WorldWideScience

Sample records for ca sc ti

  1. Enhanced Energy-Storage Density and High Efficiency of Lead-Free CaTiO3-BiScO3 Linear Dielectric Ceramics.

    Science.gov (United States)

    Luo, Bingcheng; Wang, Xiaohui; Tian, Enke; Song, Hongzhou; Wang, Hongxian; Li, Longtu

    2017-06-14

    A novel lead-free (1 - x)CaTiO 3 -xBiScO 3 linear dielectric ceramic with enhanced energy-storage density was fabricated. With the composition of BiScO 3 increasing, the dielectric constant of (1 - x)CaTiO 3 -xBiScO 3 ceramics first increased and then decreased after the composition x > 0.1, while the dielectric loss decreased first and increased. For the composition x = 0.1, the polarization was increased into 12.36 μC/cm 2 , 4.6 times higher than that of the pure CaTiO 3 . The energy density of 0.9CaTiO 3 -0.1BiScO 3 ceramic was 1.55 J/cm 3 with the energy-storage efficiency of 90.4% at the breakdown strength of 270 kV/cm, and the power density was 1.79 MW/cm 3 . Comparison with other lead-free dielectric ceramics confirmed the superior potential of CaTiO 3 -BiScO 3 ceramics for the design of ceramics capacitors for energy-storage applications. First-principles calculations revealed that Sc subsitution of Ti-site induced the atomic displacement of Ti ions in the whole crystal lattice, and lattice expansion was caused by variation of the bond angles and lenghths. Strong hybridization between O 2p and Ti 3d was observed in both valence band and conduction band; the hybridization between O 2p and Sc 3d at high conduction band was found to enlarge the band gap, and the static dielectric tensors were increased, which was the essential for the enhancement of polarization and dielectric properties.

  2. Photoionization study of Ne-like K9+, Ca10+, Sc11+, Ti12+, V13+, Cr14+, Mn15+, and Fe16+ ions using the screening constant by unit nuclear charge method

    International Nuclear Information System (INIS)

    Goyal, Arun; Khatri, Indu; Sow, Malick; Sakho, Ibrahima; Aggarwal, Sunny; Singh, A.K.; Mohan, Man

    2016-01-01

    Photoionization of the 2s 2 2p 6 ( 1 S 0 ) ground state of the Ne-like (Z=19–29) ions is presented in this paper. Resonance energies and total natural width of the 2s2p 6 np 1 P series of the Ne-like K 9+ , Ca 10+ , Sc 11+ , Ti 12+ , V 13+ , Cr 14+ , Mn 15+ , and Fe 16+ are reported. All the calculations are made using the Screening constant by unit nuclear charge (SCUNC) formalism. New data for Ne-like K 9+ , Sc 11+ , Ti 12+ , V 13+ , Cr 14+ , and Mn 15+ ions are tabulated. Good agreements are found with available literature data. - Highlights: • Photoionization of ground state of the Ne-like (Z=19–29) presented. • good agreements with scarce literature data. • New data for Ne-like K 9+ , Sc 11+ , Ti 12+ , V 13+ , Cr 14+ , and Mn 15+ ions. • Useful guidelines for application in laboratory, astrophysics, and plasma physics.

  3. The cross section measurement for the reactions of 48,46Ti(n,p) 48,46Sc, 50Ti(n, α)47Ca and 58Ni (n, 2n)57Ni, 58Ni(n,p)58m+gCo

    International Nuclear Information System (INIS)

    Yuan Junqian; Wang Yongchang; Kong Xiangzhong; Yang Jingkang

    1992-01-01

    The cross sections for the 50 Ti(n, α) 47 Ca, 46 Ti(n, p) 46 Sc, 48 Ti(n, p) 48 Sc and 58 Ni(n, 2n) 57 Ni, 58 Ni(n, p) 58m+g Co reactions have been measured by using the activation method relative to the cross sections of the 27 Al(n, α) 24 Na reaction in the neutron energy range of 13.50-14.81 MeV. The neutron energies were determined by the cross section ratios of the 90 Zr(n, 2n) 89m+g Zr and 93 Nb(n, 2n) 92m Nb reactions. The results obtained are compared with the published and to be published data of several authors

  4. β decay and isomeric properties of neutron-rich Ca and Sc isotopes

    International Nuclear Information System (INIS)

    Crawford, H. L.; Mantica, P. F.; Berryman, J. S.; Stoker, J. B.; Janssens, R. V. F.; Carpenter, M. P.; Kay, B. P.; Lauritsen, T.; Zhu, S.; Broda, R.; Cieplicka, N.; Fornal, B.; Grinyer, G. F.; Minamisono, K.; Hoteling, N.; Stefanescu, I.; Walters, W. B.

    2010-01-01

    The isomeric and β-decay properties of neutron-rich 53-57 Sc and 53,54 Ca nuclei near neutron number N=32 are reported, and the low-energy level schemes of 53,54,56 Sc and 53-57 Ti are presented. The low-energy level structures of the 21 Sc isotopes are discussed in terms of the coupling of the valence 1f 7/2 proton to states in the corresponding 20 Ca cores. Implications with respect to the robustness of the N=32 subshell closure are discussed, as well as the repercussions for a possible N=34 subshell closure.

  5. Uncertainty determination of analysis of Ti, V, Cl, Ce, Cr, Cs, Sc, Co, Fe and Ca in solid samples by INAA method using standard addition according to ISO - guide 17025

    International Nuclear Information System (INIS)

    Sumining; Agus Taftazani

    2003-01-01

    Uncertainty of analysis of Ti, V, Cl, Ce, Cr, Cs, Sc, Co, Fe and Ca in solid samples by INAA (/instrumental Neutron Activation Analysis) method using comparative technique and standard addition have been carried out at INAA laboratory of P3TM BATAN. The calculation of Ti have been presented as the example. Uncertainty sources of INAA are sampling, sample and standard preparation, irradiation and counting. Sample were come from IAEA (International Atomic Energy Agency) which had ready for analyzed therefore only for sample and standard preparation, irradiation and counting factors were determined. Analysis were done by relative technique, that sample and standard were irradiated together in same capsule therefore irradiation time, neutron flux, irradiation geometry and isotopic properties. will be eliminated. Uncertainty of counting factors were covering radioactivity decay during the counting, pulse losses caused by random counting, counting geometry, and counting rate. Relative technique makes the uncertainty come from counting time for sample and standard that was settled by same counting equipment can be neglected. Uncertainty of counting geometry and thickness of uranium was not detected so there is no contribution come from The fission product. Variation of fuel target nuclides number didn't occurred because the combustion was not occurred during irradiation, and analytical results were not influenced by the chemical status. (author)

  6. Level densities and γ strength functions in light Sc and Ti isotopes

    International Nuclear Information System (INIS)

    Burger, A.; Larsen, A.C.; Syed, N.U.H.; Guttormsen, M.; Nyhus, H.; Siem, S.; Harissopulos, S.; Konstantinopoulos, T.; Lagoyannis, A.; Perdidakis, G.; Spyrou, A.; Kmiecik, M.; Mazurek, K.; Krticka, M.; Loennroth, T.; Norby, M.; Voinov, A.

    2010-01-01

    We present preliminary results from a measurement of nuclear level densities and the γ-ray strength of light Sc (Sc 43 , Sc 45 ) and Ti (Ti 44 , Ti 45 and Ti 46 ) isotopes using the Oslo Method. The article begins with a presentation of the experimental setup. (authors)

  7. Topotactic oxidation pathway of ScTiO3 and high-temperature structure evolution of ScTiO3.5 and Sc4Ti3O12-type phases.

    Science.gov (United States)

    Shafi, Shahid P; Hernden, Bradley C; Cranswick, Lachlan M D; Hansen, Thomas C; Bieringer, Mario

    2012-02-06

    The novel oxide defect fluorite phase ScTiO(3.5) is formed during the topotactic oxidation of ScTiO(3) bixbyite. We report the oxidation pathway of ScTiO(3) and structure evolution of ScTiO(3.5), Sc(4)Ti(3)O(12), and related scandium-deficient phases as well as high-temperature phase transitions between room temperature and 1300 °Cusing in-situ X-ray diffraction. We provide the first detailed powder neutron diffraction study for ScTiO(3). ScTiO(3) crystallizes in the cubic bixbyite structure in space group Ia3 (206) with a = 9.7099(4) Å. The topotactic oxidation product ScTiO(3.5) crystallizes in an oxide defect fluorite structure in space group Fm3m (225) with a = 4.89199(5) Å. Thermogravimetric and differential thermal analysis experiments combined with in-situ X-ray powder diffraction studies illustrate a complex sequence of a topotactic oxidation pathway, phase segregation, and ion ordering at high temperatures. The optimized bulk synthesis for phase pure ScTiO(3.5) is presented. In contrast to the vanadium-based defect fluorite phases AVO(3.5+x) (A = Sc, In) the novel titanium analogue ScTiO(3.5) is stable over a wide temperature range. Above 950 °C ScTiO(3.5) undergoes decomposition with the final products being Sc(4)Ti(3)O(12) and TiO(2). Simultaneous Rietveld refinements against powder X-ray and neutron diffraction data showed that Sc(4)Ti(3)O(12) also exists in the defect fluorite structure in space group Fm3m (225) with a = 4.90077(4) Å. Sc(4)Ti(3)O(12) undergoes partial reduction in CO/Ar atmosphere to form Sc(4)Ti(3)O(11.69(2)).

  8. Enrichment of Sc{sub 2}O{sub 3} and TiO{sub 2} from bauxite ore residues

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Bona; Li, Guanghui, E-mail: liguangh@csu.edu.cn; Luo, Jun; Ye, Qing; Liu, Mingxia; Peng, Zhiwei; Jiang, Tao

    2017-06-05

    Highlights: • Sc{sub 2}O{sub 3} and TiO{sub 2} from bauxite ore residue were successfully enriched. • H{sub 3}PO{sub 4} and NaOH were efficient for enriching Sc{sub 2}O{sub 3} and TiO{sub 2} by removing SiO{sub 2}, Al{sub 2}O{sub 3}, and partial Fe{sub 2}O{sub 3} and CaO. • Enriching mechanism of Sc{sub 2}O{sub 3} and TiO{sub 2} was explicitly explained. - Abstract: As a major byproduct generated in the alumina industry, bauxite ore residue is an important reserve of scandium and titanium. In this study, the feasibility and mechanism of enriching Sc{sub 2}O{sub 3} and TiO{sub 2} from a non-magnetic material, which was obtained from carbothermal reductive roasting and magnetic separation of bauxite ore residue, were investigated based on a two-step (acidic and alkali) leaching process. It was revealed that approximately 78% SiO{sub 2} and 30–40% of CaO, FeO and Al{sub 2}O{sub 3} were removed from a non-magnetic material with 0.0134 wt.% Sc{sub 2}O{sub 3} and 7.64 wt.% TiO{sub 2} by phosphoric acidic leaching, while about 95% Al{sub 2}O{sub 3} and P{sub 2}O{sub 5} were further leached by subsequent sodium hydroxide leaching of the upper-stream leach residue. A Sc{sub 2}O{sub 3}-, TiO{sub 2}- rich material containing 0.044 wt.% Sc{sub 2}O{sub 3} and 25.5 wt.% TiO{sub 2} was obtained, the recovery and the enrichment factor of Sc{sub 2}O{sub 3} and TiO{sub 2} were about 85% and 5, respectively. The enrichment of Sc{sub 2}O{sub 3} was attributed to higher pH (>3.3) of phosphoric acid solution than its dissolution pH{sup 0}, and the enrichment of TiO{sub 2} was mainly associated with the insoluble perovskite (CaTiO{sub 3}) in the acidic solution at ambient temperature. As Sc{sub 2}O{sub 3} and TiO{sub 2} cannot be dissolved in the alkali solution, they were further enriched in the leach residue.

  9. Characteristics of laser clad α-Ti/TiC+(Ti,W)C1-x/Ti2SC+TiS composite coatings on TA2 titanium alloy

    Science.gov (United States)

    Zhai, Yong-Jie; Liu, Xiu-Bo; Qiao, Shi-Jie; Wang, Ming-Di; Lu, Xiao-Long; Wang, Yong-Guang; Chen, Yao; Ying, Li-Xia

    2017-03-01

    TiC reinforced Ti matrix composite coating with Ti2SC/TiS lubricant phases in-situ synthesized were prepared on TA2 titanium alloy by laser cladding with different powder mixtures: 40%Ti-19.5%TiC-40.5%WS2, 40%Ti-25.2%TiC-34.8%WS2, 40%Ti-29.4%TiC-30.6%WS2 (wt%). The phase compositions, microstructure, microhardness and tribological behaviors and wear mechanisms of coatings were investigated systematically. Results indicate that the main phase compositions of three coatings are all continuous matrix α-Ti, reinforced phases of (Ti,W)C1-x and TiC, lubricant phases of Ti2SC and TiS. The microhardness of the three different coatings are 927.1 HV0.5, 1007.5 HV0.5 and 1052.3 HV0.5, respectively. Compared with the TA2 titanium alloy (approximately 180 HV0.5), the microhardness of coatings have been improved dramatically. The coefficients of friction and the wear rates of those coatings are 0.41 and 30.98×10-5 mm3 N-1 m-1, 0.30 and 18.92×10-5 mm3 N-1 m-1, 0.34 and 15.98×10-5 mm3 N-1 m-1, respectively. Comparatively speaking, the coating fabricated with the powder mixtures of 40%Ti-25.2%TiC-34.8%WS2 presents superior friction reduction and anti-wear properties and the main wear mechanisms of that are slight plastic deformation and adhesive wear.

  10. Magnetic properties of Sc{sub x}Ti{sub 1-x}Fe{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Kessler, M. [Lab. de Cristallographie, CNRS, 38 - Grenoble (France); Deportes, J. [Lab. Louis Neel, CNRS, 38 - Grenoble (France); Ouladdiaf, B. [Institut Laue-Langevin, 38 - Grenoble (France); Sayetat, F. [Lab. de Cristallographie, CNRS, 38 - Grenoble (France)

    1995-02-09

    The magnetic properties and their thermal dependences of Sc{sub 0.1}Ti{sub 0.9}Fe{sub 1.96}, Sc{sub 0.1}Ti{sub 0.9}Fe{sub 2} and Sc{sub 0.1}Ti{sub 0.9}Fe{sub 2.04} are compared with those of TiFe{sub 2}. The substitution changes the iron-iron distances. Consequently, the Fe atoms on the 6h site show in addition to the antiferromagnetic component a small ferromagnetic one, and a weak magnetic moment appears on the 2a site. ((orig.)).

  11. Synthesis and Isolation of the Titanium-Scandium Endohedral Fullerenes-Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 and Sc2 TiC2 @Ih -C80 : Metal Size Tuning of the Ti(IV) /Ti(III) Redox Potentials.

    Science.gov (United States)

    Junghans, Katrin; Ghiassi, Kamran B; Samoylova, Nataliya A; Deng, Qingming; Rosenkranz, Marco; Olmstead, Marilyn M; Balch, Alan L; Popov, Alexey A

    2016-09-05

    The formation of endohedral metallofullerenes (EMFs) in an electric arc is reported for the mixed-metal Sc-Ti system utilizing methane as a reactive gas. Comparison of these results with those from the Sc/CH4 and Ti/CH4 systems as well as syntheses without methane revealed a strong mutual influence of all key components on the product distribution. Whereas a methane atmosphere alone suppresses the formation of empty cage fullerenes, the Ti/CH4 system forms mainly empty cage fullerenes. In contrast, the main fullerene products in the Sc/CH4 system are Sc4 C2 @C80 (the most abundant EMF from this synthesis), Sc3 C2 @C80 , isomers of Sc2 C2 @C82 , and the family Sc2 C2 n (2 n=74, 76, 82, 86, 90, etc.), as well as Sc3 CH@C80 . The Sc-Ti/CH4 system produces the mixed-metal Sc2 TiC@C2 n (2 n=68, 78, 80) and Sc2 TiC2 @C2 n (2 n=80) clusterfullerene families. The molecular structures of the new, transition-metal-containing endohedral fullerenes, Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 , and Sc2 TiC2 @Ih -C80 , were characterized by NMR spectroscopy. The structure of Sc2 TiC@Ih -C80 was also determined by single-crystal X-ray diffraction, which demonstrated the presence of a short Ti=C double bond. Both Sc2 TiC- and Sc2 TiC2 -containing clusterfullerenes have Ti-localized LUMOs. Encapsulation of the redox-active Ti ion inside the fullerene cage enables analysis of the cluster-cage strain in the endohedral fullerenes through electrochemical measurements. © 2016 The Authors. Published by Wiley-VCH Verlag GmbH & Co. KGaA.

  12. New nuclear data evaluations for Ca and Sc isotopes

    International Nuclear Information System (INIS)

    Koning, Arjan; Duijvestijn, Marieke

    2007-01-01

    New ENDF-6 formatted nuclear data libraries are presented for 40,42,43,44,46,48 Ca and 45 Sc, for incident neutrons and protons. Apart from the resonance range, which we have adopted from the best available source in existing libraries, the nuclear data evaluations are completely revised in the 0-20MeV energy range, and, moreover, extend up to 200 MeV. This collection of isotopic evaluations is created by using the nuclear model code TALYS with a consistent set of input parameters for all isotopes. The most important nuclear reaction models needed for our data files are described. We have intended to make these evaluations complete in their description of reaction channels and use a consistent method to store the data in ENDF-6 format, which include cross sections, angular distributions, double-differential spectra, discrete and continuum photon production cross sections, and residual production (activation) cross sections including isomers. It is shown that the data present in our libraries give an improved agreement with the existing basic experimental data. (author)

  13. Valence electron structure analysis of refining mecha-nism of Sc and Ti additions on aluminum

    Institute of Scientific and Technical Information of China (English)

    LI PieJie; YE YiCong; HE LiangJu

    2009-01-01

    The mechanism of the difference of refining effect between Sc and Ti adding to aluminum can not be explained substantially with traditional theory. Valence electron structures of AI-Ti and Al-Sc alloys have been studied by using the empirical electron theory of solids and molecules (EET). The covalent bond electron numbers and interfacial electron density differences are calculated. The conclusion is that, in the two alloys, different covalent bond electron numbers of nucleation particles, and different electron densities on the interface between the second phase particles and the matrix, fundamentally lead to the difference of refining effect between Sc and Ti adding to aluminum.

  14. Study of positive parity levels in 41Ca and 41Sc: electromagnetic deexcitation of the 3/2 isospin states

    International Nuclear Information System (INIS)

    Fortier, Simone.

