Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Carlos F Linares1 Freddy Ocanto1 Pablo Bretto1 Maricela Monsalve1. Unidad de Síntesis de Materiales y Metales de Transición, Facultad de Ciencias y Tecnología, Departamento de Química, Universidad de Carabobo, Valencia, Edo. Carabobo, Apartado Postal 3336, Venezuela ...
African Journals Online (AJOL)
Edo Journal of Counselling, the official publication of Edo Chapter of Counselling ... The Mediating Impact of Personality and Socio-Economic Status in the ... Fostering Adolescents' Interpersonal Behaviour: An Empirical Assessment of ...
Directory of Open Access Journals (Sweden)
F. Lozano-Kasten
2015-01-01
Conclusiones: El cabello del recién nacido es una fuente más de información para obtener datos de concentraciones de mercurio en cabello, y de interés para estudiar la carga de morbilidad ambiental por metilmercurio.
Archives: Edo Journal of Counselling
African Journals Online (AJOL)
Items 1 - 6 of 6 ... Archives: Edo Journal of Counselling. Journal Home > Archives: Edo Journal of Counselling. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. 1 - 6 of 6 Items. 2011 ...
Prevalence of onchocerciasis in Edo State, Nigeria | Onowhakpor ...
African Journals Online (AJOL)
Objective: To determine the prevalence of onchocerciasis in endemic areas in Edo State,Nigeria. Methodology: A descriptive cross-sectional study was conducted among 658 respondents residing in onchocerciasis endemic areas of Edo State using a pre-tested interviewers' administered questionnaire and examination of ...
Mercedes Cabello de Carbonera y su tiempo: escritora a contracorriente
Barúa Lanchippa, Norma
2011-01-01
Se examinan algunos aspectos de la vida y obra de una gran escritora peruana del siglo XIX, Mercedes Cabello de Carbonera, en el contexto social e ideológico en que vivió y escribió. Se resumen las polémicas de la época entre romanticismo, positivismo y realismo o naturalismo, como corrientes literarias y de pensamiento, y se analizan las posiciones de esta novelista y ensayista, quien aprobaba del positivismo científico de Comte, pero deploraba sus ideas retrógradas sobre la mujer. Se explor...
Paisaje del viñedo: patrimonio y recurso
Directory of Open Access Journals (Sweden)
Luis Vicente Elías
2008-01-01
Full Text Available La propuesta de que el paisaje del viñedo sea el complemento a la visita a la bodega, siendo esta el eje del turismo del vino, es el objetivo de este trabajo. Repasando los conceptos variables de patrimonio, llegamos al paisaje del viñedo como recurso, formando parte del patrimonio natural. Pero este no se puede desvincular de los otros aspectos patrimoniales, por lo que la cultura tradicional es el soporte de la tipología de paisaje que queremos proponer y que va contrastar con los nuevos paisajes del viñedo que surgen de las recientes técnicas en los cultivos y de la actual vitivicultura, emparejada con una moderna cultura del vino. El análisis de las diversas normativas, que salvaguardan el paisaje y la comprobación del escaso valor legal del paisaje del viñedo, es otro puntal de este trabajo que trata de unir paisaje con cultura tradicional como recursos del Turismo del Vino, integrados en las Rutas del Vino.
ECONOMIC DENIAL OF SUSTAINABILITY (EDOS ATTACK ON CLOUD – A SURVEY
Directory of Open Access Journals (Sweden)
A. Somasundaram
2016-12-01
Full Text Available Cloud computing is a promising technology aims to provide reliable, customized and quality of service computation environments for cloud users in terms of Software as a Service-SaaS , Plat- form as a Service-PaaS and Infrastructure as Service-IaaS, which is provided on the pay per use basis. Cloud computing enables services to be deployed and accessed globally on demand with little maintenance by providing QoS as per service level agreement (SLA of customer. However, due to elasticity of resources, cloud systems are facing severe security problems. One of the most serious threats to cloud computing is EDoS (economic Distributed Denial of Service aims to consume the cloud resource by attacker and impose financial burden to the legitimate user, where integrity, availability and confidentiality of the cloud services are never compromised but affects the accountability which leads to inaccurate billing. Since the billing models of cloud services may not be mature enough to properly account for an EDoS attack. These paper surveys, the different techniques that generate, detect and mitigate the EDoS Attack on Cloud.
Varietas Indiana: le cas de la Miscelánea Antártica de Miguel Cabello Valboa
Directory of Open Access Journals (Sweden)
2001-01-01
Full Text Available La notion de varietas est reprise par la culture de lHumanisme et érigée en principe générateur de formes de pensée et décriture. Compte tenu de ceci, il y a lieu de se demander quel fut son rôle dans lappréhension intellectuelle du Nouveau Monde et dans les divers discours sur celui-ci, aussi bien ceux qui furent élaborés depuis lEurope que ceux qui le furent depuis les Indes Occidentales. Il s'agit ici de réfléchir sur un cas particulier, celui de la fonction de la varietas dans la Miscelánea Antártica de Miguel Cabello Valboa, pour essayer de démontrer comment lauteur se sert doublement de ce principe pour insérer le lecteur, aussi bien local que peninsulaire, au sein de la matière américaine et, en même temps, assimiler celle-ci au fonds commun du savoir, rattachant lhistoire indigène à lHistoire universelle. VARIETAS INDIANA: EL CASO DE LA MISCELÁNEA ANTÁRTICA DE MIGUEL CABELLO VALBOA La noción de varietas se erige como principio generador de formas de pensamiento y de escritura y, en un sentido general, como eje de la cultura del Humanismo. Teniendo en cuenta lo anterior, cabe preguntarse sobre la función que ésta cumplió en la aprensión intelectual de los territorios ultamarinos dentro del imaginario europeo y en la formación de un imaginario local. En el presente artículo hemos examinado esta cuestión en un caso particular, el de la Miscelánea Antártica de Miguel Cabello Valboa, intentando mostrar cómo el autor se sirve doblemente del principio de la varietas para insertar al lector, tanto local como peninsular, en el ámbito de la materia americana y de la historia indígena, pero sobre todo para asimilarlas al fondo común del saber y engarzarlas, en un plano de igualdad, dentro de la historia universal. VARIETAS INDIANA: THE CASE OF MISCELÁNEA ANTÁRTICA DE MIGUEL CABELLO VALBOA The age of Humanism revived the notion of varietas and established it as a generating force of thought and
Wagner, Tom
2010-01-01
The ceremonial copper and iron bells at the Smithsonian's National Museum of African Art were the author's inspiration for an interdisciplinary unit with a focus on the contributions various cultures make toward the richness of a community. The author of this article describes an Edo bell-inspired ceramic project incorporating slab-building…
High Lassa Fever activity in Northern part of Edo State, Nigeria ...
African Journals Online (AJOL)
The purpose was to establish simple statistics of the effects of lassa fever in northern part of Edo State, Nigeria. Lassa fever activity in the northern part of Edo state, Nigeria, was confirmed in 2004 by laboratory analysis of samples sent to Bernhard–Nocht Institute (BNI) for Tropical Medicine Hamburg, Germany.
Piebaldismo, albinismo parcial en cabello y piel
Directory of Open Access Journals (Sweden)
Jorge Arturo Aviña Fierro
Full Text Available El piebaldismo es una enfermedad congénita, autosómica dominante que afecta el cabello y la piel, y se manifiesta por un mechón de pelo hipocrómico (poliosis, generalmente localizado en zona frontal; además, en la piel hay zonas de despigmentación e hipomelanosis. La causa es la ausencia de melanocitos en las áreas afectadas por mutación en el protooncogén KIT (receptor tirosinasa kinasa con tirosinasa mutada en los melanoblastos. Se reporta el caso de una niña de 4 meses de edad, con un mechón hipocrómico frontal y grandes manchas acrómicas en la cara, el tronco y las extremidades, en una distribución casi simétrica, presentes desde el nacimiento, y muy características de esta enfermedad. El diagnóstico diferencial se realizó con síndrome Waardenburg, albinismo oculocutáneo con afección ocular y el síndrome Griscelli-Prunieras, que es un albinismo que se acompaña de inmunodeficiencia.
Non-Formal education in astronomy: The experience of the University the Carabobo
Falcón, Nelson
2011-06-01
Since 1995, the University the Carabobo, in Venezuela, has come developing a program of astronomical popularization and learning Astronomy using the Non formal education methods. A synopsis of the activities is presented. We will also discuss some conceptual aspects about the extension of the knowledge like supplementary function of the investigation and the university teaching. We illustrate the characteristics of the communication with an example of lectures and printed material. The efficiency of the heuristic arguments could be evaluated through a ethnology study. In that order of ideas, we show some images of the activities of astronomical popularization. We can see the population and great concurrence with chronological (and cultural) heterogeneity. We conclude that the Non formal education, structured with characteristic different to the usual educational instruction, constitutes a successful strategy in the diffusion and the communicating astronomy.
Directory of Open Access Journals (Sweden)
A. Sarmiento
2003-04-01
Full Text Available Objetivo: La desinfección del agua con cloro en las plantas de potabilización da lugar a la formación de trihalometanos (THM. Estos compuestos están asociados a efectos adversos para la salud. En este estudio se determinó la concentración de THM en el agua para consumo humano suministrada por las redes de distribución de los dos principales sistemas de potabilización de agua del Estado Carabobo, la planta Alejo Zuloaga y el embalse Pao-Cachinche que forman el Sistema Regional del Centro I (SRC-I y la planta Lucio Baldo Soules y el embalse Pao-La Balsa que forman el Sistema Regional del Centro II (SRC-II. Métodos: Se analizaron un total de 144 muestras recolectadas durante 6 muestreos que se realizaron durante los años 2000 y 2001. La concentración de THM se determinó por cromatografía de gases, mediante la técnica de headspace. Se determinaron las concentraciones para los siguientes THM: cloroformo (CHCl3, bromoformo (CHBr3, dibromoclorometano (CHBr2Cl y diclorobromometano (CHCl2Br. Resultados: La concentración de THM totales estuvo entre 47,84 y 93,23 μg/l. El CHCl3 fue el compuesto predominante, representando el 83% de total de THM para el SRC-I y el 82% en el SRC-II. Se encontró que las concentraciones de THM totales en el SRC-I (Red Baja y Red San Diego son significativamente superiores (p Objective: Disinfection of water with chlorine in water treatment plants leads to the formation of trihalomethanes (THMs. These compounds are associated with adverse health effects. The aim of this study was to analyze THM concentrations in the water provided for human consumption in the two main water treatment systems of Carabobo State: the Alejo Zuloaga plant and the Pao-Cachinche reservoir, which form the Central Regional System I (CRS I, and the Lucio Baldo Soules plant and the Pao-La Balsa reservoir, which form the Central Regional System II (CRS II. Methods: We analyzed 144 water samples collected in 6 samplings carried out in 2000
An evaluation of electron diamond type EDO2E and EDO3 diamond radiation detectors
International Nuclear Information System (INIS)
Poole, D.A.; Wilson, R.
1977-12-01
Observations on the response of two d.c. mode (EDO2E) and three pulse mode (EDO3) diamond probes to beta and gamma radiation are reported. In the d.c. mode, response to gamma exposure rates from 1 R h -1 to >6x10 4 R h -1 were measured, currents of approximately 5x10 -13 A and approximately 3x10 -9 A respectively at 20 0 C being observed. The dark current was approximately 3x10 -13 A at 20 0 C and doubled for every 3 to 4 0 C temperature rise. In the pulse mode the count rate was approximately linear with gamma exposure rate from 10 mR h -1 to > 300 R h -1 . The detection of beta particles was limited to energies > or approximately equal 0.8 MeV. Over the temperature range -5 0 C to 50 0 C the count rate for one probe increased by a factor of 1.25 whereas a second probe showed a decrease of 1.4. There is scope for major improvement of diamond detectors as reported by Kozlov et al (1977a) who have eliminated certain undesirable effects by careful selection and the provision of special electrodes. (author)
Factors influencing breastfeeding practices in Edo state, Nigeria ...
African Journals Online (AJOL)
In Nigeria however, young infants may not benefit from such a practice as a ... The purpose of this study was to determine factors influencing breastfeeding practices in Edo State, Nigeria. ... Only 20 per cent practiced exclusive breastfeeding.
phytoplankton diversity indices of Osse River, Edo State, Nigeria
African Journals Online (AJOL)
USER
The phytoplankton diversity indices of Osse River, Edo State, Nigeria, were investigated monthly from January ... In terms of abundance, Bacillariophyceae had the highest distribution of phytoplankton (79.00%), ...... erosion beach in Lagos.
Simulación basada en SMA de sistemas originalmente representados con EDO
Directory of Open Access Journals (Sweden)
Ekaitz Zulueta Guerrero
2011-10-01
Full Text Available Resumen: En el presente trabajo se expone una metodología para modelar mediante un Sistema Multi-Agente (SMA sistemas biológicos y fisiológicos dinámicos con variables cuantificadas discretas, como el crecimiento y decrecimiento de poblaciones o el modelado epidemiológico de enfermedades. Se muestra un procedimiento para transformar un sistema de Ecuaciones Diferenciales Ordinarias (EDO (que modela un entorno de forma correcta en un SMA equivalente mediante un esquema basado en el método de Monte Carlo. Se utiliza un caso práctico fundamentado en un modelo matemático de Leucemia Mieloide Crónica (LMC para comparar la metodología basada en agentes con el modelado tradicional basado en un sistema de EDO. Se realiza una simulación con cada modelo (SMA y EDO y se compara los resultados obtenidos con ambas metodologías. Palabras clave: Ecuaciones diferenciales, modelo basado en agentes, Monte Carlo
Structure, conduct and performance of Plantain Marketing in Edo ...
African Journals Online (AJOL)
Structure, conduct and performance of Plantain Marketing in Edo State, Nigeria. ... marketing system, assess its performance and estimate the cost and returns in plantain marketing. ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
The European Drought Observatory (EDO): Current State and Future Directions
Vogt, Jürgen; Sepulcre, Guadalupe; Magni, Diego; Valentini, Luana; Singleton, Andrew; Micale, Fabio; Barbosa, Paulo
2013-04-01
Europe has repeatedly been affected by droughts, resulting in considerable ecological and economic damage and climate change studies indicate a trend towards increasing climate variability most likely resulting in more frequent drought occurrences also in Europe. Against this background, the European Commission's Joint Research Centre (JRC) is developing methods and tools for assessing, monitoring and forecasting droughts in Europe and develops a European Drought Observatory (EDO) to complement and integrate national activities with a European view. At the core of the European Drought Observatory (EDO) is a portal, including a map server, a metadata catalogue, a media-monitor and analysis tools. The map server presents Europe-wide up-to-date information on the occurrence and severity of droughts, which is complemented by more detailed information provided by regional, national and local observatories through OGC compliant web mapping and web coverage services. In addition, time series of historical maps as well as graphs of the temporal evolution of drought indices for individual grid cells and administrative regions in Europe can be retrieved and analysed. Current work is focusing on validating the available products, developing combined indicators, improving the functionalities, extending the linkage to additional national and regional drought information systems and testing options for medium-range probabilistic drought forecasting across Europe. Longer-term goals include the development of long-range drought forecasting products, the analysis of drought hazard and risk, the monitoring of drought impact and the integration of EDO in a global drought information system. The talk will provide an overview on the development and state of EDO, the different products, and the ways to include a wide range of stakeholders (i.e. European, national river basin, and local authorities) in the development of the system as well as an outlook on the future developments.
Determinants of Revenue Derived from Pineapple Marketing in Edo ...
African Journals Online (AJOL)
Determinants of Revenue Derived from Pineapple Marketing in Edo State, Nigeria. ... The results showed that an average pineapple marketer has a mean volume of 98 dozens and incurred a variable ... EMAIL FULL TEXT EMAIL FULL TEXT
Festival of Curses: A Traditional Crime Control Method In Edo State –Nigeria
Rashidi Akanji Okunola; Adediran Daniel Ikuomola
2016-01-01
Festivals and ceremonies are part and parcel of African culture, usually in all its pump, merriment and pageantry. However, with the increasing wave of criminal activities in Nigeria especially in Edo state, festivals and ceremonies are being redefined and conceptualized in practice. Only recently a new festival ‘Festival of Curses’ was brought to the fore in combating crime in Edo state. The study therefore seeks to explain the festival as a traditional mechanism in crime control, the nature...
Investigation of Ojirami reservoir, Akoko-Edo, Southsouth, Nigeria ...
African Journals Online (AJOL)
Ojirami Reservoir was constructed between 1971 and 1974 for the purpose of supplying potable water to Edo North senatorial zone, Nigeria. The reservoir is aging, with evidence of siltation but relatively free of any anthropogenic activities. A study was carried out between January 2009 and December 2010 to monitor the ...
Anion size and isotope effects in (EDO-TTF)2XF6
International Nuclear Information System (INIS)
Nakano, Yoshiaki; Yamochi, Hideki; Saito, Gunzi; Uruichi, Mikio; Yakushi, Kyuya
2009-01-01
(EDO-TTF) 2 PF 6 is a quasi one-dimensional molecular conductor and undergoes a peculiar metal-insulator (MI) transition. The phase transition mechanism is cooperative among Peierls, charge ordering, and anion ordering transitions, which is accompanied with a distinct molecular deformation. (EDO-TTF) 2 XF 6 (X = P (1h), As (2h), Sb (3h)) showed that the transition temperature (T MI ) and the width of thermal hysteresis (ΔT MI ) were systematically changed depending on the anion size, i.e., the T MI decreased in order of 279.0 K (1h), 270.8 K (2h), and 242 K (3h) and the ΔT MI increased in order of 1.0 K (1h), 5.5 K (2h), and 14 K (3h). The deuterated salts, (EDO-TTF-d 2 ) 2 XF 6 (X = P (1d) and As (2d)), showed higher T MI of 282.0 (1d) and 274.0 K (2d) and narrower ΔT MI of 0.0 (1d) and 5.0 K (2d) than the undeuterated 1h and 2h, respectively. X-ray analysis revealed the anisotropic thermal expansion of unit cell. The linear relationship between ΔT MI and volume change at T MI was found.
Challenges of Local Government Administration in Edo State of ...
African Journals Online (AJOL)
This paper examined the fundamental problems that envelope local government administration in Edo State, and discovered that the challenges are constitutional issues. It also identified problems of graft, poor revenue generation by local authorities, and poor revenue allocation cum fiscal transfer to local governments.
Socio-economic characteristics of registered cocoa farmers in Edo ...
African Journals Online (AJOL)
This study examined the socio-economic characteristics of registered cocoa farmers in Edo State; Nigeria. Primary data was collected using a well structured questionnaire administered to 180 registered cocoa farmers selected using a multi-stage sampling technique. Data were analyzed using descriptive statistics and ...
The Economic Potentials of Pineapple Marketing in Edo State, Nigeria.
African Journals Online (AJOL)
The Economic Potentials of Pineapple Marketing in Edo State, Nigeria. ... Agricultural marketing involves numerous lines of activities, which if well developed can sustain livelihood. It is in line with this ... EMAIL FULL TEXT EMAIL FULL TEXT
Gender issues in human trafficking in Edo State, Nigeria | Osezua ...
African Journals Online (AJOL)
Gender issues in human trafficking in Edo State, Nigeria. ... in order to capture family dynamics and power relations and women status in ... The paper concluded that efforts targeted towards eradicating existing gender inequality in the region ...
Human ecotoparasitoses among some rural dwellers in Edo State ...
African Journals Online (AJOL)
Studies on clinical and epidemiological aspects of human ectoparasites among some rural dwellers in Edo State Nigeria were carried out between September 2002 and August 2003. A total of 910 subjects who had complained of having been infested by arthropod parasites were enrolled for this study. The study ...
Chemical Compositions of Soils in Parts of Edo State, Southwest ...
African Journals Online (AJOL)
MICHAEL HORSFALL
www.bioline.org.br/ja. Chemical Compositions of Soils in Parts of Edo State, Southwest Nigeria and their ... the soil in agriculture and engineering (Imasuen et al. 1989b). Clay mineral ..... Unpublished Ph.D. Thesis, The. University of Western ...
Economic analysis of honey production in Edo State, Nigeria ...
African Journals Online (AJOL)
This research work was carried out to analyze the economics of honey production in Edo State. The objectives of the study were to examine the demographic characteristics of honey production, assess the profitability of honey bee and the problems facing honey production .The list of honey farmers in the state was ...
DROP OUT FROM SCHOOL AMONG GIRLS IN EDO STATE ...
African Journals Online (AJOL)
Elizabeth
this paper is to investigate why girls dropout from school in Edo State. The descriptive survey ... women. It allows them greater control of their lives and provides them with skills to ... in an attempt to protect their teenage daughters, give them out to wealthy old friends. .... Counselling intervention for gender equality. A paper.
Physio-Chemical Analysis of Industrial Effluents in parts of Edo ...
African Journals Online (AJOL)
Physio-Chemical Analysis of Industrial Effluents in parts of Edo States Nigeria. ... Journal of Applied Sciences and Environmental Management ... particularly, surface water results from all activities of man involving indiscriminate waste disposal from industry such as effluents into waterways, waste, agricultural waste, and all ...
Determinants of Rural Development in Edo State, Nigeria: An ...
African Journals Online (AJOL)
About 70% of the total population in Nigeria lives in the rural areas, while half of this population is without proper-formal education (World Bank 2005). Data for this study which is on the Determinants of rural Development in Edo State, Nigeria were collected through the primary and secondary sources. Primary data were ...
Economic Potential of Taungya Farming System in Edo State, Nigeria
African Journals Online (AJOL)
The study examined the economic potential of taungya system in Edo state, using of data obtained from both primary and secondary sources with the aid of well structured questionnaires administered to 230 respondents in eight the Local Government Areas practicing taungya farming in government reserved forests.
Vicissitudes of Edo State Council for Arts and Culture Performing ...
African Journals Online (AJOL)
Abstract. The ding-dong charade of Edo State Council for Arts and Culture Performing Troupe (ESCFAACPT) cannot be divorced from the vacillating condition the establishment had been experiencing since its establishment. This condition is fore-grounded, first, on the cacophony of nomenclature that the council had been ...
Assessment of groundwater quality of Benin City, Edo state, Nigeria ...
African Journals Online (AJOL)
The quality of groundwater of Benin City, Edo State, Nigeria was investigated between February and July 2008. Water samples were collected from functional bore holes from five locations (stations 1 – 5) and analyzed for physico-chemical parameters including heavy metals. Data obtained were compared with World ...
Evolución del e-gobierno en la Alcaldía del Municipio Naguanagua, estado Carabobo: período 2004-2014
Lubiza Osio; Pedro Luis Pineda
2015-01-01
El presente artículo, tiene como objetivo realizar una comparación evolutiva, sobre los avances del gobierno electrónico en el área específica de los servicios disponibles a través de la página Web de la Alcaldía de Naguanagua, estado Carabobo, durante el periodo comprendido entre el año 2004 y el año 2014. Su fundamentación se basó en el análisis de datos provenientes de dos investigaciones de las cuales, se precisó el avance sobre el e-gobierno en dos momentos: año 2004 y 2007, en el contex...
Loaisis in Edo State, Nigeria | Mordi | Journal of Medicine and ...
African Journals Online (AJOL)
The inaccessibility of the arthropod vector to humans could be advanced for the low prevalence of the disease in the state. The socio-cultural and economic factors, which predisposed to infection, were discussed as part of control measures. Keywords: Loaisis, Prevalence, Loa Loa, Edo State Nigeria Journal of Medicine ...
The Prevalence of Malaria in Edo State, Nigeria | Mordi | Nigerian ...
African Journals Online (AJOL)
This study determined the prevalence of malaria in Edo State, Nigeria. The study was cross-sectional, and lasted one year. Children of school ages participated in the study. Detection of malaria parasites was through thick blood film with Giemsa stain. There was a predilection for infection for children less than ten years.
Students Perception of Cyber Crime in Edo State: Implications for ...
African Journals Online (AJOL)
The study determined the perception of students toward committing cyber crime the study will determine the level of success and the gender mostly prone to commit this crime. The study employed the use of descriptive survey to find out students perception towards cyber crime in Edo State. A sample of 500 students ...
(Recognizing Mondoñedo: The Past Projects Itself as Future
Directory of Open Access Journals (Sweden)
Freire Paz, Elena
2009-12-01
Full Text Available The author approaches the current socio-cultural reality in the town of Mondoñedo (province of Lugo, Galicia, Spain by considering the rapid economic, social and cultural changes that have taken place there over the past few decades. Whereas from an outside perspective the global economic process has resulted in the transformation of certain cultural patterns everywhere, the changes occurred inside any cultural system have brought about the inception of an interesting strategy of a clearly cultural character. Local development in Mondoñedo nowadays rests on making the most of specific cultural resources so as to prompt and energize an area affected by a sharp population decline. The current context also includes the loss of the town’s provincial hegemony to Lugo, the capital, the demise of primary activities and the meagre implementation of secondary activities.
La autora se acerca a la realidad socio-cultural actual creada en Mondoñedo, ciudad del interior de la provincia de Lugo (Galicia, España, teniendo en cuenta las bruscas transformaciones económicas, sociales y culturales acontecidas en las últimas décadas. Si, desde una perspectiva externa, el movimiento económico global ha motivado la transformación de determinadas pautas culturales en todo el mundo, los cambios propiciados desde el interior de cualquier sistema cultural han repercutido en la génesis de una interesante planificación de marcado carácter cultural. El desarrollo local de la zona gira en torno al aprovechamiento de determinados recursos culturales como impulsores y dinamizadores de un territorio estrangulado por un fuerte descenso poblacional, la pérdida de consideración hegemónica de la villa frente a la capitalidad de la provincia, el abandono del sector primario y la escasez de actividades del sector secundario.
Human Trafficking in Edo State (Nigeria): A Socio- Economic Study ...
African Journals Online (AJOL)
The essay is derived from a field study executed in 2009. Its focus is on. Benin City inhabited mostly by the Bini group although other groups like the Ishan, Etsako, Akoko-Edo, and Owan are also well represented. It is generally believed that Bini girls/women dominate the sex export to. Europe through human trafficking.
Manifestation of the Kabuki actors’ gender in woodblock prints of the Edo Period
Directory of Open Access Journals (Sweden)
Beata ROMANOWICZ
2015-06-01
Full Text Available The connection between Kabuki theatre and Japanese woodblock prints of the Edo period (1603–1868, especially in their portraits of actors called yakusha‑e, offers an exceptional opportunity to analyse perceptions of the sex of the actor: as the hero of the drama, as well as the character performed on the stage. Both phenomena flourished in the Edo period and had a crucial impact on the visual art of the time, inspiring pictures of the Floating World (Jap. Ukiyo‑e. The images on Ukiyo‑e woodblock prints serve as a pretext for approaching the matter of whether to portray an actor as a performer (a man or as the character performed by him (which could also be a woman, as in the case of the onnagata actor. The author focuses on the actors’ identification with their own sex (only men appeared on the Kabuki stage and on cases of breaking the convention between the real actor and his stage emploi. In the first part, the paper discusses the historical background of Kabuki theatre, which was invented by a woman (Izumo‑no Okuni and then after a few government edicts, was allowed to be performed on the stage only by adult men. Since the Kabuki tradition has successfully continued until today, apart from surveys of theatrical archives, the author supports her arguments by also referring to contemporary phenomena, especially the Kabuki performances she has watched in Japan (in such theatres as: Kabuki‑za, Minami‑za, the National Theatre in Tokyo, and Zenshin‑za, and through interviews with actors and people of the theatre. In parallel, Ukiyo‑e images of the Edo period are studied, with core research from the National Museum in Kraków, Poland, and its collection of Japanese woodblock prints (including over 4600 original works from the Edo Period, and with special attention paid to the yakusha‑e portrait by Utagawa Kuniyoshi.
The pain of labour: Perspectives of traditional birth attendants in Edo ...
African Journals Online (AJOL)
Objective: To determine the concept of labour pain and its relief in a cultural setting using the perspectives of Traditional Birth Attendants (TBAs). Design: Cross Sectional Comparative Study. Setting: An urban area (Benin City) and a semi-urban town (Auchi) in Edo State, Nigeria. Subjects: Traditional Birth Attendants in an ...
Prevalence of diseases among sheep and goats in Edo State, Nigeria
African Journals Online (AJOL)
Clinical records of small ruminant (Sheep and Goat) diseases treated were collected from the veterinary clinics, Ministry of Agriculture and Natural Resources of three Local Government areas in Edo state, for a period of five years (1997-2002). To identify the disease occurrence and prevalence as it militates against the ...
EOS Operations Systems: EDOS Implemented Changes to Reduce Operations Costs
Cordier, Guy R.; Gomez-Rosa, Carlos; McLemore, Bruce D.
2007-01-01
The authors describe in this paper the progress achieved to-date with the reengineering of the Earth Observing System (EOS) Data and Operations System (EDOS), the experience gained in the process and the ensuing reduction of ground systems operations costs. The reengineering effort included a major methodology change, applying to an existing schedule driven system, a data-driven system approach.
Efficiency of resource-use in Cassava production in Edo state, Nigeria
African Journals Online (AJOL)
This study employed the use of the Maximum Likelihood Estimation Technique in estimating the efficiency of resource-use in cassava production in Edo State. Data used for the study were sourced through the cost-route method of data collection, based on a stratified random sampling technique. The average farm size of ...
Youth sexuality and youth age at first sexual intercourse in Edo ...
African Journals Online (AJOL)
... significant (p>0.05), using the chi-square statistic. Finally, it is advocated that such information is important to stakeholders for helping the youth who would certainly not be able to face the challenges of adulthood when they engage in early sexual activity. Keywords: Youth, Sexuality, Age, Sexual Intercourse, Edo Central ...
Poultry production constraints: the case of Esan West LGA of Edo ...
African Journals Online (AJOL)
Poultry production constraints: the case of Esan West LGA of Edo State, Nigeria. ... They also identified the lack of good quality water, and proper marketing outlets. High cost and at times ... By so doing, their resources `can be pooled together for meaningful development of their farms and the poultry industry in general.
Quality of life among female workers in edo state: consideration of ...
African Journals Online (AJOL)
This study examined the role of age, marital status and job-type on quality of Life amonge female workers in Edo State (N =188). Results from t-test revealed that female teachers reported better quality of life than female police officer, married female workers reported better quality of life than single female workers, while ...
Costs and return analysis in rubber latex production in Edo State ...
African Journals Online (AJOL)
The study examined the costs and return analysis in rubber latex production in Edo Sate, Nigeria. Multi-stage sampling method was adopted to select 96 smallholder rubber framers for the study. The first stage was a purposive sampling of two LGAs and then simple random sampling of 6 villages each from the two LGA.
Sino-Japanese Interaction via Chinese Junks in the Edo Period
MATSUURA, Akira
2010-01-01
To maintain its policy of national isolation during the Edo period, Japan restricted contact with the outside world to Dutch merchant ships and Chinese junks at the Japanese port of Nagasaki. Sino-Japanese interaction consisted not only of trade in goods, but also of cultural and scholarly exchanges. This paper will examine how this unofficial trade affected both Japan and China from a cultural perspective.
Mathematics Teachers' Use of Ethnomathematics Approach in Mathematics Teaching in Edo State
Aikpitanyi, Lucky Aiwuyor; Eraikhuemen, Lucy
2017-01-01
The study investigated mathematics teachers' use of ethnomathematics approach to teaching. Descriptive survey research was used with a target population of all mathematics teacher in all public secondary schools in Oredo, Egor and Ikpoba-Okha local government areas of Edo State out of which 121 mathematics teachers in 42 randomly selected public…
Insectos de importancia forense en cadáveres de ratas, Carabobo - Venezuela
Directory of Open Access Journals (Sweden)
Jonathan Liria Salazar
2006-01-01
Full Text Available Objetivos: Determinar la composición de la entomofauna asociada con cadáveres de ratas, para identificar las especies de importancia forense en Carabobo, Venezuela. Materiales y métodos: Se estudiaron los insectos en nueve cadáveres de ratas de laboratorio. Diariamente cada rata (cadáver + bandeja con tierra de sustrato fue recogida para obtener la fauna asociada. Con los datos de abundancias se calcularon índices de diversidad y equidad, y se empleó el análisis de componentes principales. Resultados: Se colectaron 13 590 insectos, de los cuales 14,8% correspondieron a cadáveres y 85,2% a bandejas. El orden Diptera fue el más abundante (94,2% seguido por Coleóptera e Hymenóptera (0,2%. Las especies de Diptéra más importantes fueron: Calliphoridae: Lucilia cluvia (Walker, Chrysomya albiceps (Wiedemann y C. megacephala (Fabricius; y Muscidae: Musca domestica Linnaeus. También se encontraron algunos coleópteros como Dermestes ater DeGeer (Dermestidae y Staphylinidae. Conclusiones: La equidad y diversidad fue baja, debido a la dominancia de especies, y la poca sensibilidad de los índices de diversidad a la presencia de especies raras. Se observó la sucesión de especies en donde L. cluvia se relaciona con los primeros días, seguida por C. albiceps y C. megacephala. Se recomienda continuar con estudios relacionados, para su uso como herramienta de ayuda en la medicina legal en Venezuela.
Test of the Practicality and Feasibility of EDoF-Empowered Image Sensors for Long-Range Biometrics.
Hsieh, Sheng-Hsun; Li, Yung-Hui; Tien, Chung-Hao
2016-11-25
For many practical applications of image sensors, how to extend the depth-of-field (DoF) is an important research topic; if successfully implemented, it could be beneficial in various applications, from photography to biometrics. In this work, we want to examine the feasibility and practicability of a well-known "extended DoF" (EDoF) technique, or "wavefront coding," by building real-time long-range iris recognition and performing large-scale iris recognition. The key to the success of long-range iris recognition includes long DoF and image quality invariance toward various object distance, which is strict and harsh enough to test the practicality and feasibility of EDoF-empowered image sensors. Besides image sensor modification, we also explored the possibility of varying enrollment/testing pairs. With 512 iris images from 32 Asian people as the database, 400-mm focal length and F/6.3 optics over 3 m working distance, our results prove that a sophisticated coding design scheme plus homogeneous enrollment/testing setups can effectively overcome the blurring caused by phase modulation and omit Wiener-based restoration. In our experiments, which are based on 3328 iris images in total, the EDoF factor can achieve a result 3.71 times better than the original system without a loss of recognition accuracy.
An exploration of life experiences of left behind wives in Edo State, Nigeria
Directory of Open Access Journals (Sweden)
Adediran Daniel Ikuomola
2015-06-01
Full Text Available Research emphasising effects of migration on left behind families often focus on implications of absent fathers, particularly in Africa and areas with historic male migration. Yet, information on the experiences of left behind wives in a patriarchal and familial setting is scanty. This Study explore the socio-cultural challenges facing wives of migrants (Bini women, in Edo State, Nigeria. Specifically it examines the stigmatised experiences and the effect of cultural constrains on women adjustment to life in the absence of their husbands. Drawing on qualitative data collected from in-depth interviews with twenty-one (21 left-behind wives in Benin, Edo State. The study shows how women are confronted with traditions and the need to readjust their lives amidst cultural and familial cooperations and constrains. Narratives buttressed on the excessive surveillance through significant others and the renegotiation of living arrangements based on patriarchal values and expectations. Life adjustment was described as stigmatic, hectic and demanding in maintaining the home front.
A study of blood and gastro-intestinal parasites in Edo state | Mordi ...
African Journals Online (AJOL)
A four-year study to determine the prevalence of both blood and gastro-intestinal parasites of man was done in all the eighteen local government areas of Edo State, Nigeria. The study, which commenced in January of 2000, ended in December of 2004. Of the 136,360 samples examined, 1000 that is 0.7% had parasites.
Test of the Practicality and Feasibility of EDoF-Empowered Image Sensors for Long-Range Biometrics
Directory of Open Access Journals (Sweden)
Sheng-Hsun Hsieh
2016-11-01
Full Text Available For many practical applications of image sensors, how to extend the depth-of-field (DoF is an important research topic; if successfully implemented, it could be beneficial in various applications, from photography to biometrics. In this work, we want to examine the feasibility and practicability of a well-known “extended DoF” (EDoF technique, or “wavefront coding,” by building real-time long-range iris recognition and performing large-scale iris recognition. The key to the success of long-range iris recognition includes long DoF and image quality invariance toward various object distance, which is strict and harsh enough to test the practicality and feasibility of EDoF-empowered image sensors. Besides image sensor modification, we also explored the possibility of varying enrollment/testing pairs. With 512 iris images from 32 Asian people as the database, 400-mm focal length and F/6.3 optics over 3 m working distance, our results prove that a sophisticated coding design scheme plus homogeneous enrollment/testing setups can effectively overcome the blurring caused by phase modulation and omit Wiener-based restoration. In our experiments, which are based on 3328 iris images in total, the EDoF factor can achieve a result 3.71 times better than the original system without a loss of recognition accuracy.
Reategui De Souza, Rosa Guillermina
2014-01-01
El presente trabajo de investigación, tuvo por objetivo Determinar la relación entre la Estrategia metacognitiva y la Competencia de Aprender a aprender en Estudiantes del primer grado de secundaria de la I.E. “Mercedes Cabello de Carbonera”. Lima - 201 4. La investigación es cuantitativa no experimental, se realizó un estudio transeccional descriptivo correlacional. La muestra es probabilística aleatoria simple, con una población de 245 estudiantes, quedando finalmente una ...
Attitude of Local Dwellers towards Ecotourism in the Okomu National Park, Edo State Nigeria
Directory of Open Access Journals (Sweden)
Digun-Aweto Oghenetejiri
2015-12-01
Full Text Available Ensuring local community support for national parks is viewed as a paramount ingredient for conservation and sustainability. This is advocated for the park to meet its conservation goals. The Okomu National Park (ONP, Edo State, Nigeria, is one of such protected areas of lush green rain forest requiring conservation.
Olomukoro, Caroline O.; Adelore, Omobola O.
2015-01-01
The study examined the political empowerment of women through literacy education programmes in Edo and Delta States in the South-South Geopolitical zone of Nigeria. A sample of 1022 women was randomly drawn from the different levels of literacy classes organised by the Agency of Adult and Nonformal Education and non-governmental and private…
Ultra-fast and sensitive photo-induced phase switching in (EDO-TTF)2PF6
International Nuclear Information System (INIS)
Chollet, Matthieu; Guerin, Laurent; Uchida, Naoki; Fukaya, Souichi; Ishikawa, Tadahiko; Koshihara, Shin-ya; Matsuda, Kazunari; Yamochi, Hideki; Ota, Akira; Saito, Gunzi
2005-01-01
Organic conductor (EDO-TTF) 2 PF 6 crystal having 14 filled band shows a metal (M)-insulator (I) transition accompanied with Peierls transition, charge ordering, and anion ordering at transition temperature, T C =280K. This crystal is an important and fascinating candidate for photo-induced M-I transition because the multi-instability will afford sensitivity to the tiny stimulation. We make the report of the reflectivity change in (EDO-TTF) 2 PF 6 crystal induced by the irradiation of femto-second (fs) pulsed laser (pulse width: 120fs, main wavelength: 800nm, repetition rate: 1kHz). The obtained results indicate that the highly efficient I-to-M transition occurs within 3ps in this material. Based on these results, the strong electron-lattice cooperative interaction is proved to play an essential role in the driving process of this M-I transition. Also, 14 filled materials, which show M-I transition, accompanied with the charge ordering, can be classified as fascinating candidates not only for superconductivity but also for photo-induced cooperative phenomena and application in phase switching devices
Directory of Open Access Journals (Sweden)
Nicholls Clara I.
2000-12-01
Full Text Available En el manejo de plagas es factible incrementar poblaciones de enemigos naturales, diversificando el hábitat. En los agroecosistemas es reconocida la importancia de la vegetación marginal para la sobrevivencia de parasitoides y predatores. En cultivos comercialees de viñedos, manejados orgánicamente, se adelantó este trabajo, se establecieron corredores de 65 especies diferentes de plantas con flores. Los cultivos de cobertura se sembraron en hilera por medio cada año. Los viñedos recibieron en promedio 2 toneladas de compost por hectárea. Para el control de enfermedades se empleó preventivamente azufre. Se pretendió precisar si el corredor de 200 metros de largo, podría incrementar el control biológico de insectos plaga en el viñedo. Se evaluó la contribución del corredor como proveedor de recursos alimenticios alternativos, consistentes, abundantes y bien distribuidos de enemigos naturales. Se comprobó la utilidad del corredor para incrementar los niveles poblacionales de insectos benéficos.
Festival of Curses: A Traditional Crime Control Method In Edo State –Nigeria
Directory of Open Access Journals (Sweden)
Rashidi Akanji Okunola
2016-02-01
Full Text Available Festivals and ceremonies are part and parcel of African culture, usually in all its pump, merriment and pageantry. However, with the increasing wave of criminal activities in Nigeria especially in Edo state, festivals and ceremonies are being redefined and conceptualized in practice. Only recently a new festival ‘Festival of Curses’ was brought to the fore in combating crime in Edo state. The study therefore seeks to explain the festival as a traditional mechanism in crime control, the nature of the festival, the factors that led to its emergence in the 21st century, the level of acceptance and its impact in reducing criminal activities in the State. The study employed principally secondary literature and in-depth interviews among a cross section of the Bini. Major findings revealed that immediately after the festival of curses, a lot of criminals in the state besieged the Bini Monarch’s Palace to confess their atrocities; and pleaded for forgiveness. There was an overwhelming acceptance of the festival irrespective of the people’s religious affiliations to Christianity and Islam as a result of the potency and sudden drop in crime during the period. The study concludes that the festival should be taken as a mechanism of crime control and policing in Nigeria.
Investigación de trihalometanos en agua potable del Estado Carabobo, Venezuela
Directory of Open Access Journals (Sweden)
Sarmiento A.
2003-01-01
Full Text Available Objetivo: La desinfección del agua con cloro en las plantas de potabilización da lugar a la formación de trihalometanos (THM. Estos compuestos están asociados a efectos adversos para la salud. En este estudio se determinó la concentración de THM en el agua para consumo humano suministrada por las redes de distribución de los dos principales sistemas de potabilización de agua del Estado Carabobo, la planta Alejo Zuloaga y el embalse Pao-Cachinche que forman el Sistema Regional del Centro I (SRC-I y la planta Lucio Baldo Soules y el embalse Pao-La Balsa que forman el Sistema Regional del Centro II (SRC-II. Métodos: Se analizaron un total de 144 muestras recolectadas durante 6 muestreos que se realizaron durante los años 2000 y 2001. La concentración de THM se determinó por cromatografía de gases, mediante la técnica de headspace. Se determinaron las concentraciones para los siguientes THM: cloroformo (CHCl3, bromoformo (CHBr3, dibromoclorometano (CHBr2Cl y diclorobromometano (CHCl2Br. Resultados: La concentración de THM totales estuvo entre 47,84 y 93,23 μg/l. El CHCl3 fue el compuesto predominante, representando el 83% de total de THM para el SRC-I y el 82% en el SRC-II. Se encontró que las concentraciones de THM totales en el SRC-I (Red Baja y Red San Diego son significativamente superiores (p < 0,05 con respecto a la concentración máxima permisible establecida por la Agencia de Protección Ambiental de los EE.UU. (80 μg/l para el total de los cuatro THM. Conclusiones: Los resultados demuestran que en la zona de estudio existe un riesgo de efectos adversos para la salud por la presencia de THM en agua de consumo humano, especialmente en la Red Baja y Red San Diego del SRC-I.
