available a DY3.1#CE15745#WBGene00006574#locus:tin- 13#status:Confirmed#UniProt:O45319#protein_id:CAB09410.1 11/11/04 low homology 11/11/04 low homology 11/11/04 low homology FS894425 bmov ...

  12. Thermodynamic, Kinetic, and Equilibrium Parameters for the Removal of Lead and Cadmium from Aqueous Solutions with Calcium Alginate Beads

    Directory of Open Access Journals (Sweden)

    Ruth Alfaro-Cuevas-Villanueva

    2014-01-01

    Full Text Available The sorption of cadmium (Cd and lead (Pb by calcium alginate beads (CAB from aqueous solutions in batch systems was investigated. The kinetic and thermodynamic parameters, as well as the sorption capacities of CAB in each system at different temperatures, were evaluated. The rate of sorption for both metals was rapid in the first 10 minutes and reached a maximum in 50 minutes. Sorption kinetic data were fitted to Lagergren, pseudo-second-order and Elovich models and it was found that the second-order kinetic model describes these data for the two metals; comparing kinetic parameters for Cd and Pb sorption a higher kinetic rate (K2 for Pb was observed, indicating that the interaction between lead cations and alginate beads was faster than for cadmium. Similarly, isotherm data were fitted to different models reported in literature and it was found that the Langmuir-Freundlich (L-F and Dubinin-Radushkevich (D-R models describe the isotherms in all cases. CAB sorption capacity for cadmium was 27.4 mg/g and 150.4 mg/g for lead, at 25°C. Sorption capacities of Cd and Pb increase as temperature rises. According to the thermodynamic parameters, the cadmium and lead adsorption process was spontaneous and endothermic. It was also found that pH has an important effect on the adsorption of these metals by CAB, as more were removed at pH values between 6 and 7.

  13. Genetic diversity of Colletotrichum gloeosporioides in Nigeria using ...

    African Journals Online (AJOL)

    fmodupe

    2012-04-24

    Apr 24, 2012 ... Bailey JA, Jeger MJ (1992). Colletotrichum: Biology, Pathology and. Control CAB International, Wallingford, UK. p. 398. Cannon PF, Buddie AG, Bridge PD (2008). The typification of. Colletotrichumgloeosporioides. Mycotaxon, 104: 189-204. Egesi CN, Onyeka TJ, Asiedu R (2009). Environmental stability of.

  14. Molecular variability analyses of Apple chlorotic leaf spot virus ...

    Indian Academy of Sciences (India)

    Individual recombination analysis for all the pome and stone fruit isolates was also carried out. Plum isolates indicated possible minor parenting by Indian isolates. (India17, 18) for P863 (AAA42589), PBM1 (CAB46654) and major parenting for SX/2 (AAF67188), French (NP_. 040553) isolates with SX/2 and P863 isolates, ...

  15. The G6. A heavy-duty, six-wheeled shunting locomotive

    Energy Technology Data Exchange (ETDEWEB)

    Hildebrandt, Tim [Vossloh Locomotives GmbH, Kiel (Germany). Development and Standardisation Group

    2010-05-15

    Nowadays, railway operating companies need robust, reliable and versatile locomotives. Vossloh has shown one way that future developments are likely to go with its 'G6' six-wheeled shunting locomotive, which features a central driver's cab. (orig.)

  16. 49 CFR 229.137 - Sanitation, general requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Sanitation, general requirements. 229.137 Section... Cab Equipment § 229.137 Sanitation, general requirements. (a) Sanitation compartment. Except as provided in paragraph (b) of this section, all lead locomotives in use shall be equipped with a sanitation...

  17. 49 CFR 229.139 - Sanitation, servicing requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Sanitation, servicing requirements. 229.139... Cab Equipment § 229.139 Sanitation, servicing requirements. (a) The sanitation compartment of each... present that prevents waste from evacuating the bowl. (c) The sanitation compartment of each occupied...

  18. Calumenin interacts with serum amyloid P component

    DEFF Research Database (Denmark)

    Vorum, H; Jacobsen, Christian; Honoré, Bent

    2000-01-01

    of the secretory pathway that include reticulocalbin, ERC-55, Cab45 and crocalbin. In order to further investigate the extracellular functions of calumenin we immobilized the recombinant protein to a column. After application of a placental tissue extract we were able to elute one protein that interacts...

  19. ORF Alignment: NC_003116 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003116 gi|15794632 >1kmoA 124 661 358 944 2e-08 ... emb|CAB84967.1| lactoferrin bi...nding protein A [Neisseria meningitidis Z2491] ... ref|NP_284454.1| lactoferrin binding protein A ... ... ... [Neisseria meningitidis Z2491] pir||C81798 lactoferrin ... binding protein A NMA1739 [importe

  20. An Economic Evaluation of Voriconazole versus Amphotericin B for the Treatment of Invasive Aspergillosis in Canada

    Directory of Open Access Journals (Sweden)

    Coleman Rotstein

    2004-01-01

    Full Text Available BACKGROUND: Invasive aspergillosis (IA is a serious fungal infection that affects immunocompromised patients. The Global Comparative Aspergillosis study demonstrated that voriconazole, a new broad-spectrum triazole, had better responses and improved survival compared with conventional amphotericin B deoxycholate (CAB and other licensed antifungal therapy (OLAT for the treatment of definite or probable aspergillosis.

  1. Thermodynamic, Kinetic, and Equilibrium Parameters for the Removal of Lead and Cadmium from Aqueous Solutions with Calcium Alginate Beads

    Science.gov (United States)

    Alfaro-Cuevas-Villanueva, Ruth; Hidalgo-Vázquez, Aura Roxana; Cortés Penagos, Consuelo de Jesús; Cortés-Martínez, Raúl

    2014-01-01

    The sorption of cadmium (Cd) and lead (Pb) by calcium alginate beads (CAB) from aqueous solutions in batch systems was investigated. The kinetic and thermodynamic parameters, as well as the sorption capacities of CAB in each system at different temperatures, were evaluated. The rate of sorption for both metals was rapid in the first 10 minutes and reached a maximum in 50 minutes. Sorption kinetic data were fitted to Lagergren, pseudo-second-order and Elovich models and it was found that the second-order kinetic model describes these data for the two metals; comparing kinetic parameters for Cd and Pb sorption a higher kinetic rate (K 2) for Pb was observed, indicating that the interaction between lead cations and alginate beads was faster than for cadmium. Similarly, isotherm data were fitted to different models reported in literature and it was found that the Langmuir-Freundlich (L-F) and Dubinin-Radushkevich (D-R) models describe the isotherms in all cases. CAB sorption capacity for cadmium was 27.4 mg/g and 150.4 mg/g for lead, at 25°C. Sorption capacities of Cd and Pb increase as temperature rises. According to the thermodynamic parameters, the cadmium and lead adsorption process was spontaneous and endothermic. It was also found that pH has an important effect on the adsorption of these metals by CAB, as more were removed at pH values between 6 and 7. PMID:24587740

  2. A cost effective topology migration path towards fibre

    NARCIS (Netherlands)

    Phillipson, F.

    2013-01-01

    If an operator has as starting position a Full Copper topology in which ADSL or VDSL is offered from the Central Office, the next choice he has to make is to provide Full FttH or use an other topology option, e.g. FttCab, first as intermediate step to provide a next generation service package. In

  3. "I Always Wanted to Be a Hero." Life without Parole

    Science.gov (United States)

    Roth, Angela M.

    2013-01-01

    In this article, the author recalls her face-to-face meeting with a prison inmate. Paul Jensen is currently serving a life sentence without parole in South Dakota for a crime committed at age 14. In January 1996, Paul was involved in a robbery that went tragically wrong and resulted in the shooting death of taxi cab driver Michael Hare. Three…

  4. The Reliability of the Warsaw Treaty Organization: Can the Soviet Union Depend on Its Northern Tier Allies?

    Science.gov (United States)

    1985-03-01

    Czechoslovakia L-29/39 C zechos lo- (trainer acft.) vak ia TS-11 (Iskra) Poland (trainer acit.) LI-2 CAB Poland (reed. transport acft.) IL-14/1411... reactors and other ehuipment for use domesti- cally and by other COMECON members in the production of nuclear power plants. In late 1978, the first

  5. Identification and typing of the yeast strains isolated from bili bili, a ...

    African Journals Online (AJOL)

    Owner

    1983; Chu et al., 1986) using the Yeast Identification software of. Barnett (Barnett et al., 1996). Molecular identification .... Validation of the strains conventionally identified as. K. marxianus. According to previous work ..... African fermented foods nutrition CAB International (Ed.) Université presse, Cambridge, Great Britain. pp ...

  6. 49 CFR 229.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... strength of the member are not considered to be cracked. Cruise control means a device that controls... hour is NOT considered a “cruise control” for purposes of this part. Data element means one or more... used in the administration and upkeep service of a commuter railroad. Control cab locomotive means a...

  7. iron and vitamin a status of breastfeeding mothers in zambia

    African Journals Online (AJOL)

    Capacity (TIBC) and Haemoglobin. 1° 2° 3° '0 5° 6°. Serum/blood analysis: Vitamin A and vitamin A2 were VltamlnAtug/dL) analysed by HPLC(17) and iron and TIBC by colorimetry. (CTMA/CAB with acetate buffer)( 1 8). Haemoglobin estimations were performed on a Haemoglobinometer (isoton, Figurez. Zapoglobin)(19).

  8. Resource use and cost of treatment with voriconazole or conventional amphotericin B for invasive aspergillosis.

    Science.gov (United States)

    Wingard, J R; Herbrecht, R; Mauskopf, J; Schlamm, H T; Marciniak, A; Roberts, C S

    2007-09-01

    Voriconazole, a broad-spectrum triazole, has demonstrated significantly improved survival compared with conventional amphotericin B (CAB) as initial therapy for invasive aspergillosis (IA). To compare health care resource use and cost at 12 weeks following first-line treatment with voriconazole compared with CAB for IA using resource use data collected during a clinical trial. Days of hospitalization, intensive care, antifungal drug use, and outpatient care were collected during a large randomized, controlled trial of patients with IA receiving initial treatment with voriconazole or CAB. Unit costs based on published data sources were applied to healthcare use to estimate 12-week costs following initiation of therapy. Resource use and costs were compared for each treatment arm overall and by survival. The sensitivity of total costs to changes in healthcare use and unit costs was examined. Total hospital days and intensive care unit (ICU) days were similar for voriconazole and CAB (total: 27.8 vs. 27.7, P=0.97 and ICU: 5.6 vs. 8.1, P=0.11). Among survivors, voriconazole was associated with similar numbers of total hospital days (29.8 vs. 32.0 days, P=0.54) to CAB, but fewer ICU days (3.9 vs. 8.2, P=0.03). For non-survivors, those treated with voriconazole had a similar number of total hospital days (23.0 vs. 21.8, P=0.73) and ICU days (9.8 vs. 7.9, P=0.44). Patients treated with voriconazole had significantly more days alive and out of the hospital than with CAB at 12 weeks (40.3 vs. 28.4 days, P<0.001). Total costs were similar with voriconazole compared with CAB ($78,860 vs. $83,857, P=0.51). Differences in cost were not sensitive to changes in the input parameter values. Using voriconazole first-line for treatment of IA resulted in significantly fewer deaths and similar treatment costs. Hospital-free survival was significantly greater for patients initially treated with voriconazole.

  9. APPLICATION OF CHEMICALLY ACCELERATED BIOTREATMENT TO REDUCE RISKIN OIL-IMPACTED SOILS

    Energy Technology Data Exchange (ETDEWEB)

    J.R. Paterek; W.W.Bogan; V. Trbovic; W. Sullivan

    2003-01-07

    The drilling and operation of gas/petroleum exploratory wells and the operations of natural gas and petroleum production wells generate a number of waste materials that are usually stored and/or processed at the drilling/operations site. Contaminated soils result from drilling operations, production operations, and pipeline breaks or leaks where crude oil and petroleum products are released into the surrounding soil or sediments. In many cases, intrinsic biochemical remediation of these contaminated soils is either not effective or is too slow to be an acceptable approach. This project targeted petroleum-impacted soil and other wastes, such as soil contaminated by: accidental release of petroleum and natural gas-associated organic wastes from pipelines or during transport of crude oil or natural gas; production wastes (such as produced waters, and/or fuels or product gas). Our research evaluated the process designated Chemically-Accelerated Biotreatment (CAB) that can be applied to remediate contaminated matrices, either on-site or in situ. The Gas Technology Institute (GTI) had previously developed a form of CAB for the remediation of hydrocarbons and metals at Manufactured Gas Plant (MGP) sites and this research project expanded its application into Exploration and Production (E&P) sites. The CAB treatment was developed in this project using risk-based endpoints, a.k.a. environmentally acceptable endpoints (EAE) as the treatment goal. This goal was evaluated, compared, and correlated to traditional analytical methods (Gas Chromatography (GC), High Precision Liquid Chromatography (HPLC), or Gas Chromatography-Mass Spectrometry (CGMS)). This project proved that CAB can be applied to remediate E&P contaminated soils to EAE, i.e. those concentrations of chemical contaminants in soil below which there is no adverse affect to human health or the environment. Conventional approaches to risk assessment to determine ''how clean is clean'' for soils

  10. Efficacy and safety of rapid escalation of cabergoline in comparison to conventional regimen for macroprolactinoma: A prospective, randomized trial

    Directory of Open Access Journals (Sweden)