    1976-01-01

    The γ-decay of T=3/2 states in 41 Ca has been investigated by means of the 42 Ca( 3 He,αγ) 41 Ca reaction. Angular correlation measurements have been performed for γ-rays in coincidence with α particles emitted near 0 deg, and branching ratios extracted. The lowest T=3/2 level in 41 Sc (E=5,94MeV) has been excited as a resonance in the 40 Ca(p,γ) 41 Sc reaction, and radiative widths of γ-transitions were measured. The γ decay of the first T=3/2 level in 41 Sc is found to be quite similar to the one measured for the analog level in 41 Ca (E=5,92MeV), as it could be expected from corresponding ΔT=1 transitions in mirror nuclei. The M1 strengths are also compared with the ft values of β + transitions from the 41 Ti ground state. The orbital momentum part of the M1 operator is found to be important for three couples of γ-transition in 41 Ca and 41 Sc. These results suggest that the antianalog configuration could be in the ) 72.01-2.10MeV{ levels whereas the core-excited configurations (2 particles in the f7/2 shell coupled to J=1 and T=0 in the 74.09-4.25MeV{ levels and 74.73-4.77MeV{ levels. Experimental results are finally compared with the predictions of a shell model calculation performed for positive parity levels in A=41 nuclei, with 2 or 4 particles in the 1f7/2 shell and 1 or 3 holes in the 1d3/2 and 2s1/2 shells. )] [fr

  15. Enhanced hardness in epitaxial TiAlScN alloy thin films and rocksalt TiN/(Al,Sc)N superlattices

    Energy Technology Data Exchange (ETDEWEB)

    Saha, Bivas [School of Materials Engineering, Purdue University, West Lafayette, Indiana 47907 (United States); Birck Nanotechnology Center, Purdue University, West Lafayette, Indiana 47907 (United States); Lawrence, Samantha K.; Bahr, David F. [School of Materials Engineering, Purdue University, West Lafayette, Indiana 47907 (United States); Schroeder, Jeremy L.; Birch, Jens [Thin Film Physics Division, Department of Physics, Chemistry, and Biology (IFM), Linköping University, SE-581 83 Linköping (Sweden); Sands, Timothy D. [School of Materials Engineering, Purdue University, West Lafayette, Indiana 47907 (United States); Birck Nanotechnology Center, Purdue University, West Lafayette, Indiana 47907 (United States); School of Electrical and Computer Engineering, Purdue University, West Lafayette, Indiana 47907 (United States)

    2014-10-13

    High hardness TiAlN alloys for wear-resistant coatings exhibit limited lifetimes at elevated temperatures due to a cubic-AlN to hexagonal-AlN phase transformation that leads to decreasing hardness. We enhance the hardness (up to 46 GPa) and maximum operating temperature (up to 1050 °C) of TiAlN-based coatings by alloying with scandium nitride to form both an epitaxial TiAlScN alloy film and epitaxial rocksalt TiN/(Al,Sc)N superlattices on MgO substrates. The superlattice hardness increases with decreasing period thickness, which is understood by the Orowan bowing mechanism of the confined layer slip model. These results make them worthy of additional research for industrial coating applications.

  16. Precise determination of 40Ti mass by measuring the 40Sc isospin analogue state

    International Nuclear Information System (INIS)

    Liu Weiping; Hellstroem, M.; Collatz, R.; Benlliure, J.; Cortina, G.D.; Farget, F.; Grawe, H.; Hu, Z.; Iwasa, N.; Pfuetzner, M.; Roeckl, E.; Chulkov, L.; Piechaczek, A.; Raabe, R.; Reusen, I.; Vancraeynest, G.; Woehr, A.

    2001-01-01

    The mass of 40 Ti has been determined by using the isobaric multiplet mass equation method. The experimental data of the 40 Ti β-decay were used to determine the level of the isospin analogue state of 40 Sc. The ground-state mass excess and the Q EC value for 40 Ti were determined to be -9060 +- 12 keV and 11466 +- 13 keV, respectively

  17. Naked (C5Me5)(2)M cations (M = Sc, Ti, and V) and their fluoroarene complexes

    NARCIS (Netherlands)

    Bouwkamp, MW; Budzelaar, PHM; Gercama, J; Morales, ID; de Wolf, J; Meetsma, A; Troyanov, SI; Teuben, JH; Hessen, B; Budzelaar, Peter H.M.; Hierro Morales, Isabel Del; Troyanov, Sergei I.

    2005-01-01

    The ionic metallocene complexes [Cp*M-2][BPh4] (CP* = C5Me5) of the trivalent 3d metals Sc, Ti, and V were synthesized and structurally characterized. For M Sc, the anion interacts weakly with the metal center through one of the phenyl groups, but for M = Ti and V, the cations are naked. They each

  18. Crystal structure and magnetic properties of the solid-solution phase Ca3Co2-v Sc v O6

    International Nuclear Information System (INIS)

    Hervoches, Charles H.; Fredenborg, Vivian Miksch; Kjekshus, Arne; Fjellvag, Helmer; Hauback, Bjorn C.

    2007-01-01

    The two crystallographically non-equivalent Co atoms of the quasi-one-dimensional crystal structure of Ca 3 Co 2 O 6 form chains with alternating, face-sharing polyhedra of Co2O 6 trigonal prisms and Co1O 6 octahedra. This compound forms a substitutional solid-solution phase with Sc, in which the Sc atoms enter the Co2 sublattice exclusively. The homogeneity range of Ca 3 Co 2- v Sc v O 6 (more specifically Ca 3 Co1Co2 1- v Sc v O 6 ) extends up to v∼0.55. The crystal structure belongs to space group R3-barc with lattice parameters (in hexagonal setting): 9.0846(3)≤a≤9.1300(2) A and 10.3885(4)≤c≤10.4677(4) A. The magnetic moment decreases rapidly with increasing amount of the non-magnetic Sc solute in the lattice. - Graphical abstract: The quasi-one-dimensional Ca 3 Co 2 O 6 phase forms a substitutional solid-solution system with Sc, in which the Sc atoms enter the Co2 sublattice exclusively. The homogeneity range of Ca 3 Co 2- v Sc v O 6 extends up to v∼0.55. The magnetic moment decreases rapidly with increasing amount of the non-magnetic Sc solute in the lattice

  19. One-hole states in nuclei of 41K, 41Ca and 41Sc

    International Nuclear Information System (INIS)

    Kim, Moon Won

    1985-01-01

    The one-hole states in nuclei of 41 K, 41 Ca and 41 Sc have been calculated with a model space based on the (1f 7/2 ,2P 3/2 ) 2 (1d 3/2 , 2S 1/2 ) -1 configuration using the nuclear shell model. The two body effective interaction is assumed to be a surface-delta potential. 40 Ca is also assumed to be an inert core. Energy spectra and spectroscopic factors are obtained and compared with the experimental data. The calculate results in fair agreement with the observed values. (Author)

  20. Apparent vanishing of ferroelectricity in nanostructured BiScO3PbTiO3

    OpenAIRE

    Amorín , H; Jiménez , R; Ricote , J; Hungría , T; Castro , A; Algueró , M

    2010-01-01

    Abstract Nanostructured ceramics of high-temperature piezoelectric 0.375BiScO 3 -0.625PbTiO 3 were prepared by spark plasma sintering of nanocrystalline powders obtained by mechanosynthesis. The macroscopic electrical properties were characterized on dense ceramics with decreasing average grain size down to 28 nm. Results indicate that the electric field is screened by the electrically insulating grain boundaries at the nanoscale, which needs to be considered when discussing size effects i...

  1. Experimental Investigation of Electrical Conductivity and Permittivity of SC-TiO 2 -EG Nanofluids

    Science.gov (United States)

    Fal, Jacek; Barylyak, Adriana; Besaha, Khrystyna; Bobitski, Yaroslav V.; Cholewa, Marian; Zawlik, Izabela; Szmuc, Kamil; Cebulski, Józef; żyła, Gaweł

    2016-08-01

    The paper presents experimental studies of dielectric properties of nanofluids based on ethylene glycol and SC-TiO2 nanoparticles with average size of 15-40 nm with various mass concentrations. The dielectric permittivity both real part and imaginary part as a function of temperature and frequency were measured. Also, dependence ac conductivity on frequency, temperature, and mass concentration were investigated. Based on the curves of ac conductivity, dc conductivity was calculated, and 400 % enhancement in dc conductivity was exposed.

  2. Thermoluminescence response and glow curve structure of Sc2TiO5 ß-irradiated

    International Nuclear Information System (INIS)

    Muñoz, I.C.; Brown, F.; Durán-Muñoz, H.; Cruz-Zaragoza, E.; Durán-Torres, B.; Alvarez-Montaño, V.E.

    2014-01-01

    Discandium titanate (Sc 2 TiO 5 ) powder was synthesized in order to analyze its thermoluminescence (TL) response. The TL glow curve structure shows two peaks: at 453–433 K and at 590–553 K. The TL beta dose–response has a linear behavior over the dose range 50–500 Gy. The T stop preheat method shows five glow peaks that were taken into account to calculate the kinetic parameters using the CGCD procedure. TL results support the possible use of Sc 2 TiO 5 as a new phosphor in high ß-dose dosimetry. - Highlights: • Discandium titanate was synthesized, and its TL properties were analyzed. • The beta dose–response has a linear behavior on the dose range 50–500 Gy. • The kinetic parameters were obtained by the CGCD procedure. • Results support the possible use of Sc 2 TiO 5 as a new phosphor for ß-dose dosimetry

  3. Isospin excitation of nucleus in 42,44,48Ca (p,n)42,44,48Sc

    International Nuclear Information System (INIS)

    Suzuki, Keiji

    2002-01-01

    To obtain information of (p,n) reaction of heavy nucleus in 100 MeV or less, 42,44,48 Ca(p,n) 42,44,48 Sc was observed on the Cyclotron Radio Isotope Center in Tohoku University. The experimental results showed that 7, 8 and 10 spin parities were determined for 42 Sc, 44 Sc and 48 SC, respectively. It was the first determination of one and two negative parity transition of 42 Sc and 48 Sc,respectively, by (p,n) reaction. The full space wave function made by 0f1p shell effective interaction by Richter,et al is good accuracy and reliability. On the (p,n) reaction at E p =35 MeV, the transition matrix elements of 42 Ca, 44 Ca and 48 Ca were derived. On the experiment of 42 Ca(p,n) 42 Sc at E p 2 on energy was agreed with the calculation results by Franey and Love. The nuclear structure of 42 Ca was thought to show more stronger U(4) symmetry, because strong GT transition at T=1 was not observed, which was expected by j-j bonding shell model calculation. (S.Y.)

  4. Application of shell model with the modified surface delta interaction to 42Ca and 42Sc nuclei

    International Nuclear Information System (INIS)

    Jasielska, A.; Wiktor, S.

    1975-01-01

    The shell model with MSDI residual interaction is used to investigate properties of levels in the 42 Ca and 42 Sc nuclei. The 40 Ca core with two active outer nucleons is assumed. The energy matrices are diagonalized and the calculated level schemes for both 42 Ca and 42 Sc nuclei are presented. In both nuclei the density of the calculated levels is significantly less than of the observed levels. This fact leads to the conclusion, that some core excitation modes play an important role in the formation of low-lying states in the 42 Ca and 42 Sc nuclei. The calculated eigenvalues and eigenvectors of the states below 5 MeV are given. (author)

  5. Quasi-elastic transfer and charge-exchange reactions in collisions of 48Ti on 42Ca and 26Mg

    International Nuclear Information System (INIS)

    Brendel, C.

    1985-01-01

    At the GSI magnetic spectrometer quasi-elastic transfer and charge-exchange reactions of the system 48 Ti + 42 Ca at incident energies E lab = 240, 300, and 385 MeV and additionally at the higher projectile energy the system 48 Ti + 26 Mg were studied each in the excitation energy range up to E x ≅ 80 MeV. The transition strength was for each particle-hole configuration of the final system calculated by means of the DWBA and subsequently folded with a Breit-Wigner distribution. The localization of the strength of the cross section and the specific structure of the energy spectra were at incident energies between 6 and 8 MeV/amu for all angles well reproduced. By an extension of the core-excitation model to many-stage reactions the charge-exchange reaction 48 Ti + 42 Ca → 48 Sc + 42 Sc could be described as sequential two-stage process. In the two-neutron stripping reaction 48 Ti + 42 Ca → 46 Ti + 44 Ca a surprisingly narrow line with a width of the experimental resolution and an excitation energy of E x = 17.8 MeV was measured at angles smaller than the grazing angle. In the 48 Ti + 26 Mg system the corresponding 46 Ti spectra show also under forward angles structures at excitation energies between 8 and 16 MeV. These lines can be explained as two-neutron states with high spin. (orig./HSI) [de

  6. An electroamalgamation approach to separate 47Sc from neutron activated CaO target for use in cancer theranostics

    International Nuclear Information System (INIS)

    Chakravarty, Rubel; Chakraborty, Sudipta; Dash, Ashutosh

    2016-01-01

    Over the last few years, 47 Sc has attracted significant attention for potential use in cancer theranostics due to its favorable nuclear decay characteristics (t 1/2 = 3.35 d; average β energy, 162 keV; Eγ, 159 keV). No-carrier-added (NCA) 47 Sc can be produced via the 46 Ca(n,γ)→ 47 Sc reaction in a nuclear reactor. For this purpose, 1 mg of CaO (98 % enrichment of 46 Ca) target was irradiated for 7 d at a flux of 1 × 10 14 n.cm -2 .s -1 at the Dhruva reactor of our research centre. The irradiated target was dissolved in 5 ml of 1 M HCl inside a lead shielded facility. The resultant solution was evaporated to near dryness, reconstituted in 20 ml of 0.15 M lithium citrate solution and transferred to the electrochemical cell. The electrochemical separation involved selective amalgamation of Ca from Ca/Sc mixture into mercury-pool cathode. The influence of different experimental parameters (such as applied potential, pH of the electrolyte, time of electrolysis and amount of Ca 2+ ions in the electrolyte) on the separation process was investigated and optimized for the quantitative electroamalgamation of Ca

  7. Thermomechanical processing of aluminum micro-alloyed with Sc, Zr, Ti, B, and C

    Science.gov (United States)

    McNamara, Cameron T.

    Critical exploration of the minimalistic high strength low alloy aluminum (HSLA-Al) paradigm is necessary for the continued development of advanced aluminum alloys. In this study, scandium (Sc) and zirconium (Zr) are examined as the main precipitation strengthening additions, while magnesium (Mg) is added to probe the synergistic effects of solution and precipitation hardening, as well as the grain refinement during solidification afforded by a moderate growth restriction factor. Further, pathways of recrystallization are explored in several potential HSLA-Al syste =ms sans Sc. Aluminum-titanium-boron (Al-Ti-B) and aluminum-titanium-carbon (Al-Ti-C) grain refining master alloys are added to a series of Al-Zr alloys to examine both the reported Zr poisoning effect on grain size reduction and the impact on recrystallization resistance through the use of electron backscattered diffraction (EBSD) imaging. Results include an analysis of active strengthening mechanisms and advisement for both constitution and thermomechanical processing of HSLA-Al alloys for wrought or near-net shape cast components. The mechanisms of recrystallization are discussed for alloys which contain a bimodal distribution of particles, some of which act as nucleation sites for grain formation during annealing and others which restrict the growth of the newly formed grains.

  8. Structure determinations for Ca3Ti2O7, Ca4Ti3O10, Ca3.6Sr0.4Ti3O10 and a refinement of Sr3Ti2O7

    International Nuclear Information System (INIS)

    Elcombe, M.M.; Kisi, E.H.; Hawkins, K.D.; White, T.J.; Goodman, P.; Matheson, S.

    1991-01-01

    The structures of the orthorhombic Ruddlesden-Popper (A n+1 B n X 3n+1 ) phases Ca 3 Ti 2 O 7 (n=2) refined from neutron powder diffraction data at λ=1.893 A. They consist of coherent intergrowths of perovskite (CaTiO 3 ) blocks, n TiO 6 octahedra thick, with single layers of CaO having a distorted NaCl configuration. TiO 6 octahedra are tilted and distorted in a very similar fashion to those in CaTiO 3 (n=∞). This fact was used to determine the space groups of the layered structures. Convergent-beam electron diffraction patterns are best matched by calculations in the above space groups which are thus confirmed. Octahedral tilt angles increase slightly in the sequence n=2, 3, ∞. Strontium addition reduces the octahedral tilt angles because of preferential substitution of Sr on the Ca sites within the perovskite blocks of Ca 4 Ti 3 O 10 . The algorithm used to produce starting models for structure refinements is thought to be generally applicable to Ruddlesden-Popper and possibly other layered perovskite structures. It furnishes the predictions: (a) all n-even compounds in the Ca n+1 Ti n O 3n+1 series will have space group Ccm2 1 , (b) all n-odd compounds in this series will have space group Pcab, (c) all A n+1 B n X 3n+1 series for which the n=∞ end member (ABX 3 ) is isostructural with CaTiO 3 will be isostructural with the compounds reported above (e.g. Ca n+1 Zr n O 3n+1 ). (orig./WL)

  9. Interface interaction and wetting of Sc2O3 exposed to Cu-Al and Cu-Ti melts

    International Nuclear Information System (INIS)

    Barzilai, S.; Nagar, H.; Froumin, N.; Frage, N.; Aizenshtein, M.

    2009-01-01

    Scandia is a thermodynamically stable oxide and could be used as a structural material for a crucible in order to avoid a melt contamination. In the present study wetting experiments of Cu-Al and Cu-Ti melts on Scandia substrate were preformed at 1423 K by a sessile drop method. It was established that Al and Ti additions lead to the improved wetting and that the final contact angle decreases with increasing the additives concentration. For Al containing melts, the contact angle changes gradually with time, and a relatively thick interaction layer, which consists of Al 2 O 3 , Sc 2 O 3 , and metallic channels, was formed at the Sc 2 O 3 /Cu-Al interface. For Ti containing melts, the final contact angle is achieved already during heating, and an extremely thin layer based on a Ti-Sc-O compound was detected by AES at the Sc 2 O 3 /Cu-Ti interface. The results of a thermodynamic analysis, which takes into account the formation free energy of the oxides, involved in the systems, and the thermodynamic properties of the liquid solutions are in a good agreement with the experimental observations. (orig.)

  10. Landau-Devonshire Parameters for the Tunable Paraelectric Material BaTi.9(Sc,Ta).05O3

    National Research Council Canada - National Science Library

    Miller, Virginia; Crowne, Frank

    2008-01-01

    ...).05O3 are used to deduce the thermodynamic Landau-Devonshire parameters of the material, which are found to differ strongly from those of the parent material BaTiO3, despite the small amount of added Sc and Ta...

  11. Synthesis and characterization of CTO (CaTiO3)

    International Nuclear Information System (INIS)

    Silva, M.A.S.; Fernandes, T.S. M.; Santiago, A.A.X.; Sombra, A.S.B.; Sales, J.C.

    2011-01-01

    The objective of this work is to study the ceramic material CTO (CaTiO 3 ) by X-Ray Diffraction. The composites of CTO are widely used in dielectric resonators in communication systems. The CTO was prepared by solid state method in a planetary high energy ball milling (Fritsch Pulverisette 5). Stoichiometric quantities of CaCO 3 (Aldrich 99%) and TiO 2 (Merck 99%) were dry milled during 4h with a rotational speed of 370 rpm and then calcined at 1000 deg C for 3h. After, the CTO was studied by X-ray diffraction (XRD). The refinement showed that the CTO was formed with 100% mass, the graph of Williamson-Hall showed a homogeneous sample, with a contraction in the crystal lattice and a reasonably small particle size. (author)

  12. Ionic conductivity of Ca and Mg doped NdGdZr1.95Sc0.05O7

    International Nuclear Information System (INIS)

    Anithakumari, P.; Mandal, B.P.; Grover, V.; Tyagi, A.K.; Mishra, A.K.