Silk and Sakoku : a simulation analysis of industrial location in Edo period Japan
ATSUMI, Toshihiro
2012-01-01
Japan closed itself to international trade from the 17^ century to the mid-19^ century during the Edo period, known as the Sakoku. After the closure, industries dispersed from western coastal cities to inland areas in western and eastern Japan. This paper investigates how the Sakoku may have aff ected industrial locations within Japan by applying a footloose entrepreneur type geography model to an economy with agricultural raw materials in a continuous space setting. The simulations based on ...
Calibration of System Input Volume and Non-Revenue Water Index in Edo North, Nigeria
Philipa O. Idogho; Olotu Yahaya
2013-01-01
Water scarcity is a serious problem in developing world. It could be physical scarcity or economic water shortage. The output of physicsbased study conducted in Edo North, Nigeria revealed that physical water losses in the water distribution network have compounded the accessibility and affordability of safe drinking water. Water supply and loss variables such as Water Supply (WS) Physical Water Loss (WLρ) Apparent Water Loss (WLE) Water Loss Reduction Index (WLRI) and Av...
Gutiérrez Castro, Franklin
2015-01-01
La investigación titulada EFICACIA DEL ALFABETO LLOJE YUPANKI EN LA ENSEÑANZA – APRENDIZAJE DEL QUECHUA COMO SEGUNDA LENGUA EN EL I.S.P.P. MERCEDES CABELLO DE CARBONERA DE MOQUEGUA – 2011da a conocer la experiencia educativa realizada en esta institución en el año 2008, durante los meses de setiembre y octubre. Con un total de ochenta horas pedagógicas: dos horas diarias. El objetivo es demostrar que el Alfabeto Lloje Yupanki es eficaz para el proceso de enseñanza-aprendizaje del quechua co...
Offor, Dianarose Iyeoma; Akinlosotu, Nathaniel Toyosi
2017-01-01
The study investigated attitude towards special need students (SNS) among teachers in public secondary schools in Edo Central Senatorial District. The study was undertaken to determine the teachers' attitude and the influence of gender, educational specialisation and experience on their attitude towards SNS. A total of 369 (50%) of the 739…
Energía renovable e hidrógeno generados in situ para riego y movilidad en viñedos
Directory of Open Access Journals (Sweden)
Carroquino Javier
2017-01-01
Full Text Available La energía utilizada en agricultura es fuente de emisiones de gases de efecto invernadero. Para reducir las producidas por el uso de gasóleo y electricidad, el proyecto europeo LIFE REWIND aborda el suministro desde fuentes renovables. Para ello, se ha caracterizado la demanda energética y recursos renovables en viñedo y bodega. Se ha buscado el diseño óptimo económico y medioambiental de la generación. Se ha instalado un prototipo en una explotación vitivinícola, con generación fotovoltaica, incluyendo un conjunto flotante sobre una balsa. Esto evita el uso de terreno, reduce la pérdida de agua de la balsa y mejora el rendimiento de los paneles fotovoltaicos. La electricidad producida alimenta la depuración de agua y el bombeo de riego por goteo del viñedo. Con la energía sobrante, un electrolizador produce hidrógeno mediante electrólisis del agua, que es utilizado por un vehículo todoterreno con pila de combustible. Los resultados muestran la viabilidad técnica y económica de los sistemas autónomos de energía renovable para alimentar el riego estacional en los viñedos. Así se evitan las extensiones indiscriminadas de la red y los grupos electrógenos diésel. Adicionalmente se muestra la posibilidad de reemplazar el gasóleo por electricidad o hidrógeno producido en la propia explotación.
Directory of Open Access Journals (Sweden)
Juan Jesús Torres
2017-01-01
Full Text Available Coordinado por Daniel Lesmes (Universidad Complutense de Madrid, Gabriel Cabello (Universidad de Granada y Jordi Massó Castilla (Universidad Complutense de Madrid, el número 246 de la revista Anthropos está íntegramente dedicado al pensamiento de Georges Didi-Huberman (Saint-Étienne, 1953, investigador de innegable trascendencia en el estudio sobre las imágenes y cuya recuperación del legado de Aby Warburg ha situado a la historia del arte ante un necesario replanteamiento de sus conceptos originarios, llevando, además, la reflexión sobre las imágenes a una nueva dimensión ética, emocional y gestual. Imágenes traidoras, en aquel sentido de Magritte, insostenibles sin la presencia de otros saberes diferentes y a priori dispares como la propia historia del arte, el psicoanálisis, la filosofía posestructuralista y la antropología. Desentrañar las relaciones que como seres culturales mantenemos con ellas ha sido el motivo del trabajo de Didi-Huberman, capaz de mostrar la importancia de esa dependencia revelando nuestra esgrima con el pasado y, de esta manera, nuestro trato con el presente, su legitimación y las posibilidades de transformación que este ofrece.
Directory of Open Access Journals (Sweden)
Korstanje, Maximiliano
2010-06-01
Full Text Available Resumen: El nacimiento de un hijo es un evento único e irremplazable para todos aquellos que han tenido la experiencia. Para otros, es una oportunidad de asenso social sobre todo sí por ese juego de los genes la criatura se asemeja al estereotipo indoeuropeo nórdico. Por ese motivo, los padres parecen interesados en que sus hijos tengan ojos claros y cabellos rubios tomando esa característica como cualitativamente positiva. Por ese motivo, no resulta extraño que las diferentes imágenes en publicidades de artículos para bebes enfatice en los “ojos azules y los cabellos rubios” como tipos ideales a seguir. La presente investigación ha demostrado que no sólo que los estereotipos dominantes se multiplican sino también se interiorizan generando un diálogo que tiende a reforzar la hegemonía. Por lo demás, se ha observado que discursivamente la claridad es simbolizada como sinónimo de felicidad, armonía, afecto, bondad y seguridad entre otros mientras la oscuridad adquiere categorías semánticas opuestas. Para los padres, que sus hijos tengan ojos “claros” o cabellos “rubios” significa un verdadero asenso social abstracto. Por lo pronto, no cobrarán un canon adicional por traer a la vida a un hijo rubio, pero los acerca notablemente más a las características de los grupos dominantes reforzando así el auto-desprecio por sí mismos.Abstract: Even a memorable moment as the birth of a son can be subject to a much broader pervasive experience. For some people, this event become in an opportunity to social upward wherein convergence genetic and eugenicist thoughts with concentration in Norse phenotype. For that reason, parents are concerned in their sons have bight eyes and blondes hairs. This is based on the postmodern advertising and marketing efforts to emphasize on these features. Under this context, this present research showed not only that dominant phenotypes are divulged thanks to the advertising but also create a
Massive bleaching of coral reefs induced by the 2010 ENSO, Puerto Cabello, Venezuela.
del Mónaco, Carlos; Haiek, Gerard; Narciso, Samuel; Galindo, Miguel
2012-06-01
El Niño Southern Oscillation (ENSO) has generated global coral massive bleaching. The aim of this work was to evaluate the massive bleaching of coral reefs in Puerto Cabello, Venezuela derived from ENSO 2010. We evaluated the bleaching of reefs at five localities both at three and five meter depth. The coral cover and densities of colonies were estimated. We recorded living coral cover, number and diameter of bleached and non-bleached colonies of each coral species. The colonies were classified according to the proportion of bleached area. Satellite images (Modis Scar) were analyzed for chlorophyll-a concentration and temperature in August, September, October and November from 2008-2010. Precipitation, wind speed and air temperature information was evaluated in meteorological data for 2009 and 2010. A total of 58.3% of colonies, belonging to 11 hexacoral species, were affected and the greatest responses were observed in Colpophyllia natans, Montastraea annularis and Montastraeafaveolata. The most affected localities were closer to the mainland and had a bleached proportion up to 62.73+/-36.55%, with the highest proportion of affected colonies, whereas the farthest locality showed 20.25+/-14.00% bleached and the smallest proportion. The salinity in situ varied between 30 and 33ppm and high levels of turbidity were observed. According to the satellite images, in 2010 the surface water temperature reached 31 degree C in August, September and October, and resulted higher than those registered in 2008 and 2009. Regionally, chlorophyll values were higher in 2010 than in 2008 and 2009. The meteorological data indicated that precipitation in November 2010 was three times higher than in November 2009. Massive coral bleaching occurred due to a three month period of high temperatures followed by one month of intense ENSO-associated precipitation. However, this latter factor was likely the trigger because of the bleaching gradient observed.
Alika, Ijeoma Henrietta; Egbochuku, Elizabeth Omotunde
2012-01-01
The study investigated the relationship between vocational interest socio-economic status and re-entry of girls into school in Edo State. The research design adopted was correlational because it sought to establish the relationship between the independent variable and the dependent variable. A sample size of 306 girls who re-enrolled in institutes…
Massive bleaching of coral reefs induced by the 2010 ENSO, Puerto Cabello, Venezuela
Directory of Open Access Journals (Sweden)
Carlos del Mónaco
2012-06-01
Full Text Available El Niño Southern Oscillation (ENSO has generated global coral massive bleaching. The aim of this work was to evaluate the massive bleaching of coral reefs in Puerto Cabello, Venezuela derived from ENSO 2010. We evaluated the bleaching of reefs at five localities both at three and five meter depth. The coral cover and densities of colonies were estimated. We recorded living coral cover, number and diameter of bleached and nonbleached colonies of each coral species. The colonies were classified according to the proportion of bleached area. Satellite images (Modis Scar were analyzed for chlorophyll-a concentration and temperature in August, September, October and November from 2008-2010. Precipitation, wind speed and air temperature information was evaluated in meteorological data for 2009 and 2010. A total of 58.3% of colonies, belonging to 11 hexacoral species, were affected and the greatest responses were observed in Colpophyllia natans, Montastraea annularis and Montastraea faveolata. The most affected localities were closer to the mainland and had a bleached proportion up to 62.73±36.55%, with the highest proportion of affected colonies, whereas the farthest locality showed 20.25±14.00% bleached and the smallest proportion. The salinity in situ varied between 30 and 33ppm and high levels of turbidity were observed. According to the satellite images, in 2010 the surface water temperatura reached 31ºC in August, September and October, and resulted higher than those registered in 2008 and 2009. Regionally, chlorophyll values were higher in 2010 than in 2008 and 2009. The meteorological data indicated that precipitation in November 2010 was three times higher than in November 2009. Massive coral bleaching occurred due to a three month period of high temperatures followed by one month of intense ENSO-associated precipitation. However, this latter factor was likely the trigger because of the bleaching gradient observed. Rev. Biol. Trop. 60 (2
"edo jal̀qkina üts̀varòkaetus ma vaelda ..." : [luuletused] / Andreas Kalkun
Kalkun, Andreas, 1977-
2002-01-01
Sisu: "edo jal̀qkina üts̀varòkaetus ma vaelda ..." ; "tsirguq ku kiviq no satassõ taivast aràlaq ..." ; "vahtsõq silmäq pitsitä pääluu sisse ..." ; "tõppõ tõmmat haigõst ma haarõt jal̀ki ..." ; "arsatas njago sisse aigopiteh ..." ; "rühkeq yks jumalat pallõlda jaloh ..." ; "mu süä om no süüdläne täǹtäseq kuvvõ ..." ; "halvaq haavaq häitsese veiga silmih. Eluloolisi andmeid autori kohta lk. 379
Ogbe, Joseph O.
2015-01-01
The study was meant to analyze Parents and Teachers perception of the use of corporal punishment in primary schools in Edo/Delta state. The purpose was to find time out parents and teachers opinion on the need for continuity or to discontinue the use of corporal punishment among primary school pupils. The method was a descriptive study with the…
Edo Mihevc – urbanist, arhitekt in oblikovalec. Vrednotenje povojnega urbanizma slovenske obale
Directory of Open Access Journals (Sweden)
Jasna Kralj Pavlovec
1999-01-01
Full Text Available Edo Mihevc (1911–1985 je bil eden protagonistov slovenske moderne arhitekture po drugi svetovni vojni in eden Plečnikovih študentov, ki se je ločil od njegove manire ter zakorakal na pot samoizraznosti in iskanja skladja med modernizmom, regionalizmom in humanistično filozofijo. Pomen njegovega prispevka slovenski arhitekturi in kulturi je predstavljen skozi perspektivo večrazsežnostne dejavnosti, s poudarkom na vlogi urbanista slovenske obale. Posamezni deli iz njegovega opusa so predstavljeni z vidika časa nastanka, uporabe in arhitekturne vrednosti, pomen in vloga zamisli ter trendov pa skozi dela. V luči sodobnih doktrin varovanja kulturne dediščine, pravočasna ocena in minimalno varstvo njegove arhitekture mora biti doseženo, tudi za mojstrovine iz bližnje preteklosti.
Directory of Open Access Journals (Sweden)
Antariksa Antariksa
2003-01-01
Full Text Available In the early Edo period the number of memorial cloisters (tacchu increased, especially, at Daitoku-ji and Myôshin-ji temples. As a consequence, the hondô (kyakuden, hojo were further developed in all aspects of architectural style, interior design and plan. This study will attempt to clarify the types of plans at memorial cloisters of both temples, by analyzing the arrangement and composition of the sanctuary, during the Edo period. In that period, the requirement of the rooms was interlaced with the function, and even dependent upon everyday life and the activities of religious services.
Emiri; Ogochukwu T.
2015-01-01
Abstract Libraries all over the world have been faced with the evolving technological advancement globalization and digitization of information. These have led to library automation digital and virtual libraries. This paper discussed the contemporary digital literacy skills DLS among librarians in university libraries the 21st century in Edo and Delta States of Southern Nigeria. The study was guided by six objectives and research questions and one hypothesis. The design of the study is descri...
Enato, E. F. O.; Mens, P. F.; Okhamafe, A. O.; Okpere, E. E.; Pogoson, E.; Schallig, H. D. F. H.
2009-01-01
SUMMARY: This study evaluated malaria care-seeking behaviour, as well as the prevalence of parasitaemia and anaemia among pregnant women attending antenatal clinics of two tertiary healthcare facilities in Edo State, Nigeria. Malaria was highly prevalent in the study group (20% by microscopy and
Parasites of edible land snails in Edo State, Nigeria
Directory of Open Access Journals (Sweden)
Igbinosa I. B.
2016-12-01
Full Text Available Land snails are sources of protein to man and are hosts to a number of parasites. It is imperative that the roles of the snail hosts and parasites are clearly defined. Before then however, the parasites of the different land snails collected in any locality should be identified. Land snails were collected in the wild in both dry and wet seasons. The internal organs and the faeces were examined for the presence of parasite. In the rainy season of 2015, a total of 272 snails were collected across four major towns (Benin, Uromi, Ekpoma and Auchi in Edo State, Nigeria, while in the dry season, fewer snails (n=91 were handpicked. The snail species seen are: Achatina achatina (Linnaeus, 1758, Achatina fulica (Férussac, 1821, Acharchatina marginata (Swainson, 1982, Limicolaria aurora (Jay, 1839, L. flammea (Müller, 1774 and Limicolariopsis spp. The larvae of Strongyloides stercoralis were isolated from the various snail species with overall prevalence of 54.04 %. Snails positive with Alaria mesocercariae were L. aurora, L. flammea and Limicolariopsis spp. Additionally, few L. flammea were positive of the cercariae of Drocoelium dedriticum. Meanwhile, some samples of A. fulica harboured larvae of Angiostrongylus cantonesis, sporocysts of Fasciola gigantica and Schistosoma mansoni. Therefore, these edible snails could pose serious health hazard to man and animals by serving as a possible alternative parasite transmission route.
Irrigation Capability Evaluation of Illushi Floodplain, Edo State, Nigeria
Directory of Open Access Journals (Sweden)
A.S. Umweni
2014-06-01
Full Text Available Many irrigation projects, especially in the developing tropical regions, are embarked upon without any land capability assessment, resulting in avoidable and undesirable ecological consequences. The aim of this study is to assess the irrigation capability potentials of the soils of a rice growing Illushi/Ega community in Edo State of Nigeria. Soils of Illushi/Ega (200 ha were studied to establish their irrigation capabilities. Water samples were collected from the rivers within and near the sites at the proposed points of intake structures and analyzed for salinity (ECw, permeability (SAR and ion toxicity [Chlorine (Cl and Boron (B]. Gravity irrigation suitability assessment was carried out following the guidelines of the United States Bureau for Land Reclamation (USBR, 1953 and FAO (1979. Results showed that about 5.5 % of the land was non-irrigable, 11.5 % was marginally irrigable, 30.5% was moderately irrigable and 52.5 % highly irrigable.Thus about 83 % of the total land area was found to be irrigable. The results of analyses of irrigation water [ECw, SAR and Cl and B (ion toxicity problems in water sources were 0.1 – 0.7 dS m-1, 1.2 – 1.7, 0.6 – 1.8 cmol kg-1 and 0.5 – 0.7 mg kg-1] also show that there is no indication of salinity or ion toxicity problem.
Calibration of System Input Volume and Non-Revenue Water Index in Edo North, Nigeria
Directory of Open Access Journals (Sweden)
Philipa O. Idogho
2013-09-01
Full Text Available Water scarcity is a serious problem in developing world. It could be physical scarcity or economic water shortage. The output of physicsbased study conducted in Edo North, Nigeria revealed that physical water losses in the water distribution network have compounded the accessibility and affordability of safe drinking water. Water supply and loss variables such as Water Supply (WS Physical Water Loss (WLρ Apparent Water Loss (WLE Water Loss Reduction Index (WLRI and Available Water (AW were mathematically modeled to produce realistic and efficient water loss management and improve water revenue. The result of the modeling iterations show that the average physical and apparent losses of 4,000m 3 and 2,700m 3 of (WLρ and (WLE correspond to 13,200m 3 , 6,400m 3 and 0.5 of WS/SIV, AW and WLRI in 2007. Strong indication exists between the WLRI for both physical and apparent losses with the coefficient of determination R 2=0.83 and 0.99 respectively. This relationship shows that more water is being lost through real loss with average total of 59.2% and 40.8% of apparent losses. However, a reduction of Total Non-Revenue Water (TNRW from 50.7% to 10.6% was recorded between 2007 to 2011. This reduction led to a total increase of 4,400m 3 of Revenue Water, decrease in Non-Revenue Water reduction cost from 36% in 2007 to 7% in 2011 and saving of US$17,400 which could be used to provide health facility for malaria treatment for 14,500 people on daily basis. Water efficiency, and particularly drinking water loss, is a serious issue which has significant financial and economic depression; awareness in this respect is totally unrecognized by both individual and governmental sector. Generally, long-term strategies towards the reduction of water losses should continue to be sustained by Edo State government, donor agencies and some private sectors in the area of water supply in order to support the fulfillment of the Millennium Development Goals, control of
Gender issues in contraceptive use among educated women in Edo state, Nigeria.
Osemwenkha, Sylvia Osayi
2004-04-01
While traditional contraception is widely used, in southern Nigerian modern contraception is a relatively recent phenomenon. Modern contraception is more wide spread among the educated and sexually active youth in Nigeria. Few studies have been done on contraception among educated women in Nigeria. This study was carried out in December 2000 to determine factors that influence the choice of contraceptives among female undergraduates at the University of Benin and Edo State University Ekpoma. Data was collected from a sample of 800 female undergraduates matched ethnic group, socio economic status, religion and rural urban residence. Subjects were selected by proportional representation and the instrument used was closed ended questionnaire. The responses obtained were analysed using Spearman Rank Correlation co-efficient and regression analysis. Findings revealed the highest correlation for availability (r =.96) vis a vis the use of various types of artificial contraceptive and cost (r =.96), next was safety (r =.95) and effectiveness (r =.95). Others were peer group influence (r =.80) and convenience (r =.77). An important step in improving women's reproductive health is the involvement of men. Health programmes should conduct campaigns to educate men about reproductive health and the role they can assume in family planning.
ITN utilization among pregnant women attending ANC in Etsako West Lga, Edo State, Nigeria.
Wagbatsoma, V A; Aigbe, E E
2010-06-01
To determine the factors affecting utilization of ITN by pregnant women in Etsako West LGA, Edo State. A descriptive cross-sectional study design was employed. Using a systematic sampling method, a total of 385 respondents were selected from all ANC facilities in the LGA following a verbally obtained consent. Tool for data collection was a semi-structured, researcher administered questionnaire. The respondents' knowledge of cause of malaria was good, as 269 (69%) had good knowledge but only 9 (2.3%) knew its effects on the foetus. Meanwhile, ownership of ITN and its use were very low, 36 (9.3%) and 31 (8.0) respectively. The main factor affecting the use of the commodity in the LGA was unavailability of ITNs. Other factors included belief of the women on the effectiveness of the commodity, level of education, marital status and family sizes ofrespondents. Use of Insecticide treated bed net has been hampered by unavailability of the commodity. It is therefore recommended that efforts should be made to make the commodity available to reduce morbidity and mortality among this vulnerable group.
EDO, Doses to Man and Organs from Reactor Operation Noble Gas and Liquid Waste Release
International Nuclear Information System (INIS)
Rodenas Diago, Jose; Serradell Garcia, Vicente
1983-01-01
1 - Description of problem or function: EDO evaluates individual and collective doses to man from atmospheric releases of noble gases and other gaseous effluents. 2 - Method of solution: The dose calculations are carried out by following the guide- lines of USNRC Regulatory Guide 1.109. Radiation exposure for maximum individuals and population are estimated within 30 km from the nuclear plant. This area is divided into 160 circular trapezoids, to which computations are referred. Four age groups, seven organs for internal dose and two for external dose have been considered. Dose calculations are done through 14 pathways, 7 for liquid effluents, one for noble gases, and 6 for the rest of gaseous effluents. 3 - Restrictions on the complexity of the problem: The following are the maximum dimension sizes preset in the code: 73 radionuclides (other than noble gases); 15 noble gases; 160 circular trapezoids; 31 chemical elements; 4 types of aquatic foods; 15 points of exposure for shorelines; 15 trapezoids influenced by each point; 4 terrestrial food pathways; 100 centres of population. Some of these limits can be varied
EDO, Doses to Man and Organs from Reactor Operation Noble Gas and Liquid Waste Release
Energy Technology Data Exchange (ETDEWEB)
Rodenas Diago, Jose; Serradell Garcia, Vicente [Departamento de Ingenieria Nuclear, Escuela Tecnica Superior de Ingenieros Industriales, Universidad Politecnica, Camino de Vera 2/n Apartado 2012, Valencia (Spain)
1983-10-18
1 - Description of problem or function: EDO evaluates individual and collective doses to man from atmospheric releases of noble gases and other gaseous effluents. 2 - Method of solution: The dose calculations are carried out by following the guide- lines of USNRC Regulatory Guide 1.109. Radiation exposure for maximum individuals and population are estimated within 30 km from the nuclear plant. This area is divided into 160 circular trapezoids, to which computations are referred. Four age groups, seven organs for internal dose and two for external dose have been considered. Dose calculations are done through 14 pathways, 7 for liquid effluents, one for noble gases, and 6 for the rest of gaseous effluents. 3 - Restrictions on the complexity of the problem: The following are the maximum dimension sizes preset in the code: 73 radionuclides (other than noble gases); 15 noble gases; 160 circular trapezoids; 31 chemical elements; 4 types of aquatic foods; 15 points of exposure for shorelines; 15 trapezoids influenced by each point; 4 terrestrial food pathways; 100 centres of population. Some of these limits can be varied.
Murata, T
2001-01-01
Beginnings of the study of Western sciences, "Rangaku," in Kyoto and Osaka in the late 18th century are reviewed. Profiles and achievements of several active learners are briefly described; they include Koishi Genzui (Osaka-Kyoto), Tsuji Ranshitsu (Kyoto), Kimura Kenkadō (Osaka), and Hashimoto Sōkichi (Osaka). Genzui, after having successfully made good relations with Sugita Genpaku and Ohtsuki Gentaku, leading masters of the Edo school, played a role of an advocator for promoting "Rangaku" in Osaka and Kyoto. As a result, Kenkadō attained the publication of his book "Ikkaku Sankō," a monograph of the Western crude drug unicorn, with the help of Gentaku, who had translated a Dutch reference into Japanese for him. Ranshitsu and Sōkichi were taught the Dutch language by Gentaku; Sōkichi is known as the founder of "Rangaku" in Osaka.
Magnetic ground state of quasi-two-dimensional organic conductor, τ-(EDO-S,S-DMEDT-TTF)2(AuCl2)1+y
International Nuclear Information System (INIS)
Nakanishi, T; Yasuzuka, S; Yoshino, H; Fujiwara, H; Sugimoto, T; Nishio, Y; Kajita, K; Anyfantis, G A; Papavassiliou, G C; Murata, K
2006-01-01
To understand the interplay between transport and magnetic properties, quasi-two-dimensional (Q2D) organic conductor τ-(EDO-S,S-DMEDTTTF) 2 (AuCl 2 ) 1+y was studied by measurements of electric resistivity ( ρ a , ρ c ), magnetoresistance (MR), susceptibility (χ) and specific heat (C) in the temperature region between 1 K and 300 K. In spite of the fact that the drastic changes were observed in ρ a , ρ c , MR and χ at T C = 20 K, no anomaly was seen in C. The concentration of spins estimated from M-H curve is about 360 ppm, which is difficult to detect anomaly in C. These data suggest that the number of spins is very small in the ground state like spin-glass system
International Nuclear Information System (INIS)
Stairs, Allen
2007-01-01
Recent results by Paul Busch and Adan Cabello claim to show that by appealing to POVMs, non-contextual hidden variables can be ruled out in two dimensions. While the results of Busch and Cabello are mathematically correct, interpretive problems render them problematic as no hidden variable proofs
Extent of Implementation of Post-Basic Economics Curriculum in Senior Secondary Schools in Edo State
Directory of Open Access Journals (Sweden)
E. O. Oleabhiele
2015-05-01
Full Text Available This study focused on the extent of implementation of post-economics curriculum in senior secondary schools in Edo state. Two research questions and two research hypotheses were formulated to guide the study. The research designed used for the study was the descriptive survey. The population for the study were one hundred and twenty-five (125 economics teachers. A structured questionnaire was used for the collection of data for the study while the research questions were answered using the mean and standard deviation and the research hypotheses were tested using the t-test statistics at an alpha level of 0.05. The results of the study revealed that the curriculum content of economics are adequate and in line the objective of the nation on vision 20:2020. And that the instructional strategies employed by economics teachers to implement the curriculum content are appropriate as specified by the curriculum. Based on the findings, it is recommended that economics teachers should trained to select a use instructional strategies that are learners centred and that economics teachers should be encouraged to attend seminars, workshops in order to improve their teaching skills
Corporate social responsibility in Japan from the Edo period to the Fukushima nuclear accident
International Nuclear Information System (INIS)
Rolland-Piegue, E.
2011-01-01
Behind an apparently universal adherence to corporate social responsibility, differences in approaches are lurking with roots in distinct traditions of thought. Japanese business values date back to merchants during the Edo period and to the pioneers of Japanese capitalism during the Meiji period. They have always emphasized the diversity of all the parties - and not just shareholders - who contribute to a company's prosperity and should share in the benefits. Imported from Europe in 2003, corporate social responsibility was quickly institutionalized by Japanese firms that want to comply with international standards. This concept, Japanese-style, barely touches on social questions, which are referred to traditional values; but focuses instead on environmental issues and consumer protection. Non governmental organizations are not very active in Japan, and the state refuses to take a leading role even though its pro-business policy supports corporate social responsibility and should help, for example, diffuse the new standard, Iso-26000. Since March 2011, a new phase, laden with uncertainty, has started. The most devastating earthquake since World War II and the crisis at the Fukushima Daiichi nuclear power station should lead the Japanese to raise fundamental questions about what they expect from firms and public authorities. (author)
Directory of Open Access Journals (Sweden)
Claudia Arroyave
2004-09-01
Full Text Available Las intoxicaciones por tinturas para el cabello son infrecuentes en Antioquia; sin embargo, su toxicidad es potencialmente letal cuando ingresan al organismo por vía oral al producir un compromiso multiorgánico que puede llevar a la muerte del paciente. Se presenta el caso de una paciente de 2 años que ingirió una dosis de 125 mg/kg de parafenilendiamina, asociada a ácido bórico y perborato de sodio, compuestos que hacen parte de una presentación comercial de una tintura para el cabello; la intoxicación por parafenilendiamina tuvo como consecuencia principal la obstrucción de la vía aérea por angioedema que requirió intubación endotraqueal, soporte ventilatorio y administración de esteroides y antihistamínicos; secundario al compromiso aéreo la paciente presentó edema agudo de pulmón y posteriormente un cuadro neumónico que requirió tratamiento con antibióticos. Adicionalmente presentó rabdomiolisis severa que se trató con líquidos endovenosos para que no se comprometiera la función renal. Luego de una terapia durante 10 días en el hospital, la niña fue dada de alta con resolución completa del cuadro tóxico. Se revisan los posibles mecanismos fisiopatológicos, las manifestaciones clínicas y el tratamiento de la intoxicación por parafenilendiamina, dado que este fue el compuesto tóxico clínicamente importante en el contexto de este caso. There have been few cases reported of intoxication by hair dyes in Antioquia; however, their toxicity may be potentially lethal when their components enter the organism by oral route inducing a multiorganic compromise that may lead to death. We report the case of a two year old girl who ingested 125mg/kg of paraphenylenediamine, with boric acid and sodium perborate; these compounds are part of the commercial presentation of a hair dye; the child suffered airway obstruction because of angioedema that required intubation, ventila tory support, steroids and antihistaminics; due to
Directory of Open Access Journals (Sweden)
Osaretin Oviasu
2016-05-01
Full Text Available Chronic kidney disease (CKD is a growing problem in Nigeria, presenting challenges to the nation’s health and economy. This study evaluates the accessibility to healthcare in Edo State of CKD patients diagnosed between 2006 and 2009. Using cost analysis techniques within a geographical information system, an estimated travel time to the hospital was used to examine the spatial accessibility of diagnosed patients to available CKD healthcare in the state. The results from the study indicated that although there was an annual rise in the number of diagnosed cases, there were no significant changes in the proportion of patients that were diagnosed at the last stage of CKD. However, there were indications that the travel time to the hospital for CKD treatment might be a contributing factor to the number of diagnosed CKD cases. This implies that the current structure for CKD management within the state might not be adequate.
Dos momentos de la medicina colombiana
Directory of Open Access Journals (Sweden)
Andrés Soriano Lleras
1963-06-01
Full Text Available El doctor Nicolás Osorio publicó en el número 37, serie IV, correspondiente al 15 de mayo de 1876, de la "Revista Médica", una nota titulada "Enfermedad del cabello llamada en el Cauca Piedra", en el cual después de hacer una somera descripción de los caracteres del cabello afectado y de hacer constar que no encontró en los tubérculos de los cabellos afectados ninguno de los géneros puccina, mucor, aspergillio, oidium, acho- rion, microsporo y trichophyton, concluye que la causa de la dolencia es desconocida; que no es enfermedad contagiosa y que hasta ese momento no había sido descrita.
International Nuclear Information System (INIS)
Pessanha, S.; Madeira, T.I.; Manso, M.; Carvalho, M.L.; LeGac, A.; Bardon, T.; Kazarian, S.G.; Silva, R.J.C.
2011-01-01
Full text: In 1543 Portuguese sailors arrived in southern Japan and foreign trade flourished there until they were banned and their missionaries expelled, in the early 1600s. The art that Japanese artists created after this contact has its own name: Namban. This work compares two Namban folding screens that depict the same scene, the arrival in a port which may be Nagasaki. One screen is signed by painter Kano Naizen (1570-1616), contemporaneous of this Namban trade, the other screen is attributed to the Edo period (1615-1868) and is what we could consider a second generation screen, a copy of scenes and characters that appear on the first screen but in increased scale and minor detail. The analysis of the screens was performed in situ using portable EDXRF spectrometry. The equipment used in this study consists on an X-ray generator ECLIPSE II from Amptek, with an Ag anode and an Amptek XR-100CR of Si-PIN thermoelectrically cooled detector. Micro-samples were collected and analysed with Raman spectrometry using the Xplora Confocal Raman microscope by Horiba and analyzed with micro-ATR-FTIR spectroscopy and spectroscopic imaging using a Hyperion FTIR microscope with a Ge crystal and combined with a FPA detector. The palette used by both artists seems very similar, opting to gold, malachite, azurite, vermillion, red lead, white oyster shell, and carbon black. Differences were found, namely the resort to mixtures of pigments in the later screen, namely vermillion with red lead in an orange shade of red, and also the mixture of vermillion and carbon black to obtain a brown color. It was also discovered what seems to be the mineral amazonite in the light blue shades of the screen belonging to the Edo Period. (author)
Energy Technology Data Exchange (ETDEWEB)
Pessanha, S.; Madeira, T.I.; Manso, M.; Carvalho, M.L., E-mail: luisa@cii.fc.ul.p [Centro de Fisica Atomica da Universidade de Lisboa, Lisboa (Portugal); LeGac, A. [Departamento Conservacao e Restauro, Universidade Nova de Lisboa, Caparica (Portugal); Bardon, T.; Kazarian, S.G. [Department of Chemical Engineering, Imperial College London (United Kingdom); Silva, R.J.C. [CENIMAT/I3N, Departamento de Ciencia dos Materiais, FCT, Universidade Nova de Lisboa, Caparica (Portugal)
2011-07-01
Full text: In 1543 Portuguese sailors arrived in southern Japan and foreign trade flourished there until they were banned and their missionaries expelled, in the early 1600s. The art that Japanese artists created after this contact has its own name: Namban. This work compares two Namban folding screens that depict the same scene, the arrival in a port which may be Nagasaki. One screen is signed by painter Kano Naizen (1570-1616), contemporaneous of this Namban trade, the other screen is attributed to the Edo period (1615-1868) and is what we could consider a second generation screen, a copy of scenes and characters that appear on the first screen but in increased scale and minor detail. The analysis of the screens was performed in situ using portable EDXRF spectrometry. The equipment used in this study consists on an X-ray generator ECLIPSE II from Amptek, with an Ag anode and an Amptek XR-100CR of Si-PIN thermoelectrically cooled detector. Micro-samples were collected and analysed with Raman spectrometry using the Xplora Confocal Raman microscope by Horiba and analyzed with micro-ATR-FTIR spectroscopy and spectroscopic imaging using a Hyperion FTIR microscope with a Ge crystal and combined with a FPA detector. The palette used by both artists seems very similar, opting to gold, malachite, azurite, vermillion, red lead, white oyster shell, and carbon black. Differences were found, namely the resort to mixtures of pigments in the later screen, namely vermillion with red lead in an orange shade of red, and also the mixture of vermillion and carbon black to obtain a brown color. It was also discovered what seems to be the mineral amazonite in the light blue shades of the screen belonging to the Edo Period. (author)
Directory of Open Access Journals (Sweden)
López Calderón, Carme
2013-12-01
Full Text Available In this article we deal with the sculptural and pictorial ensemble in the presbytery and transept of the Cathedral of Saint Mary of Mondoñedo, carried out by Francisco José Terán between 1769 and 1773. We propound its analysis from an iconographic point of view so as to, once subjects are identified, go into their symbolic values in depth. With this, our aim is to try to reconstruct the program —the “lost piece of evidence”— that justifies its choice. In doing so, we act according to the function given by E. Gombrich to the Iconology, that also demands to look for the concrete meaning that this illustrated story has within the context in which it appears. Of that way, handling visual and written sources of the period —standing out those referred to the frescoes by Lucas Jordan in the church of The Escorial, whose similarities with the Mondoñedo program are, at least, strinking— and considering the Counter-Reformation teachings about the prerogatives of the Deipara and the spiritual progress of the faithful, we offer an interpretation focused in the Marian exaltation, whose last target is to remind the people the mediation that, in honour of their Redemption, Virgin undertakes between them and God.En el presente artículo abordamos el conjunto escultórico-pictórico del presbiterio y crucero de la Catedral de Santa María de Mondoñedo, ejecutado por José Francisco Terán entre 1769 y 1773. Proponemos su análisis en términos iconográficos, para, una vez identificados los temas, ahondar en sus valores simbólicos de cara a intentar reconstruir el programa —la “prueba perdida”— que justifica su elección. Actuamos así conforme a la función dada por E. Gombrich a la Iconología, la cual asimismo exige buscar el significado concreto que dicha historia ilustrada posee dentro del contexto en que se gesta. De esta manera, consultando fuentes de época, visuales y escritas —destacando las referidas a los frescos de Lucas
Directory of Open Access Journals (Sweden)
Adediran Daniel Ikuomola
2017-12-01
Full Text Available Generally the growing trend of smartphones and selfies cannot be overemphasised in the discourse of social media and mass communication. Selfie is often highlighted as a domain controlled by the youthful population, relegating the agencies of the aged as active participants in the selfie bug. This article captures the agencies of the aged in the use of selfies as a medium of expression. The study employed qualitative research methodology in the data collection through in-depth interviews among a sample of forty-five (45 elderly persons in Edo State, Nigeria. Narratives reveal the ingenuities, nuances and manoeuvring strategies the elderly regularly employ in the use of selfies in their daily routine and social engagements. These narratives were nevertheless not devoid of the need to show-off their achievements and continuous existence and the influence of the younger generation of children and grandchildren, relatives and friends in the use of smartphones and selfies.
Energy Technology Data Exchange (ETDEWEB)
Rolland-Piegue, E. [Ambassade de France au Japon (Japan)
2011-05-15
Behind an apparently universal adherence to corporate social responsibility, differences in approaches are lurking with roots in distinct traditions of thought. Japanese business values date back to merchants during the Edo period and to the pioneers of Japanese capitalism during the Meiji period. They have always emphasized the diversity of all the parties - and not just shareholders - who contribute to a company's prosperity and should share in the benefits. Imported from Europe in 2003, corporate social responsibility was quickly institutionalized by Japanese firms that want to comply with international standards. This concept, Japanese-style, barely touches on social questions, which are referred to traditional values; but focuses instead on environmental issues and consumer protection. Non governmental organizations are not very active in Japan, and the state refuses to take a leading role even though its pro-business policy supports corporate social responsibility and should help, for example, diffuse the new standard, Iso-26000. Since March 2011, a new phase, laden with uncertainty, has started. The most devastating earthquake since World War II and the crisis at the Fukushima Daiichi nuclear power station should lead the Japanese to raise fundamental questions about what they expect from firms and public authorities. (author)
Entropy-Based Economic Denial of Sustainability Detection
Directory of Open Access Journals (Sweden)
Marco Antonio Sotelo Monge
2017-11-01
Full Text Available In recent years, an important increase in the amount and impact of Distributed Denial of Service (DDoS threats has been reported by the different information security organizations. They typically target the depletion of the computational resources of the victims, hence drastically harming their operational capabilities. Inspired by these methods, Economic Denial of Sustainability (EDoS attacks pose a similar motivation, but adapted to Cloud computing environments, where the denial is achieved by damaging the economy of both suppliers and customers. Therefore, the most common EDoS approach is making the offered services unsustainable by exploiting their auto-scaling algorithms. In order to contribute to their mitigation, this paper introduces a novel EDoS detection method based on the study of entropy variations related with metrics taken into account when deciding auto-scaling actuations. Through the prediction and definition of adaptive thresholds, unexpected behaviors capable of fraudulently demand new resource hiring are distinguished. With the purpose of demonstrate the effectiveness of the proposal, an experimental scenario adapted to the singularities of the EDoS threats and the assumptions driven by their original definition is described in depth. The preliminary results proved high accuracy.
Directory of Open Access Journals (Sweden)
Ekaterina Bustamante
Full Text Available Introducción: El Síndrome de Burnout se ha definido como una respuesta al estrés laboral crónico. Debido a la importancia de la labor realizada por los docentes, y los altos niveles de estrés que esta profesión genera, con los agravantes de la presencia de factores externos personales y organizacionales que puedan estar presentes, se hace evidente la necesidad de estudiar en los docentes el síndrome de burnout. Objetivo: Determinar los niveles del síndrome de burnout existentes en el personal docente de la Escuela de Bioanálisis de la Universidad de Carabobo Sede Aragua, Venezuela. Material y métodos: Estudio de campo de tipo descriptivo y documental. La población estuvo constituida por un total de 96 docentes (ordinarios y contratados. Para la selección de la muestra se empleó un muestreo de tipo no probabilístico de carácter intencional, y quedó representada por un total de 78 docentes. Los datos fueron recolectados por medio de un cuestionario, la versión en español del Maslach Burnout Inventory (MBI. Los datos, fueron analizados usando el programa estadístico Minitab 16 y siguiendo los criterios del Manual de EEUU de Maslach y Jackson en cuanto a los puntos de corte para las dimensiones que mide el cuestionario. Resultados: Se obtuvo un 57,69% de respuesta. Se encontró que el 16% de los docentes bajo estudio presenta el síndrome de burnout; mientras que en el resto de los docentes hubo un predominio de niveles medios en las dimensiones Agotamiento Emocional (53%, Despersonalización (33% y Realización Personal (55%. Conclusión: Se concluye que la población bajo estudio, solo presentan el síndrome el 16% de los docentes. Sin embargo en la mayoría de los docentes, hubo un predominio de niveles medios para las dimensiones Agotamiento Emocional, Despersonalización y Realización personal. Según esta combinación de niveles, si no se toman las medidas preventivas para su afrontamiento estos docentes pueden llegar a
Directory of Open Access Journals (Sweden)
Emiri
2015-08-01
Full Text Available Abstract Libraries all over the world have been faced with the evolving technological advancement globalization and digitization of information. These have led to library automation digital and virtual libraries. This paper discussed the contemporary digital literacy skills DLS among librarians in university libraries the 21st century in Edo and Delta States of Southern Nigeria. The study was guided by six objectives and research questions and one hypothesis. The design of the study is descriptive survey and the population consists of all librarians from university libraries in the aforementioned states in Nigeria. The instrument used to generate data is the questionnaire and the date generated was analyzed using simple percentages and frequency count for research questions and SPSS version 14.0. The findings show that electronic mailing social networking use of PDAs mobile phones and internet surfing are the major DLS amongst librarians. It was also discovered that librarians acquired DLS through colleagues assistance trial and error IT programmes and formal education while librarians level of use of DLS is low amongst other findings. Researcher recommends that management of university libraries should provide training for librarians so as to help update their knowledge in application of digital skills and digital skill competence should be giving more attention during recruitment of librarians amongst others.
Enato, E F O; Mens, P F; Okhamafe, A O; Okpere, E E; Pogoson, E; Schallig, H D F H
2009-05-01
This study evaluated malaria care-seeking behaviour, as well as the prevalence of parasitaemia and anaemia among pregnant women attending antenatal clinics of two tertiary healthcare facilities in Edo State, Nigeria. Malaria was highly prevalent in the study group (20% by microscopy and estimated 25% by PCR), but parasitaemia and incidence decreased with increasing number of pregnancies. Although the level of education of the study participants was relatively high, antimalarial control measures during pregnancy were found to be poorly utilised by the women and malaria care-seeking was often delayed. A minority of the interviewed pregnant women said they had received sulphadoxine/pyrimethamine-based intermittent preventive therapy (IPT) during current pregnancy. Moreover, the use of inferior antimalaria treatment (e.g. chloroquine) was frequent. The majority of the pregnant women, mainly primigravidae, were anaemic. Efforts to improve antimalaria healthcare must be intensified, targeting pregnant women, particularly the primigravidae and secundigravidae and the healthcare providers.