    Ashu Rastogi

    2012-01-01

    Full Text Available Introduction: Cabergoline (CAB is conventionally started at a dose of 0.25-0.5 mg once a week with dose escalation at 1to 3months intervals. Previously, we and others have shown that rapid escalation and high doses of CAB can lead to normalization of serum PRL as early as 8.2 weeks in 93% of the patients. We hypothesize that rapid escalation of CAB doses, may help in both the earlier normalization of PRL and also significant shrinkage of tumor mass. Study Design: Randomized, prospective, interventional trial. Subjects and Methods: Forty two patients (male or female with macroprolactinoma were randomized to conventional (group A or rapid escalation (group B of CAB dosing. In group B, CAB was started at a dose of 0.5 mg twice a week followed by a weekly hike of 1 mg/week, based on serum PRL and then monthly. The end point of the present study was a composite of normoprolactinemia and tumor shrinkage ≥50% from baseline. PRL and visual field analysis (weekly, other hormonal work up periodically and magnetic resonance imaging (sella was performed monthly. Results: A total of 19 patients in each group completed a minimum follow-up of 6 months. There was a reduction of 72.7 ± 26.2% in group A and 84.1 ± 15.0 in group B (P = 0.24 within a week of CAB therapy. The duration of CAB treatment to normalize PRL was 10.2 ± 9.2 week(2-36 in group A and 7.2 ± 6.2 weeks(1-24 in group B (P = 0.28. There was no difference in the tumor shrinkage in either of the groups (92.3% [46.7-100%] in group A and 90.5% [66.6-100%] reduction in group B. The composite end point was achieved in 14 patients in group A (73.6% and 16 patients in group B (84.2% (P = 0.69. The composite end point was achieved in 13.1 ± 9.5 weeks (group A versus 16.5 ± 14.1 weeks (group B (P = 0.61. Discussion: This is first head to head comparative trial showing that a rapid hike of CAB dose is not associated with earlier normalization of PRL or reduction in tumor volume as compared to

  11. The effect of branding on consumer palatability ratings of beef strip loin steaks.

    Science.gov (United States)

    Wilfong, A K; McKillip, K V; Gonzalez, J M; Houser, T A; Unruh, J A; Boyle, E A E; O'Quinn, T G

    2016-11-01

    The objective of this study was to determine the influence of knowing the brand or USDA grade on consumer palatability ratings of beef strip loin steaks. Strip loins were selected to represent 5 USDA grades and brands, USDA Select, Choice, Prime, Certified Angus Beef (CAB; upper 2/3 Choice), and Select, from carcasses of cattle classified as Angus on the basis of phenotype. After 21 d of aging, 2.5-cm-thick steaks were cut, consecutively cut steaks were paired for consumer evaluation. Consumer panelists ( = 112) evaluated samples for tenderness, juiciness, flavor liking, and overall liking. Additionally, consumers rated each palatability trait as either acceptable or unacceptable. Samples were fed in 2 rounds on the same day: blind and informed testing. In the first round, blind testing, consumers were served 1 sample from each treatment, with no product information provided. In the second round, consumers were informed of the brand or quality grade prior to sampling. During blind testing, CAB rated similar ( > 0.05) to Choice for all palatability traits; however, CAB rated greater ( 0.05) for all traits when tested blind, but Angus Select was rated greater ( brand was declared. When comparing blind and informed ratings, Angus Select and CAB had greater ( brand disclosure. However, ratings for Choice and Select samples were unaffected ( > 0.05) when brand was disclosed. Brand knowledge increased ( 0.05) in the percentage of Choice and Select samples rated as acceptable for all palatability traits. These data indicate that Prime, CAB, and Angus Select steaks receive an increase in consumer palatability perception, or "brand lift," which does not occur for Choice and Select beef.

  12. MOTORCYCLE-PROPELLED PUBLIC TRANSPORT AND LOCAL POLICY DEVELOPMENT

    Directory of Open Access Journals (Sweden)

    Marie Danielle V. GUILLEN

    2004-01-01

    Full Text Available In most developing countries, motorcycles are part of the essential mode of transportation. In the case of the Philippines, local public transport in the form of tricycles as well as “habal-habal”, or “motorcycle taxi” exists. This paper reviewed the local transport policy development with regards to innovating motorcycles as tricycles or using motorcycles as a public transport mode. It assumes that motorcycle-propelled public transport precedes the development of local public transport policy. Davao City is chosen as the site for the case study since a wide variation of motorcycle-innovations can be observed. Philippine tricycle is classified as a motor vehicle composed of motorcycle fitted with a single wheel sidecar or with a two-wheel cab, operated as a public transport for a fee. In Davao City, three forms of tricycles can be observed: side-cab, center-cab and open cab. An emerging mode, in the form of motorcycle taxi known as “habal-habal” can also be found. The study shows that the presence of various motorcycle-propelled public transport in Davao City is attributed to inadequacy of either national or local policy that defines its operation and physical design. The policy response of eliminating “triciboat” and the presence of private motorcycle credit facility led to the emergence of informal and illegal modes like the “habal-habal” and open-cab tricycles. The issues and gaps in policy implementation and the importance of relating policies to local urban and transportation planning and management were discussed.

  13. Estimating leaf photosynthetic pigments information by stepwise multiple linear regression analysis and a leaf optical model

    Science.gov (United States)

    Liu, Pudong; Shi, Runhe; Wang, Hong; Bai, Kaixu; Gao, Wei

    2014-10-01

    Leaf pigments are key elements for plant photosynthesis and growth. Traditional manual sampling of these pigments is labor-intensive and costly, which also has the difficulty in capturing their temporal and spatial characteristics. The aim of this work is to estimate photosynthetic pigments at large scale by remote sensing. For this purpose, inverse model were proposed with the aid of stepwise multiple linear regression (SMLR) analysis. Furthermore, a leaf radiative transfer model (i.e. PROSPECT model) was employed to simulate the leaf reflectance where wavelength varies from 400 to 780 nm at 1 nm interval, and then these values were treated as the data from remote sensing observations. Meanwhile, simulated chlorophyll concentration (Cab), carotenoid concentration (Car) and their ratio (Cab/Car) were taken as target to build the regression model respectively. In this study, a total of 4000 samples were simulated via PROSPECT with different Cab, Car and leaf mesophyll structures as 70% of these samples were applied for training while the last 30% for model validation. Reflectance (r) and its mathematic transformations (1/r and log (1/r)) were all employed to build regression model respectively. Results showed fair agreements between pigments and simulated reflectance with all adjusted coefficients of determination (R2) larger than 0.8 as 6 wavebands were selected to build the SMLR model. The largest value of R2 for Cab, Car and Cab/Car are 0.8845, 0.876 and 0.8765, respectively. Meanwhile, mathematic transformations of reflectance showed little influence on regression accuracy. We concluded that it was feasible to estimate the chlorophyll and carotenoids and their ratio based on statistical model with leaf reflectance data.

  14. Mechanical Demolition of Buildings with Concrete Asbestos Board Siding: Methodology, Precautions, and Results at the Hanford Central Plateau - 12417

    Energy Technology Data Exchange (ETDEWEB)

    Kehler, Kurt [Decommissioning and Demolition, CH2M HILL Plateau Remediation Company, Richland, Washington (United States)

    2012-07-01

    Since the start of its contract in 2008, the CH2M Hill Plateau Remediation Company (CH2M HILL) has demolished 25 buildings with concrete asbestos board (CAB) siding using mechanical means. While the asbestos contained in CAB siding is not friable in its manufactured form, concerns persist that mechanical methods of demolition have the potential to render the asbestos friable and airborne, therefore posing a health risk to demolition workers and the public. CH2M HILL's experience demonstrates that when carefully managed, mechanical demolition of CAB siding can be undertaken safely, successfully, and in compliance with regulatory requirements for the disposal of Class II Asbestos-Containing Material (ACM). While the number of buildings demolished at Hanford and the number of samples collected does not make a conclusive argument that CAB cannot be made friable with normal demolition techniques, it certainly provides a significant body of evidence for the success of the approach. Of course, there are many factors that affect how to demolish a structure and dispose of the waste. These factors will impact the success depending on each site. The most obvious factors which contribute to this success at Hanford are: 1. The availability of onsite waste disposal where the handling and cost of asbestos-containing waste is not much different than other potentially contaminated waste. Therefore, segregation of demolition debris from the potential asbestos contamination is not necessary from a debris handling or asbestos disposal aspect. 2. The space between structures is typically significant enough to allow for large exclusion zones. There are not many restrictions due to cohabitation issues or potential contamination of adjacent facilities. 3. The willingness of the regulators and client to understand the industrial safety issues associated with manual CAB removal. (authors)

  15. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase over the South Coast Air Basin of California

    Directory of Open Access Journals (Sweden)

    B. Barletta

    2011-03-01

    Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr−1 for HFC-152a and 2.12 ± 0.28 Gg yr−1 for HFC-134a and then extrapolated to the United States (32 ± 4 Gg yr−1 for HFC-152a and 43 ± 6 Gg yr−1 for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.

  16. Combined abdominal aortic aneurysm repair and coronary artery bypass: presentation of 13 cases and review of the literature.

    Science.gov (United States)

    Wolff, Thomas; Baykut, Doan; Zerkowski, Hans-Reinhand; Stierli, Peter; Gürke, Lorenz

    2006-01-01

    Coronary artery disease remains the major cause of perioperative mortality after abdominal aortic aneurysm (AAA) repair. The beneficial effect of coronary artery bypass (CAB) before AAA repair in patients with severe coronary artery disease has been proven. The coexistence of a very large or symptomatic AAA and coronary artery disease remains a therapeutic challenge since there is the risk of AAA rupture in the interval between CAB and AAA repair. Combined CAB and aortic aneurysm repair has been suggested for these cases, and results on several series of patients have been published. However, the exact indication for the combined operation remains to be clarified. We present a series of 13 patients who underwent CAB on cardiopulmonary bypass and aortic aneurysm repair as a one-stage procedure. The indication was a large AAA in seven patients and a symptomatic AAA in six patients. In four patients, the aortic reconstruction was performed without the use of cardiopulmonary bypass; in nine patients, the aortic reconstruction was performed under partial cardiopulmonary bypass. Thirty-day mortality was 15%. Major morbidity was 31%. All major complications were due to excessive bleeding and occurred in patients who had AAA repair performed with partial cardiopulmonary bypass, suggesting that prolonged bypass time represents a major source of morbidity. A detailed review of the literature is presented. From the evidence available we suggest that the combined procedure can be recommended only for patients with very high rupture risk, such as in symptomatic AAA. In all other cases, the staged approach--CAB followed by AAA repair 2-4 weeks later--is preferable. During the combined procedure, cardiopulmonary bypass support during AAA repair should be used only in patients with clear evidence of hemodynamic instability.

  17. Asymmetric pulsation of rat carotid artery bifurcation in three-dimension observed by ultrasound imaging.

    Science.gov (United States)

    Jin, Changzhu; Nam, Kweon-Ho; Paeng, Dong-Guk

    2016-10-01

    The arterial structure cyclically fluctuates in three-dimensions (3-D) caused by pulsatile blood flow. The evaluation of arterial wall motion and hemodynamics contributes to early diagnosis of carotid atherosclerosis. Ultrasound is one of the most appropriate imaging modalities to evaluate arterial wall motion in real time. Although many previous studies have discussed the mechanical properties of the carotid artery bifurcation (CAB) from the two-dimensional (2-D) view, the spatio-temporal variation of carotid artery geometry in 3-D has not yet been investigated in detail. In this study, the 3-D data set of CAB from rats was acquired using a high spatio-temporal resolution ultrasound imaging system with a 40 MHz probe using mechanical sector scanning. A total of 31 slices of cross-section images were stored and a spoke scan algorithm was implemented to radially scan the lumen area in polar coordinates based on a pre-tracked seed point. The boundary of the arterial lumen was segmented using intensity-threshold-based boundary detection and fitted by polynomial regression. Two operators, who were trained with the same protocol to minimize inter- and intra-operator variability, manually segmented the lumen boundary on systolic and diastolic phase from the gray-scale images. Finally, the 3-D lumen geometries of CAB during one cardiac cycle were constructed based on the segmented lumen boundaries. From this constructed 3-D geometry, we observed that the CAB geometry favorably expanded to the anterior/posterior direction, parallel to the sagittal plane; and the manually segmented geometry also confirmed the asymmetrical change in bifurcation geometry. This is the first study on visualization and quantification on the asymmetrical variation of the CAB geometry of a rat in 3-D during a whole cardiac cycle. This finding may be useful in understanding hemodynamic etiology of various cardiovascular diseases such as arterial stenosis and its complications, and also provides

  18. Autoimmune Fibrotic Adverse Reactions in One-Year Treatment with Cabergoline for Women with Prolactinoma.

    Science.gov (United States)

    Doğan, Berçem Ayçiçek; Arduc, Ayse; Tuna, Mazhar Müslüm; Berker, Dilek; Demirci, Nilgün; Demirtaş, Semra; Çiçekcioğlu, Hülya; Güler, Serdar

    2016-01-01

    Cabergoline is related to an elevated risk of fibrotic adverse reactions including cardiac valvular and pleuropulmonary fibrosis. We investigated pulmonary and cardiac valve fibrosis and immunological markers before and after 3 and 12 months of treatment with cabergoline in women with prolactinoma. The study included thirty-two women with newly diagnosed prolactinoma and 28 healthy women. CAB cumulative dose was 7.8±5.5 mg after 3-month therapy, and 31±22 mg after 12-month follow-up. The risk of autoimmune adverse fibrotic reactions related to CAB treatment including cardiac valvulopathy and pulmonary fibrosis were assessed by a transthoracic echocardiography and pulmonary function tests, respectively. Immunological markers including Antistreptolysin O, Rheumatoid factor, Immunglobuline E, Antinuchlear antibody were also evaluated. Before the start of CAB therapy, the total prevalence of trace grade of mitral, aortic, pulmonic, and tricuspid valve regurgitations were found as 34%, 3%, 6.3%, and 39 % respectively in women with prolactinoma. After improving of prolactin levels with CAB treatment, no change was found in the prevalence of the all valve regurgitations. There was no deterioration in pulmonary function tests. Rheumatoid factor was found higher in newly diagnosed women with prolactinoma than in healthy women (p=0.01), and this was improved by CAB therapy (p=0.005). The prospective study indicated that sufficient cabergoline doses for a period of one year treatment of prolactinoma were not found to be related to fibrotic adverse reactions including cardiac valvular and pulmonary fibrosis or increased levels of immunological marker, apart from rheumatoid factor. For the first time Rf was found higher in newly diagnosed women with prolactinoma and was improved after cabergoline therapy.

  19. Current drug withdrawal strategy in prolactinoma patients treated with cabergoline: a systematic review and meta-analysis.