    2014-01-01

    The ionic conductivity of pyrochlore based materials makes them promising candidates for fuel-cell applications where high ionic conductivity and low activation energy are desired. Earlier it has been reported that 5%Sc doped GdNdZr 2 O 7 shows highest ionic conductivity. In this present work, an attempt has been made to further increase the oxygen vacancy concentration by the incorporation of Ca 2+ and Mg 2+ ions at A site of NdGdZr 1.95 Sc 0.05 O 7 (NGZS)

  13. CORRELATION OF 48Ca, 50Ti, AND 138La HETEROGENEITY IN THE ALLENDE REFRACTORY INCLUSIONS

    International Nuclear Information System (INIS)

    Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang

    2015-01-01

    Precise determinations of 48 Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive 48 Ca/ 44 Ca anomalies in all analyzed CAIs after normalization to 42 Ca/ 44 Ca, and it is clearly shown that there is no simple correlation between 48 Ca/ 44 Ca and 50 Ti/ 48 Ti anomalies, in agreement with Jungck et al. Compared to the 48 Ca/ 44 Ca versus 50 Ti/ 48 Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated 50 Ti/ 48 Ti. Assuming the 48 Ca/ 44 Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess 50 Ti anomalies in CAIs can be calculated by subtracting the part associated with 48 Ca/ 44 Ca. These excesses show a linear correlation with 138 La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system 48 Ca, 50 Ti, and 138 La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II

  14. Combustion synthesis of CaSc2O4:Ce3+ nano-phosphors in a closed system

    International Nuclear Information System (INIS)

    Peng Wenfang; Zou Shaoyu; Liu Guanxi; Xiao Quanlan; Zhang Rui; Xie Lijuan; Cao Liwei; Meng Jianxin; Liu Yingliang

    2011-01-01

    Highlights: → CaSc 2 O 4 :Ce 3+ nano-phosphors can be prepared by a single-step combustion method. → The ignition temperature is the lowest in the combustion synthesis of Ce 3+ /Eu 2+ doped phosphors. → The as-prepared nano-phosphors give a uniform particle size in the range of 15-20 nm and have highly dispersity and fluorescence intensity. → It is a convenient method for preparation of monodispersed oxide nano-phosphors, especially those being sensitive to air at high temperature. - Abstract: The CaSc 2 O 4 :Ce 3+ nano-phosphors were successfully prepared by a single-step combustion method at an ignition temperature as low as 200 deg. C in a closed autoclave using glycine as a fuel and PEG4000 as a dispersant. The samples were characterized by X-ray diffraction (XRD), photoluminescence (PL) spectroscopy, scanning electron microscopy (SEM) and transmission electron microscope (TEM). The results revealed that CaSc 2 O 4 :Ce 3+ nano-phosphors can be conveniently prepared at an ignition temperature as low as 200 deg. C, which was much lower than that in the ordinary combustion methods. The optimized ignition temperature was 220 deg. C. The CaSc 2 O 4 :Ce 3+ nano-phosphors give a uniform particle size in the range of 15-20 nm. The low ignition temperature and the addition of PEG4000 dispersant play important roles in the formation of small sized nanoparticles. The as-prepared nano-phosphors were incompact aggregates, but highly dispersed nano-phosphors can be obtained after further ultrasonic treatment. The CaSc 2 O 4 :Ce 3+ nano-phosphors give satisfactory luminescence characteristic benefiting from the closed circumstance, in which cerium atoms can be isolated from the oxidizing atmosphere and non-fluorescent Ce 4+ ions can be ruled out. The present highly dispersed CaSc 2 O 4 :Ce 3+ nano-phosphors with efficient fluorescence are promising in the field of biological labeling, and the present low temperature combustion method is facile and convenient and can

  15. Multiphase nanodomains in a strained BaTiO3 film on a GdScO3 substrate

    Science.gov (United States)

    Kobayashi, Shunsuke; Inoue, Kazutoshi; Kato, Takeharu; Ikuhara, Yuichi; Yamamoto, Takahisa

    2018-02-01

    Controlling the crystal structure of ferroelectric materials via epitaxial strain, which is a well-known technique in strain engineering, can lead to the formation of unique domain structures generating non-intrinsic phenomena such as electronic conductivity, photovoltages, and enhanced piezoelectric characteristics. Strained BaTiO3 films are promising ferroelectric materials as theoretical modeling predicts that different domain morphologies can introduce additional properties not observed in conventional BaTiO3 ceramics. To rationally design materials for practical application, a thorough understanding of the formation mechanisms and stabilities of different domain structures in strained BaTiO3 films is required. However, there have been very few experimental reports on this topic, and details about the domain structures in strained BaTiO3 films are currently lacking. In this paper, we report multiphase nanodomains in a strained BaTiO3 film deposited on an orthorhombic GdScO3 substrate. The phase-transition behavior of the strained BaTiO3 film reveals that it contains multiple phases at room temperature; the film first undergoes a phase-transition upon heating at around 550 K, and then a paraelectric phase forms at temperatures above 690 K. A picometer-scale analysis of the Ti ion displacements, using an advanced scanning transmission electron microscopy technique, is used to characterize the complex multiphase nanodomains, providing useful insights into the control of domain structures in BaTiO3 films by applying epitaxial strain.

  16. Electrosynthesis of Ti5Si3, Ti5Si3/TiC, and Ti5Si3/Ti3SiC2 from Ti-Bearing Blast Furnace Slag in Molten CaCl2

    Science.gov (United States)

    Li, Shangshu; Zou, Xingli; Zheng, Kai; Lu, Xionggang; Chen, Chaoyi; Li, Xin; Xu, Qian; Zhou, Zhongfu

    2018-04-01

    Ti5Si3, Ti5Si3/TiC, and Ti5Si3/Ti3SiC2 have been electrochemically synthesized from the Ti-bearing blast furnace slag/TiO2 and/or C mixture precursors at a cell voltage of 3.8 V and 1223 K to 1273 K (950 °C to 1000 °C) in molten CaCl2. The pressed porous mixture pellets were used as the cathode, and a solid oxide oxygen-ion-conducting membrane (SOM)-based anode was used as the anode. The phase composition and morphologies of the cathodic products were systematically characterized. The final products possess a porous nodular microstructure due to the interconnection of particles. The variations of impurity elements, i.e., Ca, Mg, and Al, have been analyzed, and the result shows that Ca and Mg can be almost completely removed; however, Al cannot be easily removed from the pellet due to the formation of Ti-Al alloys during the electroreduction process. The electroreduction process has also been investigated by the layer-depended phase composition analysis of the dipped/partially reduced pellets to understand the detailed reaction process. The results indicate that the electroreduction process of the Ti-bearing blast furnace slag/TiO2 and/or C mixture precursors can be typically divided into four periods, i.e., (i) the decomposition of initial Ca(Mg,Al)(Si,Al)2O6, (ii) the reduction of Ti/Si-containing intermediate phases, (iii) the removal of impurity elements, and (iv) the formation of Ti5Si3, TiC, and Ti3SiC2. It is suggested that the SOM-based anode process has great potential to be used for the direct and facile preparation of Ti alloys and composites from cheap Ti-containing ores.

  17. XAFS Analysis of Local Structure around Ce in Ca3Sc2Si3O12:Ce Phosphor for White LEDs

    International Nuclear Information System (INIS)

    Akai, Toshio; Shigeiwa, Motoyuki; Okamoto, Kaoru; Shimomura, Yasuo; Kijima, Naoto; Honma, Tetsuo

    2007-01-01

    We have studied the local structure around Ce atom in Ca3Sc2Si3O12 host crystal, which has been developed as a new green phosphor for white light emitting diodes (LEDs). As the local structure and chemical environment of the dopant atom are very important to improve the performance of the phosphor, we have used XAFS to get chemical and structural information around the Ce dopant. The XANES spectrum of the Ce LIII-edge reveals that the Ce atom is trivalent in Ca3Sc2Si3O12. There are two kinds of possible Ce substitution sites, Ca site and Sc site, in garnet type Ca3Sc2Si3O12 crystal structure. The Ce atom is found to be at the Ca site in the host crystal by the comparison of the Fourier transform of Ce K-edge EXAFS spectrum with those of Ca and Sc K-edge EXAFS spectra. The theoretical analysis with FEFF also clarified the Ce substitution at the Ca site. Furthermore, the result of the analysis indicates the structural disorder around Ca and Si atoms at 3.75 A. It is possible that there are some defects around the Ca and Si atoms at 3.75 A to compensate the excess positive charge by introduced Ce3+ at the Ca2+ site

  18. Wetting induced by near-surface Ti-enrichment in the CaF2/In-Ti and CaF2/Cu-Ti systems

    International Nuclear Information System (INIS)

    Froumin, N.; Barzilai, S.; Aizenshtein, M.; Lomberg, M.; Frage, N.

    2008-01-01

    This paper is concerned with the wetting of CaF 2 by liquid Cu and In and with the effect of Ti additions to the melt. According to thermodynamic analysis and to the experimental observations, the significantly decreased contact angle following the addition of Ti to the molten metals is not due to the formation of interfacial fluoride phases, in contrast to previously reported results. Ab initio density functional calculations indicate that preferential Ti adsorption takes place at the near CaF 2 surface. It is suggested that the presence of a Ti-enriched liquid, adjacent to the substrate, gives rise, by means of heterogeneous nucleation, to the formation of a thin intermetallic compound layer that stands behind the experimentally observed enhanced wetting. The suggested wetting mechanism is supported by the notable correlation that has been observed between the temperature dependence of the contact angle and the temperature domains, associated with the presence of intermetallic compounds in both Me-Ti (Me = Cu, In) binary systems

  19. Investigating the local structure of B-site cations in (1-x)BaTiO3-xBiScO3 and (1-x)PbTiO3-xBiScO3 using X-ray absorption spectroscopy

    Science.gov (United States)

    Blanchard, Peter E. R.; Grosvenor, Andrew P.

    2018-05-01

    The structural properties of (1-x)BaTiO3-xBiScO3 and (1-x)PbTiO3-xBiScO3 were investigated using powder X-ray diffraction and X-ray absorption spectroscopy. Diffraction measurements confirmed that substituting small amounts of BiScO3 into BaTiO3 initially stabilizes a cubic phase at x = 0.2 before impurity phases begin to form at x = 0.5. BiScO3 substitution also resulted in noticeable changes in the local coordination environment of Ti4+. X-ray absorption near-edge spectroscopy (XANES) analysis showed that replacing Ti4+ with Sc3+ results in an increase in the off-centre displacement of Ti4+ cations. Surprisingly, BiScO3 substitution has no effect on the displacement of the Ti4+ cation in the (1-x)PbTiO3-xBiScO3 solid solution.

  20. Nuclear spectroscopy of Ca and Sc isotopes from inelastic scattering and one-nucleon transfer reactions on a radioactive 41Ca target

    International Nuclear Information System (INIS)

    Vold, P.

    1978-04-01

    The structure of energy levels in 40 , 42 Ca and 42 Sc has been studied using inelastic proton scattering and one-nucleon stripping and pick-up transfer reactions on a 41 Ca target. Data has given the following information on the properties of the 41 Ca ground state wave function; i) the 41 Ca (g.s.) looks very much like an f (sub7/2) neutron coupled to the 40 Ca (g.s.) core. ii) The core-excited component of the 41 Ca (g.s.) is determined to be 10 or less. It was inferred that the main constituents of the spectroscopic strength leading to the (f(sub7/2)) 2 , (f(sub7/2)p(sub3/2))(subt=1) and (f(sub7/2)p(sub1/2))(subT=1) configurations have been identified. This was used to deduce the effective two-particle matrix elements for these configurations. The 42 Sc and 42 Ca data result in excellent agreement for the T=1 members of the (f(sub7/2)) 2 multiplet while the (f(sub7/2)p(sub3/2))(subT=1) matrix elements derived from the 42 Sc data are about 0.2 MeV more repulsive than those obtained from the 42 Ca data. The (f(sub7/2)d(sub3/2) -1 ) matrix elements derived from the present ( 3 He,α) data were compared to the corresponding values obtained from one-nucleon stripping to mass 34 nuclei. The two sets of matrix elements are in very good agreement. The 40 Ca values are also well reproduced by calculations using the modified surface delta interaction. The experimental spectroscopic factors to both the T=0 and T=1 states of the (f(sub7/2)) 2 multiplet are in remarkably good agreement with the predicted values of the coexistence model considering the simplicity of this model. (JIW)

  1. Combined embedding of N-doping and CaCO{sub 3} surface modification in the TiO{sub 2} photoelectrodes for dye-sensitized solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Park, Su Kyung; Yun, Tae Kwan [Department of Chemistry, Keimyung University, Daegu 704-701 (Korea, Republic of); Bae, Jae Young, E-mail: jybae@kmu.ac.kr [Department of Chemistry, Keimyung University, Daegu 704-701 (Korea, Republic of); Won, Yong Sun, E-mail: yswon@pknu.ac.kr [Department of Chemical Engineering, Pukyong National University, Busan 608-739 (Korea, Republic of)

    2013-11-15

    A successive embedding of N-doping and CaCO{sub 3} surface modification was carried out in the TiO{sub 2} photoelectrodes for dye-sensitized solar cells (DSSCs). The combined effect was revealed with the great increase of the open-circuit voltage (V{sub oc}), short-circuit current (J{sub sc}), and photoelectric conversion efficiency (η) of the prepared cells; the efficiency (η) was improved from 5.42% of a commercial TiO{sub 2} photoelectrode to 7.47% of an unmodified N-doped electrode, and to 9.03% of a N-doped and CaCO{sub 3} surface modified electrode. An enhanced photoresponse in N-doped TiO{sub 2} nanoparticles generate more photo-excited electrons in adsorbed dye, as supported by measured UV–vis diffuse reflectance spectra and incident photon to current conversion efficiency (IPCE). A successive CaCO{sub 3} surface modification then form a barrier on the surface of N-doped TiO{sub 2} particles, suppressing charge recombination of photo-generated electrons from N-doped TiO{sub 2} to dye or electrolyte, and thus extending their life time in the electrode, as supported by electron impedance spectroscopy (EIS). Furthermore, the higher basicity of the CaCO{sub 3} modified TiO{sub 2} facilitates the dye adsorption, as supported by the direct measurement of the amount of adsorbed dye.

  2. Chemical solution deposition of CaCu3Ti4O12 thin film

    Indian Academy of Sciences (India)

    Administrator

    CaCu3Ti4O12; thin film; chemical solution deposition; dielectric properties. 1. Introduction. The CaCu3Ti4O12. (CCTO) compound has recently attracted considerable ... and Kelvin probe force microscopy (Chung et al 2004). Intrinsic .... SEM images of CCTO thin films as a function of sintering temperature. silicon based ...

  3. Synthesis of CaTiO 3 from calcium titanyl oxalate hexahydrate (CTO)

    Indian Academy of Sciences (India)

    Calcium titanate, CaTiO3, an important microwave dielectric material and one of major phases in synroc (synthetic rock), a titanate ceramic with potential application for fixation of high level nuclear waste was synthesized from calcium titanyl oxalate [CaTiO (C2O4)2.6H2O] (CTO) by employing microwave heating technique.

  4. Isothermal cross-sections of Hf-Sc-Ga(800 deg C) and Hf-Ti-Ga (750 deg C) phase diagrams

    International Nuclear Information System (INIS)

    Markiv, V.Ya.; Belyavina, N.N.

    1981-01-01

    Isothermal cross sections of Hf-Sc-Ga (800 deg C) and Hf-Ti-Ga (750 deg C) state diagrams are plotted. The existence of two ternary Hfsub(0.1-0.8)Scsub(0.9)-sub(0.2)Ga and Hfsub(0.8)Scsub(0.2)Gasub(3) phases is stated in the Hf-Sc-Ga system. The crystal structure of these compounds investigated by the powder method belongs to the structural α-MoB and ZrAl 3 types respectively. Continuous rows of (Hf, Sc 5 Ga 5 , (Hf, Ti)Ga 3 and (Hf, Ti)Ga 2 solid solutions are formed in the investigated systems. Essential quantity of the third component dissolve binary Sc 5 Ga 4 , Sc 2 Ga 3 (15 and 30 at % Hf respectively), Hf 5 Ga 4 , HfGa 2 (20, 10 at. % Sc), Hf 5 Ga 4 , HfGa, Hf 5 Ga 3 , Hf 2 Ga 3 (48, 30, 46, 20 at. % Ti) gallides [ru

  5. New Ce{sup 3+} doped Ca{sub 2}YMgScSi{sub 3}O{sub 12} garnet ceramic phosphor for white LED converters

    Energy Technology Data Exchange (ETDEWEB)

    Khaidukov, N. [Kurnakov Institute of General and Inorganic Chemistry, Russian Academy of Sciences, Moscow (Russian Federation); Zorenko, Yu.; Zorenko, T.; Iskaliyeva, A.; Paprocki, K. [Institute of Physics, Kazimierz Wielki University Bydgoszcz (Poland); Zhydachevskii, Y.; Suchocki, A. [Institute of Physics, Polish Academy of Sciences, Warsaw (Poland); Deun, R. van [L3 - Luminescent Lanthanide Lab, Department of Inorganic and Physical Chemistry, Ghent University (Belgium); Batentschuk, M. [Department of Materials Science and Engineering VI, Institute of Materials for Energy and Electronic Technology (i-IMEET), University of Erlangen-Nuremberg, Erlangen (Germany)

    2017-05-15

    The results on crystallization and investigation of the luminescent properties of a new prospective ceramic phosphor based on the Ce{sup 3+} doped Ca{sub 2}YMgScSi{sub 3}O{sub 12} silicate garnet are presented for the first time in this work. The luminescent properties of Ca{sub 2}YMgScSi{sub 3}O{sub 12}:Ce were compared with the properties of the reference Ca{sub 3}Sc{sub 2}Si{sub 3}O{sub 12}:Ce ceramic sample. Without any doubt, the results of this research can be suitable for the development of a new generation of white converters based on the Ca{sup 2+}-Si{sup 4+} garnet compounds. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. Theoretical study of isoelectronic SinM clusters (M=Sc-,Ti,V+; n=14-18)

    DEFF Research Database (Denmark)

    Torres, M. B.; Fernandez Sanchez, Eva; Balbás, L. C.

    2007-01-01

    We study, from first-principles quantum mechanical calculations, the structural and electronic properties of several low-lying energy equilibrium structures of isoelectronic SinM clusters (M=Sc-,Ti,V+) for n=14-18. The main result is that those clusters with n=16 are more stable than its neighbors...... of the spherical potential model). The structures of the two lowest energy isomers of Si16M are nearly degenerate, and consist of the Frank-Kasper polyhedron and a distortion of that polyhedron. The first structure is the ground state for M=V+, and the second is the ground state for Ti and Sc-. For the lowest...... energy isomers of clusters SinM with n=14-18, we analyze the changes with size n, and impurity M of several quantities: binding energy, second difference of total energy, HOMO-LUMO gap, adiabatic electron affinity, addition energy of a Si atom, and addition energy of an M impurity to a pure Si-n cluster...

  7. Effect of Ti/Sc atom ratio on heterogeneous nuclei, microstructure and mechanical properties of A357-0.033Sr alloys

    Energy Technology Data Exchange (ETDEWEB)

    Shen, Xiaocen [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300072 (China); Zhao, Naiqin, E-mail: nqzhao@tju.edu.cn [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineering, Tianjin 300072 (China); Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, Tianjin University, Tianjin, 300072 (China); Li, Jiajun [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300072 (China); He, Chunnian, E-mail: cnhe08@tju.edu.cn [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineering, Tianjin 300072 (China); Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, Tianjin University, Tianjin, 300072 (China); Shi, Chunsheng [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300072 (China); Liu, Enzuo [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineering, Tianjin 300072 (China); He, Fang; Ma, Liying; Li, Qunying [School of Materials Science and Engineering and Tianjin Key Laboratory of Composites and Functional Materials, Tianjin University, Tianjin 300072 (China)

    2016-08-01

    A systematic study on heterogeneous nucleation, microstructure and mechanical properties of A357-0.033Sr alloys with different Ti/Sc atom ratio was carried out. According to the obtained results, a Ti/Sc atom ratio up to 1:1 did not show much change in the heterogeneous nuclei but at a higher atom ratio level, heterogeneous nuclei have a great change in chemical composition and morphology (from strip Ti-rich phase to the particle-like Ti-rich phase). In addition, compared to the other four alloys studied, the A357-0.033Sr-0.30Sc-0.35Ti alloy with 1:1 atom ratio has the smallest grain size (88 µm), optimum microstructure (morphology, size and distribution of eutectic Si), densest core-shell Al{sub 3}(Sc, Ti), all of which result in the best mechanical properties. Its tensile strength and elongation reach 287 MPa and 3.62% respectively, showing about 11% and 84% increases compared with A357-0.033Sr alloy.