Vid, viñedos y vino en Sefarad : cultivo elaboración y comercio de un vino diferenciador
Directory of Open Access Journals (Sweden)
Ana María Rivera Medina
2007-01-01
Full Text Available Las comunidades hebreas peninsulares, a lo largo de la Edad Media, desarrollaron un complejo sistema de cultivo, elaboración y comercio del vino acorde con prescripciones religiosas ligadas al concepto de pureza. De ahí, que vista su importancia pretendemos analizar su función como bebida en las festividades religiosas y celebraciones; la jurisprudencia relativa a la propiedad, el cultivo y la elaboración del vino judío; y finalmente, mostrar cómo las comunidades sefardíes o sus individuos acceden a la tierra, cómo se trabajan estos viñedos y se genera una industria subsidiaria, a pesar de las diversas restricciones que se imponen desde una sociedad mayoristamente cristiana.The Hebrew communities of the Iberian peninsula, along the Middle Ages, developed a complex system for the cultivation, elaboration and trade of the wine, in agreement with religious prescriptions tied to the concept of purity. In reason to its importance, we will analyze its function like drink in the religious festivities and other celebrations; the jurisprudence relative to the property, cultivation and elaboration of the Jewish wine; and, finally, we will show how the sefardíes communities or their individuals consent to the earth, how these vineyards are worked and a subsidiary industry is generated, in spite of the diverse restrictions that are imposed from a society of Christian majority.
Determinants of cord care practices among mothers in Benin City, Edo State, Nigeria.
Abhulimhen-Iyoha, B I; Ibadin, M O
2012-01-01
Mothers care for their infants' umbilical cord stump in various ways. Different cord care practices have been documented; some are beneficial while others are harmful. Who and what influence the cord care practiced by mothers have, however, not been fully explored particularly in the study locale. The objective of this study was to determine the factors that influence cord care practices among mothers in Benin City. The study subjects included 497 mothers who brought their babies to Well Baby/Immunization Clinic at the University of Benin Teaching Hospital (UBTH), Benin City, Edo State, between July and August 2009. A structured questionnaire served as an instrument to extract information on their biodata and possible determinants of cord care practices. Significantly older women (P=0.023), educated mothers (P=0.029), and those who had male babies (P=0.013) practiced beneficial cord stump care practices. Beneficial cord care practice increased with increasing maternal educational status. The best predictors of beneficial cord care practices are maternal level of education (P=0.029) and infant's sex (P=0.013). The use of harmful cord care practices was more common among mothers who delivered outside the Teaching hospitals. Most (71.2%) of the mothers were aware of hygienic/beneficial cord care. The choices of cord care methods eventually practiced by mothers were influenced mainly by the disposition of nurses (51.3%), participants' mothers (32.0%), and their mothers-in-law (5.8%). There was no significant relationship between cord care practice on one hand and maternal parity, tribe, and socioeconomic classes on the other. The need for female education is again emphasized. The current findings strongly justify the need for public enlightenment programs, using the mass media and health talks in health facilities, targeting not only women of reproductive age but also secondary audience like their mothers, mothers-in-law, nurses, and attendants at health facilities
WEST AFRICAN JOURNAL OF MEDICINE
African Journals Online (AJOL)
user1
Departments of *Medicine, University of Benin Teaching Hospital, Benin City, Edo State, †Medicine, College of Health Sciences,. Benue State University, Makurdi, Benue State, Nigeria. *Correspondence: Dr Andrew Edo, PO BOX 10458, Ugbowo, Benin City, Edo State. E-mail: osayumen@yahoo.com. Tel No.
Directory of Open Access Journals (Sweden)
C.I. Cragnolini
2009-12-01
Full Text Available Desde 2001 se observan en viñedos de Córdoba, Argentina, hojas de Vitis vinifera y V. labrusca con manchas cloróticas y centro necrótico. Las plantas presentan nervaduras, pecíolos, raquis y entrenudos con puntos necróticos que al confluir agrietan el tejido cortical. Las bayas pueden marchitarse y desprenderse. En invierno los sarmientos toman color blanquecino con manchas negras, y en ellos y en órganos secos aparecen picnidios con cirros blanco-crema con conidios alfa y beta. El objetivo fue confirmar la presencia de Phomopsis viticola (excoriosis y cuantificar su incidencia. Se realizaron aislamientos a partir de pecíolos, brotes, zarcillos, bayas y sarmientos que produjeron micelio claro con picnidios y conidios alfa (7,5m±1,5 x 2,8m±2 y beta (19m±1 x 1,2m±0,5 o sólo alfa, típicos de P. viticola. La identificación fue confirmada mediante secuenciación molecular. En brotes de las variedades Malbec y Pinot noir inoculados con 3 10(4 conidios/mL, las hojas mostraron lesiones y picnidios 8 días después, y las bayas cirros amarillos a los 15-18 días. P. viticola (Sacc. Sacc. fue reaislado de los cirros y las colonias produjeron picnidios y conidios característicos 10-20 días después. Se detectó excoriosis en 80% de los viñedos evaluados, con mayor incidencia en viñedos añosos de las variedades Pinot noir e Isabella.Leaves with chlorotic spots and necrotic centers have been observed in Vitis vinifera and V. labrusca in vineyards of Córdoba, Argentina, since 2001. Plants exhibit veins, petioles, rachises, and internodes with necrotic spots that coalesce to form cracks in the cortical tissue. Grape berries can shrivel and fall off. Winter canes became whitish with black spots; pycnidia appear in canes and in dry organs, exuding whitish-cream cirri with alpha and beta conidia. The aim of this work was to confirm the presence of Phomopsis viticola (excoriosis and quantify its incidence. Isolates obtained from petioles
Directory of Open Access Journals (Sweden)
Mónica Núñez Flores
2010-10-01
Full Text Available Las esponjas son uno de los grupos de animales sésiles más abundantes y diversos de los fondos marinos tropicales, siendo un componente importante en los arrecifes coralinos, aunque poco estudiado a nivel de especies. El objetivo de este estudio fue caracterizar la comunidad de esponjas en el gradiente de profundidad de un arrecife coralino en Isla Larga, Parque Nacional San Esteban, Venezuela. Se trabajaron siete profundidades (1, 3, 6, 9, 12, 15 y 18m donde se midió la sedimentación neta y bruta, el índice de rugosidad, y se evaluó la riqueza, densidad y cobertura de las esponjas. Se identificaron 17 especies en 10 familias. La mayor densidad y cobertura se encontró a los 6m (6.03ind/m2, 11%, coincidiendo con la mínima sedimentación neta y la máxima rugosidad del sustrato. Las especies más abundantes fueron Desmapsamma anchorata, Amphimedon erina y Scopalina rueztleri. El análisis de componentes principales arrojó una separación de esta comunidad en 3 zonas, la somera (1 y 3m, donde las esponjas están sometidas a una tensión producida por el oleaje y alta iluminación, y las zonas media (6, 9 y 12m y profunda (15 y 18m, con características más favorables, dada una menor iluminación y sedimentación.Sponges (Porifera distribution along a depth gradient in a coral reef, Parque Nacional San Esteban, Carabobo, Venezuela. Sponges constitute one of the most diverse and abundant animal groups in the marine tropical benthos especially in coral reefs, though poorly studied to species level. The aim of this study is to characterize the sponge community along a depth gradient at Isla Larga (Parque Nacional San Esteban, Venezuela fringe reef. Net and total sedimentation, roughness index, sponge species richness, density and proportion of the bottom covered by sponges, were evaluated at seven depths (1, 3, 6, 9, 12, 15, 18m, 17 species were identified grouped in 10 demosponges families. The highest densities and coverage corresponded to
Caries dental aguda del primer molar permanente en niños de 12 años
Directory of Open Access Journals (Sweden)
Daniel Enrique Reyes Romagosa
Full Text Available Introducción: el primer molar permanente es considerado la llave de la oclusión dentaria, la presencia de caries en éste es elevada, lo que dificulta el logro de las metas trazadas por organizaciones de salud a nivel mundial en este grupo de edad. Objetivo: determinar el comportamiento de la caries dental aguda en primer molar permanente en una población de 12 años de edad atendida en la Clínica Estomatológica Santa Cruz de la Parroquia Goaigoaza. Métodos: se realizó un estudio descriptivo transversal en la Clínica Estomatológica Santa Cruz. Parroquia Goaigoaza, municipio Puerto Cabello, estado Carabobo, en el período comprendido entre abril del 2009 a abril 2010. Se seleccionaron 97 pacientes de 12 años de edad los que constituyeron el universo y la muestra. Acudieron a la consulta por dolor debido a la presencia de caries dental aguda. Se registraron las variables: edad, sexo, grado clínico de la caries dental, estímulos externos que provocaron dolor, la cara dental y la arcada dentaria más afectadas. La información fue recogida mediante interrogatorio y examen clínico. Resultados: el sexo masculino representó el 63,9 %. La caries dental de 3er grado estuvo presente en un 68 %. Los estímulos externos que provocaron dolor fueron: el frío presente en 75,2 % y los alimentos dulces en 69,1 % en ambos sexos. El primer molar inferior derecho resultó más afectado (46,4 % que el izquierdo (36,1 %, así como la arcada dentaria inferior (25,8 % y la cara oclusal (64,9 %. Conclusiones: predominaron el sexo masculino y la caries dental aguda de 3er grado. El frío y los alimentos dulces fueron los estímulos externos más frecuentes. Los más afectados resultaron el primer molar inferior derecho, la cara oclusal y la arcada dentaria inferior.
Isara, A R; Isah, E C
2009-09-01
To assess the knowledge and practice of food hygiene and safety among food handlers in fast food restaurants in Benin City, Edo State. A descriptive cross-sectional study was carried out among 350 respondents who were selected by means of a systematic sampling method and interviewed using a semi-structured researcher-administered questionnaire. An observational checklist was thereafter used to inspect their personal hygiene status. The mean age of the food handlers was 26.4 +/- 6.1 years. Two hundred and twenty eight (65.1%) were females while 34.9% were males. A majority (98%) of the respondents had formal education. There was good knowledge and practice of food hygiene and safety among the respondents. Knowledge was significantly influenced by previous training in food hygiene and safety (p = 0.002). Food handlers who had worked for longer years in the fast food restaurants had better practice of food hygiene and safety (p = 0.036). The level of education of respondents did not significantly influenced their practice of food hygiene and safety (p = 0.084). Although, 299 (85.4%) food handlers were generally clean, skin lesions was seen in 4 (7.3%) of them. This study showed good knowledge and practice of food hygiene and safety by food handlers in the fast food restaurants in Benin City, but there is need for improvement through training and retraining of food handlers by the management of the restaurants and the local government authorities.
Directory of Open Access Journals (Sweden)
Fatimah Mohammed Palmer
2015-08-01
Full Text Available Body tattooing in traditional Nigerian culture was basically believed to be used for identification as well as aesthetic purposes. In some cultures, such as seen amongst the traditional ethnic Hausa and Fulani people, permanent facial marks were used to identify slaves within a community and also used to enhance the beauty and appearance of the women folk especially. In the southern part of Nigeria, amongst the Yorubas, it is used as a tribal identification symbol that provides information about the individual, as well as some culturally-related beliefs. The use of tattoos among the Esan ethnic people transcends the purposes of identification and enhancement of physical appearance as discovered. Thus this study examines the use of tattoo as a curative process for the illness called Udeh among the Esan ethnic people of Edo state Nigeria. Udeh is an illness associated with infection of the spleen. Data was collected through visitation of traditional healing venues, oral interview of some traditional doctors and elders as well as direct observation of the treatment processes. Findings indicated that the practice of Uvinmi has been in existence from time immemorial and it is a familial profession inherited from generation to generation as the most effective medium for treating spleen related diseases among the Esan people. It was also discovered contemporarily modern medical anaesthesia is employed to help reduce the agony felt in the process of blade incision as practiced by one of the traditional doctors. Recommendation made include an indebt study of the herbs used during and after treatment to gauge its efficacy on Western medicinal practices as well as proper sterilisization processes on incision equipments and procedures amongst others.
Directory of Open Access Journals (Sweden)
Julio Fernández Portela
2016-12-01
Full Text Available Resumen: El tema del paisaje se encuentra dentro del currículo de Educación Infantil y de Educación Primaria, a través del cual se puede trabajar otro tipo de contenidos. Este trabajo presenta la pintura como una herramienta didáctica utilizada para el estudio de los temas de paisaje, y que mediante la observación de los cuadros los profesores pueden explicar otros elementos que conforman el espacio geográ co que permitan a los alumnos ver la utilidad del arte como una fuente que les proporciona información del medio que los rodea. Palabras clave: Recurso didáctico, pintura, viñedos, Castilla y León, paisaje. Abstract: The theme of the landscape is in the curriculum of Early Childhood Education and Primary Education, through which you can work other content. This paper presents painting as a didactic tool used to study the issues of landscape, and by observing the pictures teachers can explain other elements of the geographic space that allow students to see the usefulness of art as a source that provides information environment around them.
Directory of Open Access Journals (Sweden)
Carla Vanina DAGATTI
2015-01-01
Full Text Available La temperatura es la variable que más incide en el desarrollo de Lobesia botrana (Den & Schiff, cuya relación ha sido estudiada mediante modelos matemáticos, como el de Touzeau. En Mendoza, en 2010 se registró la aparición de L. botrana. El objetivo de este trabajo es ajustar el modelo de Touzeau para predecir el comportamiento de la polilla. El estudio se realizó en un viñedo cv. Malbec desde 2012. Se emplearon trampas de feromonas. La temperatura se registró con un sensor datalogger. Se calculó la integral térmica con la fórmula de Touzeau con un umbral de 10ºC desde el 1 de julio de cada año. Los resultados indicaron que el primer vuelo se desarrolló el 18 y el 20 de octubre con 204,05 ± 10,73 grados día, el segundo en la primera decena de diciembre con 728,34 ± 41,95 grados día, el tercero durante la última quincena de enero con 1329,08 ± 151,35 grados día y el cuarto a mediados de febrero de 2012 y 2013, respectivamente con 1721,84 ± 116,63 grados día. Estos resultados son útiles para predecir la aparición de la plaga y como herramienta para establecer un sistema de alarma para los productores.
92 INSULIN RESISTANCE: CAUSES AND METABOLIC ...
African Journals Online (AJOL)
drclement
2009-12-01
Dec 1, 2009 ... Edo State Institute of Technology and Management. Usen, Edo State ... type 2 diabetes mellitus. The cause of the vast ... Insulin (molecular mass 6000D) consists of 51 amino acids .... Experimental Biology and. Medicine 2004 ...
... Safe Videos for Educators Search English Español Skin, Hair, and Nails KidsHealth / For Parents / Skin, Hair, and ... piel, el cabello y las uñas About Skin, Hair and Nails Skin is our largest organ. If ...
Directory of Open Access Journals (Sweden)
Rotimi Rufus Ipinmoroti
2014-06-01
Full Text Available A study was conducted to assess nutrient dynamics of soils under old and young cocoa, coffee and cashew plantations and the leaf nutrient contents of the crops at Uhonmora, Edo State, Nigeria for proper cultural and soil fertility management of the plantations. Soil and crop leaf samples were collected from each plantation using a random sampling technique. The samples were analyzed using standard procedures for sand, silt, clay, pH (H2O, electrical conductivity (EC, total N, available P, K, Ca, Mg, Na, and Effective Cation Exchange Capacity (ECEC. Leaf samples were analyzed for N, P, K, Ca, Mg and Na. Data were compared with the corresponding soil and foliar critical nutrient values for each crop. Results indicated that the soils were texturally sandy clay loam and acidic. The soils varied in their nutrient contents, with soil P for the old cocoa, young coffee and cashew plantations far below critical values. The young cashew plot was low in N content but adequate for other plots. However, the soil ECEC increased with the increasing of calcium contents. Leaf N was below critical for all the crops. Leaf K was low for cocoa and coffee plants, leaf Ca was low for the young cashew plants, while leaf Mg was low for the young cocoa and old cashew. The high soil Mg/K ratio of 8.7- 22.3 as against the established value of 2.0 might have resulted in gross nutrient imbalance which must have affected the absorption and utilization of other nutrients. Hence, adequate soil N did not translate the same availability to the crops. The ECEC showed that the soil needs to be improved upon for sustainable productivity. Soil nutrient content variation across the plantations with age of establishment will necessitate the need for consistent routine soil nutrient assessment for proper and balanced soil nutrient supply to the crops, for healthy crop growth and optimum yield. Management practices of soil surface mulching using organic wastes and cover crops under
Les jeunes s'engagent dans la lutte contre le sida | CRDI - Centre de ...
International Development Research Centre (IDRC) Digital Library (Canada)
14 janv. 2011 ... Les nouvelles technologies de l'information et de la communication (TIC) ... Ernesto Cabellos - Dans quel contexte social s'inscrit le projet Punto J ? .... Les jeunes apprennent ainsi à éviter de représenter les femmes comme ...
Zhou, M; Ye, J
2017-11-28
Japanese physicians of Edo Period (1603-1867) wrote many dietetic books, by combining the knowledge system (content and compiling style) and thoughts of diet therapy from China with local condition in Japan. Among them, the Pao chu bei yong wo ming ben cao ( Japanese Materia Medica Prepared for Kitchen ), written by Mukai Genshou, a physician in the early Edo, is the earliest comprehensive work of dietetic materia medica. In this book, the choice and usage of Japanese dietetic materia medica reveals obvious Japanese local color, including the name, morphology, cultivation, collection, identification, nature and flavor, and indication etc., reflecting the sprouting idea of edible herbal plant at the beginning of Edo period and the characteristic of absorbing Chinese diet thoughts by Japanese physician. This is the important first-hand historical material to understand the development of Japanese dietetic herbalism in early Edo and its dietotherapy culture.
Soil Characteristics, Microbial Compostion of Plot, Leaf Count and ...
African Journals Online (AJOL)
Soil Characteristics, Microbial Compostion of Plot, Leaf Count and Sprout Studies of Cocoyam ( Colocasia [Schott] and Xanthosoma [Schott], Araceae) Collected in Edo State, ... Science, Technology and Arts Research Journal ... Government Areas (LGA) in Edo state and describe them based on leaf count and sprout
Directory of Open Access Journals (Sweden)
Jesús Rodrigo Comino
2015-01-01
Full Text Available El presente trabajo pretende examinar la respuesta erosiva del suelo en áreas cultivadas de viñe-dos sobre laderas en pendientes elevadas en el Valle del Ruwer (Alemania a través de diferentes técnicas. Los experimentos se desarrollan entre los meses de septiembre y diciembre durante di-ferentes épocas de manejo del suelo: antes, durante y después de la vendimia. En primer lugar, se realiza un análisis de la variación geométrica de tres rills para cuantificar su expansión lateral (de 7 a 13 cm y vertical (1 a 4 cm. El movimiento del suelo confirma una elevada variabilidad en los procesos hidro-geomorfológicos de la ladera. A continuación, a través del cálculo del coeficiente teórico de escorrentía a partir del número de curva y lluvias simuladas en diferentes épocas del año, se observan unas elevadas tasas de infiltración, aunque con resultados muy diferentes entre técnicas. Por último, con el cálculo de la RUSLE (Revised Universal Soil Loss Ecuation y el aná-lisis de las marcas botánicas en los tocones de las parras, se calcula el impacto negativo de la ero-sión con el manejo agrícola del ser humano sobre los suelos de los viñedos. Con ambos métodos, se han obtenido 11.28 t ha-1 y 3.4 t ha-1 año de pérdida de suelo, respectivamente.
liquid soap production with blends of rubber seed oil (rso)
African Journals Online (AJOL)
Department of Chemical Engineering, Edo State Institute of Technology and Management, Usen,. P.M.B 1104, Benin City, Edo State. ... The basic processes for making soap have re- mained unchanged for the past 200 years. How- ... palm kernel oil for good quality liquid soap using locally produced caustic potash from ...
2012-04-27
or 39% of the value of such contracts. Next, a group of nine firms—EDO Communications and Countermeasures Systems, Lockheed Martin, Sociedad ...49,437,854.00 5.94% SOCIEDAD ESPAIOLA DE MONTAJES INDUSTRIALES SA $60,000,000.00 7.21% LOCKHEED MARTIN CORPORATION $79,342,491.00 9.54% EDO
Cocoa Farmers Attitude towards Utilisation of Integrated Pest ...
African Journals Online (AJOL)
The study examined cocoa farmers' attitude towards the utilization of integrated pest management (IPM) in Edo and Ogun States of Nigeria. In Edo State, 60 respondents were randomly selected out of 100 trained cocoa farmers. Random selection of 60 respondents from registered cocoa farmers that were not trained in IPM ...
Directory of Open Access Journals (Sweden)
Ole Kayser
2012-03-01
Full Text Available Uni- or bilateral ejaculatory duct obstruction (EDO is a rare but correctable cause of infertility, chronic pelvic pain and postejaculatory pain. EDO is a congenital or acquired condition, it is the underlying cause of infertility in approximately 5% of infertile men. If acquired, the etiology often remains unresolved, but prostatitis or urethritis with post-inflammatory adhesion of the duct walls seems to be a common underlying pathomechanism. Although a certain constellation of physicochemical semen parameters may lead to correct diagnosis, EDO often resembles a diagnosis by exclusion. Imaging of acquired EDO remains a challenge and the established surgical therapy, transurethral resection of the ejaculatory ducts (TURED, leads to a low rate of natural conception and a high rate of complications such as reflux of urine and epididymitis. We present a case of a male with suspected EDO who underwent a combined approach to both, semi-invasive diagnosis and therapy by transrectal puncture of the seminal vesicles and antegrade balloon-dilation of the ejaculatory ducts. Possibilities and pitfalls of this procedure are described and the literature is reviewed. Furthermore, we suggest a CT- or MRI-guided, percutaneous intervention for treatment of ejaculatory duct obstruction by balloon dilation and demonstrate initial steps of this procedure with a body donor. We call this new procedure PTED (percutaneous transgluteal ejaculatory ductoplasty.
ISLAM IN THE NON-MUSLIM AREAS OF NORTHERN NIGERIA, c
African Journals Online (AJOL)
QUADRI Y A
sculptures, drawings, paintings, animations, sounds, film, video and video games and most predominantly in this modern era, the internet, to portray its sexual themes. Who are the Owan People? The Owan are people of Edo extraction currently scattered around the Owan River in the Northern fringe of Edo State. 19 . They ...
Nature of ergastic substances in some Poaceae seeds
African Journals Online (AJOL)
ajl yemi
2011-08-29
Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011 ... grasses) contribute more food seeds than any other plant family; it contributes about 50% per capita energy ...
The influence of family factors on delinquent adolescents in ...
African Journals Online (AJOL)
This study was carried out with the aim of finding out the influence of family factors on delinquent adolescents in secondary schools in Edo South Senatorial District of Edo State. This study ascertained the extents to which family factors such as parent child rearing style, family type and parent socio economic background ...
Preliminary experiment research of explosively driven opening switch
International Nuclear Information System (INIS)
Li Xiaolin; Chen Dongqun; Li Da; Cao Shengguang; Chen Yingcong
2010-01-01
In pulse power technology field, many loads require high current pulse with fast risetime, but sometimes, the common high current pulse powers don't satisfy request, thus there need pulse erection switches of sorts to shorten pulse risetime. Explosively driven opening switch (EDOS) is a good choice, it has simple structure and excellent performance, the primary parameters of EDOS are opening time, opening resistance, opening current and dissipation energy, which determine its performance and range for applications. For this, two kinds of EDOS are designed and manufactured, in the later experiments, the power supply is a 200 μF capacitor and the conductor is 0.03 mm copper foil, the results indicate that the two kinds of EDOS have good performance, the opening time is about 1-3 μs, the opening resistance is about 1-2 Ω, the opening current is about 24-31 kA and the average dissipation energy is about 0.125-0.34 kJ per groove, the capability of conduction current is adjusted by the thickness of conductor along with different opening current. (authors)
International Nuclear Information System (INIS)
LaBrecque, J.J.; Rosales, P.A.; Cordoves, P.R.
2002-01-01
Soils were collected at different elevations (m.a.s.l.) near the two roadways, that pass through the Henri Pittier National Park (Edo, Aragua, Venezuela) in order to determine the distribution of the concentrations of the 137 Cs fallout and its relation to the tropical cloud forest. Duplicate samples were taken at most elevations between 2-5 cm below the soil surface to confirm that the samples were representative of the area. In many cases, it was difficult or impossible to locate areas that were undisturbed by man or nature. The 137 Cs (Bq/kg) content was determined by conventional high resolution gamma ray spectroscopy employing a standard comparison method. The background of the 137 Cs fallout in soils, below the cloud (fog) baseline was calculated to be about 5 Bq/kg on both the south (land) side and north (ocean) side for both roadways. The concentrations of 137 Cs (Bq/kg) were between 2-3 times higher at the baseline of the cloud (fog) on both sides of the mountain range. The 137 Cs values at the highest elevations (1105 and 1625 m.a.s.l.) near the roadways were about 5-6 times higher than the determined background levels. Our estimates of the baseline of the cloud (fog) are in good agreement with other visual observations. It was concluded that the distribution of 137 Cs in soils in cloud forests can be employed to estimate the baseline and the concentrations of 137 Cs fallout can be related to the relative density of the cloud (fog) when it was deposited. (author)
Shirasugi, Etsuo
2007-03-01
There are two ukiyoe, Japanese woodblock prints, that were produced around 1850 and give a good picture of the images of the insides of the human body that were widely accepted among the common people in the Edo period. The Inshoku yojo kagami (Rules of Dietary Life) shows a man drinking sake. The Boji yojo kagami (Rules of Sexual Life) shows a woman, apparently a courtesan. The purpose of the two ukiyoe was to educate viewers about the functions of the principal inner organs in the traditional East Asian concept of the body and to admonish them against excessive eating, drinking and sexual intercourse. The contrivance of the two ukiyoe lies in their fusion of two formats. One is the format of a see-through body displaying the internal organs. The other is that of explaining the functions of the various internal organs in the form of familiar scenes from the living space of cities and households. Miniature sketches can be seen in the prints of people at work, performing the tasks believed to be that of each organ. However, the scheme of the two ukiyoe was not an innovation of the author of the ukioye. Already in the kibyoshi (Yellow Cover booklets), the scheme of likening the interior of the body to a living space had been adopted. After entering the 18th century, Chinese medical knowledge and anatomical drawings became available. As sex manuals, Yellow Cover booklets, and ukiyoe publications, incorporated and disseminated the newly acquired medical knowledge and the medical concept of the body gradually became the common sense view among people in the street.
Indian Academy of Sciences (India)
Barreto Stephen Dias. A quantum spin system with random inter- actions I. 347. Brock Friedemann. Continuous rearrangement and symmetry of solutions of elliptic problems. 157. Cabello SaÂnchez FeÂlix. Diameter preserving linear maps and isome- tries, II. 205. CosËkun TuÈlin. Weighted approximation of continuous ...
International Nuclear Information System (INIS)
Eze, Kenneth C.
2012-01-01
Background: Musculoskeletal injuries are common in developing countries, but access to high quality orthopedic care is not. Traditional bone setters (TBS) serve to fill the gap, but the nature and quality of their treatment are largely understudied. Traditional bone setting in Idunmunkpaghan clan of Ogwa community, Edo State, Nigeria, was founded by Odion Ekhimere between about 1680 and 1705. The TBS practice in this community is studied to find out the complications and co-morbidities associated with it. Methods: A prospective community-based study of the patients admitted in the traditional bone setters’ homes was done at Ogwa over a -2-year period by studying the admission and discharge radiographs of patients treated in the community and by interviewing the TBS and patients. Result: Ninety patients with radiographs of the lesion sites were followed up from admission to discharge at the TBS homes, comprising 53 males (53.89%) and 37 females (41.11%) with a male to female ratio of 1.4:1. Sixty five patients (72.2%) had fracture or dislocation. Forty four of the 65 patients (67.7%) with fracture/dislocation had complications including mal-union 31(70.4%), secondary osteoarthritis 8 (18.2%), non-reduction of dislocation 7 (11.9%), non-union 8 (18.2%), and others 12 (27.2%). Co-morbidities were identified in 15 patients (16.7%) and included severe osteoarthritis 7 (46.7%), diabetic foot ulcer 4 (26.7%), severe hypertension with cardiomegaly 4 (26.7%), metastatic carcinoma of the prostate 3 (20.0%), septic arthritis 2 (13.3%), pulmonary tuberculosis 1 (6.7%) and others 3 (20.0%). Conclusion: The practice of traditional bone setting is well established in Idunmunkpaghan clan in Ukpogo quarter of Ogwa. Education and training of the TBS is the key to reduction of complications and co-morbidities seen in their practices as they have high patronage and the patients have high regards for them and will continue to patronize them
Energy Technology Data Exchange (ETDEWEB)
Eze, Kenneth C., E-mail: ezechallenge@yahoo.co.uk [Department of Radiology, Faculty of Medicine, College of Health Sciences, Nnamdi Azikiwe University, Nnewi Campus, Anambra State (Nigeria)
2012-09-15
Background: Musculoskeletal injuries are common in developing countries, but access to high quality orthopedic care is not. Traditional bone setters (TBS) serve to fill the gap, but the nature and quality of their treatment are largely understudied. Traditional bone setting in Idunmunkpaghan clan of Ogwa community, Edo State, Nigeria, was founded by Odion Ekhimere between about 1680 and 1705. The TBS practice in this community is studied to find out the complications and co-morbidities associated with it. Methods: A prospective community-based study of the patients admitted in the traditional bone setters’ homes was done at Ogwa over a -2-year period by studying the admission and discharge radiographs of patients treated in the community and by interviewing the TBS and patients. Result: Ninety patients with radiographs of the lesion sites were followed up from admission to discharge at the TBS homes, comprising 53 males (53.89%) and 37 females (41.11%) with a male to female ratio of 1.4:1. Sixty five patients (72.2%) had fracture or dislocation. Forty four of the 65 patients (67.7%) with fracture/dislocation had complications including mal-union 31(70.4%), secondary osteoarthritis 8 (18.2%), non-reduction of dislocation 7 (11.9%), non-union 8 (18.2%), and others 12 (27.2%). Co-morbidities were identified in 15 patients (16.7%) and included severe osteoarthritis 7 (46.7%), diabetic foot ulcer 4 (26.7%), severe hypertension with cardiomegaly 4 (26.7%), metastatic carcinoma of the prostate 3 (20.0%), septic arthritis 2 (13.3%), pulmonary tuberculosis 1 (6.7%) and others 3 (20.0%). Conclusion: The practice of traditional bone setting is well established in Idunmunkpaghan clan in Ukpogo quarter of Ogwa. Education and training of the TBS is the key to reduction of complications and co-morbidities seen in their practices as they have high patronage and the patients have high regards for them and will continue to patronize them.
Prevalencia y factores asociados a la pediculosis en niños de un jardín infantil de Bogotá
Directory of Open Access Journals (Sweden)
Ligia Inés Moncada
2008-06-01
Conclusión. La infestación por P. humanus capitis tiene altas prevalencias en los escolares del jardín. Esta infestación se encuentra asociada a las malas prácticas higiénicas, a convivir con más de cinco personas en la casa y a la longitud del cabello.
Experimental evidence for bounds on quantum correlations.
Bovino, F A; Castagnoli, G; Degiovanni, I P; Castelletto, S
2004-02-13
We implemented the experiment proposed by Cabello in the preceding Letter to test the bounds of quantum correlation. As expected from the theory we found that, for certain choices of local observables, Tsirelson's bound of the Clauser-Horne-Shimony-Holt inequality (2 x square root of 2) is not reached by any quantum states.
Método fisicoquímico para el control de Pediculus humanus capitis
Directory of Open Access Journals (Sweden)
C. Corredor
1994-03-01
Full Text Available La pediculosis humana causada por el ectoparásito Pediculus humanus capitis, ha sido exitosamente controlada utilizando como insecticida los alcoholes presentes en las bebidas etílicas (aguardiente. La acción ietal de los alcoholes de bebida sobre el parásito es atribuida al efecto neurotóxico, así como a su acción desnaturalizante de biomoléculas celulares. El tratamiento se hace cubriendo el cabello y todas las áreas del cuero cabelludo con una bolsa plástica desechable, fijada con cinta adhesiva, previo remojo con 15-50 ml de alcohol de bebida, de todo el cabello. La atmósfera circundante del parásito queda saturada de vapores etílicos, de agua y CO2, por un período de 30-60 minutos, lo cual es letal para huevos, larvas y adultos del insecto parásito. Se dan normas cautelosas para garantizar la acción insecticida de los alcoholes de bebida en el control de la pediculosis.
Verhagen, Lilly M; Incani, Renzo N; Franco, Carolina R; Ugarte, Alejandra; Cadenas, Yeneska; Sierra Ruiz, Carmen I; Hermans, Peter W M; Hoek, Denise; Campos Ponce, Maiza; de Waard, Jacobus H; Pinelli, Elena
2013-01-01
Children in rural areas experience the interrelated problems of poor growth, anemia and parasitic infections. We investigated the prevalence of and associations between intestinal helminth and protozoan infections, malnutrition and anemia in school-age Venezuelan children. This cross-sectional study was conducted in 390 children aged 4-16 years from three rural areas of Venezuela: the Amazon Region, Orinoco Delta and Carabobo State. Stool samples were collected for direct parasitic examinations. Anthropometric indicators of chronic (height-for-age Z score) and acute (weight-for-height and Body Mass Index (BMI)-for-age Z score in respectively children under 5 years of age and children aged 5 years and above) malnutrition were calculated. Multivariate linear and logistic regression models were built to determine factors associated with nutritional status and polyparasitism. Hookworm and Strongyloides stercoralis prevalences were highest in children from the Amazon rainforest (respectively 72% and 18%) while children from the Orinoco Delta and Carabobo State showed higher rates of Ascaris lumbricoides (respectively 28% and 37%) and Trichuris trichiura (40% in both regions). The prevalence of Giardia lamblia infection was not significantly different between regions (average: 18%). Anemia prevalence was highest in the Amazon Region (24%). Hemoglobin levels were significantly decreased in children with a hookworm infection. Malnutrition was present in respectively 84%, 30% and 13% of children from the Amazon Region, Orinoco Delta and Carabobo State. In multivariate analysis including all regions, G. lamblia and helminth infections were significantly and negatively associated with respectively height-for-age and weight-for-height/BMI-for-age Z scores. Furthermore, hemoglobin levels were positively associated with the height-for-age Z score (0.11, 95% CI 0.02 - 0.20). In rural populations in Venezuela helminthiasis and giardiasis were associated with acute and chronic
Verhagen, Lilly M.; Incani, Renzo N.; Franco, Carolina R.; Ugarte, Alejandra; Cadenas, Yeneska; Sierra Ruiz, Carmen I.; Hermans, Peter W. M.; Hoek, Denise; Campos Ponce, Maiza; de Waard, Jacobus H.; Pinelli, Elena
2013-01-01
Background Children in rural areas experience the interrelated problems of poor growth, anemia and parasitic infections. We investigated the prevalence of and associations between intestinal helminth and protozoan infections, malnutrition and anemia in school-age Venezuelan children. Methods This cross-sectional study was conducted in 390 children aged 4-16 years from three rural areas of Venezuela: the Amazon Region, Orinoco Delta and Carabobo State. Stool samples were collected for direct parasitic examinations. Anthropometric indicators of chronic (height-for-age Z score) and acute (weight-for-height and Body Mass Index (BMI)-for-age Z score in respectively children under 5 years of age and children aged 5 years and above) malnutrition were calculated. Multivariate linear and logistic regression models were built to determine factors associated with nutritional status and polyparasitism. Results Hookworm and Strongyloides stercoralis prevalences were highest in children from the Amazon rainforest (respectively 72% and 18%) while children from the Orinoco Delta and Carabobo State showed higher rates of Ascaris lumbricoides (respectively 28% and 37%) and Trichuris trichiura (40% in both regions). The prevalence of Giardia lamblia infection was not significantly different between regions (average: 18%). Anemia prevalence was highest in the Amazon Region (24%). Hemoglobin levels were significantly decreased in children with a hookworm infection. Malnutrition was present in respectively 84%, 30% and 13% of children from the Amazon Region, Orinoco Delta and Carabobo State. In multivariate analysis including all regions, G. lamblia and helminth infections were significantly and negatively associated with respectively height-for-age and weight-for-height/BMI-for-age Z scores. Furthermore, hemoglobin levels were positively associated with the height-for-age Z score (0.11, 95% CI 0.02 - 0.20). Conclusions In rural populations in Venezuela helminthiasis and giardiasis were
Directory of Open Access Journals (Sweden)
Lilly M Verhagen
Full Text Available Children in rural areas experience the interrelated problems of poor growth, anemia and parasitic infections. We investigated the prevalence of and associations between intestinal helminth and protozoan infections, malnutrition and anemia in school-age Venezuelan children.This cross-sectional study was conducted in 390 children aged 4-16 years from three rural areas of Venezuela: the Amazon Region, Orinoco Delta and Carabobo State. Stool samples were collected for direct parasitic examinations. Anthropometric indicators of chronic (height-for-age Z score and acute (weight-for-height and Body Mass Index (BMI-for-age Z score in respectively children under 5 years of age and children aged 5 years and above malnutrition were calculated. Multivariate linear and logistic regression models were built to determine factors associated with nutritional status and polyparasitism.Hookworm and Strongyloides stercoralis prevalences were highest in children from the Amazon rainforest (respectively 72% and 18% while children from the Orinoco Delta and Carabobo State showed higher rates of Ascaris lumbricoides (respectively 28% and 37% and Trichuris trichiura (40% in both regions. The prevalence of Giardia lamblia infection was not significantly different between regions (average: 18%. Anemia prevalence was highest in the Amazon Region (24%. Hemoglobin levels were significantly decreased in children with a hookworm infection. Malnutrition was present in respectively 84%, 30% and 13% of children from the Amazon Region, Orinoco Delta and Carabobo State. In multivariate analysis including all regions, G. lamblia and helminth infections were significantly and negatively associated with respectively height-for-age and weight-for-height/BMI-for-age Z scores. Furthermore, hemoglobin levels were positively associated with the height-for-age Z score (0.11, 95% CI 0.02 - 0.20.In rural populations in Venezuela helminthiasis and giardiasis were associated with acute and
Cutting edge science: Laser surgery illuminates viscoelasticity of merotelic kinetochores.
Cabello, Simon; Gachet, Yannick; Tournier, Sylvie
2016-03-28
Increasing evidence in eukaryotic cells suggests that mechanical forces are essential for building a robust mitotic apparatus and correcting inappropriate chromosome attachments. In this issue, Cojoc et al. (2016. J. Cell Biol., http://dx.doi.org/10.1083/jcb.201506011) use laser microsurgery in vivo to measure and study the viscoelastic properties of kinetochores. © 2016 Cabello.
TRAINING IN ETHICS OF HUMAN CAPITAL TO BUSINESS DEVELOPMENT
Neyda Ibañez; Rubén Castillo
2009-01-01
The purpose of the investigation was to interpret training in ethics for action business students an introduction to the economy of the Faculty of Social and Economic Sciences at the University of Carabobo, as part of professional development in business studies. The investigation was addressed within the paradigm post positivist using ethnographic and hermeneutic method, descriptive mode of scientific research and technique participant-observation. It concludes that training in ethics manage...
The impact of industrial waste of Venezuelan marine water
Energy Technology Data Exchange (ETDEWEB)
Roberts, Frank [Bechtel Corp., Gaithersburg, MD (United States); Guarino, Carmen [Guarino Engineers, Philadelphia, PA (United States); Arias, Marlene [Ministerio del Ambiente y Recursos Naturales Renovables, Caracas (Venezuela)
1994-12-31
The Puerto Cabello-Marron coastal area of Venezuela is an ideal location for industries that require large land areas, water, marine transportation, minimum habitation, cooling water, etc. However, mercury spills have produced concern in the entire coastal zone. The area was investigated and negative impacts were identified. Consequently, recommendations for waste water management were proceeded. 13 refs., 6 figs., 3 tabs.
The impact of industrial waste of Venezuelan marine water
Energy Technology Data Exchange (ETDEWEB)
Roberts, Frank [Bechtel Corp., Gaithersburg, MD (United States); Guarino, Carmen [Guarino Engineers, Philadelphia, PA (United States); Arias, Marlene [Ministerio del Ambiente y Recursos Naturales Renovables, Caracas (Venezuela)
1993-12-31
The Puerto Cabello-Marron coastal area of Venezuela is an ideal location for industries that require large land areas, water, marine transportation, minimum habitation, cooling water, etc. However, mercury spills have produced concern in the entire coastal zone. The area was investigated and negative impacts were identified. Consequently, recommendations for waste water management were proceeded. 13 refs., 6 figs., 3 tabs.
Kawamoto, M; Mikage, M
1999-01-01
The rhizome of Coptis plant of the family ranunculaceae has been used in traditional Chinese medicine as a crude drug (Huanglian in present Chinese). In Japan, the rhizome of Coptis japonica Makino (the botanical name of which is "Ohren" in modern Japanese) has been utilized as a crude drug since the Nara era. The Japanese name in those days was "Kakumakusa based on descriptions in old books written in the Heian era. It changed to "Kakumikusa" early in the Edo era, and then changed again to Kakumakusa later in the Edo era. Through this herbological study, it was conjectured as follows: The resemblance between Chinese characters (or MA) and (or MI) in cursive style caused mis-copying of the character. After the "Honzo-wamyo, written in the Heian era, was revised in the late Edo era, and on which the name was accurately written as Kakumakusa, the mistake was corrected.
服部, 銈二郎
1985-01-01
The rapid modernization of Japan during the Edo, Meiji, Taisho and Showa Periods has made the modern Japan one of the top-level countries in material terms at least. The traditional culture of Japan of the Edo Period was transformed through the Western civilization introduced with the Meiji Restoration. The life style of the Japanese as well as Japan's politics, economy and culture was rapidly westernized. Both the government and the common people of Japan considered that their urgent objecti...
Directory of Open Access Journals (Sweden)
Alvaro J. ldrovo
2001-06-01
Full Text Available La minería aurífera en la región de la Orinoquia colombiana ha tenido un importante crecimiento en los últimos 15 años. Esta actividad se ha convertido en un importante problema de salud pública debido a varios factores como el uso de mercurio durante el proceso de amalgamación del oro, la contaminación del ecosistema y la exposición de la población de la región. El objetivo del presente trabajo fue determinar los niveles de mercurio en cabello y sangre en una población minera del departamento del Guainía y la percepción que tiene dicha población del riesgo de usar este elemento. Para tal fin, se encuestaron 78 residentes de la región, de los cuales se obtuvieron 59 muestras de sangre y 61 de cabello. Los resultados indican un precario ambiente laboral y una falta de conocimiento del riesgo ecológico, lo cual permite la contaminación del ecosistema de la Orinoquia. Los individuos perciben la exposición al mercurio como nociva para la salud, aunque sus conocimientos al respecto son inadecuados. Los valores de mercurio en sangre entre los mineros oscilaron entre 6,9 y 168,0 ug/l (promedio=59,16 y entre los individuos indirectamente expuestos fluctuó entre 17,7 y 100,8 ug/l (promedio=53,5. Las concentraciones de mercurio total en cabello oscilaron entre 3,0 y 89,2 ug/g (promedio=26,93 en el grupo de mineros y entre 2,8 y 48,7 ug/g (promedio=22,86 entre los expuestos indirectamente. No se encontraron diferencias significativas en los niveles de mercurio entre los dos grupos estudiados. Se sugieren medidas preventivas y de control de la situación generada por el uso de mercurio en las labores de mineria aurífera de la región.