    Science.gov (United States)

    Hu, Jintao; Zheng, Xin; Zhang, Weihua; Yang, Hui

    2015-10-01

    Cabergoline is a recommended first-line dopamine agonist for prolactinoma treatment, which is withdrawable for some cases. However, the optimal withdrawal strategy and the accurate recurrence rate associated with cabergoline withdrawal remains uncertain. To assess the current recurrence rate of hyperprolactinemia and possible favorable factors associated with cabergoline withdrawal in prolactinoma patients. The databases of PubMed, EMBASE, and Web of Science were searched up to May 2014 to identify studies containing data of recurrent hyperprolactinemia in prolactinoma patients after cabergoline withdrawal. Meta-analysis, including sensitivity analysis, meta-regression analysis, and subgroup analysis were performed. When the patients who received cabergoline withdrawal were pooled, it was found that the hyperprolactinemia recurrence rate was 65% by a random effects meta-analysis [95% confidence interval 55-74%]. In a random effects meta-regression adjusting for optimal withdrawal strategies, CAB dose reduced to the lowest level before withdrawal was associated with treatment success (p = 0.006), whereas CAB treatment longer than 2 years showed no trend of effect (p = 0.587). Patients who received the lowest CAB dose and presented a significant reduction in tumor size before withdrawal were more likely to achieve the best success (p cabergoline withdrawal in a majority of patients. The probability of success favors patients who have achieved normoprolactinemia and considerable reduction in tumor size by low dose of cabergoline treatment. In addition, our study further suggests that a beneficial strategy is associated with tapering CAB dose before withdrawal but not with CAB treatment duration longer than 2 years.

  20. [Budget impact analysis of antiplatelet therapy with ticagrelor and clopidogrel in patients with acute coronary syndrome after coronary artery bypass surgery].

    Science.gov (United States)

    Zyryanov, S K; Belousov, D Yu; Afanasyeva, E V; Dumchenko, E V

    Clinical and economic examinations were made to study whether it is appropriate to use antiplatelet therapy (APT) with ticagrelor in combination with acetylsalicylic acid (ASA) versus a combination of clopidogrel and ASA in patients with acute coronary syndrome (ACS) following coronary artery bypass surgery (CABS). A budget impact analysis was used. Data on the efficiency and safety of APT were taken from a relevant analysis in the subgroups of the randomized controlled trial PLATO. Direct medical cost due to APT and expenses on therapy for acute myocardial infarction, stroke, and massive bleeding, and those on medical care for patients dying from cardiovascular events and other causes, as well as indirect cost - gross domestic product (GDP) losses due to untimely death, were taken into account. The findings were assessed from the perspectives of society. The analysis indicated that direct medical costs per patient following CABS, both in case of calculation based on the recorded price for ticagrelor and on the median registered prices for clopidogrel generics, and based on the auction prices for comparison agents proved to be lower when clopidogrel was administered because of the higher cost of ticagrelor-based APT. At the same time GDP losses due to untimely death, as calculated per patient with ACS during post-CABS therapy with clopidogrel + ASA, were more than twice above average losses per patient taking ticagrelor in combination with ACA (107,122 and 221,645 rubles, respectively). From the registered price for ticagrelor and the median registered prices for clopidogrel generics, the total costs per patient with ACS following CABS were lower if Brilinta was used in combination with ASA versus therapy with clopidogrel in combination with ASA (210,092 and 273,257 rubles per year, respectively; the cost savings were 63,165 rubles per patient per year when ticagrelor was administered). On the basis of the auction prices for comparison drugs, the total costs per

  1. Short communication: The effects of cabergoline administration at dry-off of lactating cows on udder engorgement, milk leakages, and lying behavior.

    Science.gov (United States)

    Bach, A; De-Prado, A; Aris, A

    2015-10-01

    Cabergoline is an ergot derivative with high affinity for the D2 dopamine receptors whose dopaminergic effects cause inhibition of prolactin (PRL) secretion; thus, it could be considered a molecule that acts as a potential dry-off facilitator. One hundred ninety-nine Holstein cows (102 primiparous; 97 multiparous) producing ≥ 18 kg/d at dry-off were split in 2 treatments to evaluate the effects of diminishing PRL secretion at dry-off (between 70 and 50 d from the expecting calving date) on udder engorgement, milk leakage, and cow well-being after dry-off. Treatments consisted of a single i.m. injection of 5 mL of a solution containing 5.6 mg of cabergoline (CAB; Velactis, Ceva Santé Animal, Libourne, France) or 5 mL of saline solution as a placebo (CTRL). Each animal was evaluated for presence or absence of milk leakages during the 4 d following dry-off and udder engorgement was determined using a digital algometer. Lying behavior was recorded during 10 d after dry-off. Twenty-five cows from each treatment were randomly chosen and blood sampled at 3 and 15 d after dry-off, and again at 5 and 3 d before the expected calving date to determine serum PRL concentrations. Cows on CAB had lower serum PRL concentrations than cows on CTRL at 3 and 15 d after dry-off. Average udder engorgement was lower for cows on CAB than for cows on CTRL following dry-off, and it decreased as days after dry-off increased. The overall incidence of milk leakage in cows on CAB (3.1 ± 0.88%) was 73.5% of that obtained in cows on CTRL (11.7 ± 1.64%); cows on CAB had 0.2 lower odds of incurring milk leakage than cows on CTRL. The day following dry-off, CAB cows lied about 1.5h/d more than cows on CTRL. We conclude that i.m. administration of 5.6 mg of cabergoline at dry-off effectively reduces PRL secretion, udder engorgement, and milk leakages, and improves lying time the day following dry-off. Copyright © 2015 American Dairy Science Association. Published by Elsevier Inc. All rights

  2. Lanthanide, yttrium, and zirconium anomalies in the Fire Clay coal bed, Eastern Kentucky

    Science.gov (United States)

    Hower, J.C.; Ruppert, L.F.; Eble, C.F.

    1999-01-01

    The Fire Clay coal bed in the Central Appalachian basin region contains a laterally-persistent tonstein that is found in the coal throughout most of its areal extent. The tonstein contains an array of minerals, including sanidine, ??-quartz, anatase and euhedral zircon, thhat constitutes strong evidence for a volcanic origin of the parting. For this study, five samples of the tonstein and four sets of coal samples underlying the tonstein were collected from five sites in eastern Kentucky. Inductively coupled plasma-mass spectroscopy (ICP-MS) analysis of the tonstein and underlying coal collected from four sites in eastern Kentucky show that although Zr concentrations are high in the tonstein (570-1820 ppm on a coal-ash basis (cab)), they are highest in the coal directly underlying the tonstein (2870-4540 ppm (cab)). A similar enrichment pattern is observed in the concentration of Y plus the sum of the rare earth elements (Y + ??REE): total Y + ??REE concentrations in the five tonstein samples range from 511 to 565 ppm (cab). However, Y + ??REE contents are highest in the coals directly underlying the tonsteins: values range from 1965 to 4198 ppm (cab). Scanning electron microscopy of samples from coal which directly underlies two of the tonstein samples show that REE-rich phosphate, tentatively identified as monazite, commonly infills cracks in clays and cells in clarain and vitrain. Zircon is rare and commonly subhedral. On the basis of coal chemistry and grain morphology, we suggest that volcanic components in the tonstein were leached by ground water. The leachate, rich in Y and REE precipitated as authigenic mineral phases in the underlying coal.The Fire Clay coal bed in the Central Appalachian basin region contains a laterally-persistent tonstein that is found in the coal throughout most of its areal extent. The tonstein contains an array of minerals, including sanidine, ??-quartz, anatase and euhedral zircon, that constitutes strong evidence for a volcanic

  3. Vibroacoustic characteristics of mine locomotives

    Energy Technology Data Exchange (ETDEWEB)

    Chigirinskii, S.E.; Ponomarev, N.S.; Leiman, Ya.A.

    1982-11-01

    The paper discusses noise pollution caused by locomotives used for mine haulage in underground mining. Noise pollution in a mine working and at the driver working place is measured. Mechanical vibrations of the floor in the driver cab are also determined. Noise pollution and mechanical vibrations of 3 locomotive types are comparatively evaluated: the AM-8D electric locomotive, the GR-4 inertia-type locomotive and the 1D-8 diesel locomotive. The results of investigations are shown in 2 tables. The inertia-type locomotive causes the most intensive noise pollution. Noise pollution of the diesel locomotive has been successfully suppressed by a system of shock absorbers. The following methods for noise and vibration control are discussed: use of soundproof cabs, damping vibrations at the driver's seat, use of motors with noise abatement systems and shock absorbers. (In Russian)

  4. Computational Acoustic Beamforming for Noise Source Identification for Small Wind Turbines

    Directory of Open Access Journals (Sweden)

    Ping Ma

    2017-01-01

    Full Text Available This paper develops a computational acoustic beamforming (CAB methodology for identification of sources of small wind turbine noise. This methodology is validated using the case of the NACA 0012 airfoil trailing edge noise. For this validation case, the predicted acoustic maps were in excellent conformance with the results of the measurements obtained from the acoustic beamforming experiment. Following this validation study, the CAB methodology was applied to the identification of noise sources generated by a commercial small wind turbine. The simulated acoustic maps revealed that the blade tower interaction and the wind turbine nacelle were the two primary mechanisms for sound generation for this small wind turbine at frequencies between 100 and 630 Hz.

  5. Utilization, cycling and vertical transport of particulate organic matter in the coastal marine environment. Final project report, November 15, 1987--May 14, 1992

    Energy Technology Data Exchange (ETDEWEB)

    Landry, M.R.

    1992-10-01

    This project was funded as part of the California Basin Study (CaBS), a DOE-funded regional program investigating production, cycling, transport, and fate of organic matter, chemical tracers, and pollutants in the Southern California Bight. The study area, adjacent to Los Angeles, was of programmatic interest due to its heavy concentration of energy-related activities, including offshore oil drilling and natural seeps, shipping, nuclear power facilities, and industrial and municipal ocean waste disposal. It was also of scientific interest because the wide continental margin in the region, pot-marked with natural sediment traps in the form of deep basins with restricted inputs and outputs, was ideal for integrating water-column and benthic studies and tracing the fates of in situ production and introduced pollutants. Our role in the CABS Program was to investigate the flux of particulate matter through the water column, emphasizing the relationship between macrozooplankton feeding and particle flux.

  6. Utilization, cycling and vertical transport of particulate organic matter in the coastal marine environment

    Energy Technology Data Exchange (ETDEWEB)

    Landry, M.R.

    1992-01-01

    This project was funded as part of the California Basin Study (CaBS), a DOE-funded regional program investigating production, cycling, transport, and fate of organic matter, chemical tracers, and pollutants in the Southern California Bight. The study area, adjacent to Los Angeles, was of programmatic interest due to its heavy concentration of energy-related activities, including offshore oil drilling and natural seeps, shipping, nuclear power facilities, and industrial and municipal ocean waste disposal. It was also of scientific interest because the wide continental margin in the region, pot-marked with natural sediment traps in the form of deep basins with restricted inputs and outputs, was ideal for integrating water-column and benthic studies and tracing the fates of in situ production and introduced pollutants. Our role in the CABS Program was to investigate the flux of particulate matter through the water column, emphasizing the relationship between macrozooplankton feeding and particle flux.

  7. Avoiding the Health Hazard of People from Construction Vehicles: A Strategy for Controlling the Vibration of a Wheel Loader.

    Science.gov (United States)

    Chi, Feng; Zhou, Jun; Zhang, Qi; Wang, Yong; Huang, Panling

    2017-03-08

    The vibration control of a construction vehicle must be carried out in order to meet the aims of sustainable environmental development and to avoid the potential human health hazards. In this paper, based on market feedback, the driver seat vibration of a type of wheel loader in the left and right direction, is found to be significant over a certain speed range. In order to find abnormal vibration components, the order tracking technique (OTT) and transmission path analysis (TPA) were used to analyze the vibration sources of the wheel loader. Through this analysis, it can be seen that the abnormal vibration comes from the interaction between the tire tread and the road, and this is because the vibration was amplified by the cab mount, which was eventually transmitted to the cab seat. Finally, the seat vibration amplitudes were decreased by up to 50.8%, after implementing the vibration reduction strategy.

  8. Gene : CBRC-MMUS-04-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-04-0019 4 A Odorant/olfactory and gustatory receptors O13J1_HUMAN 1e-145 ...82% ref|NP_062359.1| olfactory receptor 71 [Mus musculus] emb|CAB55597.1| olfactory receptor [Mus musculus] ...emb|CAB96152.1| olfactory receptor [Mus musculus] gb|AAL60904.1| olfactory receptor MOR262-4 [Mus musculus] ...gb|AAP70821.1| olfactory receptor Olfr71 [Mus musculus] emb|CAM17056.1| olfactory receptor 71 [Mus mus...culus] gb|AAI41883.1| Olfactory receptor 71 [Mus musculus] gb|AAI41893.1| Olfactory receptor 71 [Mus musculus

  9. Computational Acoustic Beamforming for Noise Source Identification for Small Wind Turbines.

    Science.gov (United States)

    Ma, Ping; Lien, Fue-Sang; Yee, Eugene

    2017-01-01

    This paper develops a computational acoustic beamforming (CAB) methodology for identification of sources of small wind turbine noise. This methodology is validated using the case of the NACA 0012 airfoil trailing edge noise. For this validation case, the predicted acoustic maps were in excellent conformance with the results of the measurements obtained from the acoustic beamforming experiment. Following this validation study, the CAB methodology was applied to the identification of noise sources generated by a commercial small wind turbine. The simulated acoustic maps revealed that the blade tower interaction and the wind turbine nacelle were the two primary mechanisms for sound generation for this small wind turbine at frequencies between 100 and 630 Hz.