  8. Synthesis and photoluminescence of Ca-(Sn,Ti)-Si-O compounds

    International Nuclear Information System (INIS)

    Abe, Shunsuke; Yamane, Hisanori; Yoshida, Hisashi

    2010-01-01

    The phase relation of the compounds prepared in the CaO-SnO 2 -SiO 2 system at 1673 K and in the CaO-TiO 2 -SiO 2 system at 1573 K was investigated in order to explore new Ti 4+ -activated stannate phosphors. Solid solutions of Ca(Sn 1-x Ti x )SiO 5 and Ca 3 (Sn 1-y Ti y )Si 2 O 9 were synthesized at x = 0-1.0 and y = 0-0.10, respectively, and their crystal structures were analyzed by powder X-ray diffraction. Photoluminescence of these solid solutions was observed in a broad range of a visible light wavelength region under ultraviolet (UV) light excitation. The peaks of the emission band of Ca(Sn 0.97 Ti 0.03 )SiO 5 and Ca 3 (Sn 0.925 Ti 0.075 )Si 2 O 9 were at 510 nm under excitation of 252 nm and at 534 nm under excitation of 258 nm, respectively. The absorption edges estimated by the diffuse reflectance spectra were at 300 nm (4.1 eV) for CaSnSiO 5 and at 270 nm (4.6 eV) for Ca 3 SnSi 2 O 9 , suggesting that the excitation levels in Ca(Sn 1-x Ti x )SiO 5 were above the band gap of the host, although the levels in Ca 3 (Sn 1-y Ti y )Si 2 O 9 were within the band gap and near the conduction band edge.

  9. Canted ferrimagnetism in Ca2+Sc3+ substituted yttrium-iron-garnet

    Science.gov (United States)

    Pardavi-Horváth, M.; Thavendrarajah, A.; Wigen, P. E.; DeGasperis, P.

    1988-11-01

    The temperature dependence of the magnetization of Y3-y-zCayLuzFe5-xScxO12 (0.6≤x≤1.2, 0≤y≤0.3, 0≤z≤0.9) epitaxial garnet films was measured from 4.2 K up to the Curie temperature. For x=0.7 and T≥50 K, 4πMs is enhanced by about 10% compared to the magnetization of Sc0.7 YIG. At TJdd/Jad)/da =28 nm.-1 For x=1.2 and T<10 K the magnetization can be influenced by cooling through the Curie point in a magnetic field.

  10. The monoclinic superstructure of the M2Pt6Al15 series (M=Ca, Sc, Y, La, Lu)

    International Nuclear Information System (INIS)

    Radzieowski, Mathis; Stegemann, Frank; Hoffmann, Rolf-Dieter; Janka, Oliver; Oldenburg Univ.

    2017-01-01

    The five ternary intermetallic compounds M 2 Pt 6 Al 15 (M=Ca, Sc, Y, La, Lu) were prepared from the elements by arc-melting. The crystal structure was determined via single crystal X-ray diffraction. The title compounds crystallize in a superstructure of the RE 0.67 Pt 2 Al 5 type structure (P6 3 /mmc) in the monoclinic crystal system with space group P12 1 /m1 (Sc 2 Pt 6 Al 15 : a=734.19(2), b=1628.96(10), c=734.19(2) pm, β=119.999(3) ; wR=0.0356, 3034 F 2 values, 68 variables). The superstructure can be derived by the superspace formalism using (3+2)D or (3+1)D interpretations of the diffraction data. The structural relation to the subcell structure is discussed on the basis of a group-subgroup scheme. In the crystal structure strongly bonded [Pt 2 Al 4 ] δ- slabs are alternatingly stacked with ordered layers containing M atoms and Al 3 triangles.

  11. SSC type NbTi superconductor research program at Teledyne SC

    International Nuclear Information System (INIS)

    Kallsen, J.F.; McDonald, W.K.; Geno, J.D.; O'Larey, P.M.; Siddall, M.B.

    1991-01-01

    In an on-going research effort at Teledyne SC, several multifilament niobium titanium composite billets have been fabricated and processed to make SSC type wire. Critical current densities of 3000 A/mm 2 ± 5% and 2950 A/mm 2 ± 5% (5 T, 4.2 K, 10 -14 ohm-m) have been achieved in wires containing 6.5 and 4.8 micron diameter filaments respectively. This paper addresses piece length and cable-able characteristics

  12. Photocatalytic activity of Fe-doped CaTiO₃ under UV-visible light.

    Science.gov (United States)

    Yang, He; Han, Chong; Xue, Xiangxin

    2014-07-01

    The photocatalytic degradation of methylene blue (MB) over Fe-doped CaTiO₃ under UV-visible light was investigated. The as-prepared samples were characterized using X-ray diffraction (XRD), scanning electron microscope (SEM) equipped with an energy dispersive spectrometer (EDS) system, Fourier transform infrared spectra (FT-IR), and UV-visible diffuse reflectance spectroscopy (DRS). The results show that the doping with Fe significantly promoted the light absorption ability of CaTiO₃ in the visible light region. The Fe-doped CaTiO₃ exhibited higher photocatalytic activity than CaTiO₃ for the degradation of MB. However, the photocatalytic activity of the Fe-doped CaTiO₃ was greatly influenced by the calcination temperature during the preparation process. The Fe-doped CaTiO₃ prepared at 500°C exhibited the best photocatalytic activity, with degradation of almost 100% MB (10ppm) under UV-visible light for 180 min. Copyright © 2014. Published by Elsevier B.V.

  13. CORRELATION OF {sup 48}Ca, {sup 50}Ti, AND {sup 138}La HETEROGENEITY IN THE ALLENDE REFRACTORY INCLUSIONS

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang, E-mail: hart.chen@bristol.ac.uk [Institute of Earth Sciences, Academia Sinica, Taipei, Taiwan, ROC (China)

    2015-06-10

    Precise determinations of {sup 48}Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive {sup 48}Ca/{sup 44}Ca anomalies in all analyzed CAIs after normalization to {sup 42}Ca/{sup 44}Ca, and it is clearly shown that there is no simple correlation between {sup 48}Ca/{sup 44}Ca and {sup 50}Ti/{sup 48}Ti anomalies, in agreement with Jungck et al. Compared to the {sup 48}Ca/{sup 44}Ca versus {sup 50}Ti/{sup 48}Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated {sup 50}Ti/{sup 48}Ti. Assuming the {sup 48}Ca/{sup 44}Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess {sup 50}Ti anomalies in CAIs can be calculated by subtracting the part associated with {sup 48}Ca/{sup 44}Ca. These excesses show a linear correlation with {sup 138}La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system {sup 48}Ca, {sup 50}Ti, and {sup 138}La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II.

  14. Magnetic ground state of Ti{sub 1-x}Sc{sub x}Fe{sub 2} system

    Energy Technology Data Exchange (ETDEWEB)

    Saoudi, M.; Deportes, J.; Ouladdiaf, B. E-mail: ouladdiaf@ill.fr

    2001-06-01

    The magnetic ground states of the Laves phases Ti{sub 1-x}Sc{sub x}Fe{sub 2} system have been investigated by means of powder neutron diffraction and magnetisation techniques. For x=0.23, a transition is observed from a collinear ferromagnet along the c-axis to a canted one at T{sub f}=200 K. For x=0.27, 0.3, 0.33, an additional first-order transition is observed at T{sub t1}{approx}120 K accompanied by a large magnetovolume anomaly associated to a jump of the magnetic moment of the Fe atoms at the 2a site. The magnetic moment instability in a frustrated lattice should be considered to interpret this transition, although most of the other magnetic states can be discussed within Moriya's theory for itinerant electron systems with competing ferromagnetic and antiferromagnetic spin fluctuations.

  15. Construction of monoenergetic neutron calibration fields using 45Sc(p, n)45Ti reaction at JAEA.

    Science.gov (United States)

    Tanimura, Y; Saegusa, J; Shikaze, Y; Tsutsumi, M; Shimizu, S; Yoshizawa, M

    2007-01-01

    The 8 and 27 keV monoenergetic neutron calibration fields have been developed by using (45)Sc(p, n)(45)Ti reaction. Protons from a 4-MV Pelletron accelerator are used to bombard a thin scandium target evaporated onto a platinum disc. The proton energies are finely adjusted to the resonance to generate the 8 and 27 keV neutrons by applying a high voltage to the target assemblies. The neutron energies were measured using the time-of-flight method with a lithium glass scintillation detector. The neutron fluences at a calibration point located at 50 cm from the target were evaluated using Bonner spheres. A long counter was placed at 2.2 m from the target and at 60 degrees to the direction of the proton beam in order to monitor the fluence at the calibration point. Fluence and dose equivalent rates at the calibration point are sufficient to calibrate many types of the neutron survey metres.

  16. Wear Behavior of Cold Pressed and Sintered Al2O3/TiC/CaF2Al2O3/TiC Laminated Ceramic Composite

    Institute of Scientific and Technical Information of China (English)

    Xuefeng YANG; Jian CHENG; Peilong SONG; Shouren WANG; Liying YANG; Yanjun WANG; Ken MAO

    2013-01-01

    A novel laminated Al2O3/TiC/CaF2-Al2O3/TiC sandwich ceramic composite was fabricated through cold pressing and sintering to achieve better anti-wear performance,such as low friction coefficient and low wear rate.Al2O3/TiC/CaF2 and Al2O3/TiC composites were alternatively built layer-by-layer to obtain a sandwich structure.Solid lubricant CaF2 was added evenly into the Al2O3/TiC/CaF2 layer to reduce the friction and wear.Al2O3/TiC ceramic was also cold pressed and sintered for comparison.Friction analysis of the two ceramics was then conducted via a wear-and-tear machine.Worn surface and surface compositions were examined by scanning electron microscopy and energy dispersion spectrum,respectively.Results showed that the laminated Al2O3/TiC/CaF2-Al2O3/TiC sandwich ceramic composite has lower friction coefficient and lower wear rate than those of Al2O3/TiC ceramic alone because of the addition of CaF2 into the laminated Al2O3/TiC/CaF2-Al2O3/TiC sandwich ceramic composite.Under the friction load,the tiny CaF2 particles were scraped from the Al2O3/TiC/CaF2 layer and spread on friction pairs before falling off into micropits.This process formed a smooth,self-lubricating film,which led to better anti-wear properties.Adhesive wear is the main wear mechanism of Al2O3/TiC/CaF2 layer and abrasive wear is the main wear mechanism of Al2O3/TiC layer.

  17. Adsorption effect in non-reaction wetting: In-Ti on CaF2

    International Nuclear Information System (INIS)

    Glickman, E.; Fuks, D.; Frage, N.; Barzilai, S.; Froumin, N.

    2012-01-01

    The experiments show that the alloying liquid In with only (0.1-0.5) at% Ti dramatically reduces the equilibrium contact angle Θ ∞ formed by In on the surface of CaF 2 . The aim of this paper is to clarify whether this practically important and conceptually challenging effect can be explained solely by Ti adsorption at the F-terminated solid-liquid interface without resorting to any other Ti-induced effect. The combination of ab initio calculations and regular solution approximation was proposed for finding the binding energy, ΔE Ti of Ti adatom with the interface ''CaF 2 /liquid solutions In-Ti.'' With thus obtained ΔE Ti =1.16 eV, we calculated from the Shishkovsky isotherm the reduction in the solid-liquid interface energy, Δγ SL induced by Ti adsorption from liquid In with various Ti concentration, C. It was found that Δγ SL (C) dependence demonstrated close inverse correspondence with Θ ∞ (C) and that the theory fitted very well all available experimental data on the concentration and temperature dependence of Δγ SL . It was concluded that the Ti adsorption effect is large enough to account for the observed wetting improvement. The proposed multiscale modeling approach to the role of adsorption in wetting can be applied also to other nonreactive systems ''liquid metal-ceramics'' where the substrate determines the surface density of the adsorption sites for the active element. (orig.)

  18. Light up conversion effects in Erbium doped CaBi4Ti4O15 ceramics

    International Nuclear Information System (INIS)

    Bokolia, Renuka; Sreenivas, K.

    2013-01-01

    In recent years the rare earth doped bismuth layered structured ferroelectric (BLSF) compositions such as CaBi 4 Ti 4 O 15 , SrBi 4 Ti 4 O 15 and BaBi 4 Ti 4 O 15 ceramics have shown interesting light up-conversion emission effects. The observation of such novel effects has generated a lot of scientific interest, and there is a need to further improve their dielectric, piezoelectric and light up-conversion properties. In the present study, Erbium doped CaBi 4 Ti 4 O 15 (CBT), and SrBi 4 Ti 4 O 15 (SBT) ferroelectric ceramic have been prepared by the conventional solid state reaction method. Formation of single phase material is confirmed by X-Ray Diffraction (XRD), and changes occurring in the lattice parameters with Erbium dopant are analysed. Room temperature dielectric studies and ferroelectric studies will be discussed. (author)

  19. Synthesis of anatase nanoparticles with extremely wide solid solution range and ScTiNbO6 with α-PbO2 structure

    International Nuclear Information System (INIS)

    Hirano, Masanori; Ito, Takaharu

    2009-01-01

    Anatase-type nanoparticles Sc X Ti 1-2X Nb X O 2 with wide solid solution range (X=0-0.35) were hydrothermally formed at 180 deg. C for 5 h. The lattice parameters a 0 and c 0 , and the optical band gap of anatase gradually and linearly increased with the increase of the content of niobium and scandium from X=0 to 0.35. Their photocatalytic activity and adsorptivity by the measurement of the concentration of methylene blue (MB) that remained in the solution in the dark or under UV-light irradiation were evaluated. The anatase phase existed stably up to 900 deg. C for the samples with X=0.25-0.30 and 750 deg. C for that with X=0.35 during heat treatment in air. The phase with α-PbO 2 structure and the rutile phases coexisted in the samples with X=0.25-0.30 after heated at temperatures above 900-950 deg. C. The α-PbO 2 structure having composition ScTiNbO 6 with possibly some cation order similar to that seen in wolframite existed as almost completely single phase after heat treatment at temperatures 900-1500 deg. C through phase transformation from anatase-type ScTiNbO 6 . - Graphical abstract: Anatase-type Sc X Ti 1-2X Nb X O 2 solid solutions with wide solid solution range (X=0-0.35) were hydrothermally formed as nanoparticles from the precursor solutions of Sc(NO 3 ) 3 , TiOSO 4 , NbCl 5 at 180 deg. C for 5 h using the hydrolysis of urea. Anatase-type ScTiNbO 6 was synthesized under hydrothermal condition. ScTiNbO 6 having α-PbO 2 structure with possibly some cation order similar to that seen in wolframite was formed through phase transformation above 900 deg. C.

  20. Inclusion Modification by Al Deoxidation and Ca Treatment in Ti Containing 18%Cr Stainless Steel Melts

    International Nuclear Information System (INIS)

    Kim, Kyung-Ho; Do, Kyung-Hyo; Choi, Won-Jin; Kim, Dong-Sic; Pak, Jong-Jin; Lee, Sang-Beum

    2013-01-01

    Titanium is added to ferritic stainless steels in the range of 0.2-0.3 wt% to improve corrosion resistance and mechanical properties. However, titanium is very reactive with oxygen in liquid steel, and it can cause an unstable Ti yield. Therefore, titanium is generally added after the aluminum deoxidation process in the ladle. However, the inclusions formed by Al-Ti deoxidation can cause nozzle clogging and various defects in final products. Calcium injection can be carried out to resolve these problems. In this study, two different deoxidation patterns of Al→Ti and Al→Ti→Ca additions were carried out in Fe-18%Cr ferritic stainless steel melt at 1873 K. The melt composition and the inclusion morphology changes during the deoxidation process were investigated. With Al→Ti addition, the Al_2O_3 inclusions changed to dual phase Al_2O_3-TiO_X inclusions with time by the reaction with Ti in the melt. The morphology of the inclusions in the melt finally changed to a polygonal type indicating that the inclusions were solid phase. The size and number of inclusions in the melt did not change with time after Ti addition. With of Al→Ti→Ca addition, Ca reacted with Al_2O_3-TiO_X inclusions to form liquid CaOAl_2O_3 inclusions embedded with solid CaTiO_3 particles. The morphology of the inclusions in the melt were observed to be spherical and polygonal. The size of inclusions in the melt increased and the number of inclusions decreased by the coalescence of liquid inclusions.

  1. First-principles study of (Ba ,Ca ) TiO3 and Ba (Ti ,Zr ) O3 solid solutions

    Science.gov (United States)

    Amoroso, Danila; Cano, Andrés; Ghosez, Philippe

    2018-05-01

    (Ba ,Ca ) TiO3 and Ba (Ti ,Zr ) O3 solid solutions are the building blocks of lead-free piezoelectric materials that attract a renewed interest. We investigate the properties of these systems by means of first-principles calculations, with a focus on the lattice dynamics and the competition between different ferroelectric phases. We first analyze the four parent compounds in order to compare their properties and their different tendency towards ferroelectricity. The core of our study is systematic characterization of the binary systems (Ba ,Ca ) TiO3 and Ba (Ti ,Zr ) O3 within both the virtual crystal approximation and direct supercell calculations. In the case of Ca doping, we find a gradual transformation from B -site to A -site ferroelectricity due to steric effects that largely determines the behavior of the system. In the case of Zr doping, in contrast, the behavior is eventually dominated by cooperative Zr-Ti motions and the local electrostatics. In addition, our comparative study reveals that the specific microscopic physics of these solids sets severe limits to the applicability of the virtual crystal approximation for these systems.

  2. Study on the isospin equilibration phenomenon in nuclear reactions 40Ca + 40Ca , 40Ca + 46Ti , 40Ca + 48Ca , 48Ca + 48Ca at 25 MeV/nucleon by using the CHIMERA multidetector

    Science.gov (United States)

    Martorana, N. S.; Auditore, L.; Berceanu, I.; Cardella, G.; Chatterjee, M. B.; De Luca, S.; De Filippo, E.; Dell'Aquila, D.; Gnoffo, B.; Lanzalone, G.; Lombardo, I.; Maiolino, C.; Norella, S.; Pagano, A.; Pagano, E. V.; Papa, M.; Pirrone, S.; Politi, G.; Porto, F.; Quattrocchi, L.; Rizzo, F.; Russotto, P.; Trifirò, A.; Trimarchi, M.; Verde, G.; Vigilante, M.

    2017-11-01

    We report on the results obtained by studying nuclear reactions between isotopes of Ca and Ti at 25 MeV/nucleon. We used the multidetector CHIMERA to detect charged reaction products. In particular, we studied two main effects: the isospin diffusion and the isospin drift. In order to study these processes we performed a moving-source analysis on kinetic energy spectra of the isobar nuclei ^{3H} and ^{3He} . This method allows to isolate the emission from the typical sources produced in reactions at Fermi energy: projectile like fragment (PLF), target like fragment (TLF), and mid-velocity (MV) emission. The obtained results are compared to previous experimental investigations and to simulations obtained with CoMD-II model.