Actitud de las madres en el cumplimiento del calendario de vacunación de niños menores de 6 años
Mariana Boscan; Belén Salinas; Maria Luisa Trestini; Maria Tomat
2012-01-01
The purpose of this study was to determine the attitude of mothers regarding compliance with the vaccination calendar of children less than 6 years of age in the pediatrics hospitalization service at the children hospital Dr. Jorge Lizarraga, in Valencia, Carabobo State. This was a descriptive cross-sectional, non-experimental study. A survey designed by the author was applied, after validation and informed consent to 71 mothers. The data was displayed in graphs and tabulated showing absolute...
Directory of Open Access Journals (Sweden)
Héctor Rojas Herazo
1968-01-01
Full Text Available Sí, realmente es la nuestra la más dura, anónima y dramática de todas las tareas : la de emplearnos a fondo -con nuestros huesos, con nuestra piel y con nuestro traje- en la misión de vivir. Poner los nervios, los cabellos y los sentidos frente a la luz. Estar en ellos. Moler los días y las noches en nosotros.
FACTORS THAT PROMOTE THE DEFECTION OF THE VIRTUAL CLASSROOM
Jenniz La Madriz
2016-01-01
It education virtual is a resource that allows leverage them Tics for reduce barriers of space / time to learn and decrease the dropout school. The research had by objective determine them factors that promote the desertion of the classroom virtual of the subject of methods I, of support to them classes face-to-face, in the Faculty of Sciences economic and social, of the University of Carabobo. The methodological design was based on the quantitative paradigm and as technical survey, obtainin...
Almacén de repuestos – Venezuela
Directory of Open Access Journals (Sweden)
Bornhorst, Dirk
1971-11-01
Full Text Available This store has been constructed, and its site has been chosen, after a detailed study of: modern storage techniques; relative cost of building sites; the difficult traffic problems in densely populated zones; the distance from Port Cabello; the excellent nearby road facilities, and the close vincinity of the TW assembly plant and the Miranda Corporation. The choice of structure, platform, roofing, ventilation system, and possibility of later enlargements were also decisive factors, determining the final project.Este nuevo almacén ha sido construido en esta zona y en este lugar, como consecuencia de un profundo análisis de: las técnicas modernas de almacenaje, el costo de los terrenos en la ciudad, el congestionado tráfico de los núcleos superpoblados, la densidad del mercado de sus automóviles en la zona, la proximidad de Puerto Cabello, las excelentes carreteras de comunicación y la vecindad de la Planta de Ensamblaje VW y de la «Corporación Miranda». La elección de estructura, planta, cubierta, ventilación, posibilidades de fácil ampliación en el futuro, etc., fueron también objeto de un cuidadoso estudio, que dio como resultado el conjunto que se presenta.
Superconductivity in Bismuth. A New Look at an Old Problem.
Mata-Pinzón, Zaahel; Valladares, Ariel A; Valladares, Renela M; Valladares, Alexander
2016-01-01
To investigate the relationship between atomic topology, vibrational and electronic properties and superconductivity of bismuth, a 216-atom amorphous structure (a-Bi216) was computer-generated using our undermelt-quench approach. Its pair distribution function compares well with experiment. The calculated electronic and vibrational densities of states (eDOS and vDOS, respectively) show that the amorphous eDOS is about 4 times the crystalline at the Fermi energy, whereas for the vDOS the energy range of the amorphous is roughly the same as the crystalline but the shapes are quite different. A simple BCS estimate of the possible crystalline superconducting transition temperature gives an upper limit of 1.3 mK. The e-ph coupling is more preponderant in a-Bi than in crystalline bismuth (x-Bi) as indicated by the λ obtained via McMillan's formula, λc = 0.24 and experiment λa = 2.46. Therefore with respect to x-Bi, superconductivity in a-Bi is enhanced by the higher values of λ and of eDOS at the Fermi energy.
Energy Technology Data Exchange (ETDEWEB)
Chen, Lin [Key Laboratory of Ultra-fast Photoelectric Diagnostics Technology, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Xi' an Jiaotong University, Xi' an 710049 (China); Wang, Xingchao [North Night Vision Technology (NNVT) Co., Ltd., Nanjing 210110 (China); Tian, Jinshou, E-mail: tianjs@opt.ac.cn [Key Laboratory of Ultra-fast Photoelectric Diagnostics Technology, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006 (China); Liu, Chunliang [Xi' an Jiaotong University, Xi' an 710049 (China); Liu, Hulin [Key Laboratory of Ultra-fast Photoelectric Diagnostics Technology, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Chen, Ping [Key Laboratory of Ultra-fast Photoelectric Diagnostics Technology, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Wei, Yonglin; Sai, Xiaofeng [Key Laboratory of Ultra-fast Photoelectric Diagnostics Technology, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Sun, Jianning; Si, Shuguang [North Night Vision Technology (NNVT) Co., Ltd., Nanjing 210110 (China); Wang, Xing; Lu, Yu [Key Laboratory of Ultra-fast Photoelectric Diagnostics Technology, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); and others
2016-12-21
To obtain a high spatial resolution of a image intensifier based on microchannel plate (MCP), the long tail in the exit energy distribution of the output electrons (EDOE) is undesirable. The existing solution is increasing the penetration depth of the MCP output electrode, which will result in a serious gain reduction. Coating the MCP output electrode with efficient secondary electron yield (SEY) materials is supposed to be an effective approach to suppress the unfavorable tail component in the EDOE without negative effects on the gain. In our work, a three-dimensional MCP single channel model is developed in CST STUDIO SUITE to systematically investigate the dependences of the EDOE and the gain on the SEY property of the coated material, based on the Finite Integral Technique and Monte Carlo method. The results show that besides the high SEY of the coated material, the low incident energy corresponding to the peak SEY is another essential element affecting the electron yield in the final stage of multiplication and suppressing the output energy spread.
Discurso Feminino: Sujeito, História e Imaginário em Eleodora e Memórias de Marta
Rodrigues, Cláudia Regina da Silva
2016-01-01
IX Congresso Brasileiro de Hispanistas realizado nos dias 22 a 25 agosto 2016 A pesquisa em questão se caracteriza, inicialmente, por resgatar do esquecimento os escritos das autoras Mercedes Cabello de Carbonera (Peru) e de Júlia Lopes de Almeida (Brasil). Tentamos entender como as mulheres representadas nas obras ficcionais Eleodora (Carbonera) e Memórias de Marta (Almeida), foram configuradas pelas escritoras. As personagens foram mulheres comuns, vítimas do sistema patriarc...
Two-player quantum pseudotelepathy based on recent all-versus-nothing violations of local realism
International Nuclear Information System (INIS)
Cabello, Adan
2006-01-01
We introduce two two-player quantum pseudotelepathy games based on two recently proposed all-versus-nothing (AVN) proofs of Bell's theorem [A. Cabello, Phys. Rev. Lett. 95, 210401 (2005); Phys. Rev. A 72, 050101(R) (2005)]. These games prove that Broadbent and Methot's claim that these AVN proofs do not rule out local-hidden-variable theories in which it is possible to exchange unlimited information inside the same light cone (quant-ph/0511047) is incorrect
Análisis por espectroscopia infrarroja de algunas arcillas colombianas
Directory of Open Access Journals (Sweden)
Yolanda O. de Bravo
2009-06-01
Full Text Available Se estudiaron once muestras procedentes de distintos puntos del yacimiento Mondoñedo (Mosquera, Cundinamarca. A la fracción arcillosa menor de 2 micras, separadas, según el método de Jackson, se les tomó para su caracterización, los correspondientes espectros IR. Las muestras analizadas contienen como mineral predominante caolinita y en menor proporción cuarzo. Es de anotar la presencia de hidróxidos de hierro y de aluminio. La similitud en la composición mineralógica de las muestras permite inferir la homogenidad del yacimiento de Mondoñedo.
THE SOCIAL PHENOMENON IN PARTICIPATORY PROCESSES OF COMMUNITY COUNCILS
Directory of Open Access Journals (Sweden)
María Lourdes Sánchez
2016-07-01
Full Text Available The objective of this research is to interpret the social phenomenon in participatory processes of Community Councils of Carabobo State, centering participation within these organizations is an indispensable condition to conceive citizens as active subjects in management public affairs. It is inserted into a document type from the qualitative approach. Eventually you will reach a reflection that the success of citizen participation in these organizations rely on training, degree of commitment, teamwork, sense of belonging, responsibility and communication from their cultural worldview.
Un Marco para el Análisis de Riesgos en Ciberseguridad
Rubio Blanco, José Antonio
2015-01-01
Tesis Doctoral leída en la Universidad Rey Juan Carlos de Madrid en 2015. Director de la Tesis: David Ríos Insua Tutor: Enrique Cabello Pardos Las ciberamenazas afectan a todo tipo de organizaciones, desde empresas privadas a administraciones públicas, incluyendo infraestructuras críticas. Para abordar esta compleja problemática, una herramienta imprescindible es el análisis de riesgos, gracias a la cual las organizaciones pueden analizar las amenazas que les afectan, priorizar...
Commercializing a U.S. piezoceramic linear motor
Diehl, Rick W.
2000-06-01
A small low-cost piezoceramic linear motor has been developed in the US and is being commercialized by EDO Corporation, working with a leading motion control OEM and with a prominent US corporate research laboratory. First generation motor design has emphasized high displacement at up to 200mm per second velocity with 3.5 Newtons force with high resolution, short time constant and a 15 volt power supply at a cost of less than 100 dollars. Motor dimensions of 30 by 50 by 4 mm allow broad configuration choices, al hidden within the motion control slide. The EDO approach was to build on its core competence in high reliability electroceramic material engineering and production, and to use a strategy of back-integrating, or outsourcing of recent advances outside Edo in piezoceramics, while forward- integrating into specific emerging applications known intimately by the OEM in the market. The strategy provided design focus that has led to a cost-effective advance in 'solid-state actuation and control'. This is considered a classic case of successful industrial integration of an enabling technology across organizations in order to access the needed mix of technology for development of an innovative and competitive solution.
En California dos pioneros: Uno en el pasado y otro en el presente
Directory of Open Access Journals (Sweden)
Mauricio Bermúdez
2002-11-01
Full Text Available Agost on Haraszthy buscando un clima para alivio de su enfermedad arribó en 1849 al sur de California donde se convirtió en el pionero al importar, sembrar y producir vino con Zinfandel, una entre otras muchas vides europeas. Construyó el viñedo Buena Vista diseñado para esa época con las mejores facilidades, no obstante, la empresa estaba destinada al colapso financiero por el incumplimiento del Estado de California; la vida de Agost on fue una aventura y tras su muerte una leyenda. En 1976 Peter Haywood decide cambiar su vida dedicada a las finanzas, deja Nueva York y viaja a California, allí compra un terreno para adecuarlo como viñedo; en 1980 obtiene su primera producción comercial y gracias a la fuerte demanda se vio obligado a incrementar su producción. El Zinfandel producido en el viñedo los Chamizales de la casa Haywood ha sido galardonado y declarado como el mejor. ¿Cuáles serán las caracte-rísticas del vino para lograr esa gran acogida?
[Simejigahara, a place noted for moxa].
Oda, R
1996-01-01
Shimejigahara is a place-name often used in old Waka (Japanese poems). It was reputed in the past to be a site rich in the plants moxa and mugwort. A study of this placed carried out. Shimejigahara, as mentioned in the literature of the Heian to Kamakura eras, seems to have been located at the site of the current Tochigi City. During the Edo era, however, Senjogahara in Nikko came to be referred to as Shimejigahara. In addition, some other places in what is now called Utsunomiya City, on Ibuki Mountain in Shiga Prefecture, and in Chiba City were referred to as Shimejigahara during the Edo era. When the types of wild mugwort seen in these various sites called "Shimejigahara" were searched for, Artemisia princeps P. was found in the cities of Tochigi, Utsunomiya and Chiba, while A. montana P. was seen in Senjogahara and on Ibuki Mountain. Papers published during the Edo era suggest that moxa, gathered in the Shimejigahara, was on the market during that period. It is, however, doubtful that the moxa produced from Shimejigahara was really commercialized, like the well-known "Ibuki moxa."
TRAINING IN ETHICS OF HUMAN CAPITAL TO BUSINESS DEVELOPMENT
Directory of Open Access Journals (Sweden)
Neyda Ibañez
2009-04-01
Full Text Available The purpose of the investigation was to interpret training in ethics for action business students an introduction to the economy of the Faculty of Social and Economic Sciences at the University of Carabobo, as part of professional development in business studies. The investigation was addressed within the paradigm post positivist using ethnographic and hermeneutic method, descriptive mode of scientific research and technique participant-observation. It concludes that training in ethics management must transcend the economic theories located in the teleological by financial or economic interests toward the teleological including humanism.
Actitud de las madres en el cumplimiento del calendario de vacunación de niños menores de 6 años
Boscan, Mariana; Salinas, Belén; Trestini, Maria Luisa; Tomat, Maria
2012-01-01
La finalidad de este estudio fue determinar la actitud de las madres hacia el cumplimiento del calendario de vacunación de niños menores de 6 años en el servicio de hospitalización del hospital de niños Dr. Jorge Lizarraga, en Valencia, Estado Carabobo. Fue un estudio transversal, descriptivo, no experimental; se aplicó una encuesta, previa validación y consentimiento informado a 71 madres. Los datos fueron tabulados y graficados mostrándose frecuencias absolutas y porcentajes. En los resulta...
Gene : CBRC-PTRO-14-0016 [SEVENS
Lifescience Database Archive (English)
Full Text Available icted protein [Nematostella vectensis] gb|EDO44122.1| predicted protein [Nematostella vectensis] 5e-22 27% MHIPYTYIPYICISH...IYVYPYTYIPHICIYRPYTYIPYICIAHIHISHIHISHIYMFIPYTYIPYPYIPCTCISHIRISHVHVYPISVYPMYMYIPYPYIPCTCISHIR...ISHVHVYPVSVYPMYMYIPYPYIPCTCISHIRISHVHVYPVSVYPMYMYILYPYIPCTCISRIRISHVYVYPIYVYPMYMYNPYTYIPYISCVCIYKYPVCIYIYPVCIYIYISCVCVCVYIYIHTHTYSSVFLFLFYFIF ...
Directory of Open Access Journals (Sweden)
Marcos Carrasco
2008-06-01
Full Text Available Net radiation (Rn is the main energy balance component controlling evaporation and transpiration processes. In this regard, this study evaluated two models to estimate Rno above a commercial vineyard (Vitis vinifera cv. Cabernet Sauvignon located in Pencahue Valley, Maule Region (35º22’ S; 71°47’ Wl; 75 m.a.s.l.. An automatic meteorological station (AMS was installed in the central part of the vineyard and used to measure Rn, solar radiation (Rsi, air temperature (Ta, canopy temperature (Tf and relative humidity (RH. On a 30 min interval, results indicated that model Rne1 (assuming Ta ≠ Tf and model Rne2 (assuming Ta = Tf were able to estimate Rn with a mean absolute error (MAE of less than 40 W m-2 and root mean square error (RMSE of less than 61 W m-2. On daily intervals, the two models estimated Rno with MAE and RMSE values of less than 1.68 and 1.75 MJ m-2 d-1, respectively. In global terms, the models presented errors below 9 and 11% on 30 min and daily intervals, respectively. Furthermore, this study indicated that the incorporation of canopy temperature did not improve the Rno estimation substantially, in spite of having a temperature gradient (dT = Tf - Ta between -3 and to 4ºC. These results suggest that an Rne2 model could be used to estimate Rno using Rsi, Ta and RH measurements.El flujo de radiación neta (Rn es el principal componente del balance de energía que determina los procesos de evaporación y transpiración. En este contexto, este estudio evaluó dos modelos para estimar Rno sobre un viñedo (Vitis vinifera L. cv. Cabernet Sauvignon comercial ubicado en el Valle de Pencahue, Región del Maule (35º22’ S; 71º47’ Oeste; 75 m.s.n.m.. Para esto, se ubicó una estación meteorológica automática (AME en la parte central del viñedo para medir Rn, radiación solar (Rsi, temperatura del aire (Ta, temperatura del dosel (Tf y humedad relativa (HR. En intervalos de tiempo de 30 min, los resultados indicaron que el
Directory of Open Access Journals (Sweden)
Rosa Amaya-de Rebolledo
2010-12-01
Full Text Available ResumenLa formación permanente del docente juega un papel clave en el cambio educativo; sin embargo, su con- creción práctica representa un reto epistemológico y metodológico. La problemática ha sido abordada des- de diferentes ángulos, en los cuales la relación entre cultura docente y formación permanente no ha sido claramente desvelada. En este artículo, que constituye un avance en la investigación de tesis doctoral de la Facultad de Ciencias de la Educación de la Universidad de Carabobo, se analiza por qué la cultura docente necesita ser reconocida como una realidad dinámica, dialéctica y relacional que afecta la calidad de la for- mación permanente del docente venezolano.AbstractThe continuous training of the teacher plays a key role in educational change; however, to take it to the practice rep- resents an epistemological and meth- odological challenge. The problem has been approached from different angles, where the relation between culture of the teacher and continuous training has not been clearly discussed. In this article, which constitutes an advance in the investigation of doctoral thesis of the Faculty of Sciences of the Education of Carabobo's University, it is analyzed why the culture of the teacher needs to be recognized as a dynamic reality, dialectic and relational that affects the quality of the continuous training in Venezuelan.RésuméLa formation continue des enseignants joue un rôle essentiel dans le changement éducatif, cependant, sa concrétion prati- que représente un défi épistémologique et méthodologique. La problématique a été envisagée dès perspectives différen- tes, dans lesquelles la relation entre la culture de l'enseignant et la formation continue n'a pas encore été nettement dévoilée. Dans cet article, qui constitue une avance dans la recherche de thèse doctorale de la Faculté de Sciences de l'Éducation de l'Université de Carabobo, on
Directory of Open Access Journals (Sweden)
Raquel Herranz
2015-12-01
Full Text Available La cianamida hidrogenada (CH es un eficaz estimulante de la brotación de las yemas habitualmente utilizado en viticultura tropical, pero manipular esta materia activa conlleva un alto riesgo por su elevada toxicidad. Según algunos estudios tratamientos alternativos podrían llegar a producir sobre las yemas efectos similar a la CH, compensado la falta de horas de frío en viñedos situados en zonas tropicales, como los ubicados en la costa sur ecuatoriana. De entre todos los tratamientos evaluados destacan los efectos producidos por la aplicación directa sobre las yemas de peróxido de hidrógeno al 5%. Este tratamiento consigue estimular la brotación de la práctica totalidad de las yemas, adelantando e incrementando el desarrollo vegetativo y duplicando el rendimiento de las cepas, sin mermar la calidad de los racimos producidos. Por tanto podemos afirmar que los tratamientos con peróxido de hidrógeno son una alternativa viable, más económica y sostenible, a las aplicaciones de CH en estas condiciones de cultivo Abstract Hydrogen cyanamide (CH is an effective stimulant bud breaking usually used in tropical viticulture, but handling this active substance carries a high risk because of their high toxicity. According to some studies alternative treatments could potentially produce a similar effect on the buds to CH, offset the lack of chilling hours in vineyards located in areas without a sufficient period of chilling hours, such as those located on the southern coast of Ecuador. Among all treatments evaluated the effects include direct application to the buds of hydrogen peroxide 5%. This treatment gets stimulate bud breaking of almost all of the buds, advancing and increasing vegetative growth and doubling the performance of the strains, without compromising the quality of the grapes produced. Therefore we can say that the hydrogen peroxide treatments are a viable, economical and sustainable, alternative to CH applications in these
'All versus Nothing' Inseparability for Two Observers
International Nuclear Information System (INIS)
Cabello, Adan
2001-01-01
A recent proof of Bell's theorem without inequalities [A. Cabello, Phys.Rev.Lett. 86, 1911 (2001)] is formulated as a Greenberger-Horne-Zeilinger--type proof involving just two observers. On one hand, this new approach allows us to derive an experimentally testable Bell inequality which is violated by quantum mechanics. On the other hand, it leads to a new state-independent proof of the Kochen-Specker theorem and provides a wider perspective on the relations between the major proofs of no hidden variables
Experimental noise-resistant Bell-inequality violations for polarization-entangled photons
International Nuclear Information System (INIS)
Bovino, Fabio A.; Castagnoli, Giuseppe; Cabello, Adan; Lamas-Linares, Antia
2006-01-01
We experimentally demonstrate that violations of Bell's inequalities for two-photon polarization-entangled states with colored noise are extremely robust, whereas this is not the case for states with white noise. Controlling the amount of noise by using the timing compensation scheme introduced by Kim et al. [Phys. Rev. A 67, 010301(R) (2003)], we have observed violations even for states with very high noise, in excellent agrement with the predictions of Cabello et al. [Phys. Rev. A 72, 052112 (2005)
A quality assurance program for environmental data operations involving waste management processes
International Nuclear Information System (INIS)
Johnson, G.L.; Blacker, S.M.
1990-01-01
This paper describes the 'core' elements needed in an effective Quality Program for environmental data operations involving nuclear, mixed, or non-nuclear wastes. For each core element, this paper examines the minimum components needed for an effective Quality Program for EDOs, and compares approaches to Quality Programs currently required by the U.S. DOE and the U.S. EPA. The comparison suggests how the Quality Program requirements used at DOE, and defined by NQA-1 and its supplements, and those used by EPA through its QAMS program guidance, may provide a basis for developing a harmonized Quality Program for EDOs involving any waste management processes, nuclear, non-nuclear, or mixed. (orig./DG)
Ericka Henao Jaramillo
2006-01-01
Joachim hezberG es un ingeniero agrónomo de origen Alemán, un hombre carismático, que llegó a Colombia hace más de 20 años para liderar un proyecto del gobierno Alemán, e incorporar variedades de uva a la región de Boyacá. Se enamoró de Villa de Leyva y desde 1985 jalona un proyecto vinícola conocido como Viñedo Guananí, que en lengua indígena significa tierra prometida. Y así es, su viñedo podría considerarse como la tierra prometida para el vino en Colombia. En éste, además del cultivo de l...
Heterotropías: espacios y escritura de mujeres en los últimos años del siglo XIX
Cuesta Vélez, Cecilia
2010-01-01
El siguiente trabajo pretende explorar en algunas escritoras de fi nales del siglo XIX la resignifi cación de coordenadas históricosociales esenciales del espacio en el cual se constituyen como sujetos emergentes a través de la escritura. Para tal fi n se toma en cuenta como géneros discursivos el ensayo y la novela. Las autoras tratadas son la argentina Juana Manuela Gorriti (1818-1892), Teresa González de Fanning (1836-1918), Mercedes Cabello de Carbonera (1845-1909), C...
Funciones de la supervición escolar en Venezuela. Aproximación a un modelo
Directory of Open Access Journals (Sweden)
Mogollón de González, Amada
2006-12-01
Full Text Available Resumen:Esta investigación tiene como propósito presentar la aproximación a un Modelo para las funciones de la supervisión escolar en Venezuela sustentado en los ámbitos, acción supervisora y funciones denominadas: Técnicas, Administrativas, Sociales, de Asistencia y Mediación. El modelo se fundamentó teóricamente en Kaufman, Stufflebeam, Teoría de Sistemas de Bertalanffy, enfoque humanista y jerarquía de las necesidades de Maslow. Es una investigación de campo realizada en Venezuela en los estados: Nueva Esparta, Distrito Federal, Carabobo, Lara, Táchira, Barinas y Delta Amacuro. El instrumento arrojó resultados que evidenciaron deficiencias, omisiones y ausencias durante el hecho supervisorio y su validación condujo a garantizar el éxito y calidad en la supervisión educativa venezolana.Abastract: This investigation must like intention present/display the approach to a Model for the functions of the scholastic supervision in Venezuela sustained in the scopes, supervisora action and denominated functions: Techniques, Administrative, Social, of Attendance and Mediation. The model was based theoretically on Kaufman, Stufflebeam, Theory of Systems of Bertalanffy, focuses humanist and hierarchy of the necessities of Maslow. It is an investigation of field made in Venezuela in the states: Nueva Esparta, Federal District, Carabobo, Lara, Táchira, Barinas and Delta Amacuro. The instrument threw results that demonstrated deficiencies, omissions and absences during the fact supervisorio and its validation lead to ensure the success and quality in the Venezuelan educative supervision.
Garib, Daniela; De Cássia Moura Carvalho Lauris, Rita; Calil, Louise Resti; De Medeiros Alves, Arthur César; Janson, Guilherme; De Almeida, Araci Malagodi; Cevidanes, Lúcia Helena Soares; Lauris, José Roberto Pereira
2017-01-01
Introduction The purpose of this 2-arm parallel study was to evaluate the dentoskeletal effects of rapid maxillary expansion with differential opening (EDO) compared with the hyrax expander in patients with complete bilateral cleft lip and palate. Methods A sample of patients with complete bilateral cleft lip and palate was prospectively and consecutively recruited. Eligibility criteria included participants in the mixed dentition with lip and palate repair performed during early childhood and maxillary arch constriction with a need for maxillary expansion before the alveolar bone graft procedure. The participants were consecutively divided into 2 study groups. The experimental and control groups comprised patients treated with rapid maxillary expansion using EDO and the hyrax expander, respectively. Cone-beam computed tomography examinations and digital dental models of the maxillary dental arches were obtained before expansion and 6 months postexpansion. Standardized cone-beam computed tomography coronal sections were used for measuring maxillary transverse dimensions and posterior tooth inclinations. Digital dental models were used for assessing maxillary dental arch widths, arch perimeters, arch lengths, palatal depths, and posterior tooth inclinations. Blinding was used only during outcome assessment. The chi-square test was used to compare the sex ratios between groups (P <0.05). Intergroup comparisons were performed using independent t tests with the Bonferroni correction for multiple tests. Results Fifty patients were recruited and analyzed in their respective groups. The experimental group comprised 25 patients (mean age, 8.8 years), and the control group comprised 25 patients (mean age, 8.6 years). No intergroup significant differences were found for age, sex ratio, and dentoskeletal variables before expansion. No significant differences were found between the EDO and the hyrax expander groups regarding skeletal changes. The EDO promoted significantly
Fast processing of microscopic images using object-based extended depth of field.
Intarapanich, Apichart; Kaewkamnerd, Saowaluck; Pannarut, Montri; Shaw, Philip J; Tongsima, Sissades
2016-12-22
Microscopic analysis requires that foreground objects of interest, e.g. cells, are in focus. In a typical microscopic specimen, the foreground objects may lie on different depths of field necessitating capture of multiple images taken at different focal planes. The extended depth of field (EDoF) technique is a computational method for merging images from different depths of field into a composite image with all foreground objects in focus. Composite images generated by EDoF can be applied in automated image processing and pattern recognition systems. However, current algorithms for EDoF are computationally intensive and impractical, especially for applications such as medical diagnosis where rapid sample turnaround is important. Since foreground objects typically constitute a minor part of an image, the EDoF technique could be made to work much faster if only foreground regions are processed to make the composite image. We propose a novel algorithm called object-based extended depths of field (OEDoF) to address this issue. The OEDoF algorithm consists of four major modules: 1) color conversion, 2) object region identification, 3) good contrast pixel identification and 4) detail merging. First, the algorithm employs color conversion to enhance contrast followed by identification of foreground pixels. A composite image is constructed using only these foreground pixels, which dramatically reduces the computational time. We used 250 images obtained from 45 specimens of confirmed malaria infections to test our proposed algorithm. The resulting composite images with all in-focus objects were produced using the proposed OEDoF algorithm. We measured the performance of OEDoF in terms of image clarity (quality) and processing time. The features of interest selected by the OEDoF algorithm are comparable in quality with equivalent regions in images processed by the state-of-the-art complex wavelet EDoF algorithm; however, OEDoF required four times less processing time. This
Effects Based Operations (EDO) Endstate
National Research Council Canada - National Science Library
James, Ron; Daniels, Troy
2005-01-01
.... An analysis of the combination of physical (e.g. petroleum, electric power) and behavioral (e.g. leadership) COGs at the operational level models was performed and the results were incorporated in the EndState Tool...
Pérez Barrero, Bernardo Ricardo; Duharte Garbey, Carelia; Perdomo Estrada, Cristina; Ferrer Mustelier, Ania; Gan Caldero, Bárbara
2011-01-01
Se realizó un estudio de casos y controles en el consultorio Adaca, del área de salud integral comunitaria El Socorro en el municipio de Valencia, estado venezolano de Carabobo, para valorar los principales factores de riesgo que influyeron en la aparición de gingivitis crónica en 75 adolescentes de 15-18 años durante el período comprendido desde agosto de 2009 hasta enero de 2010. La selección para ambos grupos se efectuó a través del muestreo no probabilístico intencional (por orden de lleg...
Caracterización clínico-epidemiólogica del parasitismo intestinal en niños de 0 a 5 años
Urquiza Yero, Yisell; Domínguez Caises, Liset María; Artiles Yanes, Melva
2011-01-01
Objetivo: realizar la caracterización clínico epidemiológica del parasitismo intestinal en niños de 0 a 5 años pertenecientes al consultorio médico Altos de Uslar, Libertador, Carabobo, Venezuela. Métodos: se realizó un estudio descriptivo, de corte transversal durante los meses de enero a diciembre de 2006, en el que se estudiaron 83 niños que presentaban sintomatología de parasitismo intestinal o no, a los que se les tomó muestras de heces fecales. La información se obtuvo a través de encue...
Yisell Urquiza Yero; Liset María Domínguez Caises; Melva Artiles Yanes
2011-01-01
Objetivo: realizar la caracterización clínico epidemiológica del parasitismo intestinal en niños de 0 a 5 años pertenecientes al consultorio médico Altos de Uslar, Libertador, Carabobo, Venezuela. Métodos: se realizó un estudio descriptivo, de corte transversal durante los meses de enero a diciembre de 2006, en el que se estudiaron 83 niños que presentaban sintomatología de parasitismo intestinal o no, a los que se les tomó muestras de heces fecales. La información se obtuvo a través de encue...
pitting corrosion susceptibility pitting corrosion susceptibility of aisi
African Journals Online (AJOL)
eobe
2DEPARTMENT OF MECHANICAL ENGINEERING, UNIVERSITY OF BENIN, BENIN- CITY, EDO STATE, NIGERIA. E-mail addresses: ... fluids and aggressive chemicals. Pitting corrosion ... the kitchen, food manufacturing and dispensing and.
African Journals Online (AJOL)
2013), Market Sanitation: A Case Study of Oregbeni Market Benin - City Edo ... Pathophysiology and Evidence Based Intervention Strategy, Abstract PDF ... Hormones on Gamma Immunoglobulin Density (Ig-Gp) and Apgar ...
Le roman féminin péruvien pendant la seconde moitié du XIXe siècle
Tauzin-Castellanos , Isabelle
1990-01-01
Ofrece un analisis de las novelas realistas obras de las escritoras peruanas, desde los años anteriores a la guerra del Pacifico hasta el final del siglo XIX y la republica aristocratica presidida por Nicolas de Piérola. Después de reconstruir el contexto sociocultural de los años 70, la autora proporciona una lectura analitica de las novelas de Mercedes Cabello de Carbonera, Clorinda Matto de Turner, Maria Nieves y Bustamante, Lastenia Larriva de Llona y Margarita Praxedes Muñoz. La tesis fu...
Testing Hardy's nonlocality proof with genuine energy-time entanglement
International Nuclear Information System (INIS)
Vallone, Giuseppe; Gianani, Ilaria; Inostroza, Enrique B.; Saavedra, Carlos; Lima, Gustavo; Cabello, Adan; Mataloni, Paolo
2011-01-01
We show two experimental realizations of Hardy's ladder test of quantum nonlocality using energy-time correlated photons, following the scheme proposed by Cabello et al.[Phys. Rev. Lett. 102, 040401 (2009)]. Unlike previous energy-time Bell experiments, these tests require precisely tailored nonmaximally entangled states. One of them is equivalent to the two-setting and two-outcome Bell test requiring a minimum detection efficiency. The reported experiments are still affected by the locality and detection loopholes, but are free of the post-selection loophole of previous energy-time and time-bin Bell tests.
Diámetro transverso del cerebelo fetal en la restricción del crecimiento intrauterino
Salazar de Dugarte, Guillermina
2011-01-01
Objetivo: Evaluar el comportamiento de la biometría del cerebelo fetal en su diámetro transverso, en los casos con restricción del crecimiento intrauterino. Ambiente: Servicio de Perinatología, Hospital "Dr. Adolfo Prince Lara", Puerto Cabello. Métodos: Estudio transversal, de correlación. En 1 569 fetos se realizó la biometría del diámetro transverso del cerebelo, para la construcción del nomograma del mismo. Se estableció una comparación entre los valores del diámetro transverso del cerebel...
year surveillance of wound infections at a rural tertiary hospital in ...
African Journals Online (AJOL)
EB
Conclusions: Staphylococcus aureus was the most predominant etiologic agent of wound infection among in and out patients. ... methicillin – resistant Staphylococus aureus (MRSA) and ... Northeast local government area of Edo State,.
Socio-Economic Characteristics of Registered Cocoa Farmers in ...
African Journals Online (AJOL)
PROF HORSFALL
ABSTRACT: This study examined the socio-economic characteristics of registered cocoa farmers in Edo State; ... Key words: socio-economics, characteristics, registered cocoa farmers. ... international exchange market in two world currencies ...
Counsellor (The) - Vol 33, No 1 (2014)
African Journals Online (AJOL)
Open Access DOWNLOAD FULL TEXT ... Communication in marital homes and work performance among Secondary School ... Predictive value of parenting styles on the academic achievement of adolescent students in Edo State, Nigeria.
The attitudes of clergy in Benin City, Nigeria towards persons with ...
African Journals Online (AJOL)
Department of Clinical Services, Federal Psychiatric Hospital, Benin City, Edo State, Nigeria ... Their attitudes concerning mental illnesses would influence community mental health ... distributed to ministers at convenient group meetings, e.g..
Haematopoietic stem cell transplantation: activities (2014 report) in a ...
African Journals Online (AJOL)
PROMOTING ACCESS TO AFRICAN RESEARCH ... Introduction: Hematopoietic Stem Cell transplantation (HSCT) is the only curative therapy for ... Activities: The stem cell transplant centre at the University of Benin Teaching Hospital Edo ...
Prevalence of urinary schistosomiasis in Nigeria, 1994–2015 ...
African Journals Online (AJOL)
A. Abdulkadir
2017-03-14
Mar 14, 2017 ... Introduction: The Global significance of schistosomiasis started waning ... prevalence of schistosomiasis in Nigeria, and its six geo-political zones. ...... schistosomiasis in a rural community in Edo state, Nigeria: eosinophil-.
PERCEPTION OF HOST COMMUNITIES TOWARD THE ...
African Journals Online (AJOL)
DORCAS
Department of Forestry and Wildlife, University of Benin, Benin city, Edo state, Nigeria. Corresponding ... park laws relating to wildlife conservation in Okomu National Park. The Park ..... Parks. Federal. Government Press, Lagos, Nigeria.
design and implementation of a microcontroller-based adjustable ...
African Journals Online (AJOL)
HOD
1, DEPARTMENT OF COMPUTER ENGINEERING, UNIVERSITY OF BENIN, BENIN CITY, EDO STATE, NIGERIA ... ICs, to design a user friendly charger circuit that manually adjusts the voltage .... the multivibrator integrated circuit does it.
Evaluation of the Influence of Salt Treatment on the Structure of ...
African Journals Online (AJOL)
MICHAEL HORSFALL
Department of Chemical Engineering, University of Benin, Edo State, Nigeria. ABSTRACT: This paper ... activated carbon obtained by chemical activation exhibits a larger surface ..... A master thesis from Faculty of. Engineering, Zonguldak ...
Relationship Between Body Weight and Growth Traits of Crossbred ...
African Journals Online (AJOL)
SH
Pearson's correlation coefficient between body weight and other measured traits. .... management system where routine and ..... 13th Annual Conference of Animal ... and Genetic variation among local chickens in Edo State of Nigeria. Ed.
African Journals Online (AJOL)
AUNTY TEE
EJOTMAS: EKPOMA JOURNAL OF THEATRE AND MEDIA ARTS. 169 ... social, political and economic significance during the struggle for independence ..... was again appointed a Commissioner for Arts, Culture, and Tourism in. Edo State ...
African Journals Online (AJOL)
FINEPRINT
Farmers are exposed to certain occupational hazards which predispose ... sectional survey carried out among farmers in an agricultural industry in Edo ... general health services for farm workers. ..... industrial workers in cement, coal, steel.
International Nuclear Information System (INIS)
Suzuki, T.; Morita, M.; Yoneda, M.; Yoshinaga, J.
1998-01-01
Lead concentration and isotopic composition of prehistoric (middle and latest Jomon era, 2000-4500 BP, n=6), historic (Edo era, 130-400 BP, n=10), and contemporary (died in 1987-88, n=15) Japanese bones, and deciduous teeth from contemporary Japanese children born during 1985-88 (n=17) were analyzed by inductively coupled plasma mass spectrometry. Lead concentration was lowest in Jomon bones and was higher in rural Edo, contemporary, and urban Edo, in that order. Elevated Pb concentration in historic Edo people, as reported previously, was reconfirmed. The average isotopic ratios ( 207 Pb/ 206 Pb and 208 Pb/ 206 Pb) in excavated (prehistoric and historic) bones, contemporary bones, and deciduous teeth were different from each other. The contemporary bones had the least radiogenic composition (mean 207 Pb/ 206 Pb: 0.879; mean 208 Pb/ 206 Pb: 2.126) while the excavated bones the most (0.848; 2.098), and teeth intermediate (0.866; 2.111). The comparison with the literature data of isotopic compositions of environmental samples showed that the isotopic composition of the excavated bones was within the range of Japanese ores, rocks and soils, indicating the absence of foreign Pb sources in preindustrialized Japan. That of the contemporary bones was closer to the average gasoline Pb, the use of which had been banned in the late 1970s, than to the Pb in airborne particulate matter or refuse incineration ash of 1980s. The average Pb isotopic ratios in the deciduous teeth was close to the isotopic ratios of Pb in airborne particulate matter and refuse incineration ash. These data indicated that the contemporary Japanese population was exposed to foreign Pb which had different isotopic composition from domestic Pb. Exposure to Pb of foreign origin was particularly evidently recorded in people born before the leaded gasoline ban. The history of human Pb contamination in Japan is discussed based on the present results and other previously published data. (Copyright (c) 1998
Directory of Open Access Journals (Sweden)
Odalis López Soria
2011-09-01
Full Text Available Se realizó un estudio descriptivo y transversal para evaluar la prescripción de medicamentos contra infecciones del tracto respiratorio en niños y niñas menores de 5 años, pertenecientes al área de salud Libertador en el municipio del mismo nombre, estado de Carabobo (Venezuela, desde septiembre de 2006 hasta marzo de 2007, motivado por el incremento de indicaciones de ciertos antimicrobianos para combatirlas, dificultades en la calidad del plan terapéutico y ausencia de estadísticas al respecto. Los fármacos más prescritos fueron los betalactámicos (penicilinas, fenoximetilpenicilina y amoxicilina, aunque generalmente de forma inadecuada por obviarse la individualización del tratamiento. Se presentaron reacciones adversas medicamentosas, en su mayoría leves, por lo cual primó la satisfacción de los usuarios con el servicio de salud recibido.A descriptive and cross-sectional study was carried out from September, 2006 to March, 2007 in order to assess the drug prescription against infections of the respiratory duct in boys and girls under 5 years of age belonging to Libertador health area in the municipality with the same name from Carabobo state, Venezuela. The study was motivated by the increase of antimicrobial prescriptions to treat them, the difficulties in the quality of the therapeutic plan, and the absence of statistics regarding this matter. Most prescribed drugs were as follows: beta-lactams (penicillin, phenoxymethylpenicillin, and amoxycillin; however, they were generally prescribed in an inadequate way because individualization of treatment was overlooked. Some side effects, most of them mild, were observed. Thus, the health service received by patients was satisfactory.
ARQUITECTURA DE LA RED VIRTUAL DE APRENDIZAJE PARA EL CICLO BÁSICO (FACES-UC
Directory of Open Access Journals (Sweden)
Neyda Ibañez
2011-11-01
Full Text Available La sociedad del siglo XXI demanda una universidad adaptada a la nueva realidad que ofrece el desarrollo de la comunicación basada en la tecnología digital computarizada. En virtud de ello, la investigación tuvo como objetivo el diseñar la red virtual de aprendizaje para facilitadores y estudiantes del Ciclo Básico de la Facultad de Ciencias Económicas y Sociales de la Universidad de Carabobo (FaCES-UC, siendo este uno de los objetivos del proyecto LOCTI titulado Formación, capacitación y fortalecimiento a facilitadores del Ciclo Básico y de las Escuelas de FaCES-UC, en el manejo de entornos virtuales como herramientas de aprendizaje. Metodológicamente, el estudio se ubicó en el paradigma positivista de tipo descriptivo, con una población de 72 profesores, calculándose una muestra de 237 estudiantes, con muestreo aleatorio simple, utilizando la técnica de observación directa y aplicando como instrumento el cuestionario simple con 27 preguntas cerradas y dicotómicas. Los resultados arrojaron que más del 95 por ciento de los estudiantes y más del 37 por ciento de los profesores aportaron al diseño de la red virtual de aprendizaje. Se concluye la arquitectura del sitio Web a través de la clasificación de tres criterios que persiguen brindar a la comunidad tanto interna como externa a la Universidad de Carabobo, un portal que ofrezca y difunda información y servicios del Ciclo Básico de FaCES-UC y de sus diversas Cátedras que lo conforman.
Journal of Agriculture and Social Research (JASR) Vol. 16, No. 1 ...
African Journals Online (AJOL)
Ekunwe
The study examined the profitability of snail marketing in Benin metropolis, Edo state, Nigeria. Random ... Agricultural marketing can be defined as the performance of all business activities included in the flow of ..... Principles and Applications.
Population dynamics of Rodents and Insectivores in lowland tropical ...
African Journals Online (AJOL)
ADOWIE PERE
2018-03-19
Mar 19, 2018 ... ecosystem of Okomu National Park, Edo State, Nigeria. OMOGBEME, MI; OKE, CO. Department of Animal and Environmental Biology, University of Benin, P.M.B 1154, Benin City, Nigeria. ..... University Press ... IUCN (2017).
Beshiru, Abeni; Okareh, Oladapo T; Chigor, Vincent N; Igbinosa, Etinosa O
2018-06-09
Surface waters are important to humans because they are a significant water supply source. They are, however, under serious environmental stress and are being threatened as a consequence of developmental activities. The present study describes the physicochemical properties and water quality indices of five different rivers used for drinking and other domestic activities in rural and pre-urban communities in Edo North, Nigeria. The physicochemical variable ranges include pH [wet season (6.47 ± 0.30-6.89 ± 0.11), dry season (6.61 ± 0.14-7.84 ± 0.24)], electrical conductivity (EC) [wet season (3.33 ± 0.57-12.33 ± 2.51 μS/cm), dry season (5.33 ± 0.57-21.33 ± 2.08 μS/cm)], water temperature [wet season (24.23 ± 0.98-25.40 ± 1.15 °C), dry season (26.20 ± 0.55-27.10 ± 0.75 °C)], TDS [wet season (417.00 ± 15.87-433.33 ± 18.50 mg/L), dry season (319.33 ± 16.50-372.66 ± 22.30 mg/L)], turbidity [wet season (1.01 ± 0.11-2.08 ± 0.99 NTU), dry season (3.11 ± 0.01-5.41 ± 0.24 NTU)], and DO [wet season (2.65 ± 0.37-3.99 ± 0.01 mg/L), dry season (2.12 ± 0.11-2.44 ± 0.01 mg/L)]. For the wet and dry seasons, the water quality indices were 120.225 and 585.015 for River Osolo, 119.849 and 445.751 for River Foreign, 200.474 and 587.833 for Ijoh River, 105.261 and 512.498 for Ole River, and 150.114 and 489.992 for Ole Extension River, respectively. The pH was negatively correlated with DO (r = -0.648), and EC was negatively correlated with DO (r = -0.635). Most of the evaluated parameters were within recommended water safety guidelines. However, the water quality index shows that the water quality was very poor and/or unsuitable for drinking and other domestic uses, especially during the dry season. It is suggested that river water be treated prior to its use for drinking and other domestic purposes.