  10. Computational Acoustic Beamforming for Noise Source Identification for Small Wind Turbines

    Science.gov (United States)

    Lien, Fue-Sang

    2017-01-01

    This paper develops a computational acoustic beamforming (CAB) methodology for identification of sources of small wind turbine noise. This methodology is validated using the case of the NACA 0012 airfoil trailing edge noise. For this validation case, the predicted acoustic maps were in excellent conformance with the results of the measurements obtained from the acoustic beamforming experiment. Following this validation study, the CAB methodology was applied to the identification of noise sources generated by a commercial small wind turbine. The simulated acoustic maps revealed that the blade tower interaction and the wind turbine nacelle were the two primary mechanisms for sound generation for this small wind turbine at frequencies between 100 and 630 Hz. PMID:28378012

  11. Combining Coarse-Grained Protein Models with Replica-Exchange All-Atom Molecular Dynamics

    Directory of Open Access Journals (Sweden)

    Andrzej Koliński

    2013-05-01

    Full Text Available We describe a combination of all-atom simulations with CABS, a well-established coarse-grained protein modeling tool, into a single multiscale protocol. The simulation method has been tested on the C-terminal beta hairpin of protein G, a model system of protein folding. After reconstructing atomistic details, conformations derived from the CABS simulation were subjected to replica-exchange molecular dynamics simulations with OPLS-AA and AMBER99sb force fields in explicit solvent. Such a combination accelerates system convergence several times in comparison with all-atom simulations starting from the extended chain conformation, demonstrated by the analysis of melting curves, the number of native-like conformations as a function of time and secondary structure propagation. The results strongly suggest that the proposed multiscale method could be an efficient and accurate tool for high-resolution studies of protein folding dynamics in larger systems.

  12. Development of a Faith-Based Stress Management Intervention in a Rural African American Community.

    Science.gov (United States)

    Bryant, Keneshia; Moore, Todd; Willis, Nathaniel; Hadden, Kristie

    2015-01-01

    Faith-based mental health interventions developed and implemented using a community-based participatory research (CBPR) approach hold promise for reaching rural African Americans and addressing health disparities. To describe the development, challenges, and lessons learned from the Trinity Life Management, a faith-based stress management intervention in a rural African American faith community. The researchers used a CBPR approach by partnering with the African American faith community to develop a stress management intervention. Development strategies include working with key informants, focus groups, and a community advisory board (CAB). The community identified the key concepts that should be included in a stress management intervention. The faith-based "Trinity Life Management" stress management intervention was developed collaboratively by a CAB and an academic research team. The intervention includes stress management techniques that incorporate Biblical principles and information about the stress-distress-depression continuum.

  13. Dicty_cDB: Contig-U01696-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 06 ) JGI_CAAT5803.fwd CAAT Pimephales promelas brain 7... 32 9.9 2 ( DT306380 ) JGI_CAAW13698.fwd CAAW Pimephales promelas... testis... 32 9.9 2 ( DT234216 ) JGI_CAAT8046.fwd CAAT Pimephales promelas brain 7... 32 9.9 2... ( DT244324 ) JGI_CAAT13553.fwd CAAT Pimephales promelas brain ... 32 9.9 2 ( DT242053 ) JGI_CAAT12297.fwd CAAT Pimephales promelas... brain ... 32 9.9 2 ( DT287604 ) JGI_CAAW701.fwd CAAW Pimephales promelas...9 2 ( DT350940 ) JGI_CABS548.fwd CABS Pimephales promelas kidney 7... 32 9.9 2 ( DE878060 ) Macropus eugenii

  14. Fairing Well: Aerodynamic Truck Research at NASA Dryden Flight Research Center. From Shoebox to Bat Truck and Beyond

    Science.gov (United States)

    Gelzer, Christian

    2011-01-01

    In 1973 engineers at Dryden began investigating ways to reduce aerodynamic drag on land vehicles. They began with a delivery van whose shape they changed dramatically, finally reducing its aerodynamic drag by more than 5 percent. They then turned their attention to tracator-trailers, modifying a cab-over and reducing its aerodynamic drag by nearly 25 percent. Further research identified additional areas worth attention, but in the intervening decades few of those changes have appeared.

  15. Untitled

    African Journals Online (AJOL)

    Les nids de Cab/termes spp. présentent également de fortes teneurs en azote organique total, carbone organique total, matière organique et une C.E.C. plus élevée que le sol environnant. Ces carac- téristiques chimiques correspondent à celles des nids décrits par Tano (1993) à. Booro—Borotou. Par contre, la teneur en.

  16. ORF Alignment: NC_003076 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Arabidopsis thaliana] emb|CAC10523.1| transparent testa ... glabra 1 protein [Arabidopsis tha...ent testa glabra 1 protein (TTG1) [Arabidopsis ... thaliana] ref|NP_851070.1| transparent... testa glabra 1 ... protein (TTG1) [Arabidopsis thaliana] ref|NP_851069.1| ... transparent...liana] emb|CAB45372.1| ... Ttg1 protein [Arabidopsis thaliana] ref|NP_197840.1| ... transpar

  17. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available [Arabidopsis thaliana] emb|CAC10523.1| transparent testa ... glabra 1 protein [Arabidopsis thaliana] ...emb|CAB45372.1| ... Ttg1 protein [Arabidopsis thaliana] ref|NP_197840.1| ... transparent... testa glabra 1 protein (TTG1) [Arabidopsis ... thaliana] ref|NP_851070.1| transparent... testa glabra 1 ... protein (TTG1) [Arabidopsis thaliana] ref|NP_851069.1| ... transparent

  18. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available [Arabidopsis thaliana] emb|CAC10523.1| transparent testa ... glabra 1 protein [Arabidopsis thaliana]... emb|CAB45372.1| ... Ttg1 protein [Arabidopsis thaliana] ref|NP_197840.1| ... transparent... testa glabra 1 protein (TTG1) [Arabidopsis ... thaliana] ref|NP_851070.1| transparent... testa glabra 1 ... protein (TTG1) [Arabidopsis thaliana] ref|NP_851069.1| ... transparent

  19. Preliminary technical data summary No. 3 for the Defense Waste Processing Facility

    Energy Technology Data Exchange (ETDEWEB)

    Landon, L.F. (comp.)

    1980-05-01

    This document presents an update on the best information presently available for the purpose of establishing the basis for the design of a Defense Waste Processing Facility. Objective of this project is to provide a facility to fix the radionuclides present in Savannah River Plant (SRP) high-level liquid waste in a high-integrity form (glass). Flowsheets and material balances reflect the alternate CAB case including the incorporation of low-level supernate in concrete. (DLC)

  20. Land tenure conflicts and their management in the 5th region of Mali

    OpenAIRE

    Maïga, I.; Diallo, G.

    1998-01-01

    Metadata only record This study of land tenure conflict and its management in the 5th region of Mali describes the land tenure problems and the forms taken by land tenure disputes. It presents case studies of conflict between communities and discusses the causes of land tenure disputes, different ways of settling land tenure disputes (settlement by customary law, state intervention), actors involved in conflict resolution and prevention, and possible solutions to the problem. -CAB Abstract

  1. Longshoring Industry

    Science.gov (United States)

    2001-01-01

    dynamometer or simple scale alone will not meet this requirement; or (B) Indications in the cab according to the radius and load at the moment; or (C)A...visible to the operator, except that the use of a dynamometer or simple scale alone will not meet this requirement; or (B) An automatic weight-moment...head, chest, shoulder, arm, leg, wrist , elbow, foot, ankle, fingers, toes, and knee. 2. Splinting of the arm, elbow, clavicle, fingers, hand, forearm

  2. A New Look at the Code of Conduct

    Science.gov (United States)

    1974-04-01

    When the Pueblo continued under way, the North Korean vessels opened fire, striking the ship with cannon shells . Bucher stopped the ship, ordered...crewman received fatal injuries, two others were seriously wounded, and several others, including Bucher, were struck by shell fragments. The Pueblo was...often kept apart from the cthers in solitary confinement. Prisoners were fed two meals each day, usually consisting of pumpkin or cab- bage soup, rice

  3. Gene : CBRC-ETEL-01-1184 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-1184 Novel UN A Adrenergic receptors ADRB2_BOVIN 0.0 85% ref|NP_776656.1| adrene...rgic, beta-2-, receptor, surface [Bos taurus] sp|Q28044|ADRB2_BOVIN Beta-2 adrenergic receptor (Be...ta-2 adrenoceptor) (Beta-2 adrenoreceptor) emb|CAB06661.1| beta-2-adrenergic receptor [Bos taurus] gb|AAI14133.1| Adrene...WLGYVNSAFNPLIYCRSPDFRIAFQELLCLQKASLKALGNGCSSNSNDKSDYAAALSSYHLGQERENEPLGEDRPGTQDFVNCQGTVPNDSIDSRGRNCRTSDSLL ...

  4. Using a community advisory board to develop a serious game for older adults undergoing treatment for cancer.

    Science.gov (United States)

    Loerzel, Victoria; Clochesy, John; Geddie, Patricia

    2018-02-01

    Older adults undergoing treatment for cancer are at risk for serious complications such as chemotherapy-induced nausea and vomiting (CINV). Older adults are often overwhelmed by information and under-manage cancer treatment-related side effects. New educational strategies such as serious gaming may help teach or reinforce key symptom self-management strategies. This paper describes how a community advisory board of older adults, their caregivers, and oncology nurses were consulted to develop a serious game for CINV. A formative evaluation process using a community advisory board (CAB) and a series of three focus groups were used to develop this serious game about managing CINV at home. The formative evaluation process and involvement of the CAB allowed researchers to learn about the experience of having CINV from an older adult perspective. Common themes related to CINV onset, severity and self-management formed the basis for the serious games' script and scenarios. Themes were validated and CAB members provided feedback on a game prototype. Feedback from CAB members indicated that the serious game was realistic and reflective of their CINV experience. Including older adults in the development of a serious game was instrumental in creating a relevant educational opportunity. Serious gaming should be considered as a way to add to the educational experiences of older adults as generic teaching methods may not address the needs of all age groups. Exploring for new ways to emphasize key points related to symptom management and prioritize learning may impact outcomes for older adults. Copyright © 2017 Elsevier Inc. All rights reserved.

  5. Genes differentially expressed in Theobroma cacao associated with resistance to witches' broom disease caused by Crinipellis perniciosa.

    Science.gov (United States)

    Leal, Gildemberg Amorim; Albuquerque, Paulo S B; Figueira, Antonio

    2007-05-01

    SUMMARY The basidiomycete Crinipellis perniciosa is the causal agent of witches' broom disease of Theobroma cacao (cocoa). Hypertrophic growth of infected buds ('brooms') is the most dramatic symptom, but the main economic losses derive from pod infection. To identify cocoa genes differentially expressed during the early stages of infection, two cDNA libraries were constructed using the suppression subtractive hybridization (SSH) approach. Subtraction hybridization was conducted between cDNAs from infected shoot-tips of the susceptible genotype 'ICS 39' and the resistant 'CAB 214', in both directions. A total of 187 unique sequences were obtained, with 83 from the library enriched for the susceptible 'ICS 39' sequences, and 104 for the resistant 'CAB 214'. By homology search and ontology analyses, the identified sequences were mainly putatively categorized as belonging to 'signal transduction', 'response to biotic and abiotic stress', 'metabolism', 'RNA and DNA metabolism', 'protein metabolism' and 'cellular maintenance' classes. Quantitative reverse transcription amplification (RT-qPCR) of 23 transcripts identified as differentially expressed between genotypes revealed distinct kinetics of gene up-regulation at the asymptomatic stage of the disease. Expression induction in the susceptible 'ICS 39' in response to C. perniciosa was delayed and limited, while in 'CAB 214' there was a quicker and more intense reaction, with two peaks of gene induction at 48 and 120 h after inoculation, corresponding to morphological and biochemical changes previously described during colonization. Similar differences in gene induction were validated for another resistant genotype ('CAB 208') in an independent experiment. Validation of these genes corroborated similar hypothetical mechanisms of resistance described in other pathosystems.

  6. Electrorheological (ER) Fluids: A Research Needs Assessment

    Science.gov (United States)

    1993-05-01

    arising from charges on the particles and modified by the presence and distribution of free ions. Magnetorheological (MR) fluids undergo strong...separate control of cab and trailer motions is probably the way to go. Other automotive uses that may come in the near future include vibration dampers ...this work used very simple fluids offering less than optimum performance, but provided some useful guidelines to damper and clutch design using ER fluids

  7. Biopolymer as an Alternative to Petroleum-based Polymers to Control Soil Erosion: Iowa Army Ammunition Plant

    Science.gov (United States)

    2013-11-01

    Parking brakes will be engaged when equipment is not in use. Seat belts and Rollover Protective Structures (ROPS) will be provided and used on...Water tank trucks with tank height less than the cab; and • Self-propelled construction equipment such as front-end loaders, backhoes, rollers , and...site not open to public traffic, shall have a service brake system and a parking brake system capable of stopping and holding the equipment fully

  8. MicroRNA-451 exacerbates lipotoxicity in cardiac myocytes and high-fat diet-induced cardiac hypertrophy in mice through suppression of the LKB1/AMPK pathway.

    Science.gov (United States)

    Kuwabara, Yasuhide; Horie, Takahiro; Baba, Osamu; Watanabe, Shin; Nishiga, Masataka; Usami, Shunsuke; Izuhara, Masayasu; Nakao, Tetsushi; Nishino, Tomohiro; Otsu, Kinya; Kita, Toru; Kimura, Takeshi; Ono, Koh

    2015-01-16

    In some patients with type 2 diabetes mellitus (DM) without hypertension, cardiac hypertrophy and attenuated cardiac function are observed, and this insult is termed diabetic cardiomyopathy. To date, microRNA (miRNAs or miR) functions in diabetic cardiomyopathy remain to be elucidated. To clarify the functions of miRNAs involved in diabetic cardiomyopathy caused by type 2 DM. C57BL/6 mice were fed a high-fat diet (HFD) for 20 weeks, which induced obesity and type 2 DM. miRNA microarray analyses and real-time polymerase chain reaction revealed that miR-451 levels were significantly increased in the type 2 DM mouse hearts. Because excess supply of saturated fatty acids is a cause of diabetic cardiomyopathy, we stimulated neonatal rat cardiac myocytes with palmitic acid and confirmed that miR-451 expression was increased in a dose- and time-dependent manner. Loss of miR-451 function ameliorated palmitate-induced lipotoxicity in neonatal rat cardiac myocytes. Calcium-binding protein 39 (Cab39) is a scaffold protein of liver kinase B1 (LKB1), an upstream kinase of AMP-activated protein kinase (AMPK). Cab39 was a direct target of miR-451 in neonatal rat cardiac myocytes and Cab39 overexpression rescued the lipotoxicity. To clarify miR-451 functions in vivo, we generated cardiomyocyte-specific miR-451 knockout mice. HFD-induced cardiac hypertrophy and contractile reserves were ameliorated in cardiomyocyte-specific miR-451 knockout mice compared with control mice. Protein levels of Cab39 and phosphorylated AMPK were increased and phosphorylated mammalian target of rapamycin (mTOR) was reduced in cardiomyocyte-specific miR-451 knockout mouse hearts compared with control mouse hearts. Our results demonstrate that miR-451 is involved in diabetic cardiomyopathy through suppression of the LKB1/AMPK pathway. © 2014 American Heart Association, Inc.