  3. Consequences of Ca multisite occupation for the conducting properties of BaTiO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Zulueta, Y.A., E-mail: yohandysalexis.zuluetaleyva@student.kuleuven.be [Departamento de Física, Facultad de Ciencias Naturales, Universidad de Oriente, CP-90500 Santiago de Cuba (Cuba); Department of Chemistry, KU Leuven, B-3001 Leuven (Belgium); Dawson, J.A. [Department of Engineering, University of Cambridge, Cambridge CB2 1PZ (United Kingdom); Leyet, Y. [Departamento de Engenharia de Materiais, Universidade Federal do Amazonas, Av. General Rodrigo Otávio, 6200 – Coroado I, 69077-000 Manaus (Brazil); Departamento de Física, Universidade Federal do Amazonas, Av. General Rodrigo Otávio, 6200 – Coroado I, 69077-000 Manaus, Amazonas (Brazil); Anglada-Rivera, J. [Instituto Federal de Educação Ciência e Tecnologia do Amazonas, Av. 7de Setembro, 1975, 69020-120 Manaus (Brazil); Guerrero, F. [Departamento de Física, Universidade Federal do Amazonas, Av. General Rodrigo Otávio, 6200 – Coroado I, 69077-000 Manaus, Amazonas (Brazil); Silva, R.S. [Departamento de Física, Universidade Federal de Sergipe, 49100-000 São Cristóvão, SE (Brazil); Nguyen, Minh Tho [Department of Chemistry, KU Leuven, B-3001 Leuven (Belgium)

    2016-11-15

    In combination with the dielectric modulus formalism and theoretical calculations, a newly developed defect incorporation mode, which is a combination of the standard A- and B-site doping mechanisms, is used to explain the conducting properties in 5 mol% Ca-doped BaTiO{sub 3}. Simulation results for Ca solution energies in the BaTiO{sub 3} lattice show that the new oxygen vacancy inducing mixed mode exhibits low defect energies. A reduction in dc conductivity compared with undoped BaTiO{sub 3} is witnessed for the incorporation of Ca. The conducting properties of 5 mol% Ca-doped BaTiO{sub 3} are analyzed using molecular dynamics and impedance spectroscopy. The ionic conductivity activation energies for each incorporation mode are calculated and good agreement with experimental data for oxygen migration is observed. The likely existence of the proposed defect configuration is also analyzed on the basis of these methods. - Graphical abstract: Oxygen vacancy formation as a result of self-compensation in Ca-doped BaTiO{sub 3}.

  4. Preparation of CaTiO3 Asymmetric Membranes Using Polyetherimide as Binder Polymer

    Directory of Open Access Journals (Sweden)

    Endang Purwanti Setyaningsih

    2016-03-01

    Full Text Available Asymmetric dense and thin membranes have been prepared from powders of perovskite oxide-type CaTiO3 without cracking by phase inversion method. Polyetherimide was used as a polymeric binder in the method. The resulting green membranes, composed of CaTiO3 powder and polyetherimide binder, were sintered at 890, 1100 or 1200 °C. The crystal phase of CaTiO3 was analyzed using X-Ray Diffraction (XRD. The XRD pattern of the synthesized CaTiO3 powder was matched with the reference indicating the formation of CaTiO3 structure. Sintering at 890 °C fails to form a strong membrane. Scanning Electron Microscope (SEM images of the membranes showed that the membrane had the asymmetric structure with dense layer on one side and porous layer on the other side. The pores in the porous layer were both finger-like and sponge-like structure. The mechanical strength of the membranes, which were determined by Vickers micro hardness method, varied from 3.5 to 25.8 Hv. The strongest membrane without any crack was resulted from sintering at 1200°C with hardness values between 19.4 and 25.8 Hv. Thermal expansion coefficients of the asymmetric membranes sintered at 1100 and 1200 °C, measured with Thermomechanical Analyzer (TMA, were 10.82 × 10-6 and 12.78 × 10-6.C-1 respectively.

  5. Electrical and microstructural properties of CaTiO3-doped K1/2Na1 ...

    Indian Academy of Sciences (India)

    KNN) and CaTiO3- modified K1/2Na1/2NbO3 (CTO-KNN) systems, were investigated. Discs doped with 0 to 0.55% mol of CaTiO3 (CTO) were sintered at 1125°C for 2 h. Although minority phases were found in doped samples, CaTiO3 was not ...

  6. Subsolidus Phase Relations of the CaO-REOx-CuO Systems (RE = Eu, Tb, Dy, Ho, Er, Lu and Sc) at 900 °C in Air

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude

    2016-01-01

    The subsolidus phase relations of the CaO-REOx-CuO systems (RE = Eu, Tb, Dy, Ho, Er, Lu and Sc) were investigated in air at 900 °C. The pseudo-ternary sections with RE = Tb, Dy, Ho, Er and Lu have a similar structure. They have in common with the RE = Eu system a solid solution of Ca0.833−xRExCuO2......+y composition but the system with RE = Eu differs by the presence of an Eu2CuO4 phase instead of RE2Cu2O5 for RE = Tb, Dy, Ho, Er and Lu. In contrast, the CaO-ScO1.5-CuO section does not contain a Ca0.833−xScxCuO2+y solid solution and is dominated by the CaSc2O4 phase, which has no equivalent...... in the other systems at 900 °C in air....

  7. Sol–gel synthesis and photoluminescence of CaTi1–x Zrx O3: Pr 3 ...

    Indian Academy of Sciences (India)

    The strongest red excitation obtained from CaTi1–ZrO3 : Pr3+ ( = 4/300) and CaTi1–ZrO3 : Pr3+ ( = 5/300) possesses the strongest emission at 610 nm, similar to the intensities of Ca(Ti1–Zr)O3 : Pr3+ ( = 3/300, 4/300, 6/300), which may be corresponded to the cell parameters of CaTi1–ZrO3 : Pr3+.

  8. Growth of Araucaria angustifolia in the Embrapa/Epagri forest reserve, Caçador, SC, Brazil Crescimento de Araucaria angustifolia na Reserva Florestal Embrapa/ Epagri, Caçador, SC

    Directory of Open Access Journals (Sweden)

    Patricia Póvoa de Mattos

    2010-06-01

    Full Text Available Araucaria Forest is one of most threatened phyto-physiognomies in the Atlantic Forest domain,
    presenting great ecological-economical importance. Nevertheless, there are still lacks of knowledge concerning growth and dynamic of important species, as Araucaria angustifolia. The objective of this work was to recover  the past growth of Araucaria angustifolia, native from Caçador, SC, Brazil, by measuring growth rings and to estimate the average periodic diametric increment. The growth rings were counted and measured, using a stereoscope microscope, in increment cores of 0.5 cm collected from 32 adult trees. The measurements were done with LINTAB measuring table, with 0.01 mm of precision. The samples sizes were irregular, varying from 4.2 to 20.2 cm long. The trees presented average diameter breast height (DBH of 76.3 cm, varying from 10.7 to 141.3 cm. The periodic diameter increment from the last 10 years was 0.4 cm, varying from 0.11 to 1.15 cm. It was observed differences among trees, but there was a tendency of reduction of growth rhythm in larger trees, being more
    evident in trees with more than 110 cm of DBH.A Floresta Ombrófila Mista (FOM é uma das fitofisionomias mais ameaçadas da área de domínio da
    Mata Atlântica, apresentando grande importância ecológico-econômica. Apesar disso, ainda existem lacunas de conhecimento sobre a produtividade primária, o crescimento e a dinâmica de espécies importantes, como a Araucaria angustifolia. O presente trabalho tem por objetivo estudar o crescimento anual de Araucaria angustifolia, nativa do Município de Caçador, SC, pela medição dos anéis de crescimento. A contagem e medição dos anéis de crescimento foram feitas com o auxílio de um microscópio estereoscópico, em baguetas de 0,5 cm de diâmetro, coletadas de 32 árvores adultas. As medições foram feitas com o medidor de anéis de crescimento LINTAB, com precisão de 0,01 mm. O comprimento das amostras

  9. Combustion synthesis of CaSc{sub 2}O{sub 4}:Ce{sup 3+} nano-phosphors in a closed system

    Energy Technology Data Exchange (ETDEWEB)

    Peng Wenfang; Zou Shaoyu; Liu Guanxi; Xiao Quanlan; Zhang Rui; Xie Lijuan; Cao Liwei [Department of Chemistry, Jinan University, Guangzhou 510632 (China); Meng Jianxin, E-mail: tmjx@jnu.edu.cn [Institute of Nano-Chemistry, Jinan University, Guangzhou 510632 (China); Liu Yingliang [Institute of Nano-Chemistry, Jinan University, Guangzhou 510632 (China)

    2011-06-09

    Highlights: > CaSc{sub 2}O{sub 4}:Ce{sup 3+} nano-phosphors can be prepared by a single-step combustion method. > The ignition temperature is the lowest in the combustion synthesis of Ce{sup 3+}/Eu{sup 2+} doped phosphors. > The as-prepared nano-phosphors give a uniform particle size in the range of 15-20 nm and have highly dispersity and fluorescence intensity. > It is a convenient method for preparation of monodispersed oxide nano-phosphors, especially those being sensitive to air at high temperature. - Abstract: The CaSc{sub 2}O{sub 4}:Ce{sup 3+} nano-phosphors were successfully prepared by a single-step combustion method at an ignition temperature as low as 200 deg. C in a closed autoclave using glycine as a fuel and PEG4000 as a dispersant. The samples were characterized by X-ray diffraction (XRD), photoluminescence (PL) spectroscopy, scanning electron microscopy (SEM) and transmission electron microscope (TEM). The results revealed that CaSc{sub 2}O{sub 4}:Ce{sup 3+} nano-phosphors can be conveniently prepared at an ignition temperature as low as 200 deg. C, which was much lower than that in the ordinary combustion methods. The optimized ignition temperature was 220 deg. C. The CaSc{sub 2}O{sub 4}:Ce{sup 3+} nano-phosphors give a uniform particle size in the range of 15-20 nm. The low ignition temperature and the addition of PEG4000 dispersant play important roles in the formation of small sized nanoparticles. The as-prepared nano-phosphors were incompact aggregates, but highly dispersed nano-phosphors can be obtained after further ultrasonic treatment. The CaSc{sub 2}O{sub 4}:Ce{sup 3+} nano-phosphors give satisfactory luminescence characteristic benefiting from the closed circumstance, in which cerium atoms can be isolated from the oxidizing atmosphere and non-fluorescent Ce{sup 4+} ions can be ruled out. The present highly dispersed CaSc{sub 2}O{sub 4}:Ce{sup 3+} nano-phosphors with efficient fluorescence are promising in the field of biological labeling

  10. Vacancy induced metallicity at the CaHfO3/SrTiO3 interface

    KAUST Repository

    Nazir, Safdar; Pulikkotil, J. J.; Schwingenschlö gl, Udo; Singh, Nirpendra

    2011-01-01

    Density functional theory is used to study the electronic properties of the oxide heterointerfaceCaHfO3/SrTiO3. Structural relaxation is carried out with and without O vacancies. As compared to related interfaces, strongly reduced octahedral distortions are found. Stoichiometric interfaces between the wide band gap insulatorsCaHfO3 and SrTiO3 turn out to exhibit an insulating state. However, interface metallicity is introduced by O vacancies, in agreement with experiment. The reduced octahedral distortions and necessity of O deficiency indicate a less complicated mechanism for the creation of the interfacial electron gas.

  11. Vacancy induced metallicity at the CaHfO3/SrTiO3 interface

    KAUST Repository

    Nazir, Safdar

    2011-03-31

    Density functional theory is used to study the electronic properties of the oxide heterointerfaceCaHfO3/SrTiO3. Structural relaxation is carried out with and without O vacancies. As compared to related interfaces, strongly reduced octahedral distortions are found. Stoichiometric interfaces between the wide band gap insulatorsCaHfO3 and SrTiO3 turn out to exhibit an insulating state. However, interface metallicity is introduced by O vacancies, in agreement with experiment. The reduced octahedral distortions and necessity of O deficiency indicate a less complicated mechanism for the creation of the interfacial electron gas.

  12. Study of the supernova nucleosynthesis 40Ca(α,γ)44Ti reaction: progress report

    International Nuclear Information System (INIS)

    Nassar, H.; Paul, M.; Ghelberg, S.; Ofan, A.; Trubnikov, N.; Ben-Dov, Y.; Hass, M.; Nara Singh, B.S.

    2005-01-01

    We report on a study of the α-capture reaction on 40 Ca in the energy range relevant to supernova nucleosynthesis (T 9 ∼ 0.8-3). The experiment measures the overall yield of 44 Ti nuclei produced in an activation of a thick 4 He target by a 40 Ca beam. Preliminary results show a significantly stronger yield than observed in previous measurements in the range T 9 ∼ 1.5-3

  13. Cyclotron production of {sup 44}Sc for clinical application

    Energy Technology Data Exchange (ETDEWEB)

    Krajewski, S.; Bilewicz, A. [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Cydzik, I. [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); European Commission Joint Research Center, Ispra (Italy). Inst. for Health and Consumer Protection; Warsaw Univ. (Poland). Heavy Ion Lab.; Abbas, K. [European Commission Joint Research Center, Ispra (Italy). Institute for Transuranium Elements; Bulgheroni, A.; Simonelli, F.; Holzwarth, U. [European Commission Joint Research Center, Ispra (Italy). Inst. for Health and Consumer Protection

    2013-08-01

    {sup 44} is a promising {beta}{sup +}-emitter for molecular imaging with intermediate half-life of 4 h. Due to the chemical similarity of Sc{sup 3+} to the Lu{sup 3+} and Y{sup 3+} cations, {sup 44}Sc-DOTA bioconjugates are expected to demonstrate similar properties in vivo as the {sup 177}Lu- and {sup 90}Y-bioconjugates, what is important in planning the radionuclide therapy. {sup 44}Sc can be obtained from the {sup 44}Ti/{sup 44}Sc generator. An alternative method for {sup 44}Sc production can be the irradiation of {sup 44}Ca target at small cyclotrons. The aim of our work was to optimize the parameters of {sup 44}CaCO{sub 3} irradiation and to develop a simple procedure for {sup 44}Sc separation from the calcium target. For optimization study, {sup 44}CaCO{sub 3} targets were irradiated by protons in the energy range of 5.6-17.5 MeV with 9 MeV being found to be the best energy for {sup 44}Ca irradiations. A simple and fast separation procedure of {sup 44}Sc from calcium target was developed using chelating resin Chelex 100. DOTATATE conjugate was successfully radiolabelled with high yield at elevated temperature using the produced {sup 44}Sc. While {sup 44}CaCO{sub 3} is relatively expensive, the cost of {sup 44}Sc-DOTATATE production can be reduced by target recovery. Due to low proton energy required to produce GBq activity level of {sup 44}Sc, the availability of {sup 44}Sc radioisotope could be enhanced to open new opportunities for applications in medical imaging. (orig.)

  14. Hydration reactions in pastes C3S+C3A+CaSO4.2aq+H20 at 25°C.I

    NARCIS (Netherlands)

    Corstanje, W.A.; Stein, H.N.; Stevels, J.M.

    1973-01-01

    A characteristic retardation of the hydration of C3A is found in pastes C3S+C3A+CaSO4.2aq+H2O of weight ratios 1:3:z:4 at certain values of z, when sulphate concentration becomes insufficient for monosulphate formation. This retardation is ascribed to precipitation of amorphous Al(OH)3, when C3A

  15. Dielectric properties of CaTiO3 coatings prepared by plasma spraying

    Czech Academy of Sciences Publication Activity Database

    Sedláček, J.; Ctibor, Pavel; Kotlan, J.; Pala, Zdeněk

    2013-01-01

    Roč. 29, č. 5 (2013), s. 384-389 ISSN 0267-0844 Institutional support: RVO:61389021 Keywords : Plasma * Ceramics * CaTiO3 * Permittivity * Resistivity Subject RIV: JG - Metallurgy Impact factor: 1.510, year: 2013 http://www.ingentaconnect.com/content/maney/se/2013/00000029/00000005/art00012

  16. Chemical solution deposition of CaCu 3 Ti 4 O 12 thin film

    Indian Academy of Sciences (India)

    CaCu3Ti4O12 (CCTO) thin film was successfully deposited on boron doped silica substrate by chemical solution deposition and rapid thermal processing. The phase and microstructure of the deposited films were studied as a function of sintering temperature, employing X-ray diffractometry and scanning electron ...

  17. Green tide deactivation with layered-structure cuboids of Ag/CaTiO3 under UV light

    International Nuclear Information System (INIS)

    Lee, Soo-Wohn; Lozano-Sánchez, L.M.; Rodríguez-González, V.

    2013-01-01

    Graphical abstract: Synergic reasons such as mass transfer, morphology, biocide properties, UV-A photoresponse, and electron trapping that reduce recombination on Ag/CaTiO 3 nanocomposites, have the potential for the generation of reactive radicals that promote the fatal irreversible deactivation of Tetraselmis suecica algae in 12 min under UV-A irradiation. -- Highlights: • An alternative to deactivate harmful green tide is proposed by employing Ag/CaTiO 3 . • Particles of perovskite-like have rectangular prisms morphology with AgNPs ∼13 nm. • The cuboids achieve complete inactivation of Tetraselmis suecica algae in 12 min. • AgNPs functionalization induce fatal irreversible damages on the algae surface. -- Abstract: In this work, an alternative to deactivate noxious green tide Tetraselmis suecica in the short-term is proposed by employing Perovskite-like cube-shaped, crystalline CaTiO 3 semiconductors functionalized with atomic silver nanoparticles. CaTiO 3 was prepared by a microwave-assisted hydrothermal method and then Ag 0 NPs (1 wt% of CaTiO 3 ), were added by the photoreduction method. The XRD results show that crystalline CaTiO 3 has an orthorhombic unit cell with a Perovskite-like structure. Images obtained by FESEM and HRTEM microscopies show well-faceted CaTiO 3 rectangular prismatic morphology functionalizated with silver nanoparticles ∼13.5 nm. XPS and EDS-FESEM has confirmed the composition of CaTiO 3 and silver occurring mainly as reduced metal. The UV inactivation of noxious T. suecica with Ag/CaTiO 3 nanocomposites formed on bare materials results in complete deactivation of the algae in 12 min. The direct contact between harmful algae and Ag/CaTiO 3 nanocomposite is necessary to deactivate the algae and inhibits algae viability

  18. Ag- and Cu-doped multifunctional bioactive nanostructured TiCaPCON films

    Energy Technology Data Exchange (ETDEWEB)

    Shtansky, D.V., E-mail: shtansky@shs.misis.ru [National University of Science and Technology “MISIS”, Leninsky prospekt 4, Moscow 119049 (Russian Federation); Batenina, I.V.; Kiryukhantsev-Korneev, Ph.V.; Sheveyko, A.N.; Kuptsov, K.A. [National University of Science and Technology “MISIS”, Leninsky prospekt 4, Moscow 119049 (Russian Federation); Zhitnyak, I.Y.; Anisimova, N.Yu.; Gloushankova, N.A. [N.N. Blokhin Russian Cancer Research Center of RAMS, Kashirskoe shosse 24, Moscow 115478 (Russian Federation)

    2013-11-15

    A key property of multicomponent bioactive nanostructured Ti(C,N)-based films doped with Ca, P, and O (TiCaPCON) that can be improved further is their antibacterial effect that should be achieved without compromising the implant bioactivity and biocompatibility. The present work is focused on the study of structure, chemical, mechanical, tribological, and biological properties of Ag- and Cu-doped TiCaPCON films. The films with Ag (0.4–4 at.%) and Cu (13 at.%) contents were obtained by simultaneous sputtering of a TiC{sub 0.5}–Ca{sub 3}(PO{sub 4}){sub 2} target and either an Ag or a Cu target. The film structure was studied using X-ray diffraction, transmission and scanning electron microscopy, energy dispersive X-ray spectroscopy, glow discharge optical emission spectroscopy, and Raman-shift and IR spectroscopy. The films were characterized in terms of their hardness, elastic modulus, dynamic impact resistance, friction coefficient and wear rate (both in air and normal saline), surface wettability, electrochemical behavior and Ag or Cu ion release in normal saline. Particular attention was paid to the influence of inorganic bactericides (Ag and Cu ions) on the bactericidal activity against unicellular yeast fungus Saccharomyces cerevisiae and gram-positive bacteria Lactobacillus acidophilus, as well as on the attachment, spreading, actin cytoskeleton organization, focal adhesions, and early stages of osteoblastic cell differentiation. The obtained results show that the Ag-doped films are more suitable for the protection of metallic surfaces against bacterial infection compared with their Cu-doped counterpart. In particular, an excellent combination of mechanical, tribological, and biological properties makes Ag-doped TiCaPCON film with 1.2 at.% of Ag very attractive material for bioengineering and modification of load-bearing metal implant surfaces.

  19. Dielectric and piezoelectric properties of sol-gel derived Ca doped PbTiO3

    International Nuclear Information System (INIS)

    Chauhan, Arun Kumar Singh; Gupta, Vinay; Sreenivas, K.