Directory of Open Access Journals (Sweden)
Leonardo Cazorla Papis
2013-02-01
Full Text Available El interés de esta investigación fue identificar los rasgos característicos de las Pyme venezolanas de los Estados Aragua y Carabobo, que condicionan sus decisiones de endeudamiento, así como identificar los factores internos que condicionan su estructura de capital.Se estudiaron las variables : riesgo empresarial, rentabilidad sobre activos, oportunidades de crecimiento, tamaño, reputación, concentración de capital y estrategias empresariales.Los resultados obtenidos demostraron que las variables: Riesgo empresarial, rentabilidad sobre activos, oportunidad de crecimiento, explican en un 60% la estructura de capital de las pequeñas y medianas empresas
Pino,Luz A.; Matinella,Liboria; Morales C.,Gustavo
1999-01-01
Se infectaron experimentalmente 9 lotes de 32 caracoles B. glabrata (de 5 a 7mm de diámetro) con miracidios de la cepa C5 de Schistosoma mansoni a razón de 5 miracidios por caracol, pertenecientes a las siguientes cepas: En el área endémica de transmisión de Esquistosomiasis mansoni a) Sector Puerta Negra, Lago Valencia, b) Cagua c) Ingenio Bolívar (Estado Aragua) d) Mariara e) Caserío El 25 f) Güigüe (Estado Carabobo). Fuera del área endémica de transmisión g) Anzoátegui (Estado Lara), h) Ch...
Nature of ergastic substances in some Poaceae seeds
African Journals Online (AJOL)
ajl yemi
2011-08-29
Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. ... Since seed is the storage organs of ergastic materials such as .... Ultrastructure and Development of Silica Bodies in Monocotyledons.
African Journals Online (AJOL)
PROF. MADUKWE
Participation of Women in the Third National Fadama Development Programme in. Edo State ... The project targets the rural poor [farmers, .... Divorced. Widowed. 10.7. 61.3. 07.3. 20.7. Educational attainment. No formal education primary.
Fruits and Seeds Production of Irvingia Gabonensis (O' Rorke) and ...
African Journals Online (AJOL)
Fruits and Seeds Production of Irvingia Gabonensis (O' Rorke) and Its Economic Importance in Edo Central, Nigeria. ... Journal of Agriculture and Social Research (JASR). Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current ...
Fruits and Seeds Production of Irvingia Gabonensis (O' Rorke) and ...
African Journals Online (AJOL)
Fruits and Seeds Production of Irvingia Gabonensis (O' Rorke) and Its Economic Importance in Edo ... Journal of Agriculture and Social Research (JASR) ... Irvingia gabonensis is one of the most important indigenous fruit trees cultivated and ...
Determination of water quality index and portability of Iguedo stream ...
African Journals Online (AJOL)
Determination of water quality index and portability of Iguedo stream in Edo ... has been found functional in assessing the water quality of this stream based on the ... Key words: Water quality index, physicochemical parameters, Iguedo Stream.
DECEMBER JMBR 13 - 2 correction.cdr
African Journals Online (AJOL)
Fine Print
pregnant women attending antenatal clinic in Etsako East LGA, Edo State. Methodology: A descriptive ... by being a leading cause of anaemia in. 2 pregnancy. Plasmodium ... For the prevention and control of malaria during pregnancy in ...
Informe científico de investigador: Cabello, Marta Noemí (2011-2012)
Cabello, Marta Noemí
2012-01-01
La investigación del período informado (2011-2012) se centró en el análisis de las comunidades de hongos biótrofos (simbiontes micorrícicos y patógenos de insectos) y saprótrofos, aislados de agrosistemas y ecosistemas naturales. Estos estudios se relacionan a los roles que estos microorganismos juegan en los diferentes sistemas, su participación como agentes de control biológico y su aplicabilidad en evaluaciones de sustentabilidad. Relacionado a hongos biotrofos formadores de mico...
Awareness of high blood pressure status, treatment and control in a ...
African Journals Online (AJOL)
west LGA of Edo State to assess the level of awareness of high blood pressure status, treatment and control. Cluster sampling method was used to select participants and data collection was by researcher administered questionnaire. Blood ...
African Journals Online (AJOL)
2016-01-31
Jan 31, 2016 ... Chemical Society; and IRMS Informatics India (J-Gate) ... Health Care, Ambrose Alli University, Edo State. ... Bridging the gaps of inequality in health care service delivery ... rich and poor, men and women, urban and rural.
African Journal of Urology - Vol 23, No 2 (2017)
African Journals Online (AJOL)
Management of the exstrophy-epispadias complex in adolescents and adults · EMAIL ... An unusual presentation of advanced prostate cancer in a 56-year old ... psychosocial impediments to self reporting of erectile dysfunction by men in Edo ...
Attention Deficit Hyperactivity Disorder Intervention: Strategies ...
African Journals Online (AJOL)
Edo Journal of Counselling. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 2, No 2 (2009) >. Log in or Register to get access to full text downloads.
chemical and mineralogical characterization of lateritic iron ore
African Journals Online (AJOL)
DJFLEX
2010-04-22
Apr 22, 2010 ... The laterite iron ore deposit at Auchi, Edo State, Nigeria was studied chemically and mineralogically. The results of the chemical ... SAMPLE PREPARATION. The samples .... 2µm) and were subjected to X-ray diffraction using.
monosymptomatic childhood nocturnal enuresis in Benin City, Nigeria
African Journals Online (AJOL)
Only children with a history of bed-wetting since birth were recruited. ... The parents of children in public primary and secondary schools in Egor local government area, Edo State, were interviewed ..... fertility control in a developing country.
La educación de las mujeres en dos novelas peruanas del siglo XIX : Herencia y Blanca Sol
Bustamante Oliva, Lita Giannina
2015-01-01
Esta investigación describe la situación de la educación de las mujeres peruanas de la élite limeña a partir de la segunda mitad del siglo XIX. Analizando los aspectos educativos presentados en las novelas Herencia y Blanca Sol, de Clorinda Matto de Turner y Mercedes Cabello de Carbonera respectivamente, se explican e interpretan las características de la educación que se ofrecía a niñas y jóvenes en la capital del Perú. Por un lado, los colegios privados de la época presentaban tanto un curr...
Moreno, Mónica Cárdenas
2018-01-01
En las dos últimas décadas del siglo XIX, en el contexto de la reconstrucción nacional que siguió a la Guerra del Pacífico (1879-1883), surge en las letras peruanas un nuevo pensamiento sobre la cuestión femenina basado en el liberalismo de raigambre ilustrada y en algunas ideas del positivismo. Manuel González Prada y algunas escritoras contemporáneas a la generación de 1870, como Clorinda Matto de Turner y Mercedes Cabello de Carbonera, critican el rol de la Iglesia en la educación de las m...
African Journals Online (AJOL)
Awareness of health risks associated with body piercing and tattooing among tertiary students in Auchi, Edo state, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T.A. Ehwarieme, F.O. Amieghemie ...
African Journals Online (AJOL)
User
because they cannot appreciate the extra protection afforded by ITN. ... To determine the factors affecting utilization of ITN by pregnant women in Etsako West LGA, Edo. State. A descriptive cross-sectional study design was employed. Using a ...
1448-IJBCS-Article-Orjiekwe Chike
African Journals Online (AJOL)
hp
The pollution of Ogbese River in Ovia North-East L.G.A. of Edo State, Nigeria was studied. Parameters like pH ... Keywords: Water pollution, environment, water analysis. INTRODUCTION ..... metal pollution in streams in Zhozhon city in China.
International Journal of Pedagogy, Policy and ICT in Education - Vol ...
African Journals Online (AJOL)
Prevalence of conduct disorder among adolescents in a senior secondary school in Benin City, Edo State, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EE Omotunde, O Philomena, 15-28 ...
African Journals Online (AJOL)
Items 601 - 650 of 1463 ... Vol 4, No 1 (2004), Gender inequality and domestic violence: ... in contraceptive use among educated women in Edo state, Nigeria, Abstract PDF ... women: a cross-sectional study from coastal South India, Abstract PDF.
Journal of Agriculture and Social Research (JASR) Vol. 11, No. 1 ...
African Journals Online (AJOL)
C.P. Kalu
The study examined the economic potential of taungya system in Edo state, using of data ... potential of taungya so as to convert all the possible potentials to reality. ..... issues of university of Britain Colombia Press, Vancouver, 497-504.
Climate Change Adaptation Needs of Male and Female Oil Palm ...
African Journals Online (AJOL)
User
2008 and Ayodele, 2010) and also results in an increase in demand for palm oil. The demand .... climate change adaptation practice needs of oil palm entrepreneurs in Edo State, .... female respondents had one form of education or the other.
IGBO POLITICAL ORGANIZATION AND IMPUNITY Ifeyinwa ...
African Journals Online (AJOL)
JONATHAN
2016-07-01
Jul 1, 2016 ... The focus of this paper is on the Democratic village Republican ... some other communities such as Yoruba, Hausa, Edo etc, but they have their own style of ... and in a democratic manner that abhors autocratic leadership.
2018-03-05T17:24:19Z https://www.ajol.info/index.php/index/oai oai ...
African Journals Online (AJOL)
article/55691 2018-03-05T17:24:19Z ajrh:ART Vulnerability of Nigerian Secondary School to Human Sex Trafficking in Nigeria Omorodion, FI Adolescents; Delta State; Edo State; in-school students; Nigeria; sex trafficking Sex trafficking ...
African Journals Online (AJOL)
Diabetic Patients Attending the University Teaching Hospital, Ado Ekiti, Nigeria Abstract · Vol 5, No 3 (2009) - Articles Plasma Zinc Levels of Pregnant Women Visiting Irrua Specialist Teaching Hospital, Irrua, Edo State, Nigeria Abstract · Vol 5, No ...
Edo Journal of Counselling: Editorial Policies
African Journals Online (AJOL)
Benue State, Nigeria Professor Adriana G. McEachern Florida Inter. University, Miami. USA. Professor Bryan Hiebert University of Calgary, Alberta. Canada Professor Beatrz Malik Universidad Nacional de Educación a Distancia (UNED) Madrid, Spain Professor Jim Athanasou University of Technology, Sydney. Australia.
African Journals Online (AJOL)
E. (Eshiobo) Irekpita
2017-05-03
May 3, 2017 ... b Dept. of Surgery, Irrua Specialist Teaching Hospital, Irrua, Nigeria c Dept. of Medicine .... the hospital as the treatment facility, while, the others either did .... pros and cons of reporting and creating an appropriate environment.
Psychological empowerment and development | Oladipo | Edo ...
African Journals Online (AJOL)
Using the archival method of investigation, this paper explores the subject of psychological empowerment (particularly in relation to youths) and national development. The specific objective of the paper is to explore and establish the importance of psychological empowerment of the masses and particularly the youths, ...
Lagos Historical Review - Vol 13 (2013)
African Journals Online (AJOL)
Human Trafficking in Edo State (Nigeria): A Socio- Economic Study · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AA Lawal, 17-30. http://dx.doi.org/10.4314/lhr.v13i1.2 ...
ETHNOBOTANICAL STUDIES OF WEST AFRICAN OKRA ...
African Journals Online (AJOL)
Administrator
18-87 years old. Of this number, 259 (48%) ... Traditional uses of the crop include food (100%) and non- ... inter-relationship studies between people and plants in the ..... of economic plants sold in the market of Benin City (Edo State). Nigeria.
Nigerian Journal of Horticultural Science - Vol 6, No 1 (2002)
African Journals Online (AJOL)
The Economic Potentials of Pineapple Marketing in Edo State, Nigeria. EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. G.O. Alufohal, 20-24. http://dx.doi.org/10.4314/njhs.v6i1.3340 ...
African Journals Online (AJOL)
AFFECTING THEIR AGRICULTURAL PRODUCTIVITY 'IN EDO STATE,. NIGERIA .... Divorce 2 1.7. Widow/widowed 3 ' 2.5. 40 .... as also reflected in Table 2 when illiteracy was rated high as one of the factors affecting prevalence of health ...
Evaluation of Questionnaire, Reagent Strip and Egg Count as ...
African Journals Online (AJOL)
A longitudinal study covering 55 months evaluated the three diagnostic tools used for confirmation of prevalence of urinary schistosomiasis among 1151 consented primary school pupils in 13 communities of Edo State, Nigeria. Questionnaire, reagent strip method and parasitological examination were employed.
West African Journal of Medicine - Vol 29, No 2 (2010)
African Journals Online (AJOL)
Pregnancy Associated with Recurrent Acromegaly: A Case Report · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AE Edo, A Eregie. http://dx.doi.org/10.4314/wajm.v29i2.68207 ...
Assessment of serum biochemistry in West African Dwarf (WAD ...
African Journals Online (AJOL)
Jane
2011-06-29
Jun 29, 2011 ... in our local breeds of goats such as West African Dwarf. (WAD) does. ... Farm, Faculty of Agriculture, Ambrose Alli University, Ekpoma in. Edo State ... degree North and latitude 6 degree North located in the rainforest zone of ...
growth and physiological performance of west african dwarf goats
African Journals Online (AJOL)
user
2014-09-02
Sep 2, 2014 ... Faculty of Agriculture, University of Benin, Benin, Edo State, Nigeria. ... Twenty young growing West African Dwarf (WAD) goats of both sexes with an average body weight of 5.77kg ... Northern part of the country (Ugwu and.
Socio-Economic status of parents as a correlate of re-entry of girls ...
African Journals Online (AJOL)
economic status (SES) and re-entry of girls into school in Edo State, Nigeria. One research question and one hypothesis were formulated for the study. Two research instruments, the “Socio-Economic Status of Parents” and the “Reentry into ...
African Journals Online (AJOL)
2016-11-04
Nov 4, 2016 ... Nelson-Immu JC, Mowatt L, Walters C.A. Patterns of ocular trauma presenting to the ... 11 hospital, Addis Ababa. Ethiop J Health Dev 2001;15:131-7. 12. ... injuries in Irrua Specialist Teaching Hospital, Irrua, Edo State Nigeria.
Directory of Open Access Journals (Sweden)
Bernardo Ricardo Pérez Barrero
2011-09-01
Full Text Available Se realizó un estudio de casos y controles en el consultorio Adaca, del área de salud integral comunitaria El Socorro en el municipio de Valencia, estado venezolano de Carabobo, para valorar los principales factores de riesgo que influyeron en la aparición de gingivitis crónica en 75 adolescentes de 15-18 años durante el período comprendido desde agosto de 2009 hasta enero de 2010. La selección para ambos grupos se efectuó a través del muestreo no probabilístico intencional (por orden de llegada a la consulta: el primero estuvo integrado por 25 con gingivitis crónica (diagnosticados mediante el índice gingival de Loë y Silness y el segundo por 50 (2 sanos por cada paciente. En la casuística se obtuvo que los varones fueron los más afectados por esa inflamación en las encías, directamente relacionada con la higiene bucal deficiente y el hábito de fumar.A case-control study was carried out at Adaca doctor's office, belonging to Socorro, a comprehensive community health area, from Valencia municipality in Carabobo state, Venezuela, in order to assess the primary risk factors which influenced on the chronic gingivitis occurrence in 75 teenagers aged 15-18 years from August, 2009 to January, 2010. The selection of both groups was made through the intentional non-probability sampling (that is to say, according to the arrival order. The first group was composed of 25 patients with chronic gingivitis (diagnosed through Loë and Silness´ gingival index, while the second group consisted of 50 patients (2 healthy teenagers per each patient. In the case material, male teenagers were the most affected by the aforementioned gum inflammation, directly related to poor oral hygiene and smoking habit.
Directory of Open Access Journals (Sweden)
Tejero Encinas Silvia
2003-01-01
Full Text Available Fundamento: La tuberculosis pulmonar en España tiene una frecuencia superior a la que le correspondería, dado su desarrollo social y sanitario. Aparte de algunos estudios puntuales, la incidencia se conoce a partir del Sistema de Notificación como Enfermedad de Declaración Obligatoria (EDO, en el que se ha detectado algún grado de infradeclaración. Se ha planteado si se puede mejorar esta información empleando además otro registro, concretamente el Conjunto Mínimo Básico de Datos (CMBD. Métodos: Se trata de un estudio retrospectivo del periodo 1996-2000, llevado a cabo en la población de un área de salud de 220.572 habitantes. Se han utilizado los datos del registro EDO en el nivel de asistencia especializada y los del registro CMBD con el diagnóstico de tuberculosis pulmonar. Se calcularon las tasas de incidencia para cada fuente y según el método captura-recaptura. Se analizaron características epidemiológicas de las personas como: edad, género, lugar de residencia, condición de bacilífero, y datos asistenciales de los casos ingresados como, estancia media, tipo de ingreso, tipo de alta, servicio clínico. Resultados: La incidencia media anual registrada en el nivel de atención especializada fue de 16,6 por 10(5 habitantes en el registro EDO, 20,4 casos por 10(5 habitantes en el CMBD y de 23,1 por 10(5 habitantes combinando ambas fuentes. La incidencia estimada con el método captura-recaptura fue de 24,4 por 10(5 hab. (IC95%: 23,5-25,3. Conclusiones: Cualquier sistema de información que aporte datos fiables sirve para mejorar la vigilancia epidemiológica aunque haya sido diseñado con otro fin. Se trata de conocer sus limitaciones y peculiaridades. El CMBD proporciona información de interés epidemiológico no contenida en los partes de EDO. La aplicación del método captura-recaptura es una alternativa para estimar tasas más reales de tuberculosis pulmonar.
Directory of Open Access Journals (Sweden)
Silvia Tejero Encinas
2003-01-01
Full Text Available Fundamento: La tuberculosis pulmonar en España tiene una frecuencia superior a la que le correspondería, dado su desarrollo social y sanitario. Aparte de algunos estudios puntuales, la incidencia se conoce a partir del Sistema de Notificación como Enfermedad de Declaración Obligatoria (EDO, en el que se ha detectado algún grado de infradeclaración. Se ha planteado si se puede mejorar esta información empleando además otro registro, concretamente el Conjunto Mínimo Básico de Datos (CMBD. Métodos: Se trata de un estudio retrospectivo del periodo 1996- 2000, llevado a cabo en la población de un área de salud de 220.572 habitantes. Se han utilizado los datos del registro EDO en el nivel de asistencia especializada y los del registro CMBD con el diagnóstico de tuberculosis pulmonar. Se calcularon las tasas de incidencia para cada fuente y según el método captura-recaptura. Se analizaron características epidemiológicas de las personas como: edad, género, lugar de residencia, condición de bacilífero, y datos asistenciales de los casos ingresados como, estancia media, tipo de ingreso, tipo de alta, servicio clínico. Resultados: La incidencia media anual registrada en el nivel de atención especializada fue de 16,6 por 105 habitantes en el registro EDO, 20,4 casos por 105 habitantes en el CMBD y de 23,1 por 105 habitantes combinando ambas fuentes. La incidencia estimada con el método captura-recaptura fue de 24,4 por 105 hab. (IC95%: 23,5- 25,3. Conclusiones: Cualquier sistema de información que aporte datos fiables sirve para mejorar la vigilancia epidemiológica aunque haya sido diseñado con otro fin. Se trata de conocer sus limitaciones y peculiaridades. El CMBD proporciona información de interés epidemiológico no contenida en los partes de EDO. La aplicación del método captura-recaptura es una alternativa para estimar tasas más reales de tuberculosis pulmonar.
Annals of Biomedical Sciences - Vol 17, No 1 (2018)
African Journals Online (AJOL)
Assessment of career specialty preferences among medical students at the University of Benin, Benin city, Edo state · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. O.E. Obarisiagbon, G. Owoeye, J.C. Chukwu, V. Onwuchekwa ...
36 Dry Season Phytoplankton Composition Of Ibiekuma Dam ...
African Journals Online (AJOL)
`123456789jkl''''#
freshwater algae of Edo State. To benefit from ... Algae. (phytoplankton) are the source of oxygen in aquatic systems and are the main ... be used in determining water pollution level. A dam is a ... taken in situ, using a mercury in bulb glass.
Biochemical assessement of liver enzymes in immunocompromised ...
African Journals Online (AJOL)
Aim: This study aims at the estimation of serum alkaline phosphatase (ALP), alanine aminotransferase (ALT), Aspartate aminotransferase (AST), and glutmyltransferase GGT (Liver enzymes) in Human immunodeficiency virus(HIV) and/or Acquired immune deficiency syndrome(AIDS) patients in parts of Edo State, Nigeria.
Spatio-Temporal Variation in Water Quality of Orle River Basin, S.W. ...
African Journals Online (AJOL)
Spatio-Temporal Variation in Water Quality of Orle River Basin, S.W. Nigeria. ... Abstract. The water quality of small streams in Auchi area of Edo State, S.W. Nigeria was investigated with a view to ... and ecosystems. The study was carried out
Maize cob losses and their effects on the poverty status of maize
African Journals Online (AJOL)
This study analysed fresh maize cob losses and its effect on the poverty status of maize farmers in Edo State,. Nigeria. The specific .... is the poverty gap for ... Total cost. 162,367.48. 100.00. Returns. Total expected yield (N). 327,966.63. _.
Letters and Viewpoints Studies on the Effect of Laundry Effluent on ...
African Journals Online (AJOL)
topsoil, laundry effluent, soil physiochemical properties, pH, available phosphorus, exchangeable sodium, potassium, exchangeable sodium percentage, percentage base saturation, soil buffering capacity, cation exchange capacity, Edo, Nigeria Résume Des résidus issus des blanchisseries ont toujours prouvé leur effet ...
Women's land rights and the challenge of patriachy: lessons from ...
African Journals Online (AJOL)
Women's land rights and the challenge of patriachy: lessons from ozalla community, edo state, Nigeria. ... production output and ensuring higher incomes. KEYWORDS: Cultural practices, customary, economic life, food crisis, food production, gender equity, land rights, patriarchy, rural agriculture, rural areas, social justice ...
impact of quality improvement in primary schools (quips) programme ...
African Journals Online (AJOL)
Elizabeth
teachers in the school as well as the assistance that the programme has given to ... Edo Journal of Counselling. Vol. 2, No .... and compulsory at least at the elementary level. ... in order to get the opinions of the members of the Parent Teachers.
African Journals Online (AJOL)
FIRST LADY
Determinants of Rural Development in Edo State, Nigeria: An Overview (Pp ... half of this population is without proper-formal education (World Bank. 2005). Data for this ..... forestry, tourism) based on rural resources. The identification ... Olayide, B. (2002) Sustainable Settlement Development Constraints and. Strategies.
A survey of the parasites of the African white-bellied pangolin ...
African Journals Online (AJOL)
Phataginus tricuspis) in Edo State, Nigeria. They were purchased at Ekiuwa Market in Benin City, where they are sold and people consume the meat as a good source of protein and the animal can also be used for medicinal purposes. Four (4) ...
Assessing the knowledge of asthma among community pharmacists ...
African Journals Online (AJOL)
Purpose: To assess the knowledge of community pharmacists about asthma and its management. Methods: Seventy-six registered community pharmacists in. Edo State completed a structured questionnaire consisting of open and close ended questions which addressed issues relating to their knowledge of asthma
Helminth parasites of Silurana tropicalis from the Okomu National ...
African Journals Online (AJOL)
Silurana tropicalis, the edible clawed-frog, collected from the Okomu National Park, Edo State, Nigeria, was examined for helminth parasitic infections. From 142 specimens collected, ten endo-helminth parasites spread across four classes were recovered. These included Cestoda: Cephalochlamys compactus and the cyst ...
Original Researc Original Research
African Journals Online (AJOL)
RAGHAVENDRA
2009-09-17
Sep 17, 2009 ... agriculture systems in Edo state, Nigeria and char ... were inferred as different varieties of the species of th ... tate, Nigeria and characterize them using molecular marker ... Article Information ... The development of Polymerase Chain Reaction (PCR) ... Quarters, University of Benin Teaching Hospital.
assessment of the activity of glucose-6-phosphate dehydrogenase
African Journals Online (AJOL)
Uwaifoh
2012-10-31
Oct 31, 2012 ... Chemical Pathology, Irrua Specialist Teaching Hospital, Irrua, Edo ... in type 2 diabetes mellitus patients and control subjects using enzymatic ... inappropriate antioxidation process. ... without a previous diagnosis of diabetes develop a ... variants. It confers protection against malaria, which accounts for its ...
Ultraviolet spectroscopic evaluation of bioactive saponin fraction ...
African Journals Online (AJOL)
This study was to evaluate and characterize the saponin principles, using chromatographic and ..... triterpenoids, reducing sugars, amino acids, flavonoids, ..... blood glucose levels of diabetic rats. Int. J. Biol. Chem. ... homeostatic plants in Edo and Delta. States of ... mellitus: Systematic review and meta- analysis. BMJ,.
Effect of Consuming Rooftop Harvested Rainwater from Esan ...
African Journals Online (AJOL)
MICHAEL HORSFALL
ABSTRACT: This study assessed the effects of some local sources of drinking water in. Okiagbem, Uromi and Ubiaja communities of Esan Edo State Nigeria on the biochemical, ... International reviews have shown that .... failure multiple myeloma, nutritional deficiencies etc. ..... Caffeine effects on short-term performance.
Influence of job frustration, narcissism and demographic variables ...
African Journals Online (AJOL)
The study examines the hypothesised relationship among job frustration, narcissism, demographic variables and professional ethical behaviour among Nigerian Police officers. One hundred policemen drawn from four police divisions of Benin Area Command of Edo State participated in the study. There were 18 females ...
Knowledge and Attitude of Public Secondary School Teachers ...
African Journals Online (AJOL)
The study investigated knowledge and attitude of public secondary school teachers towards continuous assessment (CA) practices in Edo Central Senatorial District, Nigeria. The study was undertaken to determine the influence of gender, age, years of experience and area of educational specialization on teachers' attitude ...
Nigerian Journal of General Practice - Vol 11, No 1 (2013)
African Journals Online (AJOL)
Prevalence and pattern of Dyslipidaemia among adult hypertensives in the general pratice clinic of University of Benin Teaching Hospital, Benin City Edo State Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. DD Uyagu, O Ebomwonyi, PO Dienye ...
Demographics as predictors of practice of HIV voluntary counselling ...
African Journals Online (AJOL)
This study assessed the demographic variables predicting the practice of HIV Voluntary Counselling among secondary school adolescents in Edo State. Thus, a descriptive survey research was adopted for the study. One thousand, nine hundred and eighty eight (1988) secondary school adolescents were sampled from ...
The challenges facing commercial motorcycle occupation in Etsako ...
African Journals Online (AJOL)
This study examined the challenges facing commercial motorcycle occupation in Edo State, Nigeria. A descriptive survey design was adopted. Data were collected through questionnaires and in-depth interviews (IDIs) among selected motorcyclists, police officers and road safety officials in Etsako West Local Government ...
STECH, 3(3), S/NO 12, SEPTEMBER, 2014
African Journals Online (AJOL)
DR Nneka
2014-09-12
Sep 12, 2014 ... the Nigerian Economy through Integrated Rural Development. Okosun ... Department of General Studies, ... Benin City, Edo State, Nigeria .... create a vast network of growth centres in town and villages. ... farmers to form cooperative farming. ..... Country Case Study Towards a Global Strategy for Cassava.
Awareness of health risks associated with body piercing and ...
African Journals Online (AJOL)
Recently, there has been a widespread practice of tattooing and body piercing among youths despite the increased number of potential complications associated to the practice. This study aims to assess the awareness of health risk associated with body piercing and tattooing in Federal Polytechnic Auchi, Edo state.
Test anxiety, attitude to schooling, parental influence, and peer ...
African Journals Online (AJOL)
This study investigated test anxiety, attitude to schooling, parental influence, and peer pressure as predictors of cheating tendencies in examination among secondary school students in Edo State, Nigeria. Ex-post facto research design was adopted for the study. Using stratified random sampling technique, 1200 senior ...
Farmers\\' Characteristics And Adoption Of Recommended Practices ...
African Journals Online (AJOL)
The study focused on farmers under the fadama project scheme in Edo State, Nigeria with emphasis on the relationship between farmers\\' characteristics and adoption of recommended technologies. Analyses of data obtained from a random sample of 80 respondents reveals that fadama farming was dominated by females ...
International Journal of Basic, Applied and Innovative Research ...
African Journals Online (AJOL)
Prevalence and association of asymptomatic prostatitis with urinary tract infection among apparently healthy men in Ekpoma, Edo, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AA Turay, AI Obadan, GRA Okagun, MA Okadua, AEJ Okwori, 72-79 ...
Gender and environmental influence on laterality functions among ...
African Journals Online (AJOL)
Background: A semi‑structured questionnaire was designed to ascertain laterality functions in randomly sampled population of 400 preclinical students of the University of Benin, Benin City, Edo State, Nigeria. Methodology: Frequency in use of limbs in physical activities categorized as: Always if (>80%), usually if ...
Relationship between relative humidity and the dew point ...
African Journals Online (AJOL)
This research was aimed at determining the relationship between relative humidity and the dew point temperature in Benin City, Edo State, Nigeria. The dew point temperature was approximated from the measured air temperature and relative humidity with the aid of a currently self-designed weather monitoring system.
Relationship between Knowledge and Attitude towards HIV ...
African Journals Online (AJOL)
The study assessed the relationship between knowledge and attitude towards HIV voluntary counselling among secondary school adolescents in Edo State. One hypothesis guided the study. This was a descriptive correlational study based on survey research design. The population of the study was one hundred and ...
Errata: Reasons For Tooth Extraction Among Nigerian Children ...
African Journals Online (AJOL)
Dental caries was the predominant reason for exodontia in Nigeria children attending a general dental practice in Uselu, Edo State. Extensive prevention programmes targeted at children with high caries risk in schools and the communities is a necessity. Key words: exodontia, reasons, children, general dental practice ...
Estimation Of Measles Sero-conversion in Children Vaccinated ...
African Journals Online (AJOL)
A study of seroconversion of 115 children between 9 months to 5 years vaccinated against measles was conducted in Oriowon local government area of Edo State. This has to establish the immune status of the children against measles after immunisation. Haemagglutination inhibition technique was used. Prevaccination ...
Phytochemical screening and antimicrobial evaluation of the ...
African Journals Online (AJOL)
Piper umbellatum is widely distributed tropical plant species. The plant has been reported to possess an array activity including anti-inflammatory, antioxidant, antifungal, analgesic and skin protection. It is consumed as a vegetable and used ethnomedicinally in the treatment of stomach pain in Edo state, Nigeria.
Assessment of creatine kinase and lactate dehydrogenase activities ...
African Journals Online (AJOL)
Ina bid to investigate the influence of menopausal on coronary heart disease, plasma creatine kinase (CK) and lactate dehydrogenase (LDH) enzymes were analysed on a prospective cohort of 100 women attending Irrua Specialist Teaching Hospital (ISTH), Irrua, Edo state-Nigeria. They were divided into two groups; ...
African Journals Online (AJOL)
user
ABSTRACT. Onchocerciasis among 278 children (0-15yrs) of Ekpan village, a hyperendemic community in Uhunmwode. Local Government Area of Edo State, Nigeria was investigated using the prevalence of nodules as index. The overall prevalence of palpable nodules was 26.3%. Nodule prevalence increased with age ...
eudiometric theoretic eudiometric theoretic-approach to modelling
African Journals Online (AJOL)
eobe
2016-01-01
Jan 1, 2016 ... 2 DEPARTMENT OF PRODUCTION ENGINEERING, UNIVERSITY OF BENIN, BENIN CITY, EDO STATE NIGERIA ... phenomenon of chemical adsorption and desorption of DO at molecular level in a .... Again, few authors have applied linear regression in .... Our goal in modelling is to replicate this natural.
Llorens Planella, Maria Teresa (Teresa Canepa)
2015-01-01
This dissertation focused on the prolific early European trade and consumption of three Asian manufactured goods: Chinese silk and porcelain, and Japanese lacquer in the sixteenth and early seventeenth centuries, and has shown how the material cultures of late Ming China and Momoyama/early Edo Japan
10 CFR 1.32 - Office of the Executive Director for Operations.
2010-01-01
... supervision and direction of the Chairman as provided in Reorganization Plan No. 1 of 1980. (b) The EDO supervises and coordinates policy development and operational activities in the following offices: The Office... Office of Information Services, the Office of Investigations, the Office of Small Business and Civil...
Comparison of gold leaf thickness in Namban folding screens using X-ray fluorescence
Energy Technology Data Exchange (ETDEWEB)
Pessanha, Sofia; Madeira, Teresa I.; Manso, Marta [Centro de Fisica Atomica da Universidade de Lisboa, Lisbon (Portugal); Guerra, Mauro; Carvalho, Maria Luisa [Centro de Fisica Atomica da Universidade de Lisboa, Lisbon (Portugal); Universidade Nova de Lisboa, Departamento de Fisica, Faculdade de Ciencias e Tecnologia, Caparica (Portugal); Gac, Agnes le [Centro de Fisica Atomica da Universidade de Lisboa, Lisbon (Portugal); Universidade Nova de Lisboa, Departamento de Conservacao e Restauro, Faculdade de Ciencias e Tecnologia, Caparica (Portugal)
2014-09-15
In this work, the thickness of the gold leaf applied in six Japanese folding screens is compared using a nondestructive approach. Four screens belonging to the Momoyama period (∝1573-1603) and two screens belonging to the early Edo period (∝1603-1868) were analyzed in situ using energy dispersive X-ray fluorescence, and the thickness of the applied gold leaf was evaluated using a methodology based on the attenuation of the different characteristic lines of gold in the gold leaf layer. Considering that the leaf may well not be made of pure gold, we established that, for the purpose of comparing the intensity ratios of the Au lines, layers made with gold leaf of high grade can be considered identical. The gold leaf applied in one of the screens from the Edo period was found to be thinner than the gold leaf applied in the other ones. This is consistent with the development of the beating technology to obtain ever more thin gold leafs. (orig.)
Services of Economic Development Organisations in Győr
Directory of Open Access Journals (Sweden)
Adrienn Reisinger
2017-12-01
Full Text Available Economic development of a municipality is highly depended on organizations and institutions, which services target local entrepreneurs and other economic actors. In the summer of 2015 we have collected and mapped the services of organizations with the function of economic development in the Hungarian city, Győr. Through our research we could identify the services and the characteristics of linkages and cooperation of the economic development organizations (EDOs. Most important findings of the study are the followings: activity of the organizations has a wide range. Some of them are presented in more organizations at the same time. Level of diversification is quite low. Directions of cooperation are mainly based on personal or ad hoc relations. We conducted that EDOs know about each other, despite of this fact the number of linkages is low. In this paper we provide findings about Győr, but the results can be used for other settlements’ economic development, too.
Comparison of gold leaf thickness in Namban folding screens using X-ray fluorescence
International Nuclear Information System (INIS)
Pessanha, Sofia; Madeira, Teresa I.; Manso, Marta; Guerra, Mauro; Carvalho, Maria Luisa; Gac, Agnes le
2014-01-01
In this work, the thickness of the gold leaf applied in six Japanese folding screens is compared using a nondestructive approach. Four screens belonging to the Momoyama period (∝1573-1603) and two screens belonging to the early Edo period (∝1603-1868) were analyzed in situ using energy dispersive X-ray fluorescence, and the thickness of the applied gold leaf was evaluated using a methodology based on the attenuation of the different characteristic lines of gold in the gold leaf layer. Considering that the leaf may well not be made of pure gold, we established that, for the purpose of comparing the intensity ratios of the Au lines, layers made with gold leaf of high grade can be considered identical. The gold leaf applied in one of the screens from the Edo period was found to be thinner than the gold leaf applied in the other ones. This is consistent with the development of the beating technology to obtain ever more thin gold leafs. (orig.)
Supracondylar and infratubercular processes observed in the ...
African Journals Online (AJOL)
SERVER
2007-11-05
Nov 5, 2007 ... 1Department of Anatomy, School of Basic Medical Sciences, Igbinedion University, Okada, P.M.B. 0006, Benin City,. Edo State. Nigeria. 2Department ... reliance on computer imaging in diagnostic medicine. (Harry et al., 1997). ... origins, because the proximal epiphyses are absent. The proximal epiphysis ...
Seroprevalence of Hepatitis C Virus in People Exposed to ...
African Journals Online (AJOL)
This study was therefore undertaken to determine the seroprevalence of hepatitis C virus (HCV) infection in people who had been exposed to traditional surgical practices in Edo State, Nigeria. Sera from the subjects were tested for HCV antibodies using Clinotech Diagnostic test device supplied by Clinotech Diagnostic and ...
Parents' occupation as correlate of students' career aspiration in ...
African Journals Online (AJOL)
This study investigated the relationship between parents' occupation and students' career aspiration in public secondary schools in Esan West Local Government Area of Edo State. The correlational research design was adopted for the study. A sample of 320 students was drawn for by simple random sampling technique ...
Factors Militating Against Effective Implementation of the 6-3-3-4 ...
African Journals Online (AJOL)
Nneka Umera-Okeke
4 education policy in Nigeria, using Esan North East Local Government Area of Edo. State as a case study. ... Human Rights (1948), the International Covenant on Economic, Social and Cultural .... The following research questions were formulated to guide this study: (a) Does ... The role of technical education in South.
Economic analysis of the marketing of plantain: a case study of ...
African Journals Online (AJOL)
This study concentrated on economic analysis of the marketing of plantain in Uhunmwode and Ovia North East Local Government Areas of Edo State. Six markets, made up of three from each local governmnet were selected because of their high population of plantain marketers and their approximate equal sizes.
International Journal of Basic, Applied and Innovative Research ...
African Journals Online (AJOL)
The incidence and pattern of supernumerary digital flexion creases amongst the population of Ekpoma in Edo, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. VA Uko, AO Nwaopara, MA Olugbenga, GP Oyadonghan, P Imah, D Aimiosior, 57 - 62 ...
Journal of Community Medicine and Primary Health Care - Vol 30 ...
African Journals Online (AJOL)
Assessment of occupational hazards, health problems and safety practices of petrol station attendants in Uyo, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL ... Fitness to drive among commercial intercity drivers in Benin-City, Edo State · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Evaluating Basic Technology Instruction in Nigerian Secondary ...
African Journals Online (AJOL)
It is an important technique which when appropriately adopted results into effective teaching and learning of practical subjects. This study focused on identification of evaluating techniques aimed at improving the teaching of Basic technology in Edo State. The area of study comprises of the eighteen Local Government Areas ...
Trichomonas vaginalis infection among adolescent girls in some ...
African Journals Online (AJOL)
Trichomonasvaginalisis the most common non-viral sexually transmitted disease (STD) and one of the neglected parasitic infections. This study aimed to determine the prevalence of T. vaginalisinfection among adolescent girls in some secondary schools in Edo State, Nigeria. A total of 272 girls were recruited in this study.
Population dynamics of Rodents and Insectivores in lowland tropical ...
African Journals Online (AJOL)
The community structure of rodents and insectivores in the lowland tropical rainforest of Okomu National Park, Edo State, Nigeria was assessed using a combination of live-trapping and sighting techniques during the dry and wet seasons. Seventeen species (14 species of rodent, 3 species of insectivores) were captured, ...
Study habit skills as correlate of academic performance of ...
African Journals Online (AJOL)
Study habit is one of the major factors that could influence students' academic attainment. Thus, this study examined study habit skills as correlate of academic performance of undergraduates in Edo state, Nigeria. It employed a correlation research design, using multistage sampling technique. Two hundred and forty eight ...
African Journals Online (AJOL)
Items 1 - 50 of 55 ... Vol 33, No 1 (2014), Coping strategies for marital stress as reported by ... On Managing Adolescents' Aggressiveness Among Senior Secondary ... of the gifted Students in the Inclusive classroom among secondary ... in the classroom among Secondary School teachers in benin - City, Edo State, Abstract.
Federal government financing of grassroots decay in Nigeria: the ...
African Journals Online (AJOL)
... self-reproduction project typical of patron-client politics. In this context, it is assumed that phenomenal growth in statutory and allied revenues accruing to rural locales has not produced the desired development, but undesired decay. Key Words: Nigeria – Federal financing, Edo State, public administration, political science ...
Job Satisfaction and Psychological Health of Long Distance Drivers ...
African Journals Online (AJOL)
This cross-sectional analytical study was designed to assess the level of and factors affecting job satisfaction and psychological health among long distance drivers in Benin City, Edo, Nigeria. A 21-item Job satisfaction questionnaire and the Golberg's General Health Questionnaire (GHQ 28) were used for data collection ...
A Study of the Constraint to Formulation and Implementation of ...
African Journals Online (AJOL)
In recent years, Benin metropolis has been faced with solid waste management problems. Solid wastes generated from household and commercial activities are dump indiscriminately in the metropolis. The Edo state government has made effort in policy formulation and funding in line with the national policy on the ...
African Journals Online (AJOL)
Geophysical Exploration of Gravel Deposits in Abudu Area of Edo State, Nigeria Abstract · Vol 20, No 1 (2012) - Articles Transformation of the Hubbard Hamiltonian to the t-J Hamiltonian using the Raleigh- Schrodinger Perturbation Expansion Abstract. ISSN: 1116-4336. AJOL African Journals Online. HOW TO USE AJOL.
Effects of counselling techniques in rehabilitating emotional ...
African Journals Online (AJOL)
This study investigated the effectiveness of Rational Emotive therapy (RET) and Systematic Desensitization (SD) in promoting emotional adjustment among adolescents in Edo state. Quasi Experimental design was used for the study. A total number of eighty four (84) students were randomly selected for the study and three ...
Relative Contributions of Socio-Cultural Variables to the Prediction ...
African Journals Online (AJOL)
Erah
the Prediction of Maternal Mortality in Edo South. Senatorial ... variables across the two locations (rural and urban) was early marriage/early child bearing (R2 = 0.200;. F = 401.40 ... severe bleeding, infections, obstructed or prolonged .... Analytical System (SAS) mode. Descriptive .... incontinence of urine and faeces due to.
10 CFR 20.1007 - Communications.
2010-01-01
... addressed to the Executive Director for Operations (EDO), and sent either by mail to the U.S. Nuclear... Pike, Rockville, Maryland; or, where practicable, by electronic submission, for example, via Electronic Information Exchange, or CD-ROM. Electronic submissions must be made in a manner that enables the NRC to...
Causes and Management of Domestic Conflicts among Couples ...
African Journals Online (AJOL)
Whereas the issue of domestic conflict is universal, its manifestation differs between and within ethnographic regions of the world. This paper examines the phenomenon of domestic conflict among couples in Esan-speaking area of Edo State. Particularly the paper addresses the main causes of the problem and the ...
A review of the effects of dams on the hydrology, water quality and ...
African Journals Online (AJOL)
In this paper, the effects of dams on the hydrology, water quality and invertebrate fauna of some Nigerian inland waters were reviewed. The freshwaters considered include Awba Reservoir (Oyo State), Shiroro Lake (Kaduna State), Moro Lake (Kwara State), Aiba Reservoir (Osun State), Ikpoba Reservoir (Edo State), Onah ...