  9. Quantifying Molecular Hydrogen Emissions and an Industrial Leakage Rate for the South Coast Air Basin of California

    Science.gov (United States)

    Irish, M. C.; Schroeder, J.; Beyersdorf, A. J.; Blake, D. R.

    2015-12-01

    The poorly understood atmospheric budget and distribution of molecular hydrogen (H2) have invited further research since the discovery that emissions from a hydrogen-based economy could have negative impacts on the global climate system and stratospheric ozone. The burgeoning fuel cell electric vehicle industry in the South Coast Air Basin of California (SoCAB) presents an opportunity to observe and constrain urban anthropogenic H2 emissions. This work presents the first H2 emissions estimate for the SoCAB and calculates an upper limit for the current rate of leakage from production and distribution infrastructure within the region. A top-down method utilized whole air samples collected during the Student Airborne Research Program (SARP) onboard the NASA DC-8 research aircraft from 23-25 June 2015 to estimate H2 emissions from combustion and non-combustion sources. H2:carbon monoxide (CO) and H2:carbon dioxide ratios from airborne observations were compared with experimentally established ratios from pure combustion source ratios and scaled with the well-constrained CO emissions inventory to yield H2 emissions of 24.9 ± 3.6 Gg a-1 (1σ) from combustion engines and 8.2 ± 4.7 Gg a-1 from non-combustion sources. Total daily production of H2 in the SoCAB was compared with the top-down results to estimate an upper limit leakage rate (5%) where all emissions not accounted for by incomplete combustion in engines were assumed to be emitted from H2 infrastructure. For bottom-up validation, the NOAA Hybrid Single Particle Lagrangian Integrated Trajectory dispersion model was run iteratively with all known stationary sources in attempt to constrain emissions. While this investigation determined that H2 emissions from non-combustion sources in the SoCAB are likely significant, more in-depth analysis is required to better predict the atmospheric implications of a hydrogen economy.

  10. Fire Safety Aspects of Polymeric Materials. Volume 8. Land Transportation Vehicles

    Science.gov (United States)

    1979-01-01

    capacity, will con- tinue to be employed as the suppressing agent for many fire situations. Water, steam, and fogging nozzles are designed to achieve...Polyurethane foam 307 Cab »hell Epoxy/fibarglaaa 2B3 Window glaztng itript Chloroprene h CHS Rubber 308 Sealants Polyaulfide 115 Electrical imulatton...against the pavement . 7. Smoldering of cigarettes or other smoking materials. Sufficient oxygen is usually available for the fire. Table 2 provides

  11. After the Crash: The Passenger Response to the DC-10 Disaster

    OpenAIRE

    Arnold Barnett; Anthony J. Lofaso

    1983-01-01

    Through the analysis of CAB market-share data, an attempt is made to estimate the extent to which fears arising from the Chicago DC-10 crash displaced passenger traffic onto other kinds of aircraft. Factors that could distort simple "before-after" comparisons are discussed and a procedure to correct for them is proposed. The results suggest that, less than a year after the accident, there was no detectable resistance to flying the DC-10.

  12. Quantifying the loss of processed natural gas within California's South Coast Air Basin using long-term measurements of ethane and methane

    Directory of Open Access Journals (Sweden)

    D. Wunch

    2016-11-01

    Full Text Available Methane emissions inventories for Southern California's South Coast Air Basin (SoCAB have underestimated emissions from atmospheric measurements. To provide insight into the sources of the discrepancy, we analyze records of atmospheric trace gas total column abundances in the SoCAB starting in the late 1980s to produce annual estimates of the ethane emissions from 1989 to 2015 and methane emissions from 2007 to 2015. The first decade of measurements shows a rapid decline in ethane emissions coincident with decreasing natural gas and crude oil production in the basin. Between 2010 and 2015, however, ethane emissions have grown gradually from about 13 ± 5 to about 23 ± 3 Gg yr−1, despite the steady production of natural gas and oil over that time period. The methane emissions record begins with 1 year of measurements in 2007 and continuous measurements from 2011 to 2016 and shows little trend over time, with an average emission rate of 413 ± 86 Gg yr−1. Since 2012, ethane to methane ratios in the natural gas withdrawn from a storage facility within the SoCAB have been increasing by 0.62 ± 0.05 % yr−1, consistent with the ratios measured in the delivered gas. Our atmospheric measurements also show an increase in these ratios but with a slope of 0.36 ± 0.08 % yr−1, or 58 ± 13 % of the slope calculated from the withdrawn gas. From this, we infer that more than half of the excess methane in the SoCAB between 2012 and 2015 is attributable to losses from the natural gas infrastructure.

  13. Long-Haul Truck Sleeper Heating Load Reduction Package for Rest Period Idling: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Lustbader, Jason; Kekelia, Bidzina; Tomerlin, Jeff; Kreutzer, Cory; Adelman, Steve; Yeakel, Skip; Luo, Zhiming; Zehme, John

    2016-03-24

    Annual fuel use for sleeper cab truck rest period idling is estimated at 667 million gallons in the United States, or 6.8% of long-haul truck fuel use. Truck idling during a rest period represents zero freight efficiency and is largely done to supply accessory power for climate conditioning of the cab. The National Renewable Energy Laboratory's CoolCab project aims to reduce heating, ventilating, and air conditioning (HVAC) loads and resulting fuel use from rest period idling by working closely with industry to design efficient long-haul truck thermal management systems while maintaining occupant comfort. Enhancing the thermal performance of cab/sleepers will enable smaller, lighter, and more cost-effective idle reduction solutions. In addition, if the fuel savings provide a one- to three-year payback period, fleet owners will be economically motivated to incorporate them. For candidate idle reduction technologies to be implemented by original equipment manufacturers and fleets, their effectiveness must be quantified. To address this need, several promising candidate technologies were evaluated through experimentation and modeling to determine their effectiveness in reducing rest period HVAC loads. Load reduction strategies were grouped into the focus areas of solar envelope, occupant environment, conductive pathways, and efficient equipment. Technologies in each of these focus areas were investigated in collaboration with industry partners. The most promising of these technologies were then combined with the goal of exceeding a 30% reduction in HVAC loads. These technologies included 'ultra-white' paint, advanced insulation, and advanced curtain design. Previous testing showed more than a 35.7% reduction in air conditioning loads. This paper describes the overall heat transfer coefficient testing of this advanced load reduction technology package that showed more than a 43% reduction in heating load. Adding an additional layer of advanced insulation

  14. Long-Haul Truck Sleeper Heating Load Reduction Package for Rest Period Idling

    Energy Technology Data Exchange (ETDEWEB)

    Lustbader, Jason Aaron; Kekelia, Bidzina; Tomerlin, Jeff; Kreutzer, Cory J.; Yeakel, Skip; Adelman, Steven; Luo, Zhiming; Zehme, John

    2016-04-05

    Annual fuel use for sleeper cab truck rest period idling is estimated at 667 million gallons in the United States, or 6.8% of long-haul truck fuel use. Truck idling during a rest period represents zero freight efficiency and is largely done to supply accessory power for climate conditioning of the cab. The National Renewable Energy Laboratory's CoolCab project aims to reduce heating, ventilating, and air conditioning (HVAC) loads and resulting fuel use from rest period idling by working closely with industry to design efficient long-haul truck thermal management systems while maintaining occupant comfort. Enhancing the thermal performance of cab/sleepers will enable smaller, lighter, and more cost-effective idle reduction solutions. In addition, if the fuel savings provide a one- to three-year payback period, fleet owners will be economically motivated to incorporate them. For candidate idle reduction technologies to be implemented by original equipment manufacturers and fleets, their effectiveness must be quantified. To address this need, several promising candidate technologies were evaluated through experimentation and modeling to determine their effectiveness in reducing rest period HVAC loads. Load reduction strategies were grouped into the focus areas of solar envelope, occupant environment, conductive pathways, and efficient equipment. Technologies in each of these focus areas were investigated in collaboration with industry partners. The most promising of these technologies were then combined with the goal of exceeding a 30% reduction in HVAC loads. These technologies included 'ultra-white' paint, advanced insulation, and advanced curtain design. Previous testing showed more than a 35.7% reduction in air conditioning loads. This paper describes the overall heat transfer coefficient testing of this advanced load reduction technology package that showed more than a 43% reduction in heating load. Adding an additional layer of advanced insulation

  15. HOWLS LOCATER Computer Program: Description and User’s Guide

    Science.gov (United States)

    1978-12-26

    estimated. Thec initial ization is i1q)leimieted in stimrout ine TrAM ’ which is coq~osed of 4I parts. ~ 1*1. Determine the initial state vector, X, which is...AICNS. MONTE CARLO RUN NUREIR I x y z VX VY YZ KD KS WE RN Di DY DZ DVX DVW DVZ DKI DKS DWI DUN RB A ED DB A B C DRD CAB DEB DDB DA DB DC CTOTAL

  16. Small Strain Accompanied by Moderate Rotation

    Science.gov (United States)

    1981-08-01

    Arlington. VA 22217 SS 14. MONITORING AGENC, NAME & ADDRESS(’I different tram Controlling Office) IS. SECURITY CLASS. (*I thli report) Unclassified...a 8 c , (A2) S b T3 - (a eb® c) = cab ® a for any vector a,b,c 6 V, and we note that the definition (A2) 3 involves 43. ’-- *k L’± e.. the

  17. B-1 Systems Approach to Training. Volume 2. Appendix A. Cost Details

    Science.gov (United States)

    1975-07-01

    Guide. SAT- 4 Training Resources Analytic Model ( TRAM ). User’s Manual. SAT- 5 Training Resources Analytic Model ( TRAM ). Programmer’s Manual. SAT...concepts are based on TRAM (Training Resources Analytic Model) and the quick-look version TROLIE (Training Resources Organized for Logical Integration...ith individual instructional blocks and the schedules. |^ "^ "§?J week are chosen so that the average trainee will Ta^ly bl Cab elo fol o

  18. Dynamics of Rigid Guns with Straight Tubes

    Science.gov (United States)

    1983-02-01

    NUMBEROF PAGES 92 14.l A4ENC’ - AI& o~i-ss(1Trfir•’ee’ tram con roling office) IS. SECURITY CLASS. (o1 It to- UNCLASSIFIED IS.. OECLASSI FICATION...following identity can be verified: A x (B xc) = BA C- CA B (C-15) This may be memorized as the "Back- Cab " formula. The vector product is useful for

  19. DIVWAG Model Documentation. Volume II. Programmer/Analyst Manual. Part 3. Chapter 7 Through 8.

    Science.gov (United States)

    1976-07-01

    the transport system. If the transport system has no upper box--the cab and body of a truck would be considered as all being in the lower box--these...RATIO (TITO) ETEPR4IlE THE SIZEI THE COU!lTERl1EASU E [VICE (CfMT’I, CHiq hDETER41IE PK AT ELLEY A𔃻D AT TRAM ~ (PYrB, PKT) j 8 IV-7-B-245 CA CULATE PROM

  20. Expression of the entire polyhydroxybutyrate operon ofRalstonia eutrophain plants.

    Science.gov (United States)

    Mozes-Koch, Rita; Tanne, Edna; Brodezki, Alexandra; Yehuda, Ran; Gover, Ofer; Rabinowitch, Haim D; Sela, Ilan

    2017-01-01

    Previously we demonstrated that an entire bacterial operon (the PRN operon) is expressible in plants when driven by the Tomato -yellow-leaf-curl-virus (TYLCV) -derived universal vector IL-60.Petroleum-derived plastics are not degradable, and are therefore harmful to the environment. Fermentation of bacteria carrying operons for polyhydroxyalkanoates (PHAs) produces degradable bioplastics which are environmentally friendly. However, bacterial production of bioplastics is not cost-effective, and attention is turning to their production in plants. Such "green" plastics would be less expensive and environmentally friendly. Hence, attempts are being made to substitute petroleum-derived plastics with "green" plastics. However, transformation of plants with genes of operons producing bioplastics has deleterious effects. Transformation of plastids does not cause deleterious effects, however it is a complicated procedures. We have developed another TYLCV-based vector (SE100) and show that yet another bacterial operon (the phaCAB operon) when driven by SE100 is also expressed in plants. We employed the combination of SE100 and the phaCAB operon to drive the operon to the plastids and produce in plants a biodegradable plastic [polyhydroxybutyrate (PHB)].Here we indicate that the bacterial operon (phaCAB), when driven by the newly developed universal plant vector SE100 is directed to chloroplasts and produces in plants PHB, a leading PHA. The PHB-producing plants circumvent the need for complicated technical procedures. The viral vector system SE100 facilitated the production of the bio-plastic poly-3-hydroxybutyrate. This was achieved by using the full pha-CAB operon indicating that TYLCV based system can transcribe and translate genes from bacterial operons controlled by a single cis element. Our data hints to the participation of the chloroplasts in these processes.

  1. Desert Environmental Handbook. First Edition

    Science.gov (United States)

    1977-11-01

    21 3 Alix I SECTION 4. DESERT OPERATIONS Par’e 4.1 Heat Stress . . . . . . . . . . . . . ...... ...... . .. . . 4.2...0F)Surface Temperatures Floor Board : ¾-ton Truck 60^5 0 C 1410F 8-ton Goer 65 C 149OF Inside Cab: 8-ton Goer 57.20C 1350F Accelerator Pedal: ¾-ton...Experience in WWII, MS#P-129. 135 *)! Desert Effects (continued) Desert Convoy--Report of Environmental Operation, US Army Trans- portation Board

  2. Well-Child Care Clinical Practice Redesign for Serving Low-Income Children

    OpenAIRE

    Coker, Tumaini R.; Moreno, Candice; Shekelle, Paul G.; Schuster, Mark A.; Chung, Paul J.