    2006-01-01

    Synthesis of Ca doped PbTiO 3 powder by a chemically derived sol-gel process is described. Crystallization characteristics of different compositions Pb 1-x Ca x TiO 3 (PCT) with varying calcium (Ca) content in the range x = 0-0.45 has been investigated by DTA/TGA, X-ray diffraction and scanning electron microscopy. The crystallization temperature is found to decrease with increasing calcium content. X-ray diffraction reveals a tetragonal structure for PCT compositions with x ≤ 0.35, and a cubic structure for x = 0.45. Dielectric properties on sintered ceramics prepared with fine sol-gel derived powders have been measured. The dielectric constant is found to increase with increasing Ca content, and the dielectric loss decreases continuously. Sol-gel derived Pb 1-x Ca x TiO 3 ceramics with x = 0.45 after poling exhibit infinite electromechanical anisotropy (k t /k p ) with a high d 33 = 80 pC/N, ε' = 298 and low dielectric loss (tan δ = 0.0041)

  20. Evaluation of growth of calcium phosphate ceramics on sintered Ti-Ca-P composites

    Energy Technology Data Exchange (ETDEWEB)

    Karanjai, Malobika [Centre for Nano Materials, International Advanced Research Centre for Powder Metallurgy and New Materials, Balapur P.O, Hyderabad - 500 005, Andhra Pradesh (India)], E-mail: malobika_k@rediffmail.com; Sundaresan, Ranganathan [Centre for Nano Materials, International Advanced Research Centre for Powder Metallurgy and New Materials, Balapur P.O, Hyderabad - 500 005, Andhra Pradesh (India); Mohan, Tallapragada Raja Rama; Kashyap, Bhagwati Prasad [Department of Metallurgical Engineering and Materials Science, Indian Institute of Technology Bombay, Mumbai - 400 076, Maharashtra (India)

    2008-12-01

    Sintered Ti-Ca-P composites having in situ formed calcium phosphate phases developed by powder metallurgy processing were soaked for 28 days in simulated body fluid (SBF) with a pH of 7.4 at 37 deg. C and evaluated for the growth of calcium phosphate ceramics onto its surface. The composites were taken out once every 7 days and characterised using X-ray diffraction (XRD), scanning electron microscopy (SEM) and Fourier transform infrared spectroscopy (FTIR) for evaluating the Ca-P growth. Based on the change in chemistry of the SBF and phase contents, a model has been proposed for mechanism of growth of calcium phosphate compounds on sintered Ti-Ca-P composites immersed in SBF.

  1. Surface structures and osteoblast response of hydrothermally produced CaTiO{sub 3} thin film on Ti-13Nb-13Zr alloy

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jin-Woo, E-mail: jinwoo@knu.ac.kr [Department of Periodontology, School of Dentistry, Kyungpook National University, 188-1, Samduk 2Ga, Jung-Gu, Daegu 700-412 (Korea, Republic of); Tustusmi, Yusuke [Department of Metals, Institute of Biomaterials and Bioengineering, Tokyo Medical and Dental Univeristy, Tokyo 101-0062 (Japan); Lee, Chong Soo; Park, Chan Hee [Department of Materials Science and Engineering, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Kim, Youn-Jeong; Jang, Je-Hee [Department of Periodontology, School of Dentistry, Kyungpook National University, 188-1, Samduk 2Ga, Jung-Gu, Daegu 700-412 (Korea, Republic of); Khang, Dongwoo; Im, Yeon-Min [School of Materials Science and Engineering, Gyeongsang National University, Jinju 600-701 (Korea, Republic of); Doi, Hisashi; Nomura, Naoyuki; Hanawa, Takao [Department of Metals, Institute of Biomaterials and Bioengineering, Tokyo Medical and Dental Univeristy, Tokyo 101-0062 (Japan)

    2011-06-15

    This study investigated the surface characteristics and in vitro biocompatibility of a titanium (Ti) oxide layer incorporating calcium ions (Ca) obtained by hydrothermal treatment with or without post heat-treatment in the Ti-13Nb-13Zr alloy. The surface characteristics were evaluated by scanning electron microscopy, thin-film X-ray diffractometry, X-ray photoelectron spectroscopy, atomic force microscopy and contact angle measurements. In vitro biocompatibility of the Ca-containing surfaces was assessed in comparison with untreated surfaces using a pre-osteoblast cell line. Hydrothermal treatment produced a crystalline CaTiO{sub 3} layer. Post heat-treatment at 400 deg. C for 2 h in air significantly decreased water contact angles in the CaTiO{sub 3} layer (p < 0.001). The Ca-incorporated alloy surfaces displayed markedly increased cell viability and ALP activity compared with untreated surfaces (p < 0.001), and also an upregulated expression of various integrin genes ({alpha}1, {alpha}2, {alpha}5, {alpha}v, {beta}1 and {beta}3) at an early incubation time-point. Post heat-treatment further increased attachment and ALP activity in cells grown on Ca-incorporated Ti-13Nb-13Zr alloy surfaces. The results indicate that the Ca-incorporated oxide layer produced by hydrothermal treatment and a simple post heat-treatment may be effective in improving bone healing in Ti-13Nb-13Zr alloy implants by enhancing the viability and differentiation of osteoblastic cells.

  2. Perovskite-related Ca(Nb,Ti)O3.33

    International Nuclear Information System (INIS)

    Guevarra, J.; Smaalen, S. van; Daniels, P.; Rotiroti, N.; Lichtenberg, F.

    2005-01-01

    Crystals of nominal composition Ca(Nb 0.8 Ti 0.2 )O 3.4 , an n = 5 member of the homologous series A n B n O 3n+2 , have been synthesized by floating-zone melting. The material was found to be multiphase consisting also of the n = 6 type. A good single crystal of this n = 6 type was found and the crystal structure at room temperature was determined by X-ray diffraction using synchrotron radiation. Structure refinements indicate a composition of Ca(Nb 0.76 Ti 0.24 )O 3.33 . The crystal structure is monoclinic P2 1 and consists of slabs of corner-sharing (Nb,Ti)O 6 octahedra interrupted by layers of oxygen atoms. Ca atoms within the slabs are 12-fold coordinated whereas those at the borders show irregular coordination geometries. The octahedral distortion is greatest near the borders of the slabs and least near the middle of the slabs. Ti 4+ preferentially occupy octahedral sites in the middle of slabs. The non-stoichiometry in the refined composition and the insulating character of the material may be explained in terms of extra oxygen, vacancies on the cation sites, or by localization of the electrons in the 4d orbitals of Nb at the borders of slabs. (orig.)

  3. Phase transitions of titanite CaTiSiO5 from density functional perturbation theory

    Science.gov (United States)

    Malcherek, Thomas; Fischer, Michael

    2018-02-01

    Phonon dispersion of titanite CaTiSiO5 has been calculated using the variational density functional perturbation theory. The experimentally known out-of-center distortion of the Ti atom is confirmed. The distortion is associated with a Bu mode that is unstable for wave vectors normal to the octahedral chain direction of the C 2 /c aristotype structure. The layer of wave vectors with imaginary mode frequencies also comprises the Brillouin zone boundary point Y (0 ,1 ,0 ) , which is critical for the transition to the P 21/c ground-state structure. The phonon branch equivalent to the imaginary branch of the titanite aristotype is found to be stable in malayaite CaSnSiO5. The unstable phonon mode in titanite leads to the formation of transoriented short and long Ti-O1 bonds. The Ti as well as the connecting O1 atom exhibit strongly anomalous Born effective charges along the octahedral chain direction [001], indicative of the strong covalency in this direction. Accordingly and in contrast to malayaite, LO-TO splitting is very large in titanite. In the C 2 /c phase of titanite, the Ti-O1-Ti distortion chain is disordered with respect to neighboring distortion chains, as all chain configurations are equally unstable along the phonon branch. This result is in agreement with diffuse x-ray scattering in layers normal to the chain direction that is observed at temperatures close to the P 21/c to C 2 /c transition temperature and above. The resulting dynamic chains of correlated Ti displacements are expected to order in two dimensions to yield the P 21/c ground-state structure of titanite.

  4. Mechanosynthesis of nanocrystalline CaTi1-xMnxO3-δ

    Directory of Open Access Journals (Sweden)

    Figueiredo, F. M.

    2008-08-01

    Full Text Available The mechanosynthesis of nanocrystalline CaTi1-xMnxO3-δ is reported for the first time. Powdered CaO, TiO2 anatase and Mn2O3 (Aldrich were weighed in the appropriate stoichiometric quantities in order to obtain CaTi1-xMnxO3-δ (x=0.05, 0.10, 0.15, 0.20, 0.30, 0.50 and 0.80 and dry milled in a planetary high-energy ball mill, using zirconia containers and balls, with a 10:1 ball/mass ratio. The planetary rotation was kept constant at 650 rpm and the container at 1300 rpm, in the opposite direction. Powder XRD patterns revealed a perovskite forming from the early milling stages and a completed reaction after 180 min, with no apparent crystalline or amorphous intermediates, indicating significant Mn solubility in CaTiO3. Patterns show a decrease in lattice volume upon Mn substitution, as expected from the lower Mn3+ or Mn4+ ionic radii when compared to Ti4+. The average crystallite size is in the range 5-30 nm, as determined from Williamson-Hall plots and confirmed by high resolution transmission electron microscopy.La mecanosíntesis de CaTi1-xMnxO3-δ nanocristalino es presentada por primera vez. Polvos reactivos de CaO, TiO2 anatasa y Mn2O3 (Aldrich fueron pesados en las cantidades estequiométricas adecuadas para obtener CaTi1-xMnxO3-δ (x=0.05, 0.10, 0.15, 0.20, 0.30, 0.50 y 0.80 por molienda en seco en un molino planetario de alta energía utilizando contenedores y bolas de circona, en una relación masa de bolas : masa de polvo de 10:1. La rotación del planetario se mantuvo constante a 650 revoluciones por minuto (rpm y la del contenedor a 1300 rpm, en el sentido inverso. La formación de una fase con estructura de perovskita fue identificada a través del análisis de los polvos por difracción de rayos X, siendo esta fase claramente mayoritaria en los polvo molidos durante 180 min y sin observarse la formación de compuestos intermediarios. Los patrones de difracción de rayos X también indicaron una disminución de los parámetro de red

  5. Fabrication and Film Qualification of Sr Modified Pb(Ca) TiO3 Thin Films

    International Nuclear Information System (INIS)

    Naw Hla Myat San; Khin Aye Thwe; Than Than Win; Yin Maung Maung; Ko Ko Kyaw Soe

    2011-12-01

    Strontium and calcium - modified lead titanate (Pb0.7 Ca0.15 Sr0.15 ) TiO3 (PCST)thin films were prepared by using spin coating technique. Phase transition of PCST was interpreted by means of Er-T characteristics. Process temperature dependence on micro-structure of PCST film was studied. Charge conduction mechanism of PCST thin film was also investigated for film qualification.

  6. Preparation, characterization and activity evaluation of CaZrTi2O7 photocatalyst

    International Nuclear Information System (INIS)

    Chen Shifu; Ji Mingsong; Yuang Yunguang; Liu Wei

    2012-01-01

    CaZrTi 2 O 7 photocatalyst sample was prepared by a polymerizable complex method. The photocatalyst was characterized by X-ray powder diffraction, scanning electron microscopy, UV–Vis diffuse reflectance spectroscopy, photoluminescence emission spectroscopy, Brunauer–Emmett–Teller analysis, N 2 adsorption measurements, and terephthalic acid probed fluorescence technique. The photocatalytic activity of the sample was evaluated by photocatalytic oxidation of methyl orange and photocatalytic reduction of Cr 2 O 7 2− and nitrobenzene. The results showed that when the reaction solution was illuminated by UV light for 50 min, the photooxidation efficiency of methyl orange and the photoreduction efficiency of Cr 2 O 7 2− were 83.1% and 87.9%, respectively. When methanol was used as the holes scavengers and the illumination time was 10 h in the photocatalytic reduction experiment of nitrobenzene, the production efficiency of aniline was 70.3%. The effect of the heat treatment conditions on the photocatalytic activity was also investigated. The optimum preparation condition for CaZrTi 2 O 7 sample is 800 °C for 12 h. The mechanisms of influence on the photocatalytic activity of the sample were also discussed with the valance band theory. - Highlights: ► CaZrTi 2 O 7 photocatalyst was prepared by a polymerizable complex method. ► The heat treatment has a significant influence on the photocatalytic activity. ► The optimal heat treatment condition is approximately 800 °C for 12 h. ► The CaZrTi 2 O 7 has the band bap of about 2.89 eV with particle size of about 80 nm.

  7. Microwave synthesis and sintering characteristics of CaCu 3 Ti 4 O 12

    Indian Academy of Sciences (India)

    CaCu3Ti4O12 (CCTO) was synthesized and sintered by microwave processing at 2.45 GHz, 1.1 kW. The optimum calcination temperature using microwave heating was determined to be 950°C for 20 min to obtain cubic CCTO powders. The microwave processed powders were sintered to 94% density at 1000°C/60 min.

  8. Alpha clustering in Ti isotopes: 40,44,48Ca + α resonant scattering

    Directory of Open Access Journals (Sweden)

    Bailey Sam

    2016-01-01

    Full Text Available Measurements were made of the 4He(40,44,48Ca,α resonant scattering reactions at 180° and up to Ec.m. ~ 11.5MeV, using the Thick Target Inverse Kinematics technique. These measurements are discussed, with a focus on assessing their usefulness for investigating α-clustering in medium mass 44,48,52Ti nuclei.

  9. Study of the synthesis of TiO2 layers on macroporous ceramic supports in supercritical (SC) CO2 for processing radioactive aqueous effluents in dynamic mode

    International Nuclear Information System (INIS)

    Duchateau, Maxime

    2014-01-01

    Public and military nuclear industry generates a significant amount of radioactive liquid waste which must be treated before being released into the environment. Decontamination methods alternative to the industrial techniques (evaporation, chemical treatment) are being developed, such as column treatments or coupled filtration/sorption processes. Current researches mainly focus on the development and shaping of specific sorbents. In this context, the objectives of this thesis were first to study the synthesis of TiO 2 layers on macroporous ceramic supports in supercritical (SC) CO 2 and then to evaluate their potential for radionuclide extraction in these alternative processes. A robust synthesis method has been developed, based on the thermal decomposition of titanium isopropoxide in SC CO 2 in the temperature range between 150 C and 350 C. Nano-structured TiO 2 films were formed on the macroporous supports (ceramic foams, tubular α-alumina supports) with good adhesion, already at 150 C. The effect of the synthesis temperature on sorbents physico-chemical characteristics and sorption properties has been studied with TiO 2 powders prepared under the same conditions as the supported films. The best sorption performance were observed for the powder prepared at 150 C, owing to its higher density of surface sites in comparison with powders prepared at either 250 C or 350 C. Consequently, this synthesis temperature (150 C) was selected for a detailed study of the composite sorbents (TiO 2 /support), in order to assess their sorption performance in continuous treatment processes. The sorption experiments have shown that a column of alumina macroporous foam (Φpore = 400μm) coated with TiO 2 was suitable for processing effluents in dynamic mode with high throughputs. Both macro-pore sizes and column height were revealed as important parameters to be controlled. For the coupled filtration/sorption treatment, TiO 2 membranes exhibit good mechanical strength and are able

  10. Impact of symmetry on the ferroelectric properties of CaTiO{sub 3} thin films

    Energy Technology Data Exchange (ETDEWEB)

    Biegalski, Michael D.; Qiao, Liang [Center for Nanophase Materials Sciences, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States); Gu, Yijia; Chen, Long-Qing [Department of Materials Science and Engineering, Pennsylvania State University, University Park, Pennsylvania 16801 (United States); Mehta, Apurva [Stanford Synchrotron Lightsource SLAC National Accelerator Laboratory, Menlo Park, California 94025 (United States); He, Qian; Borisevich, Albina [Materials Science and Technology Division, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States); Takamura, Yayoi, E-mail: ytakamura@ucdavis.edu [Department of Chemical Engineering and Materials Science, University of California Davis, Davis, California 95616 (United States)

    2015-04-20

    Epitaxial strain is a powerful tool to induce functional properties such as ferroelectricity in thin films of materials that do not possess ferroelectricity in bulk form. In this work, a ferroelectric state was stabilized in thin films of the incipient ferroelectric, CaTiO{sub 3}, through the careful control of the biaxial strain state and TiO{sub 6} octahedral rotations. Detailed structural characterization was carried out by synchrotron x-ray diffraction and scanning transmission electron microscopy. CaTiO{sub 3} films grown on La{sub 0.18}Sr{sub 0.82}Al{sub 0.59}Ta{sub 0.41}O{sub 3} (LSAT) and NdGaO{sub 3} (NGO) substrates experienced a 1.1% biaxial strain state but differed in their octahedral tilt structures. A suppression of the out-of-plane rotations of the TiO{sub 6} octahedral in films grown on LSAT substrates resulted in a robust ferroelectric I4 mm phase with remnant polarization ∼5 μC/cm{sup 2} at 10 K and T{sub c} near 140 K. In contrast, films grown on NGO substrates with significant octahedral tilting showed reduced polarization and T{sub c}. These results highlight the key role played by symmetry in controlling the ferroelectric properties of perovskite oxide thin films.

  11. Spectroscopic studies on (Ba,Ca)(Ti,Zr)O3 ferroelectric ceramics with high piezoelectric coefficients

    International Nuclear Information System (INIS)

    Archana Kumar; Sreenivas, K.

    2013-01-01

    In recent year non lead-based multi component ceramics consisting Ba(Ti 0.8 Zr 0.2 )O 3- (Ba 0.7 Ca 0.3 )TiO 3 have been found to exhibit high piezoelectric coefficients comparable to those of PZT, and there is a lot interest to understand nature of phase transition in these novel compositions. In the present study 0.5Ba(Ti 0.8 Zr 0.2 )O 3- 0.5(Ba 0.7 Ca 0.3 )TiO 3 ceramic composition calcinated and sintered at different temperatures has been investigated. The ceramics are prepared from the raw powders and reacted by a solid state reaction method. Spectroscopic methods including DTA/TGA, FTIR and Raman spectroscopy been used to understand the changes occurring in the chemical and structural properties during processing. The nature of polymorphic phase transition has been studied through the temperature dependent Raman spectroscopy. The de-poling characteristics with temperature have been studied to assess their usefulness for high temperature transducer applications, and their ferroelectric properties have been studied. This new composition exhibits high piezoelectric (d 33 ), and the transition temperature is low around 120℃. (author)

  12. The cross section measurements for the 51V(n, α)48Sc and 51V(n,p)51Ti reactions

    International Nuclear Information System (INIS)

    Hu Shangbin; Kong Xiangzhong; Yang Jingkang

    1999-01-01

    The cross sections for 51 V(n, α) 48 Sc and 51 V(n,p) 51 Ti have been measured by using the activation method relative to the cross sections of 27 Al(n, α) 24 Na in the neutron energy range 13.4 --14.8 MeV. The results are compared with the published data. The neutron energies were determined by the method of cross section ratios for the reactions 90 Zr(n.2n) 89 Zr by 93 Nb(n,2n) 92m Nb

  13. Measurement of Gamow-Teller and spin dipole strength in the 45Sc(n,p)45Ca reaction at 198 MeV

    International Nuclear Information System (INIS)

    Alford, W.P.; Celler, A.; Brown, B.A.; Long, S.; Raywood, K.