Business Educators' Views on the Entrepreneurial Competencies ...
African Journals Online (AJOL)
This study investigated Business Educators' views on the entrepreneurial competencies eeded by business education graduates in Nigeria. A 23-item instrument was used for this study. The study sample comprised all the 66 Business Education lecturers in the universities and colleges of Education in Edo and Delta states ...
FINANCIAL CONTROL STRATEGIES FOR COLLECTING BODY OF A MUNICIPAL TAX
Directory of Open Access Journals (Sweden)
Ernesto Rodríguez
2015-07-01
Full Text Available This article's main purpose is to propose fiscal control strategies for tax collection in a Hall of Carabobo state, taking into account the responsibility of municipal governments within its governance process to provide optimal services to citizens the municipality, in order to improve their quality of life. This research focused on the modality of feasible project and descriptive. The population under study consisted of 10 staff of the institution, applying a survey as a tool for information gathering, allowing coding, tabulating and analyzing the results. The findings established that the institution is presenting negatives in tax revenue of the municipality, which generates large arrears and tax evasion by citizens, hence leading to the importance of design strategies that lead to minimize this situation.
Bacterial Isolates from Blood Samples of Patients in University of ...
African Journals Online (AJOL)
Bacterial Isolates from Blood Samples of Patients in University of Benin Teaching Hospital Benin City, Edo State, Nigeria. ... The thioglychollate broth was sub cultured onto blood agar plate for anaerobic incubation, while the brain heart infusion broth was sub cultured onto chocolate, blood agar and McConkey agar for ...
Comparative Demand Analysis for Rice in Three States of South ...
African Journals Online (AJOL)
Dauda Omoba
2013-01-01
Jan 1, 2013 ... The contribution of the effect of the price of rice on the budget share of rice in the study ...... it is a luxury in rural areas of Delta state. This may imply that ... between brands of rice in rural Lagos and urban. Edo was the highest ...
Ethnobotanical studies of west african okra [ Abelmoschus caillei (a ...
African Journals Online (AJOL)
It is produced in traditional agriculture especially when other vegetables are not in season and an important cash crop in the local economy. This study is aimed at generating information and documenting the ethnobotany of A. caillei via the indigenous knowledge among tribes of Delta, Edo and Ondo States of Nigeria).
Strategic Implications of Emerging Threats to West African Countries
2012-03-14
foresters are smaller and as their name suggests seek refuge in the forests (the Ibo, the Edo, the Yoruba , the Nupe, the Ashanti, the Fon, the Kru, the...secession of the southeastern provinces of Nigeria as the self-proclaimed Republic of Biafra. The conflict stemmed from economic, ethnic, cultural and
l-moments approach for floo moments approach for floo okhuwan
African Journals Online (AJOL)
User
Generalized Logistic distribution (GLO) and G distribution ... nnual maximum stream flow series for 20 years (1989-2008). e the best ... eter distribution models namely: Generalized Extreme Value distribu namely: .... Figure 1: Map of Edo state Nigeria showing location of study River in the Benin Owena River Basin. Table 2: ...
Perinatal mortality in a rural community | Ewah | East African Medical ...
African Journals Online (AJOL)
Objective: To determine the peri-natal mortality rate (PMR), still birth rate (SBR) and early neonatal death rate (ENDR) in Igueben Local Government Area (LGA) of Edo State. Design: A descriptive cross-sectional study. Setting: Igueben LGA is a rural governmental unit in mid-western Nigeria. Subjects: All women of ...
Attitude o f librarians towards the use of Information and ...
African Journals Online (AJOL)
Attitude o f librarians towards the use of Information and Communication Technology in some selected Nigerian Universities in Edo and Delta State , Nigeria. ... Furthermore, knowledge of IC T and training of librarians influence positive attitude towards ICT. Based on the findings, it is recommended that all librarians who do ...
African Journals Online (AJOL)
Abstract · Vol 15, No 1 (2016) - Articles Undergraduates' view of lecturers' age as a factor in their teaching effectiveness. Abstract PDF · Vol 15, No 1 (2016) - Articles Test anxiety, attitude to schooling, parental influence, and peer pressure as predictors of students cheating tendencies in examination in Edo state, Nigeria
Global Journal of Geological Sciences - Vol 2, No 1 (2004)
African Journals Online (AJOL)
GEOPHYSICAL INVESTIGATION OF GROUND SUBSIDENCE: A CASE STUDY OF A BEVERAGE FACTORY SITE IN EDO STATE, NIGERIA · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JO Fatoba, BM Salami, 153-160. http://dx.doi.org/10.4314/gjgs.v2i1.18690 ...
The crustacean zooplankton assemblage of a relatively pristine Utor ...
African Journals Online (AJOL)
The water quality and crustacean zooplankton of Utor River, a relatively pristine freshwater body in Edo State, Nigeria was investigated at four stations. The Utor River is slightly acidic, well oxygenated, oligotrophic and low in solids, conductivity, cations and heavy metals. A total of 380 individuals comprising eleven taxa ...
Health Workers' Knowledge of Preventing Mother-To-Child ...
African Journals Online (AJOL)
Health Workers' Knowledge of Preventing Mother-To-Child Transmission of HIV in Benin City, Edo State, Nigeria. ... The proportion of health workers with poor, fair, and good knowledge of the national guidelines on PMTCT was 8.5%, 30.4% and 61.1% respectively. Knowledge of the national guidelines was significantly ...
JMBR Journal - dec 2012 - gan...
African Journals Online (AJOL)
Mrs Musa
Benin City, Edo State, Nigeria. It provides specialist medical services, including ophthalmic services. ... Benin Teaching Hospital, Benin City, Nigeria - A Preliminary Report.....45 about where to get eye care services, patient For the .... rate, and with good surgical outcome will. 1. Patel D, Baker H, Murdoch I. Barriers to uptake.
African Journals Online (AJOL)
Isibor, J P. Vol 14, No 2 (2005) - Articles Chlamydia trachomatis Infecion Among Apparently Healthy Students of Ambrose Alli University Ekpoma, Edo State, Nigeria Abstract. ISSN: 1116-1043. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...
Fitness to drive among commercial intercity drivers in Benin-City ...
African Journals Online (AJOL)
Background: Unfit drivers are prone to road traffic accident, therefore their health is paramount in ensuring the safety of road users. To determine the fitness to drive among commercial intercity bus drivers in Benin City, Edo State Material and methods: A descriptive cross-sectional study was conducted among 194 ...
Characteristics of Commercial Motorcyclists in Benin City ...
African Journals Online (AJOL)
The aim of this paper is to evaluate the characteristics of commercial motorcyclists in Ugbowo, Benin-city. A cross-sectional and descriptive study was carried out among commercial motorcyclists in Ugbowo, Benin-city, Edo State. A total of 252 commercial motorcyclists were involved in the study. A cluster sampling method ...
Assessment of water quality of Ogbese River in Ovia North-East ...
African Journals Online (AJOL)
The pollution of Ogbese River in Ovia North-East L.G.A. of Edo State, Nigeria was studied. Parameters like pH, temperature, electrical conductivity, colour, odour, chlorides, nitrates, phosphates and heavy metal ions such as lead, chromium, zinc etc, were analyzed. Also various techniques such as titrimetric methods, atomic ...
Pre-colonial economy of Igala society | Achoba | Nigerian Journal of ...
African Journals Online (AJOL)
Throughout the vicissitude of history, man has always moved from one place to another in search for better economic activities. Hence, Igala people developed long distance trade with their neighbours such as the Yoruba, Igbo, Nupe, Tiv, Idoma, Edo and others around them. This type of economy brought a considerable ...
Assessment of training needs of extension staff of agricultural ...
African Journals Online (AJOL)
The study identified strong training needs for Edo State extension agents on communication skills (X= 4.60), planning demonstration (X=4.60), evaluation of trials (X= 4.57) and farmers training (X=4.56). The correlation analysis showed that education had significant relationship many areas of the respondents' training ...
Self-esteem, gender, family-communication-style and parental ...
African Journals Online (AJOL)
This study examined the role of self-esteem, gender, family communication style, and parental neglect on aggressive tendencies among secondary school adolescents' in Esan West Local Government Area of Edo State. A total of two hundred and forty (240) secondary school adolescents drawn from 9 private and 3 public ...
Evaluation of fungicides for the control of false smut of rice caused ...
African Journals Online (AJOL)
Benomyl, Copper Oxychloride, Iprodione, Thiabendazole (TBZ) and Mancozeb were evaluated both in the laboratory and field study in 1994, for the control of false smut of rice caused by Ustilaginoidea virens (Cooke) Tak. in upland rice in Edo State, Nigeria. In the laboratory the fungicides were evaluated at three ...
Zidovudine therapy: Effect(s) on histology of the kidney of wister rats ...
African Journals Online (AJOL)
This study investigated the histo-morphological effect(s) of Zidovudine therapy on the kidney of Wister rats. Fifteen Wistar rats obtained from the Animal house of the College of Medicine, Ambrose Alli University, Ekpoma, Edo State, Nigeria, were used for this study. A three week period of acclimatisation was allowed.
Soldiers’ Psychological Responses to Tactical Nuclear Warfare
1992-02-01
530. Greene , T.L. (1987). Description of a nuclear battlefield. In R.H. Young & B.H. Drum (Edo.), Proceedings of the Defense Nuclear Agency Symposium...ATTN: DEPT OF BEHAVOR SCI & LEADERSHIP ATTN: PMS/PMA-423 ATTN: DEPT OF PHYSICS COL J G CAMPBELL ATTN: SCIENCE RESEARCH LAB OPERATIONAL TEST & EVALUATION
Physico-chemical analysis of fish pond water in Okada and its ...
African Journals Online (AJOL)
Water samples were collected from concrete and earthen fish ponds in different locations in Okada and its environs, Edo State, Nigeria. Twenty-one different physiochemical parameters were analyzed using standard laboratory methods and procedures. In the present study, the values of the parameters ranged from pH 6.75 ...
Sodium concentration in home made salt – sugar – solution (sss ...
African Journals Online (AJOL)
In a cohort of 210 young mothers, selected through cluster sampling technique from Ogida health district of Egor Local Government Area of Edo State, the electrolyte concentration of prepared salt-sugar-solutions (SSS) were evaluated. This was predicated on the need to determine the effects of introduction of various ...
Child adoption amongst women attending infertility clinic in a tertiary ...
African Journals Online (AJOL)
Worldwide, child adoption is one of the main options for infertile couples that help in alleviating the psychological and social consequences of childlessness. The study set out to assess the knowledge, attitude and practice to adoption in a rural community in Esan central Local government area of Edo state, Nigeria.
A study of the microbiology and polycyclic aromatic hydrocarbons ...
African Journals Online (AJOL)
A study was carried out on the drill cuttings from three different oil and gas wells located at Ologbo Community at Edo State with respect to their microbiology and polycyclic aromatic hydrocarbons (PAHs) compositional profile and sources. Isolation and enumeration of heterotrophic bacteria and fungi was carried out using ...
art and culture administration in Edo State
African Journals Online (AJOL)
imitch
its environment the social, political, economic, aesthetic and religious norms and ... essence of culture “as the development and refinement of the various aspects of ... the academia, had many editions of it published before going out of circulation. ... of the statue of “General Asoro” which was unveiled in Benin City on 11th.
art and culture administration in Edo State
African Journals Online (AJOL)
imitch
its environment the social, political, economic, aesthetic and religious norms and .... December, 2009, the Ministry of Arts, Culture and Tourism did organize a well ... and Social Welfare Departments and the mass media in the state so that the ...
HYDROLOGICAL ASSESSMENTS OF SOME RIVERS IN EDO ...
African Journals Online (AJOL)
Highest monthly hydropower yields were recorded in September for Ovia, Ikpoba and Edion Rivers and in August for Orlie River. On annual basis, Ovia River, recorded the highest power yield of 61.619MW (suggesting that Ovia river may be suitable for a Medium hydropower scheme, 10MW-100MW) with the highest ...
African Journals Online (AJOL)
Enabulele, EE. Vol 33, No 1 (2012) - Articles Helminth Community of Tree frogs at the Okomu National Park, Edo State, Nigeria Abstract · Vol 33, No 1 (2012) - Articles Ecto and Gastrointestinal Parasites of Captured Wild Pigeons in Benin City, Nigeria Abstract. ISSN: 1117-4145. AJOL African Journals Online. HOW TO USE ...
EJOTMAS: Ekpoma Journal of Theatre and Media Arts: Submissions
African Journals Online (AJOL)
The contributor must be consistent in the use of either the MLA or APA style. Footnotes to the text should be avoided. All articles, correspondence and enquiries should be sent to: The Editor. EJOTMAS: Ekpoma Journal of Theatre and Media Arts. Department of Theatre and Media Arts,. Ambrose Alli University, Ekpoma, Edo ...
Human serum protein and C-reactive protein levels among HIV ...
African Journals Online (AJOL)
Human serum protein and C-reactive protein levels were determined among HIV patients visiting St Camillus Hospital, Uromi, Edo State, Nigeria, between January to March, 2013. Fifty (50) HIV patients (20 males; 30 females) and 50 control subjects (24 males; 26 females) were enrolled for this study. The clinical status of ...
African Journals Online (AJOL)
UNIBEN
Background: Emergency contraception (EC) refers to the use of drugs or a device as an emergency measure ... Methods: A descriptive cross-sectional study was carried out on 400 male students of the. University of ... University of Benin, Benin City, Edo State, Nigeria. E-mail: ..... pill,. IUD. 2013.www.nhs.uk/conditions/contra.
Case Report of A Baby with Suspected Vacterl Constellation ...
African Journals Online (AJOL)
A term, normal birth weight, appropriate for gestational age, male infant born in a private hospital in Delta State and referred to University of Benin Teaching Hospital, Benin City, Edo State on account of his abdominal and limb defects. The baby had multiple birth defects consistent with a diagnosis of VACTERL association.
Effects of Plant Density and NPK Application on the Growth and ...
African Journals Online (AJOL)
Studies were conducted at Evboneka, Edo State, Nigeria in a forest zone to examine the effect of increasing plant population and NPK application on the growth and tuber yield of Dioscorea rotundata (Poir) cv “Obiaoturugo”. This study involved three trials. The first was conducted in 2010 involving five plant densities (10000 ...
African Journals Online (AJOL)
Items 401 - 450 of 917 ... Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives ... Vol 17, No 4 (2017), Factors associated with anaemia status and ... breastfeeding practices in Edo state, Nigeria, Abstract PDF ... Vol 8, No 3 (2008), Factors likely to enhance mycotoxin introduction into the human ...
Parenting Styles as Predicators of Anxiety and Depression of In-School Adolescents in Nigeria
Adubale, Andrew A.
2017-01-01
The study investigates parenting styles as predictors of anxiety and depression in secondary school students in Edo State, Nigeria. It employed a correlation research design. Two hundred and forty students constituted the sample for the study. Parenting Style Scale questionnaire was used to collect data for the study. Linear regression was used to…
Prevalence of conduct disorder among adolescents in a senior ...
African Journals Online (AJOL)
The study investigated the prevalence of conduct disorder among adolescents in a senior secondary school in Benin City. This was a survey study. The population was made up of 1,540 students in one of the mixed schools that was randomly selected from the senior secondary schools in Benin City, Edo State Nigeria.
An Empirical Investigation of Some Social and Economic ...
African Journals Online (AJOL)
This study explored the level of some socio-economic remittances from relatives to the elderly in Edo Central. It focused on the range of income/financial assistance; revealed the regularity of assistance with food, clothing, laundry and medicine. A total of 514 respondents, 65 years and above, selected by systematic random ...
Medical cost of Lassa fever treatment in Irrua Specialist Teaching ...
African Journals Online (AJOL)
This cross-sectional study sought to estimate the direct medical cost of Lassa fever treatment on patients in South-South Nigeria. All the 73 confirmed Lassa fever cases admitted in the isolation ward of the Institute Of Lassa Fever Research and Control, Irrua Specialist Teaching Hospital (ISTH) Irrua, in Edo State, Nigeria, ...
Female access to basic education: a case for open distance learning ...
African Journals Online (AJOL)
The purpose of this study was to investigate the impact of Open Distance Learning (ODL) on the female access to basic education. The population of the study consists of all lecturers/teachers of ODL centres in Benin City, Edo State. Five ODL/Community Resource Study centres were identified and used for the study.
Vocational interest, counselling, socioeconomic status and age as ...
African Journals Online (AJOL)
The aim of the study was to investigate the relationship between vocational interest, counselling, socio-economic status and age on re-entry of girls into school in Edo State. One research hypothesis was formulated to guide the study. The design was correlational. Five research instruments were used: they are the Modified ...
Indications for Surgical Removal of the Eye in Irrua, Nigeria | Enock ...
African Journals Online (AJOL)
Objective: To determine the reasons for removal of the eye at the. Irrua Specialist Teaching hospital, Irrua, Edo State, southern Nigeria. Method: A retrospective study of all cases of enucleation and evisceration carried out over a 10-year period – July 1997 to June 2007 – at the Irrua Specialist Teaching Hospital. Data
Ethno veterinary practices of small ruminant livestock farmers in ...
African Journals Online (AJOL)
Data were collected from a total of 400 ruminant livestock farmers selected from Oyo, Ogun, Lagos, Ondo and Edo States of Nigeria using Multi-stage sampling technique. The data collected include the specific attributes of small ruminant livestock farmers in the area, ethno-veterinary practices of farmers in the treatment of ...
Prevalence of obesity in nigerians with type 2 diabetes mellitus seen ...
African Journals Online (AJOL)
Background: Obesity increases the cardiovascular disease burden in type 2 diabetes mellitus (DM). There are few reports on obesity in type 2 DM patients in Edo State, Midwestern Nigeria. Objective: To determine the prevalence of obesity in Nigerians with type 2 DM seen in a secondary medical center. Methods: This was ...
Marine Corps Systems Command (MCSC) Advanced Planning Briefing To Industry (APBI)
2008-05-14
Members: 16 • Primes: Columbia Group, DTI , EDO, EG&G, INS/LM, Logis-Tech, ProSol, Titan L3 CEOss FY08 Domain Players 30 Prime...and staff locations – Driver cannot be suspended but will need a reinforced seat and leg protection 61 “$5-8 Million dollars per year are provided
Nigerian Hospital Practice - Vol 7, No 5-6 (2011)
African Journals Online (AJOL)
Awareness of Sickle Cell Disease amongst Mothers of Under-Fives in Ekosodin community, Edo state, Nigeria. EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. BI Abhulimhen-Iyoba, ME Odunvbun, AA Okolo, 57-63. http://dx.doi.org/10.4314/nhp.v7i5-6.70347 ...
Journal of Applied Sciences and Environmental Management - Vol 9 ...
African Journals Online (AJOL)
Activity of Zymomonas species in palm-sap obtained from three areas in Edo State, Nigeria. ... Flood risk assessment: a review. TE Ologunorisa, MJ Abawua. A preliminary evaluation of otamiri river sands for the production of plain glass ... Health impact assessment of mangrove vegetation in an oil spilled site at the Bodo ...
African Journals Online (AJOL)
Items 201 - 229 of 229 ... Vol 16, No 2 (2004), The deposition of magnesium fluoride (MGF2) thin films by chemical bath deposition (CBD) technique: their characterization and ... Vol 18, No 1 (2006), Variation in well-head gamma radiation levels at the Nigerian Petroleum Development Company oil field, Ologbo, Edo State, ...
International Journal of Arts and Humanities(IJAH) Ethiopia
African Journals Online (AJOL)
Nneka Umera-Okeke
General laws comprise the framework from which a particular ... election and evaluate the impact on political participation of the voters of Edo State. In ... shares with the reader the results of other studies that are closely related to the study ... other mass media when they became evident- radio, movies and television. Interest ...
Directory of Open Access Journals (Sweden)
Jessica Flores-Torres
2011-03-01
Full Text Available Objetivos. Evaluar las diferencias entre el valor de hemoglobina observada y el valor estimado a partir del hematocrito en el marco del Segundo Estudio Nacional de Crecimiento y Desarrollo Humano de la Población Venezolana (SENACREDH en el eje centro norte costero del país. Materiales y métodos. Por medio de un muestreo probabilístico multietápico por conglomerados se seleccionó un total de 6004 sujetos que representan 7 286 781 habitantes del eje Centro Norte Costero (Vargas, Carabobo, Distrito Capital, Aragua y Miranda. Se compararon medias de la hemoglobina observada y hemoglobina estimada (hematocrito/3, usando la prueba t para muestras relacionadas. Se realizaron regresiones lineales entre hemoglobina observada y hematocrito. Resultados. Se observó que el promedio de las diferencias entre la asignadas a la hemoglobina observada y la estimada por el hematocrito fue de -0,3446 ± 0,0002 (pObjectives. To evaluate the differences between the observed hemoglobin levels and those estimated based on hematocrit in the context of the 2nd National Study of Human Growth and Development of the Venezuelan Population (SENACREDH. Materials and methods. 6,004 individuals were chosen by a probabilistic multistage cluster sampling representing 7,286,781 inhabitants from North Central Coastal area (Vargas, Carabobo, Capital District, Aragua and Miranda. Means of observed and estimated hemoglobin (hematocrit/3 were compared, using t test for related samples and linear regression. Results. Mean difference between the values of observed and estimated hemoglobin was -0.3446 ±0.0002 (p<0.001; significantly overestimating the hemoglobin values. Regression models of hemoglobin on hematocrit showed an r2=0,87. In order to correct the estimation, we propose a new formula for calculating hemoglobin based on haematocrit values: estimated hemoglobin=(Haematocrit/3.135+ 0.257. Conclusions: There is an overestimation of hemoglobin levels from hematocrit levels and
Imaging of obstructive azoospermia
Energy Technology Data Exchange (ETDEWEB)
Cornud, F. [Clinique Radiologique, 15 Avenue Robert Schuman, F-75 007 Paris (France)]|[Service de Radiologie, Hopital Necker, 169 rue de Sevres, F-75 015 Paris (France); Belin, X. [Clinique Radiologique, 15 Avenue Robert Schuman, F-75 007 Paris (France)]|[Service de Radiologie, Hopital Necker, 169 rue de Sevres, F-75 015 Paris (France); Delafontaine, D. [Medicine de la Reproduction, 8 rue Jean Richepin, F-75 016 Paris (France); Amar, T. [Uro-Andrologist, 19 Avenue Victor Hugo, F-75016, Paris (France); Helenon, O. [Service de Radiologie, Hopital Necker, 169 rue de Sevres, F-75 015 Paris (France); Moreau, J.F. [Service de Radiologie, Hopital Necker, 169 rue de Sevres, F-75 015 Paris (France)
1997-09-01
Obstructive azoospermia represents approximately 10 % of cases of male hypofertility. It is classified according to the volume of ejaculate. When the latter is normal a proximal obstruction is suspected. Scrotal sonography can help to detect dilation of the epididymal head when clinical findings are equivocal. Ejaculatory duct obstruction (EDO) is suspected when the volume of ejaculate is low. The use of transrectal ultrasonography (TRUS) plays a major role in the investigation of these patients, and endorectal MRI is a very useful adjunct in selected cases. The most common cause of EDO is congenital bilateral absence of vas deferens, which is now thought to be a genital form of cystic fibrosis in 80 % of cases. Consequently, a definitive diagnosis must be made before any attempt at in vitro fertilization. TRUS accurately visualizes abnormalities of the caudal junction of the vas deferens and seminal vesicles, yielding a definitive diagnosis without scrototomy. Other causes of EDO are congenital cysts compressing the distal part of the ejaculatory ducts and inflammatory distal stenosis. The former are accurately identified by TRUS, but the latter give more or less marked signs of obstruction which are only of value in azoospermic patients with a low-volume ejaculate. More invasive imaging is required to diagnose partial obstruction of the ED. Surgical vasography is still the reference, but puncture of the seminal vesicles under TRUS guidance is an attractive alternative, as it permits aspiration of seminal fluid (to seek motile sperm) and vasography without scrototomy. Lastly, endorectal MRI well assesses the relationships between the proximal prostatic urethra and the posterior wall of the ejaculatory ducts, which need to be precisely known when endoscopic resection of the ejaculatory ducts is planned. (orig.). With 9 figs.
Imaging of obstructive azoospermia
International Nuclear Information System (INIS)
Cornud, F.; Belin, X.; Delafontaine, D.; Amar, T.; Helenon, O.; Moreau, J.F.
1997-01-01
Obstructive azoospermia represents approximately 10 % of cases of male hypofertility. It is classified according to the volume of ejaculate. When the latter is normal a proximal obstruction is suspected. Scrotal sonography can help to detect dilation of the epididymal head when clinical findings are equivocal. Ejaculatory duct obstruction (EDO) is suspected when the volume of ejaculate is low. The use of transrectal ultrasonography (TRUS) plays a major role in the investigation of these patients, and endorectal MRI is a very useful adjunct in selected cases. The most common cause of EDO is congenital bilateral absence of vas deferens, which is now thought to be a genital form of cystic fibrosis in 80 % of cases. Consequently, a definitive diagnosis must be made before any attempt at in vitro fertilization. TRUS accurately visualizes abnormalities of the caudal junction of the vas deferens and seminal vesicles, yielding a definitive diagnosis without scrototomy. Other causes of EDO are congenital cysts compressing the distal part of the ejaculatory ducts and inflammatory distal stenosis. The former are accurately identified by TRUS, but the latter give more or less marked signs of obstruction which are only of value in azoospermic patients with a low-volume ejaculate. More invasive imaging is required to diagnose partial obstruction of the ED. Surgical vasography is still the reference, but puncture of the seminal vesicles under TRUS guidance is an attractive alternative, as it permits aspiration of seminal fluid (to seek motile sperm) and vasography without scrototomy. Lastly, endorectal MRI well assesses the relationships between the proximal prostatic urethra and the posterior wall of the ejaculatory ducts, which need to be precisely known when endoscopic resection of the ejaculatory ducts is planned. (orig.). With 9 figs
International Nuclear Information System (INIS)
Koizumi, Akio; Azechi, Miki; Shirasawa, Koyo
2009-01-01
Teeth can serve as records of environmental exposure to heavy metals during their formation. We applied a new technology - synchrotron radiation microbeams (SRXRF) - for analysis of heavy metals in human permanent teeth in modern and historical samples. Each tooth was cut in half. A longitudinal section 200 μm in thickness was subjected to the determination of the heavy metal content by SRXRF or conventional analytical methods (ICP-MS analysis or reduction-aeration atomic absorption spectrometry). The relative concentrations of Pb, Hg, Cu and Zn measured by SRXRF were translated in concentrations (in g of heavy metal/g of enamel) using calibration curves by the two analytical methods. Concentrations in teeth in the modern females (n=5) were 1.2±0.5 μg/g (n=5) for Pb; 1.7±0.2 ng/g for Hg; 0.9±1.1 μg/g for Cu; 150±24.6 μg/g for Zn. The levels of Pb were highest in the teeth samples obtained from the humans of the Edo era (1603-1868 AD) (0.5-4.0 μg/g, n=4). No trend was observed in this study in the Hg content in teeth during 3,000 years. The concentrations of Cu were highest in teeth of two medieval craftsmen (57.0 and 220 μg/g). The levels of Zn were higher in modern subjects (P<0.05) than those in the Jomon (∼1000 BC) to Edo periods [113.2±27.4 (μg/g, n=11)]. Reconstruction of developmental exposure history to lead in a famous court painter of the Edo period (18th century) revealed high levels of Pb (7.1-22.0 μg/g) in his childhood. SRXRF is useful a method for reconstructing human exposures in very long trends. (author)
Directory of Open Access Journals (Sweden)
Danny A Asogun
Full Text Available BACKGROUND: Lassa fever is a viral hemorrhagic fever endemic in West Africa. However, none of the hospitals in the endemic areas of Nigeria has the capacity to perform Lassa virus diagnostics. Case identification and management solely relies on non-specific clinical criteria. The Irrua Specialist Teaching Hospital (ISTH in the central senatorial district of Edo State struggled with this challenge for many years. METHODOLOGY/PRINCIPAL FINDINGS: A laboratory for molecular diagnosis of Lassa fever, complying with basic standards of diagnostic PCR facilities, was established at ISTH in 2008. During 2009 through 2010, samples of 1,650 suspected cases were processed, of which 198 (12% tested positive by Lassa virus RT-PCR. No remarkable demographic differences were observed between PCR-positive and negative patients. The case fatality rate for Lassa fever was 31%. Nearly two thirds of confirmed cases attended the emergency departments of ISTH. The time window for therapeutic intervention was extremely short, as 50% of the fatal cases died within 2 days of hospitalization--often before ribavirin treatment could be commenced. Fatal Lassa fever cases were older (p = 0.005, had lower body temperature (p<0.0001, and had higher creatinine (p<0.0001 and blood urea levels (p<0.0001 than survivors. Lassa fever incidence in the hospital followed a seasonal pattern with a peak between November and March. Lassa virus sequences obtained from the patients originating from Edo State formed--within lineage II--a separate clade that could be further subdivided into three clusters. CONCLUSIONS/SIGNIFICANCE: Lassa fever case management was improved at a tertiary health institution in Nigeria through establishment of a laboratory for routine diagnostics of Lassa virus. Data collected in two years of operation demonstrate that Lassa fever is a serious public health problem in Edo State and reveal new insights into the disease in hospitalized patients.
African Journals Online (AJOL)
Ofevwe, GE. Vol 22, No 1-2 (2010) - Articles Evaluation of the performance of primary schools in Oredo Local Government Area of Edo State in the school health programme. Abstract PDF. ISSN: 0794-7410. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...
High Prevalence of Vitamin A Deficiency in School Age Children in ...
African Journals Online (AJOL)
One hundred and fifty two children aged 6 to 12 years were randomly selected from10 out of 33 public primary schools in a Local Government Area of Edo State, Nigeria, to assess their plasma Vitamin A levels. Bessey's spectrophotometric method of ultraviolet destruction of vitamin A was used for determination of their ...
Features and perceptions of menopausal women in Benin City ...
African Journals Online (AJOL)
Methods: A descriptive cross-sectional study of 533 randomly selected Nigerian women in Benin City, Edo State who had experienced at least 24 continuous months of amenorrhea using a structured questionnaire. Results: The ages of the women studied ranged between 47 and 78 years; mean 57.4 ± 6.3 years. The mean ...
African Journals Online (AJOL)
Adubale, AA. Vol 33, No 1 (2014) - Articles Predictive value of parenting styles on the academic achievement of adolescent students in Edo State, Nigeria. Abstract. ISSN: 0189-0263. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners ...
A Comparative Analysis of Profitability of Broiler Production Systems ...
African Journals Online (AJOL)
This study investigated the cost implications of raising broilers under the battery cage and deep litter system of poultry production. The data used in the study were obtained from a cross-sectional survey of broiler farmers in Edo State from October– December, 2013. A multi-stage sampling process was used to select the 211 ...
Nature of ergastic substances in some Poaceae seeds
African Journals Online (AJOL)
ajl yemi
2011-08-29
Aug 29, 2011 ... 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011. Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and ...
African Journals Online (AJOL)
Experience from Benin, Edo State. Abstract PDF · Vol 39, No 2 (2012) - Articles Accuracy of mother's touch in assessing the presence of fever in children. Abstract PDF · Vol 39, No 2 (2012) - Articles Morbidity and mortality of childhood illnesses at the emergency paediatric unit of the University of Benin Teaching Hospital, ...
Physicochemical, heavy metal and mineral elements assessment of ...
African Journals Online (AJOL)
The Benin-Agbor road is a major road linking Edo State and the Eastern states of Nigeria, characterized by daily vehicular movements. The inhabitants of the area depend on the river waters mainly for their domestic purposes. It was against the above background that this research was conducted in order to assess the ...
Attitude and Motivation as Predictors of Academic Achievement of Students in Clothing and Textiles
Uwameiye, B. E.; Osho, L. E.
2011-01-01
This study investigated attitude and motivation as predictors of academic achievement of students in clothing and textiles. Three colleges of education in Edo and Delta States were randomly selected for use in this study. From each school, 40 students were selected from Year III using simple random technique yielding a total of 240 students. The…
African Journals Online (AJOL)
Omotunde, EE. Vol 4, No 1 (2014) - Articles Prevalence of conduct disorder among adolescents in a senior secondary school in Benin City, Edo State, Nigeria Abstract. ISSN: 2026-6081. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...
The Relationship Between Library Development and Students ...
African Journals Online (AJOL)
The study examined the level of development of school libraries in privately owned secondary schools in five local government areas of Edo State and the influence of the school libraries on students' academic performances. Random sampling was used to select 48 out of a total of the 83 private schools in the study area.
THE PERFORMANCE PRACTICE IN AYELE MUSIC AND DANCE ...
African Journals Online (AJOL)
ABSTRACT. This paper focuses on Ayele music and dance of the Unuwazi village in Uromi, Esan North East Local Government Area of Edo State. It examines the term Ayele, its tradition of origin, its musical instruments, context of performance and performance practices. So as to be able to elicit data from the field, ...
Onyesom, Moses; Okolocha, Chimezie Comfort
2013-01-01
The study assessed the adequacy of instructional resources available for business education programmes at the colleges of education in Edo and Delta states of Nigeria in relation to the standards stipulated by the National Commission for Colleges of Education (NCCE). The study adopted the ex-post facto research design and was guided by five…
A contrastive study of two varieties of Onicha and the Central Igbo ...
African Journals Online (AJOL)
Igbo is also a minority language of the people of Delta, Rivers, and Edo states in the present south-south geopolitical zone. It is fraught with numerous dialects which can be arranged in clusters. Some Igbo linguists recognize merely two major dialect areas, namely Onicha (Onitsha) and Owere (Owerri) on which this study is ...
Attitudinal and motivational factors influencing job performance of ...
African Journals Online (AJOL)
The study investigated the attitudinal and motivational factors influencing job performance of female extension agents in Edo State, Nigeria. A random sample of 35 female extension agents was selected for the study. Findings reveal that the majority of the respondents (57.1%) were in the age group of 31 – 40 years and ...
Serological markers of hepatitis B infection in infants presenting for ...
African Journals Online (AJOL)
owner
2012-12-29
Dec 29, 2012 ... birth. Key words: Serological markers, hepatitis B. first infant immuniza- tion. Introduction. Universal infant immunization has been recommended since 1992 by the World ... to the inhabitants of Benin City, the capital of Edo state,. Nigeria. .... Of the 13(52%) that were done at home 5(38.5%) were carried out ...
The Influence of Gender on Junior Secondary School Students ...
African Journals Online (AJOL)
This paper is on the influence of gender on junior secondary school student's attitude towards mathematics in Ovia North East local government area of Edo state. The descriptive survey design was employed for the study. The population of the study comprised of all the JSS3 students, a total of Three Thousand Six Hundred ...
African Journals Online (AJOL)
Hospital (UPTH) who met the criteria for diagnosis of GDM were recruited for the study. It is routine practice in the ... For the purpose of this study the selection criteria for diagnosis of GDM were as follows: The presence of .... populations are predominantly Yoruba / Edo stock who are ethno-linguistically different from the Port.
Zerbitzu-marketineko terminologiaren azterketa
Oyarzabal Zapirain, Yon
2017-01-01
UPV/EHUko Enpresen Administrazio eta Zuzendaritza gradu amaierako lan honen helburua Marketin sektoriala edo Sektore-marketina irakasgaiaren barruan kokatzen den Zerbitzu-marketin arloko terminologia erreala biltzen duen termino-zerrenda eleaniztun bat egitea da. Honekin, Ekonomia Zientzien esparruan euskarazko terminologia errealaren garapen eta finkapenean ekarpen bat egin nahi dugu eta terminoak testuetan nola erabiltzen diren erakutsi.
The relation between invasive and non-invasive tear break-up time ...
African Journals Online (AJOL)
Tear stability normal to Nigerians with consideration of gender and age has not been reported. Tear stability in young adults was measured using invasive and non-invasive tear break-up time (TBUT and NIBUT). Forty –five subjects aged 20 to 30 years were selected from among the students of University of. Benin, Edo ...
African Journals Online (AJOL)
Items 51 - 100 of 408 ... Vol 16, No 1 (2017), Attitude of final year medical students of a Nigerian university towards homosexuality, Abstract. E.O. Adayonfo, C.O. Selo-Ojeme. Vol 15, No 1 (2016), Awareness and knowledge of female genital mutilation among women in a sub-urban community in Edo State, Nigeria, Abstract.
Art in Venezuela during the Centenary of its Independence, 1910-1911
Directory of Open Access Journals (Sweden)
Roldán Esteva-Grillet
2010-07-01
Full Text Available The commemoration of the centenary of Venezuela's independence strengthened in the people the idea of finally having reached an environment of peace and harmony, and of reunion with past glories. Official initiatives favoring the arts necessarily chose the path of exalting patriotic values through public monuments following classical standards. The Centennial was probably the highest point in this academic tradition rejected by youths, but useful to official institutions, so the success of two artists is not casual: sculptor Eloy Palacios with his Monument to Carabobo in 1911, and painter Tito Salas with his Bolivarian Triptych in the same year. Most of the public artistic heritage commissioned for the centennial still adorns the capital, but the artists’ contribu- tion has not yet been fully assessed.
LA SUCESIÓN EXITOSA EN LAS EMPRESAS FAMILIARES
Directory of Open Access Journals (Sweden)
María Roselia Aira
2016-04-01
Full Text Available El objetivo general de investigación fue establecer las características requeridas para la sucesión exitosa en empresas familiares del Estado Carabobo. La metodología se sustenta en la indagación exploratoria y descriptiva, apoyada en un esquema de investigación cualitativa empleando la entrevista. Los resultados del estudio consideran que la empresa familiar está en manos de personas que son familia, con capacidad profesional, confianza, tolerancia, lealtad, colaboración y comunicación. Con características de liderazgo, rol de mando, adecuado uso de recursos de la empresa y negociación en condiciones favorables, búsqueda de resultados económicos satisfactorios. Con actitudes concretas que implican compromiso, integración afectiva y proactividad.
African Journals Online (AJOL)
Items 101 - 150 of 1215 ... Journal Home > Advanced Search > Browse Title Index. Log in or ... Vol 12, No 1 (2018), Analysis of the effects of frequent strikes on academic performance of students in universities in Nigeria: Edo State as a focal point, Abstract PDF ... Vol 6, No 1 (2012), Appraisal as a Determinant for Adequate ...
Features of Neonatal Jaundice at Irrua Specialist Hospital, Irrua, in ...
African Journals Online (AJOL)
Thirty of the 75 (2-7 day-old) jaundiced neonates delivered at the Irrua Specialist Teaching Hospital, Irrua, in, Edo State were studied. Of the males, 55.6% were kernicteric, compared to 41.7% of the females. Two neonates who had sepsis had mean weight of 2.51 ± 0.86kg, indicating low birth-weight associated with ...
African Journals Online (AJOL)
Olusi, FI. Vol 6, No 1 (2009) - Articles Students Perception of Cyber Crime in Edo State: Implications for Teaching and Learning Abstract. ISSN: 1813-2227. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of ...
African Journals Online (AJOL)
Items 101 - 150 of 319 ... Vol 24, No 3 (2017), Effect of age and gender on lipid profile in healthy rural population of Edo State, Nigeria, Abstract. J.O. Idemudia, H.F. Idogun ... Vol 18, No 2 (2011), Effects of Oral Administrationof Nicotine on Blood Glucose, Electrolytes and Lipid Profile in Albino Rats, Abstract. IP Oyeyipo, Y Raj, ...
The Concept of Illness and Musical Intervention Among Members of ...
African Journals Online (AJOL)
The healing effect of music on man is very significant in most parts of the world. However, not much has been done by African researchers to study music and the ailments it heals especially among the peoples of Nigeria. This work examines the therapeutic effect of music in Iyayi society of Esan community, Edo state of ...
African Journals Online (AJOL)
FINEPRINT
Community, Edo State, to help develop programs and interventions to curtail this harmful cultural practice. A community based ... 95%CI=0.028-0.869; p=0.034) and attitude towards FGM (OR=0.115; 95%CI=0.056-0.235; p?0.001)were identified as ..... Nigeria and ICF International.Nigeria. Demographic and Health Survey ...
Male Infertility Secondary to Varicocele: A Study of the Management ...
African Journals Online (AJOL)
Varicocele is a common condition worldwide. The aim of this five-year prospective study is to examine the effect of varicocelectomy on the fertility profile of affected men in a male infertility clinic in Benin City, Edo State. A total of 45 men aged 16-65 years were diagnosed with varicocele during the period. Forty one (91.1%) ...
International Journal of Arts and Humanities(IJAH) Bahir Dar- Ethiopia
African Journals Online (AJOL)
DrNneka
of Delta, Rivers, and Edo states in the present south-south geopolitical zone. It is fraught with numerous ... Onitsha known as the generalized form or O̩ni̩cha Igbo. This variety is ... harmony groups in such a way that within any one simple word, only vowels of one group may ..... Elements of modern Igbo grammar. Ibadan: ...
Development Of Rainfall Erosivity Map For Nigeria | Ogedengbe ...
African Journals Online (AJOL)
The indices were used to develop a rainfall erosivity map or Nigeria. The map reveals that Nigeria may be broadly divided into five major erosion risk zones. The south-western part is generally in the low erosion zone, with the exception of the coastal portion of Lagos, Ondo, Edo and Delta states. The south-east and central ...
Segawa, Masashi
2008-06-01
Buddhism is an ancient religion that began in India and spread throughout Asia. It is prevalent in modern Japan. Breastfeeding has been a strong practice for centuries with the custom being to continue until the child is 6 or 7 years of age. The Edo period was very influential in establishing breastfeeding customs that continue today.
African Journals Online (AJOL)
The journal is published about four times a year (January, April, July ... As of 2013 all issues of AFRREV will be open access and therefore free to download. ... of students in universities in Nigeria: Edo State as a focal point · EMAIL FREE FULL TEXT ... Use of forensic accounting techniques in the detection of fraud in tertiary ...