    2014-01-01

    Our objective was to conduct a rigorous, structured process to create a new model of well-child care (WCC) in collaboration with a multisite community health center and 2 small, independent practices serving predominantly Medicaid-insured children. Working groups of clinicians, staff, and parents (called “Community Advisory Boards” [CABs]) used (1) perspectives of WCC stakeholders and (2) a literature review of WCC practice redesign to create 4 comprehensive WCC models for children ages 0 to ...

  3. Seventh Symposium on Subtypes of Musccarinic Receptors.

    Science.gov (United States)

    1997-01-01

    1015 Con ’t on next page INDEXED IN: Current Contents, CABS, BIOSIS Database, Index Medicus, MEDLINE , Psychol. Abstr., Nutr. Abstr., Energy...Fischmeister Laboratoire de Cardiologie Cellulaire et Mol~culaire, INSERM U446, Universit6 de Paris-Sud, Facult6 de Pharmacie, F-92296 Chatenay-Malabry...Science sible for selected synaptic deficits in Citation Index, MEDLINE , MEDLARS, Alzheimer’s disease. Excerpta Medica, Current Awareness in Biological

  4. NCBI nr-aa BLAST: CBRC-ATHA-04-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ATHA-04-0002 ref|NP_192254.1| ankyrin repeat family protein [Arabidopsis thali...ana] gb|AAD11587.1| hypothetical protein [Arabidopsis thaliana] emb|CAB77830.1| hypothetical protein [Arabid...opsis thaliana] gb|AAV91330.1| At4g03450 [Arabidopsis thaliana] gb|AAW30039.1| At4g03450 [Arabidopsis thaliana] NP_192254.1 3e-86 45% ...

  5. Pregled in analiza izbranih podatkovnih zbirk ter predmetnih oznak za področje lesarskih znanosti in tehnologije

    OpenAIRE

    Bartol, Tomaž

    2007-01-01

    Uporabniki morajo znati identificirati najrelevantnejše vire kakovostnih znanstvenih in tehničnih informacij. Razumeti morajo strukturo zbirk, iskalne tehnike, kontroliran besednjak, terminologijo in klasifikacijske sheme. V članku podajamo glavne značilnosti bibliografskih podatkovnih zbirk (Agricola,Agris, Cab Abstracts (CABI), Compendex, Inspec, Iconda), statističnih zbirk (Eurostat, Faostat) in zbirk tehničnih dokumentov - standardov in patentov (ISO, WIPO) glede na značilnosti lesarstva ...

  6. Kapak ve İçindekiler

    Directory of Open Access Journals (Sweden)

    Kapak ve İçindekiler

    2016-04-01

    Full Text Available Bu dergi, aşağıda listelenen veri tabanları tarafından taranmaktadır / This journal is indexed by the following abstracting and indexing databasesBASE, CAB Abstracts, CAS (Chemical Abstracts Service, DOAJ, EBSCO Discovery Service (EDS, Google Scholar, JournalTOCs, OAJI, ResearchBib, Ulakbim TR Dizin (Mühendislik ve Temel Bilimler, WorldCat (OCLC, Zentralblatt MATH

  7. Kapak ve İçindekiler

    Directory of Open Access Journals (Sweden)

    Kapak İçindekiler

    2016-08-01

    Full Text Available Bu dergi, aşağıda listelenen veri tabanları tarafından taranmaktadır / This journal is indexed by the following abstracting and indexing databasesBASE, CAB Abstracts, CAS (Chemical Abstracts Service, CiteFactor, DOAJ, DRJI, EBSCO Discovery Service (EDS, Google Scholar, JournalTOCs, OAJI, ResearchBib, Ulakbim TR Dizin (Mühendislik ve Temel Bilimler, WorldCat (OCLC, Zentralblatt MATH

  8. Julie Rovner?s Health Care Policy and Politics A to Z: a review

    OpenAIRE

    Berry-Caban, Cris

    2010-01-01

    Cristóbal S Berry-CabánWomack Army Medical Center, Fort Bragg, NC, USAAbstract: Drawing on her vast experience covering health care policy on Capitol Hill, Julie Rovner has written explanations for over 300 key concepts that demystify the world of United States Government health care policy. In the newest edition of Health Care Policy and Politics A to Z, readers will find updated information on long-term health care spending, abortion, Medicaid and Medicare, health insu...

  9. POESIA E FANTASIA: RIMAS POBRES E RIMAS RICAS

    Directory of Open Access Journals (Sweden)

    Ana Vicentini de Azevedo

    2014-09-01

    Full Text Available  Que relações podem ser estabelecidasentre o fazer poético e a noção de fantasia,tal qual elaborada inicialmente porFreud e desenvolvida pro Lacan? Nessaaproximação, privilegiamos o filme deFederico Fellini, Noites de Cabíria, comolócus de exploração de algumas ressonânciasentre arte e psicanálise. 

  10. NCBI nr-aa BLAST: CBRC-MMUR-01-0992 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0992 ref|NP_001094506.1| alpha 10 subunit of nicotinic acetylcholine r...t alpha-10; AltName: Full=Nicotinic acetylcholine receptor subunit alpha 10; Short=NACHR alpha 10; AltName: ...Full=Alpha 10 nAChR; Flags: Precursor emb|CAB99482.1| alpha 10 subunit of nicotinic acetylcholine receptor [Gallus gallus] NP_001094506.1 6e-39 84% ...

  11. Cosmic axion background propagation in galaxies

    Directory of Open Access Journals (Sweden)

    Francesca V. Day

    2016-02-01

    Full Text Available Many extensions of the Standard Model include axions or axion-like particles (ALPs. Here we study ALP to photon conversion in the magnetic field of the Milky Way and starburst galaxies. By modelling the effects of the coherent and random magnetic fields, the warm ionized medium and the warm neutral medium on the conversion process, we simulate maps of the conversion probability across the sky for a range of ALP energies. In particular, we consider a diffuse cosmic ALP background (CAB analogous to the CMB, whose existence is suggested by string models of inflation. ALP–photon conversion of a CAB in the magnetic fields of galaxy clusters has been proposed as an explanation of the cluster soft X-ray excess. We therefore study the phenomenology and expected photon signal of CAB propagation in the Milky Way. We find that, for the CAB parameters required to explain the cluster soft X-ray excess, the photon flux from ALP–photon conversion in the Milky Way would be unobservably small. The ALP–photon conversion probability in galaxy clusters is 3 orders of magnitude higher than that in the Milky Way. Furthermore, the morphology of the unresolved cosmic X-ray background is incompatible with a significant component from ALP–photon conversion. We also consider ALP–photon conversion in starburst galaxies, which host much higher magnetic fields. By considering the clumpy structure of the galactic plasma, we find that conversion probabilities comparable to those in clusters may be possible in starburst galaxies.

  12. AN ANALYSIS OF CIVIL AERONAUTICS BOARD POLICY CONCERNING AIRLINE MERGERS.

    Science.gov (United States)

    The study determines and analyzes the Civil Aeronautics Board’s policy concerning airline mergers . This is accomplished by: (1) tracing the...evolution of statutory authority granted the Board to regulate airline mergers ; (2) analyzing specific decisions of the Board to determine Board policy...condition of the carriers involved in the mergers . Conclusions are that (1) the CAB was given statutory authority by Congress because of realization that

  13. NCBI nr-aa BLAST: CBRC-TTRU-01-0085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0085 ref|YP_002737606.1| hypothetical protein SPP_0390 [Streptococcus ...pneumoniae P1031] emb|CAB05926.1| unknown [Streptococcus pneumoniae] emb|CAI32705.1| oligosaccharide repeat unit polymerase Wzy [Stre...ptococcus pneumoniae] emb|CAI30300.1| oligosaccharide repeat unit polymerase Wzy [Streptococcus... pneumoniae] gb|ACO21593.1| membrane protein, putative [Streptococcus pneumoniae P1031] YP_002737606.1 0.001 25% ...

  14. Assessing the Potential of Societal Verification by Means of New Media

    Science.gov (United States)

    2014-01-01

    target those reported materials? Even in instances where terrorism is unlikely, skeptics are also right to remind us that unskilled and amateur ...microblogging service, and Flickr, a photo -sharing web site could easily be re-identified on the anonymous data stream Twitter provides to advertisers.36...Marketing Photo of the Chinese WS51200 A marketing photograph online depicted a chassis of this type with only a cab attached. One previously unresolved

  15. The Bacillus subtilis and Bacillus halodurans Aspartyl-tRNA Synthetases Retain Recognition of tRNA(Asn).

    Science.gov (United States)

    Nair, Nilendra; Raff, Hannah; Islam, Mohammed Tarek; Feen, Melanie; Garofalo, Denise M; Sheppard, Kelly

    2016-02-13

    Synthesis of asparaginyl-tRNA (Asn-tRNA(Asn)) in bacteria can be formed either by directly ligating Asn to tRNA(Asn) using an asparaginyl-tRNA synthetase (AsnRS) or by synthesizing Asn on the tRNA. In the latter two-step indirect pathway, a non-discriminating aspartyl-tRNA synthetase (ND-AspRS) attaches Asp to tRNA(Asn) and the amidotransferase GatCAB transamidates the Asp to Asn on the tRNA. GatCAB can be similarly used for Gln-tRNA(Gln) formation. Most bacteria are predicted to use only one route for Asn-tRNA(Asn) formation. Given that Bacillus halodurans and Bacillus subtilis encode AsnRS for Asn-tRNA(Asn) formation and Asn synthetases to synthesize Asn and GatCAB for Gln-tRNA(Gln) synthesis, their AspRS enzymes were thought to be specific for tRNA(Asp). However, we demonstrate that the AspRSs are non-discriminating and can be used with GatCAB to synthesize Asn. The results explain why B. subtilis with its Asn synthetase genes knocked out is still an Asn prototroph. Our phylogenetic analysis suggests that this may be common among Firmicutes and 30% of all bacteria. In addition, the phylogeny revealed that discrimination toward tRNA(Asp) by AspRS has evolved independently multiple times. The retention of the indirect pathway in B. subtilis and B. halodurans likely reflects the ancient link between Asn biosynthesis and its use in translation that enabled Asn to be added to the genetic code. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  16. Safety of long-term treatment with cabergoline on cardiac valve disease in patients with prolactinomas.

    Science.gov (United States)

    Auriemma, Renata S; Pivonello, Rosario; Perone, Ylenia; Grasso, Ludovica F S; Ferreri, Lucia; Simeoli, Chiara; Iacuaniello, Davide; Gasperi, Maurizio; Colao, Annamaria

    2013-09-01

    Cabergoline (CAB) has been found to be associated with increased risk of cardiac valve regurgitation in Parkinson's disease, whereas several retrospective analyses failed to detect a similar relation in hyperprolactinemic patients. The current study aimed at investigating cardiac valve disease before and after 24 and 60 months of continuous treatment with CAB only in patients with hyperprolactinemia. Forty patients (11 men and 29 women, aged 38.7 ± 12.5 years) newly diagnosed with hyperprolactinemia entered the study. Cumulative CAB dose ranged from 12 to 588 mg (median 48 mg) at 24 months and 48-1260 mg (median 149 mg) at 60 months. All patients underwent a complete trans-thoracic echocardiographic examination. Valve regurgitation was assessed according to the American Society of Echocardiography. At baseline, the prevalence of trace mitral, aortic, pulmonic, and tricuspid regurgitations was 20, 2.5, 10, and 40% respectively, with no patient showing clinically relevant valvulopathy. After 24 months, no change in the prevalence of trace mitral (P=0.78) and pulmonic (P=0.89) regurgitations and of mild aortic (P=0.89) and tricuspid (P=0.89) regurgitations was found when compared with baseline. After 60 months, the prevalence of trace tricuspid regurgitation was only slightly increased when compared with that after 24 months (37.5%; P=0.82), but none of the patients developed significant valvulopathy. No correlation was found between cumulative dose and prevalence or grade of valve regurgitation at both evaluations. Prolactin levels normalized in all patients but one. CAB does not increase the risk of significant cardiac valve regurgitation in prolactinomas after the first 5 years of treatment.

  17. Rhodium diesel-reforming catalysts for fuel cell applications

    OpenAIRE

    Karatzas, Xanthias

    2011-01-01

    Heavy-duty diesel truck engines are routinely idled at standstill to provide cab heating or air conditioning, and in addition to supply electricity to comfort units such as radio and TV. Idling is an inefficient and unfavorable process resulting in increased fuel consumption, increased emissions, shortened engine life, impaired driver rest and health, and elevated noise. Hydrogen-fueled, polymer-electrolyte fuel-cell auxiliary power unit (PEFC-APU) as a silent external power supply, working i...

  18. Impact of Paint Color on Rest Period Climate Control Loads in Long-Haul Trucks: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Lustbader, J.; Kreutzer, C.; Jeffers, M.; Adelman, S.; Yeakel, S.; Brontz, P.; Olson, K.; Ohlinger, J.

    2014-02-01

    Cab climate conditioning is one of the primary reasons for operating the main engine in a long-haul truck during driver rest periods. In the United States, sleeper cab trucks use approximately 667 million gallons of fuel annually for rest period idling. The U.S. Department of Energy's National Renewable Energy Laboratory's (NREL) CoolCab Project works closely with industry to design efficient thermal management systems for long-haul trucks that minimize engine idling and fuel use while maintaining occupant comfort. Heat transfer to the vehicle interior from opaque exterior surfaces is one of the major heat pathways that contribute to air conditioning loads during long-haul truck daytime rest period idling. To quantify the impact of paint color and the opportunity for advanced paints, NREL collaborated with Volvo Group North America, PPG Industries, and Dometic Environmental Corporation. Initial screening simulations using CoolCalc, NREL's rapid HVAC load estimation tool, showed promising air-conditioning load reductions due to paint color selection. Tests conducted at NREL's Vehicle Testing and Integration Facility using long-haul truck cab sections, 'test bucks,' showed a 31.1% of maximum possible reduction in rise over ambient temperature and a 20.8% reduction in daily electric air conditioning energy use by switching from black to white paint. Additionally, changing from blue to an advanced color-matched solar reflective blue paint resulted in a 7.3% reduction in daily electric air conditioning energy use for weather conditions tested in Colorado. National-level modeling results using weather data from major U.S. cities indicated that the increase in heating loads due to lighter paint colors is much smaller than the reduction in cooling loads.