    1990-11-01

    The reaction 45 Sc(n,p) 45 Ca has been studied at an energy of 198 MeV with energy resolution of about 1 MeV. Measurements were carried out at nominal angles 0, 3, 6, 9, 12, 15, and 18 degrees and spectra obtained up to ∼40 MeV excitation energy in 45 Ca. Significant Gamow-Teller strength is observed at an excitation energy of about 7 MeV, somewhat higher than predicted by shell model calculations. The strength observed is in agreement with calculations using g A /g V ≅ 1. The spin dipole giant resonance is seen with centroid at about 15 MeV excitation and total cross section of 25 mb/sr at an angle of 6 degrees. (Author) (22 refs., 9 figs.)

  14. Fluorescence properties of novel near-infrared phosphor CaSc{sub 2}O{sub 4}:Ce{sup 3+}, Nd{sup 3+}

    Energy Technology Data Exchange (ETDEWEB)

    Meng, J.X., E-mail: tmjx@jnu.edu.c [Department of Chemistry, Jinan University, Guangzhou 510632 (China); Institute of Nanochemistry, Jinan University, Guangzhou 510632 (China); Zhang, F.J.; Peng, W.F.; Wan, W.J.; Xiao, Q.L.; Chen, Q.Q.; Cao, L.W. [Department of Chemistry, Jinan University, Guangzhou 510632 (China); Wang, Z.L. [School of Chemistry and Biotechnology, Yunnan Nationalities University, Kunming 650031 (China)

    2010-10-15

    Research highlights: Novel near-infrared (NIR) phosphor, CaSc{sub 2}O{sub 4}:Ce{sup 3+}, Nd{sup 3+}, was synthesized. The phosphor gives strong Nd{sup 3+} characteristic NIR emissions in the range of 880-930 nm. The NIR emission intensity gets a 200 times enhancement benefited from the efficient energy transfer from a co-doped Ce{sup 3+}. The energy transfer mechanism was also briefly based on detailed investigation on spectrum and fluorescence lifetime. - Abstract: Novel near-infrared (NIR) phosphor, CaSc{sub 2}O{sub 4}:Ce{sup 3+}, Nd{sup 3+}, was synthesized by co-precipitation method followed by firing at 1300 {sup o}C in reduced atmosphere. When irradiated with blue light, the phosphor gives strong Nd{sup 3+} characteristic NIR emissions in the range of 880-930 nm. The NIR emission intensity gets a 200 times enhancement by co-doping of Ce{sup 3+}. Detailed investigation on spectrum and fluorescence lifetimes indicated the NIR luminescence enhancement is obtained from an energy transfer process. The process initiates with efficient absorption of blue light by Ce{sup 3+} ions via an allowed 4f-5d transition, follow by efficient energy transfer from Ce{sup 3+} to Nd{sup 3+}, and emitting strong Nd{sup 3+} characteristic fluorescence.

  15. Crystal growth and piezoelectric properties of Ca3Ta(Ga0.9Sc0.1)3Si2O14 bulk single crystal

    Science.gov (United States)

    Igarashi, Yu; Yokota, Yuui; Ohashi, Yuji; Inoue, Kenji; Yamaji, Akihiro; Shoji, Yasuhiro; Kamada, Kei; Kurosawa, Shunsuke; Yoshikawa, Akira

    2018-03-01

    Ca3Ta(Ga0.9Sc0.1)3Si2O14 langasite-type single crystal with a diameter of 1 in. was grown by Czochralski (Cz) method. Obtained crystal had good crystallinity and its lattice constants exceeded those of Ca3TaGa3Si2O14 (CTGS) according to the X-ray analysis. A crack-free specimen cut from the grown crystal was used for the measurements of dielectric constant ε11T/ε0, electromechanical coupling factor k12, and piezoelectric constant d11. The accuracies of these measurements were better than those for the crystal grown by micro-pulling-down (μ-PD) method. Substitution of Ga with Sc resulted modification of these constants in the directions opposite to those observed after partial substitution of Ga (of CTGS) with Al. This suggests that increase of |d14| was most probably associated with enlargement of average size of the Ga sites. The crystal reported here had greater dimensions as compared to analogous crystals grown by the μ-PD method. As a result, accuracy of determination of acoustic constants of this material may be improved.

  16. The structure and piezoelectric properties of (Ca1-xSrx)Bi4Ti4O15 ceramics

    International Nuclear Information System (INIS)

    Zheng Liaoying; Li Guorong; Zhang Wangzhong; Chen, Daren; Yin Qinrui

    2003-01-01

    In this paper, the structure and piezoelectric properties of (Ca 1-x Sr x )Bi 4 Ti 4 O 15 ceramics (x=0-1.0) are investigated. The formation of single orthorhombic phase is verified by XRD. The dependence of dielectric and piezoelectric properties on x is also determined. The results show that the excellent properties could be found in the composition of x=0.4. In that composition, d 33 =14.9, T C =677 deg. C and the DC resistivity is decuplely higher than that of BST (SrBi 4 Ti 4 O 15 ) and CBT (CaBi 4 Ti 4 O 15 )

  17. Electron paramagnetic resonance investigation of polycrystalline CaCu3Ti4O12

    International Nuclear Information System (INIS)

    Mozzati, Maria Cristina; Azzoni, Carlo Bruno; Capsoni, Doretta; Bini, Marcella; Massarotti, Vincenzo

    2003-01-01

    Electron paramagnetic resonance (EPR) measurements on pure polycrystalline CaCu 3 Ti 4 O 12 have been performed and are discussed within a crystal-field approach. A symmetric signal centred at g = 2.15 is observed for T>25 K, with no evidence of hyperfine structure. At this temperature an antiferromagnetic transition is observed as confirmed by static magnetization data. Cu defective and 2% doped (V, Cr, Mn, La) samples were also prepared and considered, mainly to understand the nature of the observed paramagnetic centre. Substitutions in the octahedral sites, causing variations of the configuration in CuO 4 -TiO 6 -CuO 4 complexes, change the magnetic and EPR features. To justify the EPR response a strong copper-hole delocalization is suggested

  18. Thermoelastic properties of ScB2, TiB2, YB4 and HoB4

    DEFF Research Database (Denmark)

    Waskowska, A.; Gerward, L.; Staun Olsen, J.

    2011-01-01

    (4)GPa). No pressure-induced phase transformations are observed in any of the above borides up to about 20GPa. A continuous temperature-driven orthorhombic distortion is observed for HoB4 below 285K. Values of the thermal expansion coefficient are reported for ScB2 and HoB4 at 293, 200 and 100K...

  19. Low-temperature elastic anomalies in CaTiO3: dynamical characterization

    Science.gov (United States)

    Placeres-Jiménez, R.; Gonçalves, L. G. V.; Rino, J. P.; Fraygola, B.; Nascimento, W. J.; Eiras, J. A.

    2012-11-01

    Pulse-echo ultrasonic measurements of elastic coefficients of CaTiO3 show anomalous behavior around 200 K, with a notable rise in the attenuation coefficient. Molecular dynamics simulation is used to simulate the elastic response of a mono-domain (MDm) and a poly-domain (PDm) configuration of CaTiO3 using the Vashishta-Raman interatomic potential. The PDm is obtained by cooling the melt from 3600 to 300 K at a rate of 0.5 K ps-1, so that it recrystallizes to the PDm orthorhombic configuration. The elastic behavior is simulated in the temperature range from 300 to 20 K. In the MDm, it is observed that the bulk modulus varies linearly with temperature, while in the PDm an anomalous hardening is seen around 210 K. The bulk modulus of the PDm fluctuates strongly and is lower than that of the MDm. Neither the pair correlation function nor the Ti-Ti-O bonding angle indicate a true structural phase transition in this range of temperatures. Given the absence of any apparent change in the structure, a possible explanation for this phenomenon is the emergence of a certain class of dynamical instability associated with domain wall motion. Curiously, the pressure fluctuations in both the MDm and PDm configurations follow a power law distribution f ˜ P-α, with the exponent independent of applied strain and temperature. Time series for pressure are used to analyze the dynamics by time-delay reconstruction techniques. The calculus of embedding and correlation dimension indicates that in the polycrystalline configuration, low-dimension dynamics (<26) appears, which tend to disappear at higher temperatures.

  20. Ionic conductivity of the lithium titanium phosphate (Li/sub 1+x/M/sub x/Ti/sub 2-x/(PO/sub 4/)/sub 3/, M=Al, Sc, Y, and La) systems

    International Nuclear Information System (INIS)

    Aono, H.; Sugimoto, E.; Sadaaka, Y.; Imanaka, N.; Adachi, G.Y.

    1989-01-01

    High lithium ionic conductivity was obtained in Li/sub 1+X/M/sub X/Ti/sub 2-X/(PO/sub 4/)/sub 3/ (M=Al, Sc, Y, and La) systems. Lithium titanium phosphate, LiTi/sub 2/(PO/sub 4/)/sub 3/, is composed of both TiO/sub 6/ octahedra and PO/sub 4/ tetrahedra, which are linked by corners to form a three dimensional network, with a space group R3-barC. Some workers have already described that the conductivity increased considerably if Ti/sup 4+/ in LiTi/sub 2/(PO/sub 4/)/sub 3/ was substituted by slightly larger cations such as Ga/sup 3+/(1),Sc/sup 3+/(2), and In/sup 3+/(3,4). These results are similar to each other because of their close ionic radii. In this communication, substitution effects of Ti/sup 4+/ in LiTi/sub 2/(PO/sub 4/)/sub 3/ by various ions (Al/sup 3+/, Sc/sup 3+/, Y/sup 3+/, and La/sup 3+/) on their conductivities are reported

  1. Blue-green and red photoluminescence in CaTiO3:Sm

    International Nuclear Information System (INIS)

    Figueiredo, Alberthmeiry T. de; Longo, Valeria M.; Lazaro, Sergio de; Mastelaro, Valmor R.; De Vicente, Fabio S.; Hernandes, Antonio C.; Siu Li, Maximo; Varela, Jose A.; Longo, Elson

    2007-01-01

    Blue-green and red photoluminescence (PL) emission in structurally disordered CaTiO 3 :Sm (CT:Sm) powders was observed at room temperature with laser excitation at 350.7 nm. The perovskite-like titanate CT:Sm powders prepared by a soft chemical processing at different temperatures of annealing were structurally characterized by X-ray diffraction (XRD) and X-ray absorption near-edge structure (XANES). The results indicate that the generation of the broad PL band is related to order-disorder degree in the perovskite-like structure

  2. Performance Limits and IR Design Challenges of a Possible LHC Luminosity Upgrade Based on Nb-Ti SC Magnet Technology

    CERN Document Server

    Brüning, Oliver Sim; Ostojic, R; Rossi, L; Ruggiero, F; Scandale, Walter; Taylor, T

    2004-01-01

    We investigate the maximum LHC performance for a standard IR design based on classical NbTi insertion magnets. We include in our analysis a ternary Nb-based ductile allow such as NbTi(Ta), a less developed but relatively cheap superconducting material which may allow to gain about 1 T in the peak field in the coils, and discuss the corresponding luminosity reach for a possible LHC upgrade compared to that based on Nb$_{3}$Sn magnets.

  3. Plasma-sprayed CaTiSiO5 ceramic coating on Ti-6Al-4V with excellent bonding strength, stability and cellular bioactivity

    Science.gov (United States)

    Wu, Chengtie; Ramaswamy, Yogambha; Liu, Xuanyong; Wang, Guocheng; Zreiqat, Hala

    2008-01-01

    Novel Ca-Si-Ti-based sphene (CaTiSiO5) ceramics possess excellent chemical stability and cytocompatibility. The aim of this study was to prepare sphene coating on titanium alloy (Ti-6Al-4V) for orthopaedic applications using the plasma spray method. The phase composition, surface and interface microstructure, coating thickness, surface roughness and bonding strength of the plasma-sprayed sphene coating were analysed using X-ray diffraction, scanning electron microscopy, atomic force microscopy and the standard mechanical testing of the American Society for Testing and Materials, respectively. The results indicated that sphene coating was obtained with a uniform and dense microstructure at the interface of the Ti-6Al-4V surface and the thickness and surface roughness of the coating were approximately 150 and 10 μm, respectively. Plasma-sprayed sphene coating on Ti-6Al-4V possessed a significantly improved bonding strength and chemical stability compared with plasma-sprayed hydroxyapatite (HAp) coating. Plasma-sprayed sphene coating supported human osteoblast-like cell (HOB) attachment and significantly enhanced HOB proliferation and differentiation compared with plasma-sprayed HAp coating and uncoated Ti-6Al-4V. Taken together, plasma-sprayed sphene coating on Ti-6Al-4V possessed excellent bonding strength, chemical stability and cellular bioactivity, indicating its potential application for orthopaedic implants. PMID:18664431

  4. The monoclinic superstructure of the M{sub 2}Pt{sub 6}Al{sub 15} series (M=Ca, Sc, Y, La, Lu)

    Energy Technology Data Exchange (ETDEWEB)

    Radzieowski, Mathis; Stegemann, Frank; Hoffmann, Rolf-Dieter [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Janka, Oliver [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Oldenburg Univ. (Germany). Inst. fuer Chemie

    2017-07-01

    The five ternary intermetallic compounds M{sub 2}Pt{sub 6}Al{sub 15} (M=Ca, Sc, Y, La, Lu) were prepared from the elements by arc-melting. The crystal structure was determined via single crystal X-ray diffraction. The title compounds crystallize in a superstructure of the RE{sub 0.67}Pt{sub 2}Al{sub 5} type structure (P6{sub 3}/mmc) in the monoclinic crystal system with space group P12{sub 1}/m1 (Sc{sub 2}Pt{sub 6}Al{sub 15}: a=734.19(2), b=1628.96(10), c=734.19(2) pm, β=119.999(3) ; wR=0.0356, 3034 F{sup 2} values, 68 variables). The superstructure can be derived by the superspace formalism using (3+2)D or (3+1)D interpretations of the diffraction data. The structural relation to the subcell structure is discussed on the basis of a group-subgroup scheme. In the crystal structure strongly bonded [Pt{sub 2}Al{sub 4}]{sup δ-} slabs are alternatingly stacked with ordered layers containing M atoms and Al{sub 3} triangles.

  5. Enhanced dielectric and ferroelectric characteristics in Ca-modified BaTiO3 ceramics

    Directory of Open Access Journals (Sweden)

    Xiao Na Zhu

    2013-08-01

    Full Text Available Synergic modification of BaTiO3 ceramics was investigated by Ca-substitution, and the superior dielectric and ferroelectric properties were determined together with the structure evolution. X-ray diffraction (XRD analysis demonstrated a large solubility limit above x = 0.25 in Ba1−xCaxTiO3 solid solution where the fine grain structure was observed with increasing x. Room temperature dielectric constant as high as 1655 was achieved in the present ceramics together with the significantly reduced dielectric loss of 0.013 (x = 0.20 at 100 kHz, where the Curie temperature kept almost a constant while other two transition temperatures decreased continuously with increasing x. More importantly, the remanent polarization Pr and dielectric strength Eb were significantly enhanced by Ca-substitution, and the best Pr (11.34 μC/cm2 and the highest dielectric strength Eb (75 kV/cm were acquired at x = 0.25. The present ceramics should be very desirable for the applications such as high density energy storage devices.

  6. Natural CaO-TiO2-SiO2 based ceramics

    Directory of Open Access Journals (Sweden)

    Jelena Pantić

    2011-06-01

    Full Text Available Lešnica river deposits consist of a large number of minerals of different grain sizes including sphene. Since it is very difficult to obtain pure monophase titanite by different synthetic routes (sol-gel, coprecipitation, combustion, spray pyrolysis and hydrothermal method, the aim of this work was to study the structure of the sphene from the Lešnica river deposits and possibility of using it as a natural precursor for CaO-TiO2-SiO2 based ceramics. The sphene from Lešnica was analyzed by different methods: tristimulus colorimetry, infrared spectroscopy, electron microprobe and X-ray single crystal diffraction. It was confirmed that Al, Fe, Mn and P are present in the sphene structure and proposed that corresponding structural formula could be: (Ca2+1.008 Mn2+0.0021.010(Ti4+0.901 Fe3+0.033 Al3+0.060 P5+0.0010.995 Si4+1.024 O2-5.

  7. Synthesis and characterization of CaTiO3 powder by combustion synthesis process

    International Nuclear Information System (INIS)

    Jung, C. W.; Shin, H. C.; Park, J. Y.; Lee, H. G.; Kim, H. Y.; Hong, K. W.

    2000-01-01

    Synroc is considered as a one of the most promising candidate for HLW solidification. CaTiO 3 , perovskite, which is a component of Synroc, can immobilize lanthanide and actinides by forming solid solutions. Generally most of the radioactive wastes elements were treated as a nitrate form. Therefore, the combustion process using metal nitrates as reactant materials can be easily applied to immobilize the radioactive waste elements. In this study, the feasibility of preparing fine, single-phase powders of multi-component oxide by a combustion process was investigated. Generally, the powder synthesized by combustion process showed different characteristics depending on the type and amount of fuel. And the spherical CaTiO 3 particles were directly prepared from the aqueous solution by an ultrasonic mist combustion process using an ultrasonic nebulizers as mist generators. The particles prepared with simple spray pyrolysis method using nitrate solution without fuel as precursor solution showed porous and hollow morphology, while the particles prepared with precursor solutions containing fuel showed dense solid morphology. Among various kinds of fuel tested, glycine showed the best result in reaction kinetics and crystalline phase purity

  8. Synthesis and characterization of CCTO (CaCu3Ti4O12)

    International Nuclear Information System (INIS)

    Fernandes, T.S.M.; Silva, M.A.S. da; Simao, S.H.C.; Silva, C.C.; Sombra, A.S.B.; Sales, J.C.

    2011-01-01

    The objective of this work is to study the ceramic material CCTO (CaCu 3 Ti 4 O 12 ) by X-Ray Diffraction. The CCTO is a material with a giant dielectric constant at room temperature and good temperature stability over a wide temperature and frequency ranges. The preparation method has a great influence on the structure and dielectric properties of this material. The CCTO was prepared by solid state method in a planetary high energy ball milling (Fritsch Pulverisette 5). Stoichiometric quantities of CaCO 3 (Aldrich 99%), TiO 2 (Merck 99%) and CuO (Analar 98%) were dry milled during 30h with a rotational speed of 370 rpm and then calcined at 1050 deg C for 12h. After, the CCTO was studied by X-ray diffraction (XRD). The refinement showed that the CCTO was formed with 100% mass, the graph of Williamson-Hall showed a homogeneous sample, with a contraction in the crystal lattice and a reasonably small particle size. (author)

  9. Fe-moment instability in Ti{sub 1-x}Sc{sub x}Fe{sub 2} Laves-phase compounds

    Energy Technology Data Exchange (ETDEWEB)

    Ouladdiaf, B. [Institut Laue-Langevin, BP 156, 38042 GRENOBLE Cedex 09 (France); Deportes, J. [Lab. Louis Neel, CNRS, BP 166, 38042 GRENOBLE Cedex 09 (France); Saoudi, M. [Centre Universitaire de Guelma, GUELMA 24 000 (Algeria)

    2002-07-01

    The magnetic properties of the pseudo-binary Laves-phase compounds Ti{sub 1-x}Sc{sub x}Fe{sub 2} were investigated by means of magnetisation and high-resolution powder neutron diffraction techniques. For x<0.2 a transition from an antiferromagnetic state to a canted one with a ferromagnetic component in the basal plane is observed, while for 0.2

  10. Reactive spark plasma synthesis of CaZrTi2O7 zirconolite ceramics for plutonium disposition

    Science.gov (United States)

    Sun, Shi-Kuan; Stennett, Martin C.; Corkhill, Claire L.; Hyatt, Neil C.

    2018-03-01

    Near single phase zirconolite ceramics, prototypically CaZrTi2O7, were fabricated by reactive spark plasma sintering (RSPS), from commercially available CaTiO3, ZrO2 and TiO2 reagents, after processing at 1200 °C for only 1 h. Ceramics were of theoretical density and formed with a controlled mean grain size of 1.9 ± 0.6 μm. The reducing conditions of RSPS afforded the presence of paramagnetic Ti3+, as demonstrated by EPR spectroscopy. Overall, this study demonstrates the potential for RSPS to be a disruptive technology for disposition of surplus separated plutonium stockpiles in ceramic wasteforms, given its inherent advantage of near net shape products and rapid throughput.