TOPICAL REVIEW: New aspects of π-d interactions in magnetic molecular conductors
Sugimoto, Toyonari; Fujiwara, Hideki; Noguchi, Satoru; Murata, Keizo
2009-04-01
The 2 : 1 cation radical salts of bent donor molecules of ethylenedithio-tetrathiafulvalenoquinone-1,3-dithiolemethide (EDT-TTFVO), ethylenedithio-diselenadithiafulvalenoquinone-1,3-dithiolemethide (EDT-DSDTFVO), ethylenedithio-diselenadithiafulvalenothioquinone-1,3-diselenolemethide (EDT-DSDTFVSDS), ethylenedioxy-tetrathiafulvalenoquinone-1,3-dithiolemethide (EDO-TTFVO) and ethylenedioxy-tetrathiafulvalenoquinone-1,3-diselenolemethide (EDO-TTFVODS) with FeX4- (X = Cl, Br) ions are prepared by electrocrystallization. The crystal structures of these salts are composed of alternately stacked donor molecule and magnetic anion layers. The band structures of the donor molecule layers are calculated using the overlap integrals between neighboring donor molecules and are compared with the observed electronic transport properties. The magnetic ordering of the Fe(III) d spins of FeX4- ions is determined from magnetization and heat capacity measurements. The magnetic ordering temperatures are estimated by considering a combination of a direct d-d interaction between the d spins and an indirect π-d interaction between the conduction π electron and the d spins, whose magnitudes are separately calculated from the crystal structures with an extended Hückel molecular orbital method. The occurrence of a π-d interaction is proved by the negative magnetoresistance, and the magnitude of magnetoresistance reflects the strength of the π-d interaction. The effect of pressure on the magnetoresistance is studied, and the result indicates that the magnitude of magnetoresistance increases, namely, the π-d interaction is enhanced with increasing pressure. From these experimental results it is shown that (EDT-TTFVO)2•FeBr4 is a ferromagnetic semiconductor, (EDT-DSDTFVO)2•FeX4 (X = Cl, Br) and (EDT-DSDTFVSDS)2•FeBr4 are metals exhibiting antiferromagnetic ordering of the d spins, and (EDO-TTFVO)2•FeCl4 and (EDO-TTFVODS)2•FeBr4•(DCE)0.5 (DCE =-dichloroethane) are genuine
Directory of Open Access Journals (Sweden)
M. Hidaka
2009-06-01
Full Text Available Kakiemon-style porcelains produced at Arita areas (SAGA in Kyushu Island are famous Japanese porcelains. The porcelain-techniques creating its elegant and bright red-color underglaze and overglaze were found and developed in 1650's (early Edo period first by Kakiemon kiln. Red-color overglaze and transparent glaze of the Kakiemon-style porcelains have been investigated by means of X-ray diffraction using synchrotron radiation. The results suggest that the red-color brightness is mainly induced by micro-structural correlation between α-Fe2O3 fine particles, as red-color emission elements, and other oxides of SiO2, Al2O3, CaO, KNaO, PbO. The stability of the red-overglaze on the porcelain surface is related to interfacial fusion of the glasses existing in the fritted red-overglaze and the transparent glaze on the porcelain body. The ancient porcelain-techniques of the Kakiemon-style porcelains are clearly based on the micro-structural and material properties of the overglazes, the underglazes, and the transparent glazes, though the techniques were experimentally and accidentally found and developed in the Edo period.As porcelanas do estilo Kakiemon produzidas nas áreas de Arita (SAGA na ilha Kyushu são porcelanas japonesas famosas. As técnicas de produzir porcelanas com os elegantes e brilhantes vidrados de cores vermelho brilhante foram encontradas e desenvolvidas nos anos 1650 (início do período Edo primeiramente em fornos Kakiemon. Vidrados vermelhos e vidrados transparentes de porcelanas do estilo Kakiemon foram investigadas por meio de difração de raios X com radiação sincrotron. Os resultados sugerem que o brilho de cor vermelha é principalmente induzido pela correlação microestrutural entre finas partículas de α-Fe2O3, como elementos emissores de cor vermelha, além de outros óxidos como SiO2, Al2O3, CaO, KNaO, e PbO. A estabilidade dos vidrados na superfície da porcelana com vidrado vermelho está relacionada com a fus
Realistic limits on the nonlocality of an N-partite single-photon superposition
Energy Technology Data Exchange (ETDEWEB)
Laghaout, Amine [Department of Physics, Technical University of Denmark, Building 309, DK-2800 Lyngby (Denmark); Bjoerk, Gunnar [Department of Applied Physics, Royal Institute of Technology (KTH), AlbaNova University Center, SE-106 91 Stockholm (Sweden); NORDITA, Roslagstullsbacken 23, SE-106 91 Stockholm (Sweden); Andersen, Ulrik L. [Department of Physics, Technical University of Denmark, Building 309, DK-2800 Lyngby (Denmark); NORDITA, Roslagstullsbacken 23, SE-106 91 Stockholm (Sweden)
2011-12-15
A recent paper [L. Heaney, A. Cabello, M. F. Santos, and V. Vedral, New J. Phys. 13, 053054 (2011)] revealed that a single quantum symmetrically delocalized over N modes, namely a W state, effectively allows for all-versus-nothing proofs of nonlocality in the limit of large N. Ideally, this finding opens up the possibility of using the robustness of the W states while realizing the nonlocal behavior previously thought to be exclusive to the more complex class of Greenberger-Horne-Zeilinger states. We show that in practice, however, the slightest decoherence or inefficiency of the Bell measurements on W states will degrade any violation margin gained by scaling to higher N. The nonstatistical demonstration of nonlocality is thus proved to be impossible in any realistic experiment.
VizieR Online Data Catalog: BV light curves of WX Eridani (Arentoft+, 2004)
Arentoft, T.; Lampens, P.; van Cauteren, P.; Duerbeck, H. W.; Garcia-Melendo, E.; Sterken, C.
2004-04-01
Photometric V and B CCD time-series observations of WX Eri, obtained at the South African Astronomical Observatory (SAAO), Beersel Hills Observatory (BH), Las Campanas Observatory (LCO), European Southern Observatory (ESO), Sternwarte Hoher List (HOLI/HOLIr) and at Esteve Duran Observatory (EDO) during 2001 and early 2002. The measurements from the different observatories was merged and shifted to standard values. (1 data file).
FACTORS THAT PROMOTE THE DEFECTION OF THE VIRTUAL CLASSROOM
Directory of Open Access Journals (Sweden)
Jenniz La Madriz
2016-12-01
Full Text Available It education virtual is a resource that allows leverage them Tics for reduce barriers of space / time to learn and decrease the dropout school. The research had by objective determine them factors that promote the desertion of the classroom virtual of the subject of methods I, of support to them classes face-to-face, in the Faculty of Sciences economic and social, of the University of Carabobo. The methodological design was based on the quantitative paradigm and as technical survey, obtaining the percentage ranges for each item of the questionnaire. The results of the study indicate that to reduce the drop-out necessary to face and avoid the feeling of frustration that the student can conceive with the disadvantages in the use of the virtual environment, personal, technical, academic and economic components.
Funciones de la supervición escolar en Venezuela. Aproximación a un modelo
Directory of Open Access Journals (Sweden)
Amada Mogollón de González
2006-01-01
Full Text Available Esta investigación tiene como propósito presentar la aproximación a un Modelo para las funciones de la supervisión escolar en Venezuela sustentado en los ámbitos, acción supervisora y funciones denominadas: Técnicas, Administrativas, Sociales, de Asistencia y Mediación. El modelo se fundamentó teóricamente en Kaufman, Stufflebeam, Teoría de Sistemas de Bertalanffy, enfoque humanista y jerarquía de las necesidades de Maslow. Es una investigación de campo realizada en Venezuela en los estados: Nueva Esparta, Distrito Federal, Carabobo, Lara, Táchira, Barinas y Delta Amacuro. El instrumento arrojó resultados que evidenciaron deficiencias, omisiones y ausencias durante el hecho supervisorio y su validación condujo a garantizar el éxito y calidad en la supervisión educativa venezolana.
Psychological Techniques In Helping Rape Victims | Ayinde | Edo ...
African Journals Online (AJOL)
Counselling psychology is concerned with assisting people who have personal, social, educational and vocational problems to better understand themselves and solve their problems. Rape is seen as a problem that militates against the psychological well being of victims, because of the devastating aftermath of the incident ...
invertebrate fauna of Ovia River, Edo State, Nigeria
African Journals Online (AJOL)
ogbe
low species abundance in station II is an indication of the grazing effect of the herds of cattle, which resulted in the ... potential to influence the condition of our freshwater .... taxonomic groups using an American Optical ..... Journal of the North.
Duodenal Obstruction: Etiology, Morbidity and Mortality among Edo ...
African Journals Online (AJOL)
Duodenal obstruction in children is associated with poor outcome which has improved in developed but remained poor in developing countries. The objective of this study was to ascertain the etiology, morbidity, mortality and factors that contributed to poor outcome in a developing country. Retrospective analysis of pediatric ...
Management of examinations: ethical issues. | Nweze | Edo Journal ...
African Journals Online (AJOL)
Talking about the ethical issues, we are all aware of the manner/way in which examination malpractice has eaten deep into the fabrics of our society. Some measures really have to be taken to normalize the examination system in our society. The challenges of examination management are numerous for example, having ...
Forest regeneration, dereservation and management in Edo State ...
African Journals Online (AJOL)
STORAGESEVER
2008-12-29
Dec 29, 2008 ... concluded that the role of the forests which cut across many areas of human endeavour seem not to be appreciated ... as an agroforestry system could be an effective and cost saving ... manpower, logistics, and patrol duties to prevent forest offences. ... The reversal of political direction in this matter is.
Pornograghy in Postcolonial Nigeria: An Owan (Edo) Traditional ...
African Journals Online (AJOL)
Sexual morals vary across culture, religion and historical periods. This is evidenced in the various norms set by different societies, religions and ideological groups on what is perceived as permissible sexual behaviour. This paper reviews the phenomenon of pornography in postcolonial Nigeria. It seeks to evaluate the ...
Xingling, Shao; Honglun, Wang
2014-11-01
This paper proposes a novel hybrid control framework by combing observer-based sliding mode control (SMC) with trajectory linearization control (TLC) for hypersonic reentry vehicle (HRV) attitude tracking problem. First, fewer control consumption is achieved using nonlinear tracking differentiator (TD) in the attitude loop. Second, a novel SMC that employs extended disturbance observer (EDO) to counteract the effect of uncertainties using a new sliding surface which includes the estimation error is integrated to address the tracking error stabilization issues in the attitude and angular rate loop, respectively. In addition, new results associated with EDO are examined in terms of dynamic response and noise-tolerant performance, as well as estimation accuracy. The key feature of the proposed compound control approach is that chattering free tracking performance with high accuracy can be ensured for HRV in the presence of multiple uncertainties under control constraints. Based on finite time convergence stability theory, the stability of the resulting closed-loop system is well established. Also, comparisons and extensive simulation results are presented to demonstrate the effectiveness of the control strategy. Copyright © 2014 ISA. Published by Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Anita Sabzghabaei
2014-09-01
Full Text Available Introduction: Creating a calm and stress-free environment affects education significantly. The effects of the emergency department overcrowding (EDO on the training of emergency medicine residents (EMR is a highly debated subject. Therefore, this study aimed to evaluate the effect of EDO on efficiency of EMR’s education. Methods: In this cross-sectional study, the effects of overcrowding on EMR’s education in the resuscitation room and acute care unit. Data collection was done using a questionnaire, which was filled out by the second year EMRs. The crowding level was calculated based on the national emergency department overcrowding scale (NEDOCS. The relationship between the two studied variables was evaluated using independent sample t-test and SPSS 21 statistical software. Results: 130 questionnaires were filled out during 61 shifts. 47 (77.05% shifts were overcrowded. The attend’s ability to teach was not affected by overcrowding in the resuscitation room (p=0.008. The similar results were seen regarding the attend’s training ability in the acute care unit. Conclusion: It seems that the emergency department overcrowding has no effect on the quality of education to the EMRs.
Displasia ectodérmica en odontopediatría
Directory of Open Access Journals (Sweden)
Marcelle Danelon
2018-01-01
Full Text Available La displasia ectodérmica (DE se caracteriza por ser una enfermedad hereditaria que consiste en alteraciones genéticas y ambientales, provocando hipodoncia, distrofia en uñas, cabello escaso y anomalías dentarias. El tratamiento de rehabilitación en pacientes pediátricos con DE es difícil debido al continuo crecimiento y desarrollo cráneo facial de estos niños. El presente trabajo tiene como objetivo relatar un caso clínico de rehabilitación oral en paciente pediátrico diagnosticado con DE. Paciente de sexo femenino, con 5 años y 6 meses de edad que compareció a la clínica de odontopediatría en la UNIDERP. Al examen físico, extra oral, se constató que la paciente era respiradora bucal, y presentaba disminución del tercio inferior de la cara, labios protruidos y evertidos, frente prominente, nariz en “silla de montar”, escasez de cabello, pestañas y cejas, piel fina y seca. En el examen intraoral se observó ausencia de los siguientes dientes: 51/52, 61/62/63, 71/72, 81/82, y aspecto conoide de los dientes 53, 73 y 83. Al examen radiográfico se constató agenesia de 9 dientes primarios y de los gérmenes de los siguientes dientes permanentes: 11/12/13, 21/22/23, 41/42, 31/32, se observó la presencia de los gérmenes de los dientes 33 y 43. Con base en las características físicas y radiográficas se diagnosticó displasia ectodérmica hidrótica. Como conducta clínica, se optó por la instalación de mantenedores estéticos funcionales removibles, con el fin de favorecer la fonación, deglución, tonicidad muscular labial y lingual y el desenvolvimiento social.
The Role of the Armed Forces in the Mexican Economy in the 1980’s.
1981-06-01
integrating role, especially in 17 " . - _ .. .. .~- ... . .. . . . . . .. . ....._ • ,,.- .. . 1 .. .. •, , ," remote geographic regions, and have...integration of the Armed Forces insures their integration with the population in every town. This is especially important in the small villages. The...Jefe Edo Mayor de la Armada Revillagigedo No. 11 Primer Piso Mexico 1, D.F. 99 141. Vicealmirante Doroteo Silva Lopez Director de Educacion Naval Dr
Zaintzen garrantzia Haur Hezkuntzako lehenengo zikloan
Silva Díaz, Ane
2016-01-01
[EUS] Gizarteak jasandako aldaketak direla eta, eskolatze goiztiarrak nabarmen egin du gora azken urteotan. Haurrak bere biziko lehen hilabeteetan gurasoengandik aldendu eta haur eskolara joan beharra dauka. Hala ere, lehen haurtzaroko edo 0-3 urte bitarteko haurren premiak ez dira Haur Hezkuntzako bigarren zikloko haurren beharrizanen berdinak eta, ondorioz, gure hezkuntza sistema egoera berri horretara egokitzen jarraitu beharra daukagu. Lan honetan haurra behatu eta tratatzeko eredu ezberd...
Ruben D. Elias-Roman; Ned B. Klopfenstein; Mee-Sook Kim; Dionicio Alvarado-Rosales; John W. Hanna; Amy L. Ross-Davis; Remigio Anastacio Guzman-Plazola; Guillermo Calderon-Zavala; Antonio Mora-Aguilera
2013-01-01
A collaborative project between the Programa de FitopatologÃa, Colegio de Postgraduados, Texcoco, Edo. de México and the USDA Forest Service-RMRS, Moscow Forest Pathology Laboratory began in 2011 to identify which species of Armillaria are causing widespread and severe damage to the peach orchards from México State, México. We are employing a DNA-based approach in...
González Santana, Alazne
2015-01-01
Dani Fanori egindako elkarrizketa, Ikastolen Elkarteak argitaratzen duen Xabiroi aldizkariaren parte-hartzaileetako bat Txikitan Tintin, Asterix eta Obelix, Mortadelo y Filemón, Ipurbeltz edo Mafalda irakurtzen igarotzen zituen Dani Fanok (Donostia, 1968). Gaur egun donostiarrak Goscinny, Miguelanxo Prado, Quino, Enki Bilal, Arthur Rackham… bezalako autoreak miresten ditu. Zientzia fikzioa oso baieztatzen duen arren, denetariko komikiak irakurtzen dituela aipatzen du komiki eta irudigile g...
2011-12-14
Teammates per Prime: 29 • Primes: TCG, CTC, DTI , EDO, INS/LM, L-3, Logis-Tech, Thomas Assoc. , URS...terrains S-MET Program Matures payload carrying and dismount following capabilities DARPA LS3 System A legged robot with improved mobility over irregular...to ride upon more difficult terrains at higher speeds. Legged robots have continued to improve through research. The DARPA Legged Squad Support
Directory of Open Access Journals (Sweden)
Alvaro J. Idrovo
2002-03-01
Full Text Available El mercurio puede servir de trazador del grado de contaminación ambiental. En este trabajo se midió el mercurio mediante técnicas convencionales en el cabello de dos momias de los siglos XII y XIV, una adulta y otra infantil, y en el pelo de un venado (Odocoileus virginianus. Se encontraron muy bajos niveles de mercurio total e inorgánico, probablemente debido a la mínima exposición alimentaria y a la ausencia de contaminación atmosférica. Es posible utilizar estas técnicas para explorar la relación hombre-ambiente, especialmente después de la aparición de la metalurgia, y para estimar la contaminación ambiental en diferentes períodos.
New aspects of π–d interactions in magnetic molecular conductors
Sugimoto, Toyonari; Fujiwara, Hideki; Noguchi, Satoru; Murata, Keizo
2009-01-01
The 2 : 1 cation radical salts of bent donor molecules of ethylenedithio-tetrathiafulvalenoquinone-1,3-dithiolemethide (EDT-TTFVO), ethylenedithio-diselenadithiafulvalenoquinone-1,3-dithiolemethide (EDT-DSDTFVO), ethylenedithio-diselenadithiafulvalenothioquinone-1,3-diselenolemethide (EDT-DSDTFVSDS), ethylenedioxy-tetrathiafulvalenoquinone-1,3-dithiolemethide (EDO-TTFVO) and ethylenedioxy-tetrathiafulvalenoquinone-1,3-diselenolemethide (EDO-TTFVODS) with FeX4− (X = Cl, Br) ions are prepared by electrocrystallization. The crystal structures of these salts are composed of alternately stacked donor molecule and magnetic anion layers. The band structures of the donor molecule layers are calculated using the overlap integrals between neighboring donor molecules and are compared with the observed electronic transport properties. The magnetic ordering of the Fe(III) d spins of FeX4− ions is determined from magnetization and heat capacity measurements. The magnetic ordering temperatures are estimated by considering a combination of a direct d–d interaction between the d spins and an indirect π–d interaction between the conduction π electron and the d spins, whose magnitudes are separately calculated from the crystal structures with an extended Hückel molecular orbital method. The occurrence of a π–d interaction is proved by the negative magnetoresistance, and the magnitude of magnetoresistance reflects the strength of the π–d interaction. The effect of pressure on the magnetoresistance is studied, and the result indicates that the magnitude of magnetoresistance increases, namely, the π–d interaction is enhanced with increasing pressure. From these experimental results it is shown that (EDT-TTFVO)2•FeBr4 is a ferromagnetic semiconductor, (EDT-DSDTFVO)2•FeX4 (X = Cl, Br) and (EDT-DSDTFVSDS)2•FeBr4 are metals exhibiting antiferromagnetic ordering of the d spins, and (EDO-TTFVO)2•FeCl4 and (EDO-TTFVODS)2•FeBr4•(DCE)0.5 (DCE =-dichloroethane) are
Características fisicoquímicas del aceite del endospermo de la Palma Yagua (Attalea cryptanther
Directory of Open Access Journals (Sweden)
Linares, Oscar
2006-09-01
Full Text Available In this research, the physicochemical characteristics of the yagua palm (Attalea cryptanther endospermus oil were evaluated. Seeds of mature fruits from Santa Ana hill, Canoabo, Bejuma municipality, Carabobo state-Venezuela, harvested in November 2003, were decorticated and the endospermus was transformed to meal by means of grinding. The oil from meal was extracted with n-hexane using Soxhlet equipment. Yagua endospermus crude oil showed the following characteristics: iodine index 13.77 cg I2/g; refraction index 1.4441 at 60 ºC; saponification value 233 mg KOH/g; peroxide value 0.20 meq O2/kg; unsaponifiable matter 0.97 %; AOM stability 31 h; solid fat content 54 % at 10 ºC and 10 % at 20 ºC; Lovibond color: R 3.2 and Y 1.3. The major fatty acids were lauric acid (58 % and miristic acid (16.5 %.Yagua endospermus is an alternative oleaginousEl objetivo de esta investigación fue caracterizar físicoquímicamente el aceite de la palma Yagua (Attalea cryptanther. El endospermo de frutos maduros procedentes del cerro Santa Ana, Canoabo, municipio Bejuma, estado Carabobo Venezuela, pertenecientes a la cosecha Noviembre 2003, fueron transformados en harina mediante molienda. Una vez obtenida la harina se procedió a la extracción del aceite mediante un equipo Soxhlet utilizando como solvente n-Hexano. El aceite crudo extraído fue caracterizado mediante normas COVENIN y AOCS. Se determinaron valores de índice de yodo de 13,77 cg I2/g, índice de refracción 1,4441 a 60 °C, índice de saponificación 233mg KOH/g, índice de peroxido 0,20 meq O2/Kg, materia insaponificable 0,97%, estabilidad AOM (31 horas, contenido de grasa sólida (54% a 10 °C y 10% a 20 °C, color (R: 3,2- A: 1,3-A: 0. Los ácidos grasos mayoritarios encontrados fueron el ácido laurico (58% y el ácido miristico (16,5%. El endospermo evaluado es una alternativa como materia prima para la obtención de aceite ya que presenta características similares al aceite de coco y
Nave de montaje Volkswagen, Venezuela
Directory of Open Access Journals (Sweden)
Bornhorst, D.
1966-02-01
Full Text Available To assemble Volkswagen cars for the Venezuela market, a large hall has been built, which is fitted with full facilities for its purpose, such as painting and greasing installations, and large parking area for the finished vehicles. The siting of this hall was carefully studied, and such factors as nearness to industrial zones, climate, and ease of access were decisive aspects that were taken into account. The final choice was a site near Morón, in the Carabobo Department, close to the sea. The main constructional item is the roof of the large hall. It is made of a series of hyperbolic-parabolic reinforced concrete thin shells, of rectangular planform, and slightly inclined towards the north, to produce a saw edge profile. Each of these shells is supported by a central column. The hollow spaces along the saw edge profile have been used for ventilation. The enclosing walls consist of trellice material, which also provide ample facility for additional ventilation.Para el montaje de los coches Volkswagen destinados al mercado venezolano, se ha construido una gran nave dotada de todos los servicios necesarios: pintura, engrases, aparcamiento de los vehículos terminados, etc. La elección del lugar más apropiado para la situación de la nave y edificios anexos fue motivo de un detenido estudio, en el que la proximidad a zonas industriales, clima, fácil entrada de materiales procedentes de ultramar y salida para los acabados, fueron los factores decisivos. Definitivamente se eligió un solar en las cercanías de Morón, del departamento de Carabobo, y próximo al mar. Lo más notable es la cubierta de la gran nave, formada por una serie de láminas parabólico-hiperbólicas de hormigón armado, de planta rectangular, inclinadas ligeramente hacia el norte para formar un perfil en diente de sierra. Cada una de estas láminas se soporta por un montante central. Los huecos que dichos dientes de sierra dejan se han aprovechado para la ventilación. Los
Directory of Open Access Journals (Sweden)
Castells Llavanera Marina
2009-08-01
Full Text Available Resumen:La investigación indaga l as acciones de docentes experimentados a partir del estudio de sus explicaciones en clases de física. El contexto es la Facultad de Ingeniería de la Universidad de Carabobo, Venezuela. La aproximación metodológica es cualitativa. Es un estudio descriptivo-interpretativo de casos.Considerando el carácter social, retórico y argumentativo de las clases de ciencias, seleccionamos el referente teórico aportado por Perelman y Olbrechts-Tyteca (1989. El carácter social, didáctico, semiótico y comunicativo de las clases de ciencias se analiza tomando como referente teórico el aportado por Ogborn, Kress, Martins & McGillicuddy (1996. Incorporamos aportes de la investigación sobre la multimodalidad en la enseñanza de las ciencias (Lemke, 2002, 1999, 1998, 1997; Jewitt, Kress, Ogborn, Tsatsarelis, 2000; Kress, Ogborn, Jewitt y Tsatsarelis, 2001; Kress, Ogborn y Martins, 1998 para analizar los aspectos multimodales de las explicaciones.Los análisis y resultados destacan la contribución del uso de demostraciones y objetos materiales en relación a la construcción de significados y al convencimiento de los alumnos.Abstract:The research investigates the performance of experienced teachers from the study of their explanations in physics classes. The context is the Faculty of Engineering at the University of Carabobo, Venezuela. The methodological approach is qualitative. It is a descriptive and interpretative study of cases. Considering the social, rhetorical and argumentative in science classes, we select the theoretical frame given by Perelman and Olbrechts-Tyteca (1989. The social, educational, communicative and semiotic science classes is analyzed by reference to the theory provided by Ogborn, Kress, Martins & McGillicuddy (1996. Incorporating input from research on multimodality in science education (Lemke, 2002, 1999, 1998, 1997, Jewitt, Kress, Ogborn, Tsatsarelis 2000, Kress, Ogborn, Tsatsarelis and
The Applicability of Patented Technologies to Sonobuoys
1988-06-30
Ave, Boulder, CO 80301 2. Compagnie Generale de Geophysique 6 Rue Galvani Paris, France 3. EIC Laboratories, Incorporated Newton, MA 02146 4. Edo...Co. 2 Compagnie de Geophysique , France 3 Cooper, Charles E. 2 M Crown Controls Corporation 1 ,6 Cyr, Reginald J. 1 DeltaLab Research, Incorporated 1...Int’l App ....... 7,5 [73) Assignees: Institut Francais du Petrole. OTHER PUBLICATIONS -" Rueil-Malmaison; Compagnie Generale de Geophysique , Massy
Directory of Open Access Journals (Sweden)
Alina Sotolongo Aguiar
2014-04-01
Full Text Available El propósito de este trabajo es construir códigos adaptativos del método de Linealización Local para Ecuaciones Diferenciales Ordinarias (EDO y analizar su comportamiento numérico. Además, se estudia el efecto que sobre las propiedades de los códigos produce la variación en la precisión de las aproximaciones de Padé utilizadas.
Sugiyama, Shigeru
2006-01-01
The commercialization of drugs started toward the end of Heian period (794-1192) when not only aristocrats and monks who were traditional patrons to drug makers, but also local clans and landlords who became powerful as a result of the disbanding of aristocratic manors accumulated enough wealth to spend money on medicine. Although traveling around the country was still a dangerous endeavor, merchants assembled groups to bring lucrative foreign drugs (mainly Chinese) to remote areas. The spread of commercial drugs to common people, however, did not happen until the early Edo period (1603-1867), when the so-called barrier system was installed nationwide to make domestic travel safe. Commercialization started in large cities and gradually spread to other areas. Many nostrums popular until recently appeared in the Genroku period (1688-1703) or later. Many such nostrums were all-cures, often consisting of such active ingredients as Saussureae radix, Agalloch, or Gambir. Even in the Edo period, many people living in agricultural or fishing villages, as well as those in the lower tier, were still poor. Much of the medication available to those people was therefore made of various plant or animal-derived substances that were traditionally used as folk medicines.
Hepatitis A behaviour in Yaguajay Municipality.
Directory of Open Access Journals (Sweden)
Teresa Iluminada Hernández Pérez
2009-12-01
Full Text Available A retrospective-descriptive study was made to characterize the behavior of “Hepatitis A” in Yaguajay Municipality in the period between 2006 and 2007, in which were included all the patients that were notified by Declaration Card (EDO. For collecting data, EDO cards were analized; as well as the endemic accumulative and the annual chronological series. The prevalence of this disease was determined in health areas and small population, so as to establish a geographic stratification. The disease was characterized by social-demographic variables (sex, age, home and also the seasonally of Hepatitis A. As a result all the disease prognosis in both years were over the expectation and are regarded as “Normal”, this disease behavior was higher in Meneses and Mayajigua areas representing the majority of the community population The most affected ages were under 10, from 11 to 20 and from 21 to 29. Females and the urban area registered the highest amount of cases. The seasonally was different in both years. As a conclusion we can say that the Epidemic was characterized by a wide geographical distribution where Jarahueca and Perea were the most affected communities; causing injuries in male sex, affected ages were babies, teenagers and young adults, the seasonally behaved differently in both years.
Lombardi, Olimpia; Fortin, Sebastian; Holik, Federico; López, Cristian
2017-04-01
Preface; Introduction; Part I. About the Concept of Information: 1. About the concept of information Sebastian Fortin and Olimpia Lombardi; 2. Representation, information, and theories of information Armond Duwell; 3. Information, communication, and manipulability Olimpia Lombardi and Cristian López; Part II. Information and quantum mechanics: 4. Quantum versus classical information Jeffrey Bub; 5. Quantum information and locality Dennis Dieks; 6. Pragmatic information in quantum mechanics Juan Roederer; 7. Interpretations of quantum theory: a map of madness Adán Cabello; Part III. Probability, Correlations, and Information: 8. On the tension between ontology and epistemology in quantum probabilities Amit Hagar; 9. Inferential versus dynamical conceptions of physics David Wallace; 10. Classical models for quantum information Federico Holik and Gustavo Martin Bosyk; 11. On the relative character of quantum correlations Guido Bellomo and Ángel Ricardo Plastino; Index.
Microbiology of Composting Pig Waste: Comparison of Vermicomposting and Open Heap Techniques
Ogefere, H. O.; Ogbimi, A. O.; Omoregie, R.
2010-01-01
Against the background of an effective waste management, microbiological studies of composting pig waste were investigated. Freshly deposited excreta from confined pigs in a private pig farm in Benin City, Edo State, Nigeria were composted by two aerobic methods – vermicomposting and open heap. Microbial (bacterial and fungal) counts and characterization were carried out periodically within the 40 weeks of composting, using standard techniques. The results showed that only duration of compos...
Oguega Divination Poetry In Edo State, Nigeria Abstract Introduction
African Journals Online (AJOL)
Frederick Iraki
Although Oguega terms are esoteric, one notices that the poetry which goes with the codified .... It is a normal thing to go through the door to access a room and an abnormal thing to use the window ... This is of course why such persons may be seen as poor historians. .... Encarta Encarta Microsoft Corporation1993-2008.
Geophysical Study of Lithologies Attributes At Isihor Village, Edo ...
African Journals Online (AJOL)
These attributes include depth, thickness of lithologies or rock types beneath the sea level or earth's surface. Geophysical prospect of lithologies in this studied area is vital for many economic and environmental reasons for examples a large portion of the world's fossil fuels such as oil, gas and coal are found in stratified ...
hydrological assessments of some rivers in edo state, nigeria
African Journals Online (AJOL)
user
friction of flowing water with the rocks and the sediment in the river beds. Harnessing the kinetic energy from ... reported that the amount of achievable hydropower at any given site is a function of turbine head and the .... the discharge coefficient of each land use pattern, using GIS [52,2, 53,54,55], Discharge estimates based.
Gender Issues in Human trafficking in Edo State, Nigeria
African Journals Online (AJOL)
Importantly, previous studies have utilized macro theoretical perspective in explaining the .... represent the territorial label in recent times as in Benin Division, Benin City, Benin. Kingdom. ..... and this was a psychological boost for the Benin.
Dynamics of the zooplankton assemblage of Ojirami Reservoir, Edo ...
African Journals Online (AJOL)
Zooplankton form an important trophic link between phytoplankton and fish in ... with water temperature and water level; and positive with alkalinity, free CO2 and phosphate. The study revealed low pollution indicator species in the reservoir ...
Examination anxiety among secondary school students in Edo State ...
African Journals Online (AJOL)
... encourage stakeholders in the learning process to promote good study habits, provide learning materials and facilities that will build self confidence in the students, thereby reducing anxiety over examination. Keywords: Examination Anxiety, Adolescents, Secondary School Students, Examination Phobia, Test Anxiety ...
Job satisfaction of extension workers in Edo State Agricultural ...
African Journals Online (AJOL)
Agricultural extension can be said to be germane for any meaningful development in the agricultural sector. Extension personnel that are saddled with this responsibility need to be satisfied with their job in order to perform their duties effectively. Therefore this study examined the factors affecting job performance and level of ...
Středočeská integrovná doprava
Faltýnek, Jan
2012-01-01
The objective of this Bachelor's Thesis is to describe integrated transport systém in the Central Bohemia Region, Kladno district. Special attention will be given to the Central Bohemian integrated transport systém. The thesis is divided into theoretical and practical part. In the theoretical part are explained basic terms and principles of integrated transport systems and public transport. The practical part focuses on area of Kladno district the and local dominant transport company CSAD MHD...
Parasitic infections in African pangolin ( Manis temminckii ) from Edo ...
African Journals Online (AJOL)
Amblyomma sp.). Oochoristica sp. (100%) and Amblyomma sp. (75%) were the most prevalent parasites. Both male and female pangolins recorded equal prevalence (100%) of infection, however, mean intensity of parasites was higher in males ...
Edo Journal of Counselling - Vol 3, No 1 (2010)
African Journals Online (AJOL)
Remedy to the inadequate representation of guidance and counselling in the national policy on education · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. E Egbochuku, I Alika, 16-27. http://dx.doi.org/10.4314/ejc.v3i1.52677 ...
Tuberculous pyomyositis in a patient with diabetes Mellitus | Edo ...
African Journals Online (AJOL)
Pyomyositis is a pyogenic infection of the skeletal muscle which can cause significant morbidity and mortality if not properly treated. Diabetes mellitus (DM) is a well recognized risk factor for development of pyomyositis. The usual causative pathogen of pyomyositis in diabetes mellitus is Staphylococcus aureus. Tuberculous ...
Régimen climático y patrón espacial de las lluvias en la cuenca del Lago de Valencia, Venezuela
Directory of Open Access Journals (Sweden)
Edilberto Guevara Pérez
2008-07-01
Full Text Available El objetivo de la investigación es diagnosticar el régimen climático de la cuenca del lago de Valencia y determinar la densidad de la red pluviométrica mediante el análisis de distribución espacial de las lluvias, utilizando la información disponible en la región central (Aragua, Carabobo y Cojedes. La precipitación mensual muestra una distribución unimodal, con el máximo en agosto y el mínimo en marzo. En marzo la humedad relativa disminuye y la velocidad del viento aumenta, ocasionando mayor evaporación. La red pluviométrica debe estar constituida por no más de 18 estaciones pluviométricas, espaciadas a unos 14 km; sin embargo, para mejorar la confiabilidad de los datos, se recomienda prestar atención a la ubicación, instalación y operaciones de las estaciones.
Camacho, C; Alfonzo, B; Ortiz de Bertorelli, L; De Venanzi, F
2001-06-01
Krispy King, Víctor and 324, super sweet hybrids (sh2) were cultivated in San Joaquín, estado Carabobo, Venezuela. The scheme was stablished to produce refrigerated fresh ears to be commercialized. The chemistry, microbiology and sensorial characteristics were evaluated at 0; 7; 14; 21 and 28 days of storage. One hundred ears of each hybrid were picked at the ripe fresh stage and packed in polystyrene trays covered with polyethylene. The storage temperature was 4 degrees C +/- 1 degree C. The scheme used was well adapted, allowing a good stability of the ears until 28 days of storing. The plastic cover avoid the lost of humidity. The soluble solids, total sugars and pH went down during the storage. The acidity and the microorganisms increased as expected. The sensorial variables kept the same for Krispy king and Víctor, while the hybrid 324 shown the lowest humidity content, the highest count of microorganisms and the poorest sensorial quality.
2010-01-22
Review Assistant, at (508) 389-6361. Sincerely, ~J.J Thomas W. French , Ph.D. Assistant Director Division ofFisheries and Wildlife www. masswildl{(e...doors or COA Cinema Friday. Dec.18. 1 been given the opportunity to windows. The COA would like p.m. Come and relax with a purchase tickets for the...Chang. clarinet. grade ll edo Chang. trombone. e10 1el Davidow. French hom. ell stey. French hom. grade es Gorry. flute. grade 12 Andrew Goulet
Šuranská, Ivana
2014-01-01
This bachelor theses focuses on the research of the teacher's attitudes towards several issues such as introducing professional standards, new carreer structure of teacher's and it's supporting systems. It has been created on the bases of theoretical resources and the research among teachers of kindergartens, elementary schools and high schools in Moravskoslezský and Středočeský region. The theoretical part provides a summary of the current state of teacher evaluation, proffesional standards,...
早川, 泰弘; 城野, 誠治
2012-01-01
The Western Kings on Horseback Screens,designated as important cultural properties, are masterpieces of the early period western style paintings that were created in the Momoyama to early Edo periods. Today this pair of screens is split between the collections of Suntory Museum of Art and the Kobe City Museum. Previously,they were handed down over the centuries at the Aizu Wakamatsu Castle, and their depiction clearly reveals western style painting techniques. However, the actual history of h...
松浦, 章
2010-01-01
During the Edo period (1603–1868), Japan steadfastly maintained its national seclusion policy. Japan’s constant cultural interaction with foreign countries, therefore, took place mainly in the following ways: direct contacts with China and the Netherlands, centering on trade in Nagasaki; contacts with Korea through the So clan on Tsushima Island; and indirect contacts with China via the Kingdom of Ryukyu under the control of the Satsuma clan. Quantitatively, the largest number of direct conta...
Nazrala, Jorge José Bautista
2008-01-01
Para determinar la influencia del manejo del suelo sobre la composición de la uva y el vino se estableció un experimento en un viñedo de Cabernet Sauvignon conducido en doble cordón de pitones en espaldero alto. Se aplicaron tres tratamientos: TR-suelo sin maleza; CVP-cobertura de suelo espontánea y control del desarrollo vegetativo por desbrozado y CA-cobertura de flora espontánea y control del desarrol...
Llorens Planella, Maria Teresa (Teresa Canepa)
2015-01-01
This dissertation focused on the prolific early European trade and consumption of three Asian manufactured goods: Chinese silk and porcelain, and Japanese lacquer in the sixteenth and early seventeenth centuries, and has shown how the material cultures of late Ming China and Momoyama/early Edo Japan became inextricably linked with the West. Multiple sources provided new and unexpected documentary and material evidence of this trade by the Iberian Kingdoms of Portugal and Spain, and the tradin...
di Yorio, C.; García-Carcedo, F.; Hernández, A.; Ayala, N.; Cornejo, N.
1998-01-01
Graphite is an useful material in the modern industry. In Venezuela, the ore contains 8 to 14 % of graphite from Cerro Osumita, Edo Cojedes, with enough reserves for exploitation. Samples from this deposit were characterized and tests of electrostatic and flotation were carried out. The electrical potential and velocity of drum were varied for two different size fractions. Kerosene, sodium silicate as depressant and pulp agitation were varied. The results indicate the important of size for th...
National Geographic en España (1997-2007
Directory of Open Access Journals (Sweden)
Vicente Domínguez, Aída María de
2011-06-01
Full Text Available En español: La investigación tiene como objeto de estudio aportar la historia de la edición en español de la revista National Geographic en su primera década de existencia (1997-2007, y analizar su evolución en este periodo cronológico. La metodología ha consistido en una revisión bibliográfica en repertorios, catálogos, metabuscadores, y diversas bases de datos (Teseo, TDR, Dialnet, Compludoc, Rebiun, CSIC, junto a una entrevista personal y exclusiva al director de la revista en España, Josep Cabello. Tras recopilar los datos históricos, para analizar su evolución (contenidos, publicidad, difusión y suscriptores, se han tomado como base de estudio los datos aportados por la Oficina de Justificación de la Difusión y otros elaborados por la analista. Los resultados aportan la historia de la revista, y desvelan que la edición española de National Geographic se convierte en su primera década de existencia en una de las revistas de referencia en el campo de la divulgación científica en España.In english: The investigation aims study provide the history of the Spanish edition of National Geographic magazine in its first decade of existence (1997-2007, and to analyze its evolution in this chronological period. The methodology has consisted in a bibliographic review on directories, catalogs, metasearch, and various databases (Teseo, TDR, Dialnet, Compludoc, Rebiun, CSIC along with a personal interview and exclusive to the director of the magazine in Spain, Joseph Cabello. After collecting historical data, to analyze its evolution (content, adversiting, diffusion and subscribers has been taken as a basis for study data provides by the Office of Justification for Dissemination and others prepared by the analyst. The results provide the history of the magazine, and reveal that the Spanish edition of National Geographic becomes its first decade of existence in one of the reference magazine in the field of popular science in Spain.
Anticonceptivos orales combinados: Guías Latinoamericanas
Directory of Open Access Journals (Sweden)
David Vásquez-Awad
2014-09-01
Full Text Available En los últimos años se han visto importantes avances en el desarrollo de nuevos anticonceptivos orales combinados (AOC incluyendo las transiciones de altas a bajas dosis de estrógenos y la introducción de nuevas progestinas; últimamente han salido al mercado AOC con estrógeno natural, estradiol, y en cuanto a las progestinas, su uso se enfoca al logro de efectos benéfi cos no contraceptivos específi camente en piel, cabello, peso corporal y síntomas relacionados al período menstrual. Por otra parte, también se han visto avances en cuanto a la introducción de píldoras de solo progestinas, inyectables de solo progestinas y combinados, implantes subdérmicos de progestinas y de largo lazo, parches transdérmicos combinados, anillos vaginales y dispositivos intrauterinos liberadores de levonorgestrel.
Directory of Open Access Journals (Sweden)
Vlastimil Kudláček
2010-12-01
have found that students from Czech high schools have a different structure of self perception then the original PSPP population from England (Fox, 1990. Our findings correspond with findings among Flemish adults (Van de Vliet et al., 2002; Ferreira & Fox, 2007 where components of sport and condition were also loaded into one factor. There are clear, subtle differences in the structure of physical self perception as related to cultural and language differences. Findings of internal reliability and content validity suggest that the three subscales questionnaire can be used in the Czech population as a valid and reliable instrument. CONCLUSIONS: In conclusion, we can recommend using the PSPP-CZ with three scales for use among young adults for the exploration of the role of physical self-perception as a determinant of physical activity/inactivity and a healthy lifestyle.[VÝCHODISKA: Tělesné sebepojetí bylo široce zkoumáno jako určující činitel pro cvičení stejně jako jeden z prvků majících vliv na duševní zdraví a blaho (Fox, 1997. Sebepojetí je všeobecně přijímáno jako významný prostředník mezi cvičením a sebeúctou (Fox, 2000; Sonstroem, 1997. Porozumění procesům seberozvoje nabylo na důležitosti, jelikož sebeúcta a sebepojetí jsou stále významnějšími komponenty vzdělávacích, klinických a komunitních programů péče o zdraví (Ferreira & Fox, 2008. Abychom mohli prozkoumat vztahy mezi různými úrovněmi tělesných aktivit a sebepojetí, musíme k měření tělesného sebepojetí mezi českými adolescenty využít standardizované nástroje. CÍLE: Účelem této studie bylo analyzovat strukturu přeloženého dotazníku PSPP-CZ mezi populací středoškolských studentů, a to hledáním komponentů PSPP-CZ za pomoci analýzy hlavních komponentů. Dotazník tělesného sebepojetí (Physical Self Perception Profi le, PSPP na české populaci nikdy nebyl použit. METODIKA: Studie se zúčastnili středo
HISTOLOGICAL STUDIES OF THE EFFECTS OF RED PEPPER ON THE STOMACH OF ADULT WISTAR RATS
Directory of Open Access Journals (Sweden)
Josiah O. Adjene
2007-01-01
Full Text Available Histological effects of red pepper commonly used as spice in food on the stomach of adult wistar rats were carefully investigated. The rats of both sexes (n=24, average weight of 200g were randomly assigned into two treatments (n=16 and control (n=6 groups. The rats in the treatments groups received 1g and 2g of red pepper thoroughly mixed with 20g of their feeds for 7 and 14 days, while the control rats received equal amounts of feeds without the red pepper added. The rats were fed with grower's mash purchased from Edo feeds and flour mill Ltd, Ewu, Edo State and were given water liberally. The rats were sacrificed on day eight and fifteen of the experiment respectively.The stomach was carefully dissected out and quickly fixed in 10% formol saline for routine histological procedure after H & E method.The histological findings after H&E methods indicated that the treated sections of the stomach showed some level of cellular hypertrophy, congestion of blood vessels degenerative changes disruption and distortion of the cytoarchitecture of the stomach.These findings indicate that red pepper may have some deleterious effects on the microanatomy of the stomach of adult wistar rat at higher doses. It is recommended that further studies aimed at corroborating these findings be carried out.
A Critical Review of the Oil and Tar Sands of the Dahomey Basin
International Nuclear Information System (INIS)
Osundina, A.; Mustapha, A.; Nzewi, T.