  19. Remote sensing based mapping of leaf nitrogen and leaf area index in European landscapes using the REGularized canopy reFLECtance (REGFLEC) model

    DEFF Research Database (Denmark)

    Boegh, E.; Houborg, R.; Bienkowski, J.

    2011-01-01

    Leaf biochemistry and biophysical parameters are important for simulating soil-vegetation-atmosphere exchanges of energy, water, CO2 and ammonia. The accumulation of leaf nitrogen (N) in vegetation canopies is a major component of the ecosystem N balance, and leaf N concentration and leaf area...... European landscapes. The estimations of leaf N, Cab and LAI soil reflectance parameters and canopy parameters are discussed in relation to the prevailing soil types and vegetation characteristics of land cover classes across the 5 European landscapes....

  20. The Close Aboard Bastion: a Soviet ballistic missile submarine deployment strategy

    OpenAIRE

    Kreitler, Walter M

    1988-01-01

    Approved for public release; distribution is unlimited This thesis describes and analyzes a possible deployment posture for the Soviet ballistic missile submarine force. It examines the proposition that the Soviet Navy will establish a point defense, labeled "Close Aboard Bastions" (CABs), for its ballistic missile submarine fleet within the Soviet claimed 12 nautical mile territorial sea. This is a logical derivation of the currently widely held view that the Soviets will estab...

  1. Balancing of the anthropomorphous robot walking

    Science.gov (United States)

    Devaev, V. M.; Nikitina, D. V.; Fadeev, A. Y.

    2016-06-01

    Anthropomorphic robots are designed a human environment operates: buildings and structures, cabs and etc. The movement of these robots is carried out by walking which provides high throughput to overcome natural and manmade obstacles. The article presents some algorithm results for dynamic walking on the anthropomorphic robot AR601 example. The work is performed according to the Russian Government Program of Competitive Growth of Kazan Federal University.

  2. Oncologic Response and Hospitalization Rate of Patients Receiving Cabazitaxel in the Fourth-Line and Beyond in Castration-Resistant Prostate Cancer: Analysis of a Retrospective Cohort and a Structured Literature Review.

    Science.gov (United States)

    von Hardenberg, Jost; Schwartz, Maike; Werner, Thorsten; Fuxius, Stefan; Strauss, Arne; Worst, Thomas Stefan; Nuhn, Philipp; Bolenz, Christian; Heinrich, Elmar

    2017-01-01

    Limited data are available for the use of agents in metastatic castration-resistant prostate cancer (mCRPC) beyond the third-line. We provide data during treatment with cabazitaxel (CAB), helping to improve the informed-consent process. We retrospectively reviewed patients treated with fourth-line or beyond CAB for mCRPC after failure of previous therapies with docetaxel, abiraterone acetate, enzalutamide and/or radium-223. The progression-free survival (PFS) and the overall survival (OS) were estimated using the Kaplan-Meier method and compared to published data based on a structured literature review. The hospitalization rate was recorded. Factors influencing 6-months OS were analyzed. Fifteen patients were identified at 4 institutions and included in the analysis. The median PFS was 104 days (range 47-397 days). The median time to death was 10 months (range 2-16). PFS and OS data are in accordance with 17 published patients so far. During the therapy, eleven (73%) of the patients were hospitalized. Prostate-specific antigen (PSA, 500 units; hazards ratio [HR] 1.491, 95% CI 1.000-2.0175), white blood cell count (HR 0.425, 95% CI 0.108-0.952), hemoglobin (HR 0.6014, 95% CI 0.2942-1.0758), and alkaline phosphatase (100 units; HR 1.0964, 95% CI 1.000-1.2859) correlate with 6-months OS. CAB beyond the third-line is often accompanied by hospitalization. PFS is a significant proportion of the median time of OS. The baseline laboratory might be a good indicator for the decision between CAB and best-supportive care. © 2017 S. Karger AG, Basel.

  3. Regions of variability for a class of analytic and locally univalent ...

    Indian Academy of Sciences (India)

    Abstract. In this article, we consider a family C(A,B) of analytic and locally uni- valent functions on the open unit disc D = {z : |z| < 1} in the complex plane that properly contains the well-known Janowski class of convex univalent functions. In this article, we determine the exact set of variability of log(f ′(z0)) with fixed z0 ∈ D ...

  4. Alteration of gene expression in Pisum sativum tissue cultures caused by the free radical-generating agent 2,2`-azobis (2-amidinipropane) dihydrochloride

    Energy Technology Data Exchange (ETDEWEB)

    Henkow, L. [Sveriges Lantbruksuniv., Inst. foer Vaextfoeraedling, Uppsala (Sweden); Strid, Aa.; Rydstroem, J. [Goeteborgs Univ. och Chalmers Tekniska Hoegskola, Inst. foer Biokemi och Biofysik, Goeteborg (Sweden); Berglund, T.; Ohlsson, A.B. [Kungliga Tekniska Hoegskolan, Inst. foer Biokemi och biokemisk Teknologi, Stockholm (Sweden)

    1996-04-01

    Root-differentiated tissue cultures (PS-R) from Pisum sativum (cv. Greenfeast) were exposed to a 5 mM solution of the free radical-generating compound 2,2`-azobis (2-amidinopropane) dihydrochloride (AAPH). The levels of mRNA transcripts for two genes were examined: chs2, encoding a chalcone synthase isozyme, and cab, encoding the chlorophyll a/b-binding protein of the light-harvesting antenna complex. In light-grown PS-R, cab mRNA transcript levels decreased to 14% of controls after 6 h of exposure, whereas chs2 mRNA levels increased 50-fold. In dark-grown PS-R, chs2 mRNA transcripts increased by 40-fold compared with the controls. Glutathione determination inlight-grown PS-R showed no substantial difference in total glutathione (GSH{sub tot}), whereas oxidized glutathione (GSSG) increased by 66% after 12 h of exposure. However, in dark-grown PS-R a decrease in both GSH{sub tot} and GSSG after 6 h was followed by an increase of about 70%, as compared with the controls, after 12 h of exposure. In conclusion AAPH generated oxidative stress, reflected in changed glutathione levels and induced expression of the chs2 gene of the flavonoid biosynthetic pathway and also caused a decreased level of mRNA for the photosynthetic cab gene. (au) 39 refs.

  5. A forward-design approach to increase the production of poly-3-hydroxybutyrate in genetically engineered Escherichia coli.

    Directory of Open Access Journals (Sweden)

    Richard Kelwick

    Full Text Available Biopolymers, such as poly-3-hydroxybutyrate (P(3HB are produced as a carbon store in an array of organisms and exhibit characteristics which are similar to oil-derived plastics, yet have the added advantages of biodegradability and biocompatibility. Despite these advantages, P(3HB production is currently more expensive than the production of oil-derived plastics, and therefore, more efficient P(3HB production processes would be desirable. In this study, we describe the model-guided design and experimental validation of several engineered P(3HB producing operons. In particular, we describe the characterization of a hybrid phaCAB operon that consists of a dual promoter (native and J23104 and RBS (native and B0034 design. P(3HB production at 24 h was around six-fold higher in hybrid phaCAB engineered Escherichia coli in comparison to E. coli engineered with the native phaCAB operon from Ralstonia eutropha H16. Additionally, we describe the utilization of non-recyclable waste as a low-cost carbon source for the production of P(3HB.

  6. Taxicab tipping and sunlight.

    Science.gov (United States)

    Devaraj, Srikant; Patel, Pankaj C

    2017-01-01

    Does the level of sunlight affect the tipping percentage in taxicab rides in New York City? We examined this question using data on 13.82 million cab rides from January to October in 2009 in New York City combined with data on hourly levels of solar radiation. We found a small but statistically significant positive relationship between sunlight and tipping, with an estimated tipping increase of 0.5 to 0.7 percentage points when transitioning from a dark sky to full sunshine. The findings are robust to two-way clustering of standard errors based on hour-of-the-day and day-of-the-year and controlling for day-of-the-year, month-of-the-year, cab driver fixed effects, weather conditions, and ride characteristics. The NYC cab ride context is suitable for testing the association between sunlight and tipping due to the largely random assignment of riders to drivers, direct exposure to sunlight, and low confounding from variation in service experiences.

  7. Assessment of Plant-Probiotic Performance of Novel Endophytic Bacillus sp. in Talc-Based Formulation.

    Science.gov (United States)

    Basheer, Jasim; Ravi, Aswani; Mathew, Jyothis; Krishnankutty, Radhakrishnan Edayileveettil

    2018-01-25

    Endophytic bacteria are considered to have a plethora of plant growth promoting and anti-phytopathogenic traits to live within the plants. Hence, they have immense promises for plant probiotic development. In the current study, plant probiotic endophytic Bacillus sp. CaB5 which has been previously isolated from Capsicum annuum was investigated for its performance in talc-based formulation. For this, CaB5 was made into formulation with sterile talc, calcium carbonate, and carboxymethyl cellulose. The viability analysis of the formulation by standard plate count and fluorescence methods has confirmed the stable microbial count up to 45 days. Plant probiotic performance of the prepared formulation was analyzed on cowpea (Vigna unguiculata) and lady's finger (Abelmoschus esculentus). The results showed the formulation treatment to have enhancement effect on seed germination as well as plant growth in both selected plants. The results highlight the potential of CaB5-based formulation for field application to enhance growth of economically important plants.

  8. A Novel Potassium-Competitive Acid Blocker Improves the Efficacy of Clarithromycin-containing 7-day Triple Therapy against Helicobacter pylori.

    Science.gov (United States)

    Noda, Hisatsugu; Noguchi, Seiji; Yoshimine, Takashi; Goji, Shigeki; Adachi, Kazunori; Tamura, Yasuhiro; Izawa, Shinya; Ebi, Masahide; Yamamoto, Sayuri; Ogasawara, Naotaka; Funaki, Yasushi; Sasaki, Makoto; Kasugai, Kunio

    2016-09-01

    In Japan, 7-day triple therapy for Helicobacter pylori including clarithromycin (CAM) was approved in 2000. However, antibiotic resistance subsequently reduced this rate to an unacceptable level (70%). Vonoprazan, an orally bioavailable potassium-competitive acid blocker (P-CAB), was approved in Japan in 2014. This could improve eradication rates by increasing the intragastric pH, thus increasing bacterial antibiotic susceptibility. This study compared the efficacy of 7-day triple therapies that included CAM and vonoprazan or proton pump inhibitor (PPI). We prospectively analyzed H. pylori eradication rates in 146 patients receiving 7-day triple therapy containing P-CAB (April 2015 to September 2015), and in a retrospective cohort of 1,305 patients who received 7-day triple therapy containing a PPI (April 2011 to September 2015). H. pylori was eradicated in a significantly higher number of P-CAB-treated patients (89.7% [131/146]) than PPI-treated patients (73.9% [965/1305]; p treatment for H. pylori infection.

  9. Septic Participation in Cardiogenic Shock: Exposure to Bacterial Endotoxin.

    Science.gov (United States)

    Ramirez, Paula; Villarreal, Esther; Gordon, Monica; Gómez, María Dolores; de Hevia, Luis; Vacacela, Karla; Gisbert, Teresa; Quinzá, Adrian; Ruiz, Jesús; Alonso, Ricardo; Bonastre, Juan; Vila, Jordi

    2017-05-01

    In cardiogenic shock (CS), presence of fever, leukocytosis, relatively low systemic vascular resistances, and high serum procalcitonin levels are quite frequent and recurrently involve the search for an infectious complication. We hypothesized that endotoxin exposure in CS could explain this sepsis-like syndrome. Prospective observational study of consecutive CS patients admitted to our intensive care unit (ICU). Patients were followed during the first 3 days after CS onset. All clinical, hemodynamic, and microbiological data were collected. Inflammatory biomarkers and anti-endotoxin antibodies (IgM EndoCAb) were daily measured. We included 37 consecutive CS patients. Twenty-two patients (60%) had body temperature >38.3°C or 14,000/mm or <4,000/mm. Microbiological study was performed in 30 patients (81%). No infection was diagnosed in the studied patients. All the patients had serum inflammatory biomarkers levels above normal values including procalcitonin (19 patients [51%] had serum procalcitonin above 2 ng/mL). All the patients had IgM EndoCAb below the normal median value; 22 patients (59.5%) had IgM anti-endotoxin value below 10th percentile range for healthy people. Hemodynamic and respiratory stabilization was achieved in 23 patients (62%) and the ICU mortality rate was 38%, only procalcitonin and interleuquin-6 were associated with higher mortality rate. We have detected extremely low titers of IgM EndoCAb in CS suggesting endotoxin exposure. However, only inflammatory biomarkers were related to ICU mortality.

  10. Prenatal stress and balance of the child's cardiac autonomic nervous system at age 5-6 years.

    Directory of Open Access Journals (Sweden)

    Aimée E van Dijk

    Full Text Available OBJECTIVE: Autonomic nervous system (ANS misbalance is a potential causal factor in the development of cardiovascular disease. The ANS may be programmed during pregnancy due to various maternal factors. Our aim is to study maternal prenatal psychosocial stress as a potential disruptor of cardiac ANS balance in the child. METHODS: Mothers from a prospective birth cohort (ABCD study filled out a questionnaire at gestational week 16 [IQR 12-20], that included validated instruments for state anxiety, depressive symptoms, pregnancy-related anxiety, parenting daily hassles and job strain. A cumulative stress score was also calculated (based on 80(th percentiles. Indicators of cardiac ANS in the offspring at age 5-6 years are: pre-ejection period (PEP, heart rate (HR, respiratory sinus arrhythmia (RSA and cardiac autonomic balance (CAB, measured with electrocardiography and impedance cardiography in resting supine and sitting positions. RESULTS: 2,624 mother-child pairs, only single births, were available for analysis. The stress scales were not significantly associated with HR, PEP, RSA and CAB (p≥0.17. Accumulation of maternal stress was also not associated with HR, PEP, RSA and CAB (p≥0.07. CONCLUSION: Results did not support the hypothesis that prenatal maternal psychosocial stress deregulates cardiac ANS balance in the offspring, at least in rest, and at the age of five-six years.