2002-01-01
The Benin Basin previously referred to as the Dahomey embayment has been designated as a frontier basin within Nigeria due to its potentially high prospects, but comparatively low exploitation campaign to date. The basin offers a promising opportunity for heavy oil exploration in a narrow belt extending westward from Edo State to the republic of Benin; while offshore, there are high prospects for finding more conventional hydrocarbon.The eastern Dahomey embayment is known to have an extensive reserve of hydrocarbons (bitumen and tar sands). The sediments occur in a 5 8 km belt stretching 120km from the fringes of Lagos State through Ogun, Ondo and Edo States. The estimated reserve potentials exceed 30 billion barrels of oil equivalent.Recently acquired seismic data in OPL 309 and 310, and subsequent drilling of 2 wells on the narrow continental shelf, have shown the presence of closed structures over Basement Highs and other related structural styles in the basin and confirm that conventional light oils and condensates hydrocarbons occur in commercial quantity. These hydrocarbons are reservoired in stratigraphic sequences of Albian Cenomanian age.This paper hopes to expose the hidden riches of this Basin and hopefully get the attention of the big players in refocusing their interests in the basin that attracted attention of the early petroleum explorers to Nigeria approximately 100 years ago
Morishita, Tetsuya
2009-05-21
We report a first-principles study of the structural, electronic, and dynamical properties of high-density amorphous (HDA) silicon, which was found to be formed by pressurizing low-density amorphous (LDA) silicon (a normal amorphous Si) [T. Morishita, Phys. Rev. Lett. 93, 055503 (2004); P. F. McMillan, M. Wilson, D. Daisenberger, and D. Machon, Nature Mater. 4, 680 (2005)]. Striking structural differences between HDA and LDA are revealed. The LDA structure holds a tetrahedral network, while the HDA structure contains a highly distorted tetrahedral network. The fifth neighboring atom in HDA tends to be located at an interstitial position of a distorted tetrahedron composed of the first four neighboring atoms. Consequently, the coordination number of HDA is calculated to be approximately 5 unlike that of LDA. The electronic density of state (EDOS) shows that HDA is metallic, which is consistent with a recent experimental measurement of the electronic resistance of HDA Si. We find from local EDOS that highly distorted tetrahedral configurations enhance the metallic nature of HDA. The vibrational density of state (VDOS) also reflects the structural differences between HDA and LDA. Some of the characteristic vibrational modes of LDA are dematerialized in HDA, indicating the degradation of covalent bonds. The overall profile of the VDOS for HDA is found to be an intermediate between that for LDA and liquid Si under pressure (high-density liquid Si).
Directory of Open Access Journals (Sweden)
Ericka Henao Jaramillo
2006-11-01
Full Text Available Joachim hezberG es un ingeniero agrónomo de origen Alemán, un hombre carismático, que llegó a Colombia hace más de 20 años para liderar un proyecto del gobierno Alemán, e incorporar variedades de uva a la región de Boyacá. Se enamoró de Villa de Leyva y desde 1985 jalona un proyecto vinícola conocido como Viñedo Guananí, que en lengua indígena significa tierra prometida. Y así es, su viñedo podría considerarse como la tierra prometida para el vino en Colombia. En éste, además del cultivo de la vid y la producción del vino, hay un pequeño hostal y un restaurante que administra en compañía de su esposa. "Juaco el Boyaco", como es conocido en la región, consiente a la caprichosa vid y se da a la difícil tarea de producir vinos en Colombia, un país donde sólo un par de lugares en el Valle del Cauca y en Boyacá tienen las condiciones climáticas y geográficas para la producción de la vid.
LA SALUD EN EL PROCESO DE DESCENTRALIZACION TERRITORIAL EN VENEZUELA
Directory of Open Access Journals (Sweden)
Maritza Avila Urdaneta
2001-07-01
Full Text Available La estrategia de la descentralización del Estado se inicia con la aprobación de la Ley de Descentralización, Delimitación y Transferencia de Competencias del Poder Público (LOD en diciembre de 1989. El propósito de la descentralización es aumentar la capacidad de respuesta eficiente del sistema de servicios a los problemas de salud a la población entre los diferentes niveles de poder central, estadal y municipal, así como brindarle una mayor participación a las comunidades en su solución. En Venezuela las instituciones que prestan servicios de salud son numerosas, en su mayoría independientes y ausentes de una coordinación efectiva por parte del Ministerio de Sanidad y Asistencia Social (MSAS, ente creado en 1936 con mayor injerencia en los asuntos relativos a la salud. El MSAS se orienta hacia una política de centralización normativa – procedimental y desconcentración programática que consiste en la transferencia de las funciones administrativas, requeridas para el desarrollo de los programas, a los órganos regionales del Sistema Nacional de Salud. Destaca que el MSAS delimitará a las comunidades territorial, demográfica y técnicamente, en función del establecimiento de atención integral a la salud que le preste sus servicios. Este trabajo tiene como objetivo evaluar el proceso de descentralización de la salud, tomando en cuenta la actual coyuntura sociopolítica y económica en el marco de la nueva Constitución Bolivariana (1999. La muestra está constituida por los Estados Monagas, Carabobo, Aragua, Falcón y Zulia. Los resultados se concretan en el aumento de la productividad y calidad de los servicios de atención médica; simplificación de los procesos administrativos y el fortalecimiento de la democracia, al contar con una comunidad involucrada y satisfecha con el servicio de salud. Se concluye que el proceso de descentralización municipal ha sido frenado por el Gobierno central en los Estados Monagas y
Benin Video-film: A Case for the Documentary Genre
Omoera, Osakue Stevenson
2016-01-01
Although Onions Edionwe’s films, such as Echoes of a Kingdom, Arousa N’ohuan-ren, and Aisiokuoba, are notable documentaries, they represent an “insignificant” component of the total number of movies that have been made in the Benin or Edo language film section of the Nigerian film culture (Nollywood). A critical review of the Benin video culture indicates that a majority of the Benin film content creators tend to ignore the documentary genre. This article explores the reasons Benin filmmakers...
Fire Protection of Weapon Storage and Water Mist Redundancy Philosophies
2012-11-01
criteria me system ged system ozzles dummy tor d, insulated titute of Swe stems pedo pipe Date 2012 den Refere -03-31 P90 nce 0038-04...test wit tion test wit ution test wi t system, 10 st system, 5 m, 5 bar, 50 , 10 bar, 50 ummy, free- edo dummy pedo dummy pedo dummy ummy, dren...systems usi lower volum pedo dumm temperature discharge d ion. h Institute ynamics dström Date 2012 den ater mist/wa ests indicate fire
Rodr??guez P??rez, Jos?? Ram??n, 1968-; ??lvarez Taboada, Mar??a Flor; Peters, Stefan
2008-01-01
Los estudios tradicionales sobre par??metros de calidad del mosto abarcan grandes bloques de vi??edo y se centran en determinar la evoluci??n temporal de estas variables para decidir la ??poca de vendimia m??s adecuada. En este trabajo se propone una metodolog??a para el an??lisis de la variabilidad espacial de los par??metros del mosto y se exponen los resultados obtenidos en la DO Bierzo, para cuatro variedades diferentes de vid. Los resultados permiten identificar zonas homogeneas en cuant...
Directory of Open Access Journals (Sweden)
Ever Agustín Osorio Rebolledo
2004-04-01
Full Text Available Objetivo Identificar factores de riesgo asociados al uso de drogas lícitas e ilícitas en estudiantes adolescentes de ambos sexos cursantes de educación básica y diversificada de instituciones públicas diurnas. Métodos Con base a un estudio descriptiva, de campo y transversal fue realizado estudio en el año 2002 en el Municipio Naguanagua, Estado Carabobo, Venezuela. Se utilizo un cuestionario anónimo auto aplicado denominado Test Drug Use Screening Inventory (DUSI para adolescentes versión Venezuela, fue respondido por una muestra probabilística sistemática estratificada por año de estudio de estudiantes adolescentes de 12 a 17 años de edad de ambos sexos, de dos instituciones educativas públicas diurnas de educación básica y diversificada. Resultados Las áreas de riesgo alto asociadas al uso de drogas lícitas e ilícitas son las de familia y salud mental; mientras que en las de riesgo moderado se encuentran las áreas de recreación, conducta y escuela; y las de riesgo bajo pares, habilidades sociales y uso de drogas. Los resultados del Índice de Severidad Total, es alto. Esto es un indicador de que el adolescente venezolano presenta más riesgo de uso de drogas lícitas e ilícitas, pero al mismo tiempo presenta menos uso de drogas. Lo que pudiera indicar cómo la presencia de factores de protección interactúan con los factores de riesgo, para modificar el efecto de éstos.Este estudo objetiva identificar fatores de riscos associados ao uso de drogas lícitas e ilícitas entre estudantes da educação básica de diversas instituições públicas. Métodos: em estudo descritivo foi realizado no Município de Naguanagua, Carabobo, Venezuela, um estudo por meio de um questionário Test Drug Use Screening Inventory, através de uma amostra estratificada por ano de estudo entre estudantes de 12 a 17 anos. Resultados: áreas de altos riscos associadas ao uso de drogas foram: família e saúde mental; enquanto que as de riscos
Easy Impossibility Proofs for Distributed Concensus Problems.
1985-07-01
device F such that in any system t which u rums F, dhe behavor of each outedge (4.9) b Er In this case, we write FA(E.Ed for F. This axiom expmees a pom...node ad edO bebaiorn SylLSimilarly. Iflbasysm dien A is dwsystcmobtained byscwafteswaydock In 1y h. Intuitively, a scled dock or behavor is in the...Agency Branch Office, Pasadena ATTN: Program MonagemeIIIIIIntIMIS 1030 gast Green Street 1400 Wilson Boulevard Pasadena, CA 91106 Arlington, VA 22209 (1
Directory of Open Access Journals (Sweden)
Sergio Machín García
2011-12-01
Full Text Available El síndrome de Beguez-Chediak-Higashi es una enfermedad rara, autosómica recesiva, descrita en Cuba por el Dr. Beguez-César en 1943. Se presenta un paciente masculino de 8 meses de edad con antecedentes de infecciones graves, obesidad, palidez cutáneo-mucosa intensa, cabello de color plateado, hepatoesplenomegalia y anemia con presencia de gránulos lisosomales gigantes en las células del sistema granulopoyético. Se trató con prednisona, vincristina, etopósido y aciclovir oral con respuestas parciales y transitorias.Beguez-Chediak-Higashi syndrome is a rare illness; it was described in 1943 by Dr. Beguez-Cesar in Cuba. We present an 8 months boy with frequent infections, obesity, intense paleness, silver hair, hepatomegaly, splenomegaly, anemia and big lisosomal granules in myelopoietic system. He was treated with prednisolona, vincristin, VP-16, and oral acyclovir with partial and transitory results.
Physio-Chemical Analysis of Industrial Effluents in parts of Edo ...
African Journals Online (AJOL)
Journal of Applied Sciences and Environmental Management. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 18, No 2 (2014) >. Log in or Register to get access to full text downloads.
Parasitic contamination of fruits and vegetables in Benin city, Edo ...
African Journals Online (AJOL)
Aim: The consumption of fresh fruits and vegetables helps in protecting the human body from diseases and also has a positive impact on body-weight regulation and related conditions, including diabetes and hypertension. This study was conducted to determine the parasitic contamination of fruits and vegetables in Benin ...
Edo Journal of Counselling - Vol 4, No 1-2 (2011)
African Journals Online (AJOL)
The Mediating Impact of Personality and Socio-Economic Status in the Treatment of Stress in Adolescents · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT ... Fostering Adolescents' Interpersonal Behaviour: An Empirical Assessment of Enhanced Thinking Skills and Social Skills Training · EMAIL FREE FULL TEXT ...
Youth contract of some sexually transmitted infections (STIs) In Edo ...
African Journals Online (AJOL)
Finally, the prevalence of Gonorrhea, herpes simplex, Chlamydia, trachomatis, genital warts, syphilis, staph aureus and HIV/AIDS at 6.5, 0.4, 0.8, 2.6, 1.9, 1.0 and 1.3 percent among youth was found. It was, therefore, asserted in this study that STIs can cause infertility, serious illness, disability and death if left untreated.
Jurisprudenţa CtEDO în cazul regimurilor separatiste
Directory of Open Access Journals (Sweden)
Mitrofan Livia
2015-12-01
Full Text Available The territorial separatism, we refer below, may be saw as an illegitimate movement, as well legitimate in some cases. Separatist movement will always be illegitimate for the state on which territory it is happening in contradiction with the state’s official legislation. The issue consists in the state power’s legality and the compliance of its policy with law and morality principles. Thus, the separatism may, morally, be legitimate and commiserate poor nations dominated by strong nations, and to justify itself as an adequate reaction to the state’s actions through the realization of the historical right to self determination.
Attitude of Nursing Mothers In Edo State Towards Exclusive | Alutu ...
African Journals Online (AJOL)
Secondly, practice of exclusive breast-feeding adversely affected by the nursing mothers\\' nature of work. The nurses and teachers were more favourably disposed to exclusive breast-feeding than the bankers. There is therefore need to provide an enabling environment for working mothers to cope with infant feeding and ...
Geophysical Prospecting Of Clay Deposits in Abudu Area of Edo ...
African Journals Online (AJOL)
Its resistivities varied from about 1.0 ohm - m to 500 ohm-m. Area of probable clay formation and their thicknesses have been identified especially for future mining of industries foundation, operations and drilling. Journal of the Nigerian Association of Mathematical Physics, Volume 19 (November, 2011), pp 335 – 342 ...
Prevalence and Prevention of Malaria in Pregnancy in Edo State ...
African Journals Online (AJOL)
Erah
Prevention used against malaria in pregnancy is a sure safe guard against maternal morbidity/mortality and should be ... This acquired anti- malarial immunity ... her family by reducing malaria related ... complications arising during pregnancy,.
Optimum Plans For Oilpalm And Food Crop Combinations In Edo ...
African Journals Online (AJOL)
Intercropping food crops in oil palm plantations is a popular practice among oil ... are not guided by economic rationale for the choice of food crops and oil palm. ... linear programming model for oil palm/food crops enterprise combinations in ...
Yuvaraj, Surya V J; Zhdanov, Ravil K; Belosludov, Rodion V; Belosludov, Vladimir R; Subbotin, Oleg S; Kanie, Kiyoshi; Funaki, Kenji; Muramatsu, Atsushi; Nakamura, Takashi; Kawazoe, Yoshiyuki
2015-10-08
The solvation behavior of task-specific ionic liquids (TSILs) containing a common, L-histidine derived imidazolium cation [C20H28N3O3](+) and different anions, bromide-[Br](-) and bis(trifluoromethylsulfonyl)amide-[NTF2](-), in water is examined, computationally. These amino acid functionalized ionic liquids (ILs) are taken into account because of their ability to react with rare earth metal salts. It has been noted that the TSIL with [Br](-) is more soluble than its counterpart TSIL with [NTF2](-), experimentally. In this theoretical work, the combined classical molecular dynamics (CMD) and density functional theory (DFT) calculations are performed to study the behavior of the bulk phase of these two TSILs in the vicinity of water (H2O) molecules with different concentrations. Initially, all the constructed systems are equilibrated using the CMD method. The final structures of the equilibrated systems are extracted for DFT calculations. Under CMD operation, the radial distribution function (RDF) plots and viscosity of TSILs are analyzed to understand the effect of water on TSILs. In the DFT regime, binding energy per H2O, charge transfer, charge density mapping, and electronic density of states (EDOS) analyses are done. The CMD results along with the DFT results are consolidated to support the hydrophilic and hydrophobic nature of the TSILs. Interestingly, we have found a strong correlation between the viscosity and the EDOS results that leads to an understanding of the hydration properties of the TSILs.
International Nuclear Information System (INIS)
1987-11-01
After the accident of Three Mile Island, Unit 2, nuclear power plant owners made a number of improvements to their nuclear facilities. Despite these improvements, the US Nuclear Regulatory Commission (NRC) staff is concerned that the number and complexity of events at Babcock and Wilcox (B and W) nuclear plants have not decreased as expected. This concern was reinforced by the June 9, 1985 total-loss-of-feedwater event at Davis-Besse Nuclear Power Station and the December 26, 1985 overcooling transient at Rancho Seco Nuclear Generating Station. By letter dated January 24, 1986, the Executive Director for Operations (EDO) informed the Chairman of the B and W Owners Group (BWOG) that a number of recent events at B and W-designed reactors have led the NRC staff to conclude that the basic requirements for B and W reactors need to be reexamined. In its February 13, 1986 response to the EDO's letter, the BWOG committed to lead an effort to define concerns relative to reducing the frequency of reactor trips and the complexity of post-trip response in B and W plants. The BWOG submitted a description of the B and W program entitled ''Safety and Performance Improvement Program'' (BAW-1919) on May 15, 1986. Five revisions to BAW-1919 have also been submitted. The NRC staff has reviewed BAW-1919 and its revisions and presents its evaluation in this report. 2 figs., 34 tabs
Directory of Open Access Journals (Sweden)
A.O. Eweka.
2008-01-01
Full Text Available Histological effects of Monosodium glutamate (MSG commonly used as food additive on the inferior colliculus (IC of adult Wistar rats were carefully studied. The rats of both sexes (n=24, average weight of 185g were randomly assigned into two treatments (n=16 and control (n=8 groups. The rats in the treatment groups received 3g and 6g of MSG thoroughly mixed with their feeds for fourteen days, while the control rats received equal amounts of feeds without MSG added. The rats were fed with growers' mash purchased from Edo Feeds and Flour Mill Ltd, Ewu, Edo State and were given water liberally. The rats were sacrificed on day fifteen of the experiment. The inferior colliculus was carefully dissected out and quickly fixed in 10% formal saline for routine histological study after H&E method.The histological findings after H&E methods indicated that the treated sections of the inferior colliculus showed some cellular degenerative changes, cellular hypertrophy, and autophagic vacuoles with some intercellular vacuolations appearing in the stroma, and some degree of neuronal hypertrophy when compared to the control sections.These findings indicate that MSG consumption may have a deleterious effect on the neurons of the inferior colliculus (IC. MSG may probably have adverse effects on the auditory sensibilities by its deleterious effects on the nerve cells of the IC of adult Wistar rats. It is recommended that further studies aimed at corroborating these observations be carried out.
Directory of Open Access Journals (Sweden)
J.O. Adjene
2010-01-01
Full Text Available The effects of chronic consumption of nutmeg commonly used as a spice in various dishes, as components of teas and soft drinks or mixed in milk and alcohol on the lateral geniculate body of adult wistar rats was studied.The rats of both sexes, with average weight of 200g were randomly assigned into treatment and control groups. The rats in the treatment group (n=8 received 2g of nutmeg thoroughly mixed with the feeds on a daily basis for thirty-two days. The control group (n=8 received equal amount of feeds daily without nutmeg added for thirty-two days. The growers mash feeds was obtained from Edo Feeds and Flour Mill Limited, Ewu, Edo State, Nigeria and the rats were given water liberally. The rats were sacrificed on the thirty-three day of the experiment. The lateral geniculate body was carefully dissected out and quickly fixed in 10% formal saline for histological study.The findings indicate that rats in the treated group showed some cellular degenerative changes like sparse cellular population, pyknotic nuclei with some microcystic changes, edema and vacuolations in the stroma of the treated lateral geniculate body as compared to that of the control group.Chronic consumption of nutmeg may therefore have an adverse effect on the visual sensibilities by affecting the microanatomy of the lateral geniculate body of adult wistar rats. It is recommended for further studies aimed at corroborating these observations.
[Diagnosis of insulin resistance by indirect methods in obese school children].
Angulo, Nerkis; de Szarvas, Sobeida Barbella; Mathison, Yaira; Hadad, Erika; González, Dora; Hernández, Ana; Guevara, Harold
2013-06-01
Obesity leads to a deterioration of glucose tolerance and the action of insulin. The purpose of this study was to determine insulin resistance (IR) by indirect methods, and its correlation with clinical, anthropometric and biochemical variables in obese normoglycemic school children. This was a descriptive-correlational study of 72 school prepubescent children, who attended the ambulatory "El Concejo" of the University of Carabobo (UC) and at the Gastroenterology and Pediatric Nutrition service of the city hospital "Enrique Tejera" (CHET), in Valencia, Venezuela, between January-April 2011. exogenous obesity. We assessed personal and family history, presence of Acanthosis Nigricans and nutritional and biochemical status. We found a higher percentage of IR, through the use of the QUICKI method (66.7%), followed by the HOMA (55.6%) and basal insulin (45.9%). The mean (chi) indexes of body mass and waist circumference were significantly greater (p method detected significant differences (p methods. In conclusion, the evaluated techniques, QUICKI, HOMA and basal insulin indexes, were most effective for detecting the IR.
Incidencia de la enfermedad diarreica aguda en menores de cinco años
Directory of Open Access Journals (Sweden)
Mayelín Ávila Labrada
2015-05-01
Full Text Available La enfermedad diarreica aguda es motivo frecuente de consulta pediátrica, representando un problema grave de salud pública. Los agentes infecciosos son causa frecuente de diarrea aguda. Se realizó un estudio descriptivo, retrospectivo sobre la prevalencia de la enfermedad diarreica aguda en menores de cinco años, atendidos en la clínica “Simón Bolívar” en la ciudad de Mariara del municipio Diego Ibarra, Carabobo, Venezuela; en el periodo comprendido entre enero de 2008 y diciembre de 2012, lo cual ofreció información de cinco años completos. La prevalencia de la enfermedad diarreica aguda disminuyó significativamente en el intervalo 2009-2011, sin embargo, se caracterizó por tener la mayor prevalencia en los años extremos, 2012 y 2008, por ese orden. Los varones y los del grupo de uno a cuatro años fueron los que más incidieron en cada uno de los años estudiados
Flores-Torres, Jessica; Echeverría-Ortega, María; Arria-Bohorquez, Melissa; Hidalgo, Glida; Albano-Ramos, Carlos; Sanz, Rafael; Rodríguez-Morales, Alfonso J
2011-03-01
To evaluate the differences between the observed hemoglobin levels and those estimated based on hematocrit in the context of the 2nd National Study of Human Growth and Development of the Venezuelan Population (SENACREDH). 6,004 individuals were chosen by a probabilistic multistage cluster sampling representing 7,286,781 inhabitants from North Central Coastal area (Vargas, Carabobo, Capital District, Aragua and Miranda). Means of observed and estimated hemoglobin (hematocrit/3) were compared, using t test for related samples and linear regression. Mean difference between the values of observed and estimated hemoglobin was -0.3446 ±0.0002 (phemoglobin values. Regression models of hemoglobin on hematocrit showed an r2=0,87. In order to correct the estimation, we propose a new formula for calculating hemoglobin based on haematocrit values: estimated hemoglobin=(Haematocrit/3.135)+ 0.257. There is an overestimation of hemoglobin levels from hematocrit levels and therefore an underestimation of the prevalence of anemia; however, a high positive correlation between them was found, allowing modeling for achieving a better estimation of the hemoglobin from the hematocrit value.
OFERTA Y DEMANDA: UN MODELO MATEMÁTICO CON ECUACIONES DIFERENCIALES
Hernán Alberto Escobar
2010-01-01
Se presentan inicialmente unas ideas relacionadas con los modelos matemáticos en general, para luego enfocarse en uno muy concreto: el que utiliza como insumo básico las ecuaciones diferenciales ordinarias (EDOs). Dado que el modelo de oferta y demanda, utiliza para su explicación matemática y económica, las ecuaciones diferenciales lineales, se lleva a cabo una explicación de cómo obtener una solución analítica y gráfica de dichas ecuaciones. Posteriormente, se explica con detalle los elemen...
Directory of Open Access Journals (Sweden)
Rodolfo Richard-Jorba
2006-12-01
Full Text Available Las actuales provincias de Mendoza y San Juan, localizadas en el árido centro-oeste argentino, llevan a cabo sus actividades económicas principales en grandes oasis de regadío, pequeñas porciones del territorio, en las cuales se concentra más del 95% de la población. A lo largo de su historia los productos de sus viñedos fueron dotándolas de una clara identidad hasta conformar lo que hoy conocemos como la gran Región Vitivinícola Argentina.
Nogales García, Amaia Miren
2009-01-01
El síndrome de replante es consecuencia de una explotación continua y repetida del terreno en el que los problemas de estrés, principalmente de origen patogénico, juegan un papel importante. En los viñedos españoles, el hongo Armillaria mellea que produce la podredumbre blanca de raíz, está considerado como una de sus principales causas. Existen pocas medidas de control disponibles, puesto que no hay portainjertos comerciales que confieran resistencia frente a A. mellea, y la fumigación del s...
上野, 隆生
2010-01-01
This article deals with the Italian School Textbooks, especially those of geography, published from 1920's to the first half of 1960's. My focus falls upon the Italian images of Japan──how they described Japan and things Japanese──and its transition. Naturally in the field of culture or belle arte important exchanges between Japan and Italy have been occurred since the end of Edo period. But the study of public images between the two nations has been less exhausted than we expect in the domai...
Caracterización de un colectivo de cuidadores informales de acuerdo a su percepción de la salud
Trinidad Lorenzo; José Carlos Millán-Calenti; Laura Lorenzo-López; Ana Maseda
2014-01-01
La salud autopercibida es un elemento clave a la hora de minimizar el impacto socioeconómico generado por el cuidado de personas mayores con dependencia. En este estudio, se pretende caracterizar a un colectivo de personas cuidadoras informales de acuerdo a dicha variable. Se realizó un estudio transversal con un grupo de cuidadores seleccionados por muestreo no probabilístico incidental, en el área urbana de A Coruña y área rural de Mondoñedo (Lugo). En nuestro estudio, el género y el hábita...
Educação e Cinema / Education and Cinema
Cielo, Fernanda; de Oliveira, Valeska Fortes
2013-01-01
Rosália Duarte é professora do Departamento de Educação edo Programa de Pós-Graduação em Educação, da PUC do Rio deJaneiro. É graduada em Psicologia, mestre e doutora em Educação,pela Universidade do Estado do Rio de Janeiro e Fundação GetúlioVargas, respectivamente. Atualmente coordena o Grupo dePesquisa Educação e Mídia na PUC/Rio de Janeiro, trabalhandotemas como cinema, mídias, televisão na educação.
Desarrollo empresarial como eje transversal para la competitividad en el sector portuario Venezolano
Directory of Open Access Journals (Sweden)
Ada Maritza Pérez Cárdenas
2014-01-01
Full Text Available El desarrollo Regional del Caribe Venezolano, está conformado por los principales puertos marítimos de Maracaibo, Puerto Cabello y La Guaira. Los cuales se encuentran ubicados en el eje Andino, que está constituido por cinco países: Bolivia, Ecuador, Colombia, Perú y Venezuela. Donde promocionan un sistema de coordinación para la planificación estratégica de la integración física y sincronización de las actividades de comercio internacional. El Eje Andino se caracteriza por articular los principales aeropuertos internacionales y los puertos marítimos de los cinco países. Originando esto un punto estratégico para las negociaciones internacionales y el desarrollo económico social y cultural para lograr un impacto en las funciones comerciales.En Venezuela sus principales centros urbanos, lo componen las ciudades de Caracas, Maracay, Valencia, Maracaibo, Puerto La Cruz, Barcelona, Ciudad Guayana y San Cristóbal. Dentro del eje andino Venezuela es el punto de enlace ferroviario de Caracas con la red nacional, así como brindar apoyo a la negociación comercial en el eje fluvial Orinoco Apure.Palabras Clave: Desarrollo; Eje Transversal; Punto de Enlace. Business development as cross shaft for competitiveness in the port sectorAbstractThe development of the Venezuelan Caribbean Regional, is formed by. major seaports Maracaibo Puerto Cabello and La Guaira. Which are located in the Andean axis, which is formed by five countries, Bolivia, Colombia, Peru and Venezuela. Which promoted a system of coordination for the strategic planning of the integration of physical and disincronizacion international trade activities. The Andean axis is characterized by articulating the major international airports and seaports of the five countries.Causing it a strategic point for international negotiations in Venezuela the main urban centers, it comprises the cities of Caracas, Maracay, Valencia, Maracaibo, Puerto La Cruz, Barcelona, Ciudad Guayana and
Directory of Open Access Journals (Sweden)
Albert Cuñat Vicente
2000-01-01
Full Text Available FUNDAMENTOS: Se pretende conocer las características de los hábitos higiénicos en las personas mayores de 65 años que no presentan deterioro cognitivo, de la provincia de Guadalajara, residentes en la comunidad y a partir de la hipótesis que estos son deficientes y por ello mejorables. MÉTODOS: Se trata de un estudio observacional, analítico transversal, en el marco de la Atención Primaria, diferenciando ámbito urbano y rural. Se encuestó mediante cuestionario (con pilotaje previo y estudio de fiabilidad mediante análisis de estabilidad en las respuestas a partir de coeficiente kappa, a las personas de una muestra aleatoria estratificada, polietápica y proporcional según edad, sexo y núcleos de población. Analizamos las variables: A Hábitos higiénicos: a.- Higiene personal-aseo diario: Procedimiento y periodicidad, Cuidados del cabello; Lavado de manos siempre antes de comer y después de ir al servicio; Afeitado en varones; Higiene bucodental, b.- Higiene del sueño, B Variables sociodemográficas. Efectuamos análisis de datos mediante procedimientos propios de la estadística descriptiva, analítica y multivariante por regresión logística. RESULTADOS: La pérdida de sujetos de la muestra osciló entre el 16 y 26% (la negativa aparece como primera causa en el medio rural y la no localización en el medio urbano. La muestra finalmente estudiada incluyó a 388 personas en medio rural y 392 en el urbano. La mitad utilizan la ducha y lavan el cabello al menos una vez en semana. Hasta el 15% no se lavan las manos siempre antes de ir a comer y hasta el 44% no lo hacen después de ir al servicio. Mas del 50% de los varones se afeitan según el procedimiento correcto. Un alto porcentaje de edéntulos, tanto parciales como totales, no utilizan prótesis y en aquellos que sí lo hacen la higiene es defectuosa. CONCLUSIONES: Los hábitos higiénicos en las personas ancianas de nuestra provincia son manifiestamente mejorables en todos
Energy Technology Data Exchange (ETDEWEB)
Romay, Z; Otero, I; Chavez, A [Centro de Estudios Aplicados al Desarrollo Nuclear (CEADEN), La Habana (Cuba); Torriente, I [Centro de Histoterapia Placentaria, La Habana (Cuba)
1997-12-31
The Hair conditioner, which belongs to the group of cosmetic products Dr Miyares Cao, was artificially contaminated, kept at different values of temperature (-20 {sup oC}, 0{sup oC} and +20{sup oC}) and irradiated to different doses (6, 10, 12, 15, 20, 25 and 30 kGy) and 25 {sup oC} for studying the effect of gamma radiation on it and the possibility of use of this technology for its decontamination. The radiobiological parameters of the contaminator and the quality of irradiated products were determined. Was conclude that the product maintain its organolepthics characteristics and others quality parameters after irradiated to 20 kGy and +20{sup oC} of temperature before irradiation. Finally, the decontamination of studied product was obtained by means its irradiation to 16.2 kGy.
Directory of Open Access Journals (Sweden)
José Miguel Delgado Idarreta
2009-12-01
Full Text Available Andrés Cabello, Sergio; Capellán de Miguel, Gonzalo; Fandiño Pérez, Roberto y Orduña Prada, Mónica, La transición a la democracia en La Rioja. Logroño, Gobierno de La Rioja, 2001, 291 pp.Páginas 199-200José Miguel Delgado IdarretaBeneyto, José María; Martín de la Guardia, Ricardo y Pérez Sánchez, Guillermo (dirs., Europa y Estados Unidos. Una historia de la relación atlántica en los últimos cien años. Madrid, Biblioteca Nueva, 2005, 356 pp.Páginas 201-203David Molina RabadánBosworth, Richard J. B., Mussolini’s Italy. Life under the Fascist Dictatorship 1915-1945. New York, Penguin, 2006, 692 pp.Páginas 203-205Jan NelisDávila A., Mireya; Fuentes S., Claudio (eds., Promesas de cambio. Izquierda y derecha en el Chile contemporáneo. Santiago de Chile, Editorial Universitaria, FLACSO, 2003, 189 pp.Páginas 205-208David Oviedo SilvaDelgado Idarreta, José Miguel; Andrés Cabello, Sergio, Actas del V Simposio de Historia Actual: La Rioja, España, Europa. Logroño, Instituto de Estudios Riojanos, 2006, 449 pp.Páginas 208-212Alfonso Pinilla GarcíaEvans, Richard J., La llegada del Tercer Reich. Barcelona, Península, 2005, 672 pp.Páginas 212-214Alejandro Piñero GonzálezFriedman, Thomas L., La Tierra es plana. Breve historia del mundo globalizado del siglo XXI. Madrid, Martínez Roca, 2006, 496 pp.Páginas 214-216David Molina RabadánGil Calvo, Enrique, El miedo es el mensaje. Riesgo, incertidumbre y medios de comunicación. Madrid, Alianza Editorial, 2004, 320 pp.Páginas 216-218Lucía Benítez EyzaguirreGoicovic Donoso, Igor, Entre el dolor y la ira. La venganza de Antonio Ramón Ramón. Chile, 1914. Osorno, Editorial Universidad de los Lagos, 2005, 188 pp.Páginas 218-221Alejandra Brito PeñaGriffin, Roger (ed., Fascism, Totalitarianism and Political Religion. New York, Routledge, 2005, 225 pp.Páginas 221-222Jan NelisMcNeill, John R., Algo nuevo bajo el Sol. Historia medioambiental del mundo en el siglo XX. Alianza
Directory of Open Access Journals (Sweden)
Maritza Rojas
2003-08-01
Full Text Available OBJETIVO: Establecer la relación entre concentración de plomo en sangre (Pb-S y parámetros demográficos y socioeconómicos, en una población infantil. METODOS: Se estableció la relación entre la concentración de plomo en sangre (Pb-S, de 243 niños (promedio de edad 5,94±2,78 años, que asistieron al Centro de Investigaciones Toxicológicas de la Universidad de Carabobo (CITUC, Venezuela (periodo 1998-2000. Se utilizó tecnología de Sistemas Geográficos de Información (SGI, ubicando espacialmente a los niños, asociando de forma gráfica la procedencia de éstos con los resultados analíticos. RESULTADOS: El promedio de Pb-S de la población total (11,62 ug/dl, fue significativamente superior al límite permisible (CDC=10 ug/dl. El número de niños con valores superiores al límite permisible de Pb-S (VSLP [150; 61,7%], fue significativamente alto (pOBJECTIVE: To determine the relationship between blood lead concentration (Pb-S, and sociodemographic parameters among children. METHODS: Blood lead concentration (Pb-S was determined in 243 children (aged 5.94±2.78 years in the district of Valencia. The required analysis was performed at the Center for Toxicological Investigations of University of Carabobo (CITUC, Venezuela, between January 1st, 1998 to December 31st, 2000. Geographical Information Systems (GIS technology was used for data mapping. RESULTS: Average Pb-S (11.62 ug/dl was significantly higher than the allowed levels. One hundred and fifty (61.7% children had Pb-S levels above the allowed concentration (VSLP and this amount was significantly high in relation to the total number of subjects studied. The logistic regression analysis showed a significant association of sectors 12 (status A and 16 and 28 (status C with VSLP (R=0.1189; p<0,01; R=0.1202, p<0,01 and R=0.1189; p<0.01, respectively. Odds ratio showed that children from status C are 7,286 times more likely to have Pb-S VSLP than those from A or B. CONCLUSIONS: This
Directory of Open Access Journals (Sweden)
Yisell Urquiza Yero
2011-03-01
Full Text Available Objetivo: realizar la caracterización clínico epidemiológica del parasitismo intestinal en niños de 0 a 5 años pertenecientes al consultorio médico Altos de Uslar, Libertador, Carabobo, Venezuela. Métodos: se realizó un estudio descriptivo, de corte transversal durante los meses de enero a diciembre de 2006, en el que se estudiaron 83 niños que presentaban sintomatología de parasitismo intestinal o no, a los que se les tomó muestras de heces fecales. La información se obtuvo a través de encuestas que se aplicaron a los tutores legales. Resultados: la frecuencia general de parasitismo fue de 67,48 %, con predominio del sexo masculino sobre el femenino; las especies más frecuentes fueron Ascaris lumbricoides y Enterobius vermicularis, y se identificó con poliparasitismo un 61,45 % de pacientes. Entre los factores que favorecieron las parasitosis se detectaron la presencia de vectores, los malos hábitos higiénicos sanitarios y la ingestión de agua no tratada. Conclusiones: predominó la edad de 5 años y el sexo masculino, así como, el poliparasitismo, las infecciones por helmintos, y las malas condiciones higiénico-sanitarias de las viviendas; y como principales factores de riesgo estuvo la presencia de vectores, la insuficiente higiene de las manos y los alimentos de consumo, así como la baja calidad sanitaria del agua.Objective: to carry out a clinical and epidemiological characterization of intestinal parasitism in children aged 0 to 5 from Altos de Uslar, Libertador, Carabobo, Venezuela medical consulting room. Methods: a cross-sectional and descriptive study was conducted from January to December, 2006 in 83 children presenting or not intestinal parasitism symptomatology in which cases feces samples were taken. Information was collected by surveys applied to legal protectors. Results: the general frequency of the parasitism was of 67,48 %, with predominance of male sex over the female one; the more frequent species were
Avances en viticultura en el mundo
Directory of Open Access Journals (Sweden)
Vicente Sotés Ruiz
2011-10-01
Full Text Available Esta presentación incluye dos grandes apartados. Primero se define la situación actual y segundo se analizan las tendencias y se mira al futuro. El mercado del vino está muy afectado por la globalización y en la situación de crisis actual del sector (incremento de producciones, descenso de consumo global, incremento de excedentes,.. El objetivo que se plantea es la obtención de productos competitivos en precios y apetecibles a los consumidores para lo que se considera imprescindible la mejora de la calidad y la tipicidad de los vinos. En este sentido en los últimos años se han producido avances importantes en el cultivo del viñedo en las diferentes áreas vitícolas mundiales y que se refieren principalmente a: la búsqueda de diferenciación frente a la globalización mediante el estudio de variedades y ambientes caracterización de los ambientes adecuados (terroir,adaptación de variedades. Fisiología y cultivo de la vid equilibrio del viñedo y calidad del vino,sistemas de conducción y manejo de la vegetación,riego: aplicación racional del agua Viticultura y cambio climático la huella de carbono adaptación desarrollo de la mejora genética e identificación del material vegetal. Mirando al futuro reducción de los costes de producción y mecanización,desarrollo sostenible.
Directory of Open Access Journals (Sweden)
James Edomwonyi Edokpolor
2017-12-01
Full Text Available The research is aimed at assessing the important role of TVET on job creation and sustainable development of Nigerian economy. Two research questions were answered using mean and standard deviation statistics, while two hypotheses were tested using t-test statistic. A survey method was employed for the research. A four-point scale questionnaire was employed as the instrument for collection of data. The population consists of 332 TVET lecturers in 3 universities and 4 colleges of education in Edo and Delta States. There was no need to adopt sampling technique, nor select any sample size, since the entire population is of a manageable size. The instrument was validated by two experts and its reliability coefficient value using Cronbach alpha method was 0.81. The research revealed that TVET can equip students with skills for job creation and sustainable development of Nigerian economy. It also revealed that there was no significant difference between the mean ratings of TVET lecturers in Edo and Delta States on the extent to which TVET can equip students with skills for job creation. It further revealed that there was no significant difference between the mean ratings of male and female TVET lecturers on the extent to which TVET can equip students with skills for sustainable development of Nigerian economy. Optimizing sufficient amount of financial resources, regular supplies of state-of-the-art facilities, sourcing for qualified manpower, and organization of advocacy programme, that would help in effective management delivery of TVET were further recommended.
System-Solver: una herramienta de código abierto para la modelación de sistemas dinámicos
Directory of Open Access Journals (Sweden)
Efraín Domínguez
2010-09-01
Full Text Available En este artículo se presenta una herramienta de código abierto para la simulación de sistemas dinámicos, representados a través de ecuaciones diferenciales de distinto orden o de sistemas de ecuaciones diferenciales ordinarias (EDO. La idea principal que incentivó el desarrollo de esta herramienta consiste en que muchos procesos físicos, biológicos, ecológicos, económicos, químicos y sociales, y un sinnúmero de problemas ingenieriles, pueden ser expresados de esta forma. Adicionalmente, la solución de ese tipo de problemas exige experticia en métodos numéricos y programación. Este tipo de experticia no es muy común para los expertos de las áreas mencionadas; por ello, se requiere de una herramienta que permita sortear esta falta de experticia e incrementar la productividad en trabajos relacionados con tópicos de modelación. System-Solver es una aplicación que facilita la formulación de problemas de valor inicial en EDO y su solución unmérica, y mediante un programa en Visual Basic la automatiza. El programa obtenido se puede compartir fácilmente con otros investigadores, facilitando la reproducción del ejercicio de modelación incluso en diferentes sistemas operativos. La presentación del software está acompañada con ejercicios de diversas áreas temáticas, incluyendo un ejemplo de modelación estocástica.
Algunas consideraciones acerca de la superficie foliar del viñedo
Lissarrague Garcia-Gutierrez, Jose Ramon
2011-01-01
Las hojas representan el centro básico de la actividad de la vid, en ellas se realizan múltiples funciones que van desde las funciones fisiológicas más conocidas entre las que destaca la fotosíntesis, a través de la cual las hojas captan de la atmosfera la energía luminosa, que trasforman en energía química para trasformar el anhídrido carbónico (CO2) atmosférico en hidratos de carbono, en azúcares, que son el primer eslabón de todas las cadenas metabólicas de la planta, azúcares que la vid u...
Feeding practices in late infancy in Benin City, Edo State, Nigeria
African Journals Online (AJOL)
2015-05-13
May 13, 2015 ... mum feeding in early infant feed- ing same ... basis of equal distribution of 68,748 women of child bearing age ... used by the Expanded Programme on Immunization. (EPI).14 All ..... Mothers Attitudes and Practices;. December ...
Edo N'ekue Phenomenon: A Study in Pre-colonial Benin Imperialism ...
African Journals Online (AJOL)
Most societies in pre-colonial times experienced one form of relationship or the other with their neighbours. More often than not, these relationships came in form of commercial, cultural and political relations. Characteristic of these relations were intermarriages, linguistic borrowings and other interactions dictated by the ...
2013-07-01
DTRA-TR-13-48 Low Power, Room Temperature Systems for the Detection and Identification of Radionuclides from Atmospheric Nuclear Test Approved for...01-C-0071 Radionuclides from Atmospheric Nuclear Tests 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER Muren Chu...I IIlIl4eI ilf "tt""f;lk~ l).t::l’e.do)- mllin:: in an n-t~’Jf mlllril.: II!’ ,-kll ~".r’I::!, ..... ·hkh j,-, .:auI,,·d br thP . la-ek f.r ·;IIff
Díez Bueno, Nuria
2012-01-01
El objetivo de este trabajo es evaluar la influencia de una cubierta vegetal frente al laboreo convencional en dos tipos de suelo con diferente dotación hídrica (suelo de pendiente con riego y suelo de vaguada sin riego) y su influencia sobre el estado hídrico de la planta, la producción, el vigor y la calidad. El presente trabajo final de carrera se realizó en una parcela de viñedo plantado en 1980 de la variedad Tempranillo injertado sobre patrón 41B, de conducción en espaldera, de c...