  11. The 5' untranslated region of the VR-ACS1 mRNA acts as a strong translational enhancer in plants.

    Science.gov (United States)

    Wever, Willem; McCallum, Emily J; Chakravorty, David; Cazzonelli, Christopher I; Botella, José R

    2010-08-01

    The structure and function of untranslated mRNA leader sequences and their role in controlling gene expression remains poorly understood. Previous research has suggested that the 5' untranslated region (5'UTR) of the Vigna radiata aminocyclopropane-1-carboxylate synthase synthase (VR-ACS1) gene may function as a translational enhancer in plants. To test such hypothesis we compared the translation enhancing properties of three different 5'UTRs; those from the VR-ACS1, the chlorophyll a/b binding gene from petunia (Cab22L; a known translational enhancer) and the Vigna radiata pectinacetylesterase gene (PAE; used as control). Identical constructs in which the coding region of the beta-glucuronidase (GUS) gene was fused to each of the three 5'UTRs and placed under the control of the cauliflower mosaic virus 35S promoter were prepared. Transient expression assays in tobacco cell cultures and mung bean leaves showed that the VR-ACS1 and Cab22L 5'UTRs directed higher levels of GUS activity than the PAE 5'UTR. Analysis of transgenic Arabidopsis thaliana seedlings, as well as different tissues from mature plants, confirmed that while transcript levels were equivalent for all constructs, the 5'UTRs from the VR-ACS1 and Cab22L genes can increase GUS activity twofold to fivefold compared to the PAE 5'UTR, therefore confirming the translational enhancing properties of the VR-ACS1 5'UTR.

  12. Dangerous Beliefs: College Alcohol Beliefs Are Associated With Increased Risk of Regretted Sexual Encounters.

    Science.gov (United States)

    Osberg, Timothy M; Boyer, Amber

    2016-10-14

    This study explored the relative impact of college alcohol beliefs (CABs; i.e., the extent to which the student views alcohol as part of the fabric of college life), descriptive norms, injunctive norms, positive alcohol expectancies, and sensation seeking on college students' (N = 415) risk for engaging in regretted sexual encounters (RSE). Overall, 12% of our sample reported having experienced RSE within the past 30 days. When pitted against the other traditional predictors of college student drinking and its consequences, such as positive alcohol expectancies, descriptive and injunctive norms, and sensation seeking, CABs emerged as the strongest correlate of RSE other than drinking itself, and explained significant additional variance in RSE beyond these other predictors. Mediation analyses revealed that CABs had a significant indirect effect on RSE through typical weekly drinking. This pattern of findings indicates that college alcohol beliefs are, from a public health perspective, dangerous beliefs, that warrant serious consideration in the development of new approaches to college student drinking and its consequences.

  13. [A crisis of ginseng capital and the countermeasures of the ginseng-cultivating people during Daehan empire].

    Science.gov (United States)

    Yang, Jeong Pil

    2009-12-01

    This thesis examines a crisis of ginseng capital and the source of crisis during Daehan empire. After the China-Japan war of 1894, the Japanese merchants actively engaged in taking over the ginseng fields, so that ginseng-cultivating Koreans suffered substantial economic losses. After the Russo-Japanese war, the Japanese imperialists undertook the 'Currency Arranging Business'(CAB) in order to set a cornerstone for their invasion of Korea. The CAB eventually provoked a wide depression which in turn produced massive number of Korean merchants going bankrupt. The Kaesong merchants were no exception, since CAB stroke a severe blow on the ginseng industry, which relied heavily on the commercial capitals of the Kaesong merchants. Moreover, the Japanese imperialists broke the previous promise and bought ginseng at a dirt-cheap price, which put ginseng-cultivating Koreans in serious trouble. In order to combat such crisis, ginseng field-owners protested against such injustice by petitioning or stirring up Kaesong popular riot in vain, and consequently the number of ginseng field-owners decreased sharply. A few of the ginseng field-owners survived, and managed to maintain and even flourish more than before. These successful owners were characterized with their strong link with the official circle, utilizing their influence in ginseng industry. Their original background was not identical as some came from the influential families of Kaesong area for generations, while others made their own fortunes and continue to prosper through the difficult times of the late of the Daehan empire period.

  14. The main concept analysis in cantonese aphasic oral discourse: external validation and monitoring chronic aphasia.

    Science.gov (United States)

    Kong, Anthony Pak-Hin

    2011-02-01

    The 1st aim of this study was to further establish the external validity of the main concept (MC) analysis by examining its relationship with the Cantonese Linguistic Communication Measure (CLCM; Kong, 2006; Kong & Law, 2004)-an established quantitative system for narrative production-and the Cantonese version of the Western Aphasia Battery (CAB; Yiu, 1992). The 2nd purpose of the study was to evaluate how well the MC analysis reflects the stability of discourse production among chronic Cantonese speakers with aphasia. Sixteen participants with aphasia were evaluated on the MC analysis, CAB, and CLCM in the summer of 2008 and were subsequently reassessed in the summer of 2009. They encompassed a range of aphasia severity (with an Aphasia Quotient ranging between 30.2/100 and 94.8/100 at the time of the 1st evaluation). Significant associations were found between the MC measures and the corresponding CLCM indices and CAB performance scores that were relevant to the presence, accuracy, and completeness of content in oral narratives. Moreover, the MC analysis was found to yield comparable scores for chronic speakers on 2 occasions 1 year apart. The present study has further established the external validity of MC analysis in Cantonese. Future investigations involving more speakers with aphasia will allow adequate description of its psychometric properties.

  15. Effect of the maceration technique on the relationships between anthocyanin composition and objective color of Syrah wines.

    Science.gov (United States)

    Gómez-Míguez, Manuela; Heredia, Francisco J

    2004-08-11

    The effects of two different vinification techniques, traditional fermentation and carbonic maceration, on the anthocyanin composition and color of young red wines, made with Syrah grapes grown in a warm climate, were compared. Tristimulus colorimetry was applied to study the color of wines during the vinification, and a high-performance liquid chromatography (HPLC) procedure was used for the analysis of anthocyanins. Carbonic maceration led to wines with lower anthocyanin content, mainly monoglucosides, and total phenols. This was related to lighter wines, less saturated, but more colorful (higher chroma C*ab values), and hues hab similar to those of the Syrah wines made by traditional vinification. Thus, the lightness L* had much more influence on the saturation s*uv of the wines obtained by carbonic maceration than the chroma (s*uv = C*uv/L*). From a study of the color-composition relationships using linear and multiple regression, better relationships were found for the wines from traditional vinification, where the chromatic parameters L*, hab, and s*uv could be predicted from the 3-monoglucosides of delphinidin, petunidin, peonidin, and malvidin concentrations (R > 0.9). However, a good prediction of the chroma C*ab from the anthocyanin composition was not possible. On the contrary, C*ab was the best predicted parameter from the anthocyanins monoglucosides (R > 0.9) in the carbonic maceration wines.

  16. Isolation and characterization of psychotrophic bacteria from oil-reservoir water and oil sands.

    Science.gov (United States)

    Kato, T; Haruki, M; Imanaka, T; Morikawa, M; Kanaya, S

    2001-06-01

    Four psychrotrophic strains, which grew at 4 degrees C but not at 37 degrees C, were isolated from Japanese oil-reservoir water (strains SIB1, SIC1, SIS1) and Canadian oil sands (strain CAB1). Strains SIB1, SIS1, and CAB1 had a maximum growth rate at 20 degrees C and grew to the highest cell densities at the cultivation temperature of 0-4 degrees C. Strain SIS1 was capable of growing even at -5 degrees C. The growth profile of strain SIC1 was rather similar to that of a mesophilic bacterium. Strains SIB1, SIC1, and SIS1 were identified as members of the genus Shewanella, and strain CAB1 was a member of the genus Arthrobacter. All these strains exhibited weak degradation ability against catechol, a hydroxylated aromatic hydrocarbon, and tributyrin. These strains are expected to be of potential use in the in situ bioremediation technology of hazardous hydrocarbons and esters under low-temperature conditions.

  17. Anatomy of biocalcarenitic units in the Plio-Pleistocene record of the Northern Apennines (Italy)

    Science.gov (United States)

    Cau, Simone; Roveri, Marco; Taviani, Marco

    2017-04-01

    The Castell'Arquato Basin (CAB) in the foothills of the thrust-belt Northern Apennines is a foreland basin infilled by Plio-Quaternary sediments and a reference area for Plio-Pleistocene biostratigraphy. The CAB exposes plurimetric biodetrital carbonate units at discrete temporal intervals. Such shell-rich units are at places lithified, turning into conspicuous biodetritral carbonate rocks (biocalcarenites) that display a cyclical stacking motif highlighted by the regular alternation with finer-grained marine deposits. The cyclical nature of thick biocalcarenites has been hypothesized to be orbitally-controlled by obliquity and/or precession cyclicity. Furthermore, biocalcarenite-mudstone couplets form distinct clusters governed by 100-400 ka eccentricity maxima starting from 3.1 Ma at the inception of the Northern Hemisphere glaciation. They correlate with sapropels cycles formed at times of maximum insolation (precession minima). The CAB calcarenites are poorly known with respect to their environmental genetic context what motivated a detailed paleoecological analysis to unravel at best their formative context. Five distinct biofacies arranged in stacking patterns are identified through two-way cluster analysis based on the macrofossil content. Our quantitative and qualitative results suggest that these polytaxic shell concentrations and their bracketing marine mudstones developed in middle shelf settings being sensitive to climatically-driven changes.

  18. A Forward-Design Approach to Increase the Production of Poly-3-Hydroxybutyrate in Genetically Engineered Escherichia coli

    Science.gov (United States)

    Kelwick, Richard; Kopniczky, Margarita; Bower, Iain; Chi, Wenqiang; Chin, Matthew Ho Wai; Fan, Sisi; Pilcher, Jemma; Strutt, James; Webb, Alexander J.; Jensen, Kirsten; Stan, Guy-Bart; Kitney, Richard; Freemont, Paul

    2015-01-01

    Biopolymers, such as poly-3-hydroxybutyrate (P(3HB)) are produced as a carbon store in an array of organisms and exhibit characteristics which are similar to oil-derived plastics, yet have the added advantages of biodegradability and biocompatibility. Despite these advantages, P(3HB) production is currently more expensive than the production of oil-derived plastics, and therefore, more efficient P(3HB) production processes would be desirable. In this study, we describe the model-guided design and experimental validation of several engineered P(3HB) producing operons. In particular, we describe the characterization of a hybrid phaCAB operon that consists of a dual promoter (native and J23104) and RBS (native and B0034) design. P(3HB) production at 24 h was around six-fold higher in hybrid phaCAB engineered Escherichia coli in comparison to E. coli engineered with the native phaCAB operon from Ralstonia eutropha H16. Additionally, we describe the utilization of non-recyclable waste as a low-cost carbon source for the production of P(3HB). PMID:25699671

  19. Oxidation of Tetracaine Hydrochloride by Chloramine-B in Acid Medium: Kinetic Modeling

    Directory of Open Access Journals (Sweden)

    Jayachamarajapura Pranesh Shubha

    2014-01-01

    Full Text Available Tetracaine hydrochloride (TCH is one of the potent local anaesthetics. A kinetic study of oxidation of tetracaine hydrochloride by sodium N-chlorobenzenesulfonamide (chloramine-B or CAB has been carried in HClO4 medium at 303 K. The rate shows first-order dependence on [CAB]o, shows fractional–order dependence on [substrate]o, and is self-governing on acid concentration. Decrease of dielectric constant of the medium, by adding methanol, increased the rate. Variation of ionic strength and addition of benzenesulfonamide or NaCl have no significant effect on the rate. The reaction was studied at different temperatures and the activation parameters have been evaluated. The stoichiometry of the reaction was found to be 1 : 5 and the oxidation products were identified by spectral analysis. The conjugate free acid C6H5SO2NHCl of CAB is postulated as the reactive oxidizing species. The observed results have been explained by plausible mechanism and the related rate law has been deduced.

  20. Economic evaluation of voriconazole compared with conventional amphotericin B for the primary treatment of aspergillosis in immunocompromised patients.

    Science.gov (United States)

    Wenzel, R; Del Favero, A; Kibbler, C; Rogers, T; Rotstein, C; Mauskopf, J; Morris, S; Schlamm, H; Troke, P; Marciniak, A

    2005-03-01

    The objective of this study was to conduct an economic evaluation of voriconazole compared with conventional amphotericin B deoxycholate (CAB) using data from a recently reported randomized comparative trial in patients with various underlying immunosuppressive conditions. This trial demonstrated the superiority of voriconazole in terms of clinical response, survival and safety when used as primary therapy for invasive aspergillosis. A decision analytic model was designed using an expert panel and populated primarily with efficacy and resource utilization data collected prospectively during the clinical trial. The analysis was carried out from the perspective of the health care system and all costs are reported in 2002 US dollars. Average total treatment costs per patient were 10% lower in the voriconazole arm ($30 664) than in the CAB arm ($34 144), resulting from reduced consumption of hospital resources and fewer changes in antifungal therapy. In the base case analysis, voriconazole provided an average saving of $3481 per treated patient, resulted in a lower cost per survivor ($43 310 versus $58 971) and a lower cost per successfully treated patient ($58 100 versus $108 124) compared with CAB. Sensitivity analyses demonstrated that the cost savings observed were maintained over a wide range of alternative values for both unit costs and resource utilization, including length of hospital stay, time spent in intensive care units, bed day costs and the cost of lipid formulations of amphotericin B. Incremental cost-effectiveness analysis indicated the dominance of voriconazole because of both lower costs and greater efficacy.