  11. DFT investigation of NH_3, PH_3, and AsH_3 adsorptions on Sc-, Ti-, V-, and Cr-doped single-walled carbon nanotubes

    International Nuclear Information System (INIS)

    Buasaeng, Prayut; Rakrai, Wandee; Wanno, Banchob; Tabtimsai, Chanukorn

    2017-01-01

    Highlights: • Transition metal-doped single wall carbon nanotubes and their adsorption with NH_3, PH_3 and AsH_3 molecules were investigated using a DFT method. • Adsorptions of NH_3, PH_3 and AsH_3 molecules on pristine single wall carbon nanotubeswere improved by transition metal doping. • Structural and electronic properties of single wall carbon nanotubes were significantly changed by transition metal doping and gas adsorptions. - Abstract: The adsorption properties of ammonia (NH_3), phosphine (PH_3), and arsine (AsH_3) on pristine and transition metal- (TM = Sc, Ti, V, and Cr) doped (5,5) armchair single-walled carbon nanotubes (SWCNTs) were theoretically investigated. The geometric and electronic properties and adsorption abilities for the most stable configuration of NH_3, PH_3, and AsH_3 adsorptions on pristine and TM-doped SWCNTs were calculated. It was found that the binding abilities of TMs to the SWCNT were in the order: Cr > V > Sc > Ti. However, the adsorption energy showed that the pristine SWCNT weakly adsorbed gas molecules and its electronic properties were also insensitive to gas molecules. By replacing a C atom with TM atoms, all doping can significantly enhance the adsorption energy of gas/SWCNT complexes and their adsorption ability was in the same order: NH_3 > PH_3 > AsH_3. A remarkable increase in adsorption energy and charge transfer of these systems was expected to induce significant changes in the electrical conductivity of the TM-doped SWCNTs. This work revealed that the sensitivity of SWCNT-based chemical gas adsorptions and sensors can be greatly improved by introducing an appropriate TM dopant. Accordingly, TM-doped SWCNTs are more suitable for gas molecule adsorptions and detections than the pristine SWCNT.

  12. Ab initio study of domain structures in half-metallic CoTi{sub 1−x}Mn{sub x}Sb and thermoelectric CoTi{sub 1−x}Sc{sub x}Sb half-Heusler alloys

    Energy Technology Data Exchange (ETDEWEB)

    Miranda Mena, Joaquin, E-mail: joaquin.miranda@uni-bayreuth.de; Schoberth, Heiko G.; Gruhn, Thomas; Emmerich, Heike

    2015-11-25

    We present first-principles calculations of the electronic density of state, the structures in CoTi{sub 1−x}Sc{sub x}Sb and CoTi{sub 1−x}Mn{sub x}Sb. In addition for the latter we calculate magnetic moments. Systems with different stoichiometries are compared and low energy configurations are determined using a cluster expansion procedure. For all studied manganese concentrations, x > 0, CoTi{sub 1−x}Mn{sub x}Sb is half-metallic and magnetic, which make it interesting for spintronic applications. In contrast, with increasing scandium concentration, the band gap of CoTi{sub x}Sc{sub 1-x}Sb closes continuously, while the material changes from a semiconductor to a non-magnetic metal. For low Sc doping this material is well suited for thermoelectric applications. The electronic states close to the Fermi energy are strongly influenced by the distribution of Ti and Mn (or Ti and Sc). This has important consequences for the usage of materials in application fields like spintronics and thermoelectrics. In general, a phase separation of the alloys into a Ti rich and a Ti poor phase is energetically favored. Using mean field theory we create a phase diagram that shows the coexistence and the spinodal region. A spontaneous demixing can be used for the creation of nanodomains within the material. In the case of CoTi{sub 1−x}Sc{sub x}Sb, the resulting reduced lattice thermal conductivity is beneficial for thermoelectric applications, while in CoTi{sub 1−x}Mn{sub x}Sb the nanodomains are detrimental for polarization.

  13. Influence of titanium precursor on photoluminescent emission of micro-cube-shaped CaTiO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Mazzo, Tatiana Martelli, E-mail: tatimazzo@gmail.com [Departamento de Ciências do Mar, Universidade Federal de São Paulo, Avenida Almameda Saldanha da Gama, 89, Ponta da Praia, CEP 11030-400 Santos, SP (Brazil); Santilli do Nascimento Libanori, Gabriela [Departamento de Ciências do Mar, Universidade Federal de São Paulo, Avenida Almameda Saldanha da Gama, 89, Ponta da Praia, CEP 11030-400 Santos, SP (Brazil); Moreira, Mario Lucio [Instituto de Física e Matemática, Universidade Federal de Pelotas, P.O. Box 354, Campus do Capão do Leão, 96001-970 Pelotas, RS (Brazil); Avansi Jr, Waldir [Departamento de Física, Universidade Federal de São Carlos, Jardim Guanabara, 13565-905 São Carlos, SP (Brazil); Mastelaro, Valmor Roberto [Instituto de Física de São Carlos, Universidade de São Paulo, Av. Trabalhador São Carlense, 400, Arnold Schimidt, 13566-590 São Carlos, SP (Brazil); Varela, José Arana; Longo, Elson [INCTMN/LIEC, Instituto de Química, Universidade Estadual Paulista, P.O. Box 355, R. Francisco Degni, 55, Bairro Quitandinha, 14801-907 Araraquara, SP (Brazil)

    2015-09-15

    For this research, we studied the influence of titanium tetrachloride (TC) and titanium tetraisopropoxide (TTP) precursors on CaTiO{sub 3} (CTO) synthesis by employing a microwave-assisted hydrothermal (MAH) method regarding their respective short-, medium- and long-range features to determine if the use of different titanium precursors enhances the structural evolution of the material. The growth mechanism for the formation of the micro-cube-shaped CTO is proposed to obtain nanoparticle aggregation of self-assembly nanoplates. The disorder coupled to the oxygen vacancies of [TiO{sub 5}]–[TiO{sub 6}] in complex clusters in the CTO 1 powder and twists in bonding between the [TiO{sub 6}]–[TiO{sub 6}] complex clusters in the CTO 2 powder were mainly responsible for photoluminescent (PL) emission. - Highlights: • Different titanium precursors enhance the structural evolution of the material. • [TiO{sub 5}]–[TiO{sub 6}] and twists in bonding [TiO{sub 6}]–[TiO{sub 6}] were responsible for PL emission. • Micro-cube shaped was formed by nanoparticle aggregation of self-assembly nanoplates.

  14. Influence of Ti4+ on the magnetic state of CaRu1-xTixO3

    International Nuclear Information System (INIS)

    Zorkovska, A.; Baran, A.; Bradaric, I.; Savic, I.; Sebek, J.; Santava, E.; Svoboda, P.; Marincev, D.; Kohout, S.; Keller, H.; Feher, A.

    2007-01-01

    In order to shed more light on the character of magnetic correlations at low temperatures in CaRuO 3 , the delicate effect of substituting nonmagnetic Ti 4+ for Ru 4+ in low concentrations (0.5-15%) has been investigated by magnetization, AC-susceptibility and specific heat measurements. Despite the clear features in magnetic measurement data at 34K no specific heat anomaly has been observed, nevertheless, two temperature regions with different magnetic characters have been identified. In pure CaRuO 3 significant low-temperature upturn of C/T is visible below 15K. This feature is suppressed by Ti substitution

  15. Synthesis of Nanoparticles of the Giant Dielectric Material, CaCu3Ti4O12 from a Precursor Route

    OpenAIRE

    Thomas, P.; Dwarakanath, K.; Varma, K. B. R.; Kutty, T. R. N.

    2013-01-01

    A complex oxalate precursor, CaCu3(TiO)4(C2O4)8.9H2O, was synthesized and the precipitate that obtained was confirmed to be monophasic by the wet chemical analyses, X-ray diffraction, FTIR absorption and TG, DTA analyses. The thermal decomposition of this oxalate precursor led to the formation of phase-pure calcium copper titanate, CaCu3Ti4O12, at 680oC. The bright field TEM micrographs revealed that the size of the as synthesized crystallites to be in the 30 to 80 nm range. The powders so ob...

  16. Nanoparticles of the giant dielectric material, CaCu3Ti4O12 from a precursor route

    OpenAIRE

    Thomas, P.; Dwarakanath, K.; Varma, K. B. R.; Kutty, T. R. N.

    2013-01-01

    A method of preparing the nanoparticles of CaCu3Ti4O12 (CCTO) with the crystallite size varying from 30 to 200 nm is optimized at a temperature as low as 680 1C from the exothermic thermal decomposition of an oxalate precursor, CaCu3(TiO)4(C2O4)8 ? 9H2O. The phase singularity of the complex oxalate precursor is confirmed by the wet chemical analyses, X-ray diffraction, FT-IR and TGA,DTA analyses. The UV Vis reflectance and ESR spectra of CCTO powders indicate that the Cu(II) coordination chan...

  17. Microstructure and electric characteristics of AETiO3 (AE=Mg, Ca, Sr doped CaCu3Ti4O12 thin films prepared by the sol–gel method

    Directory of Open Access Journals (Sweden)

    Dong Xu

    2015-10-01

    Full Text Available This paper focuses on the effects of alkline-earth metal titante AETiO3 (AE=Mg, Ca, Sr doping on the microstructure and electric characteristics of CaCu3Ti4O12 thin films prepared by the sol–gel method. The results showed that the grain size of CCTO thin films could be increased by MgTiO3 doping. The movement of the grain boundaries was impeded by the second phases of CaTiO3 and SrTiO3 concentrating at grain boundaries in CaTiO3 and SrTiO3 doped CCTO thin films. Rapid ascent of dielectric constant could be observed in 0.1Mg TiO3 doped CCTO thin films, which was almost as three times high as pure CCTO thin film and the descent of the dielectric loss at low frequency could also be observed. In addition, the nonlinear coefficient (α, threshold voltage (VT and leakage current (IL of AETiO3 doped CCTO thin films (AE=Mg, Ca, Sr showed different variation with the increasing content of the MgTiO3, CaTiO3 and SrTiO3.

  18. Critical thickness of high structural quality SrTiO3 films grown on orthorhombic (101) DyScO3

    International Nuclear Information System (INIS)

    Biegalski, M. D.; Trolier-McKinstry, S.; Schlom, D. G.; Fong, D. D.; Eastman, J. A.; Fuoss, P. H.; Streiffer, S. K.; Heeg, T.; Schubert, J.; Tian, W.; Nelson, C. T.; Pan, X. Q.; Hawley, M. E.; Bernhagen, M.; Reiche, P.; Uecker, R.

    2008-01-01

    Strained epitaxial SrTiO 3 films were grown on orthorhombic (101) DyScO 3 substrates by reactive molecular-beam epitaxy. The epitaxy of this substrate/film combination is cube on cube with a pseudocubic out-of-plane (001) orientation. The strain state and structural perfection of films with thicknesses ranging from 50 to 1000 A were examined using x-ray scattering. The critical thickness at which misfit dislocations was introduced was between 350 and 500 A. These films have the narrowest rocking curves (full width at half maximum) ever reported for any heteroepitaxial oxide film (0.0018 deg.). Only a modest amount of relaxation is seen in films exceeding the critical thicknesses even after postdeposition annealing at 700 deg. C in 1 atm of oxygen. The dependence of strain relaxation on crystallographic direction is attributed to the anisotropy of the substrate. These SrTiO 3 films show structural quality more typical of semiconductors such as GaAs and silicon than perovskite materials; their structural relaxation behavior also shows similarity to that of compound semiconductor films

  19. Critical thickness of high structural quality SrTiO{sub 3} films grown on orthorhombic (101) DyScO{sub 3}.

    Energy Technology Data Exchange (ETDEWEB)

    Biegalski, M. D.; Trolier-McKinstry, S.; Nelson, C. T.; Schlom, D. G.; Fong, D. D.; Eastman, J. A.; Fuoss, P. H.; Streiffer, S. K.; Heeg, T.; Schubert, J.; Tian, W.; Pan, X. Q.; Hawley, M. E.; Bernhagen, M.; Reiche, P.; Uecker, R.; Pennsylvania State Univ.; Forschungszentrum Julich; Univ. Michigan; LANL; Max-Born-Strabe

    2008-12-01

    Strained epitaxial SrTiO{sub 3} films were grown on orthorhombic (101) DyScO{sub 3} substrates by reactive molecular-beam epitaxy. The epitaxy of this substrate/film combination is cube on cube with a pseudocubic out-of-plane (001) orientation. The strain state and structural perfection of films with thicknesses ranging from 50 to 1000 {angstrom} were examined using x-ray scattering. The critical thickness at which misfit dislocations was introduced was between 350 and 500 {angstrom}. These films have the narrowest rocking curves (full width at half maximum) ever reported for any heteroepitaxial oxide film (0.0018{sup o}). Only a modest amount of relaxation is seen in films exceeding the critical thicknesses even after postdeposition annealing at 700 C in 1 atm of oxygen. The dependence of strain relaxation on crystallographic direction is attributed to the anisotropy of the substrate. These SrTiO{sub 3} films show structural quality more typical of semiconductors such as GaAs and silicon than perovskite materials; their structural relaxation behavior also shows similarity to that of compound semiconductor films.

  20. Quantitative analysis of UV excitation bands for red emissions in Pr3+-doped CaTiO3, SrTiO3 and BaTiO3 phosphors by peak fitting

    International Nuclear Information System (INIS)

    Fujiwara, Rei; Sano, Hiroyuki; Shimizu, Mikio; Kuwabara, Makoto

    2009-01-01

    A quantitative spectral analysis of the ultraviolet (UV) broad excitation bands, which are located in the range 300-400 nm, for red emissions at around 610 nm in Pr-doped CaTiO 3 , SrTiO 3 :Al and BaTiO 3 :Mg phosphors has been carried out using a peak fitting technique. The obtained results demonstrate that the UV broad band of CaTiO 3 :Pr consists of four primary excitation bands centered around 330, 335, 365 and 380 nm and those of both SrTiO 3 :Al and BaTiO 3 :Mg consist of three primary bands centered around 310, 345 and 370 nm. Based on the behavior patterns and the values of the respective primary excitation bands' parameters, i.e. center gravity (λ top ), maximum height (I max ) and full-width at half-maximum (FWHM), the UV-to-red relaxation processes in these titanate phosphors can be explained to be essentially the same, except for the existence of an additional relaxation pathway via electron-trap states in CaTiO 3 :Pr, which gives a characteristic shape of its UV excitation spectrum in the wavelength range of >360 nm

  1. Dielectric and electrical characteristics of Sr modified Ca1Cu3Ti4O12

    Science.gov (United States)

    Sahu, M.; Choudhary, R. N. P.; Roul, B. K.

    2018-05-01

    This paper mainly reports on the effect of Sr substitution on dielectric and electrical properties of CaCu3Ti4O12 at different temperature and frequency. Preliminary analysis of X-ray diffraction data of sintered samples confirms the reported cubic structure. Study of surface morphology shows that the surface of the samples contains well-defined and uniformly distributed grains. Some electrical parameters (permittivity, tangent loss and impedance) of the materials were measured and analyzed over a wide range of temperature (25 to 315 °C) and frequency (50 to 2x106 Hz). The ultra high dielectric constant and low energy dissipation have been observed in the said experimental conditions of phase-pure prepared compounds. It is expected that the addition of nano-size compounds or oxide will help to enhance the above properties useful for fabrication of super-capacitor.

  2. Microscopic origins of the large piezoelectricity of leadfree (Ba,Ca)(Zr,Ti)O3.

    Science.gov (United States)

    Nahas, Yousra; Akbarzadeh, Alireza; Prokhorenko, Sergei; Prosandeev, Sergey; Walter, Raymond; Kornev, Igor; Íñiguez, Jorge; Bellaiche, L

    2017-06-20

    In light of directives around the world to eliminate toxic materials in various technologies, finding lead-free materials with high piezoelectric responses constitutes an important current scientific goal. As such, the recent discovery of a large electromechanical conversion near room temperature in (1-x)Ba(Zr 0.2 Ti 0.8 )O 3 -x(Ba 0.7 Ca 0.3 )TiO 3 compounds has directed attention to understanding its origin. Here, we report the development of a large-scale atomistic scheme providing a microscopic insight into this technologically promising material. We find that its high piezoelectricity originates from the existence of large fluctuations of polarization in the orthorhombic state arising from the combination of a flat free-energy landscape, a fragmented local structure, and the narrow temperature window around room temperature at which this orthorhombic phase is the equilibrium state. In addition to deepening the current knowledge on piezoelectricity, these findings have the potential to guide the design of other lead-free materials with large electromechanical responses.

  3. Synthesis of Cr-doped CaTiSiO5 ceramic pigments by spray drying

    International Nuclear Information System (INIS)

    Lyubenova, T. Stoyanova; Matteucci, F.; Costa, A.L.; Dondi, M.; Ocana, M.; Carda, J.

    2009-01-01

    Cr-doped CaTiSiO 5 was synthesized by spray drying and conventional ceramic method in order to assess its potential as ceramic pigment. The evolution of the phase composition with thermal treatment was investigated by X-ray powder diffraction (XRPD) and thermal analyses (DTA-TGA-EGA). Powder morphology and particle size distribution were analyzed by scanning electron microscopy (SEM) and laser diffraction, respectively. The color efficiency of pigments was evaluated by optical spectroscopy (UV-vis-NIR) and colorimetric analysis (CIE Lab). Results proved that spray drying is an efficient procedure to prepare highly reactive pigment precursors. The spray-dried powders consist of hollow spherical particles with aggregate size in the 1-10 μm range, developing a brown coloration. Optical spectra reveal the occurrence of Cr(III) and Cr(IV), both responsible for the brown color of this pigment. The former occupies the octahedral site of titanite, in substitution of Ti(IV), while the latter is located at the tetrahedral site, where replaces Si(IV)

  4. Study of the structural and electrical behavior of Bi(Mg,TiO3 modified (Ba,CaTiO3 ceramics

    Directory of Open Access Journals (Sweden)

    Md. Kashif Shamim

    2016-12-01

    Full Text Available The ability of BaTiO3 to form solid solutions with different dopants (both iso- and aliovalent makes it versatile for various applications. In the present study, (Ba,CaTiO3 (BCT is modified with Bi(MgTiO3 (BMT in search for new lead-free ferroelectric material and improve their properties. For this purpose, BCT acts as a main base material and BMT acts as a modifier to fabricate a multifunctional material. In this study, we report the structural and electrical properties of lead free piezo-ceramics (1−x(Ba0.8Ca0.2TiO3–xBi(Mg0.5Ti0.5O3 with x=0.2, 0.4, 0.5 prepared by solid-state sintering technique. Single perovskite phase with tetragonal structure is obtained for all the compositions, which is reconfirmed by the Raman Spectroscopic study. Dielectric study confirm the temperature stable behavior of the dielectric permittivity values above 300∘C. The dielectric constant value decreases with increase in BMT doping content. Impedance Spectroscopic study confirms non-Debye type dielectric relaxation in the specimen. The Nyquist plot and conductivity studies show the negative temperature coefficient of resistance behavior (NTCR of the samples.

  5. Investigation of the stability of glass-ceramic composites containing CeTi2O6 and CaZrTi2O7 after ion implantation

    Science.gov (United States)

    Paknahad, Elham; Grosvenor, Andrew P.

    2017-12-01

    Glass-ceramic composite materials have been investigated for nuclear waste sequestration applications due to their ability to incorporate large amounts of radioactive waste elements. A key property that needs to be understood when developing nuclear waste sequestration materials is how the structure of the material responds to radioactive decay of nuclear waste elements, which can be simulated by high energy ion implantation. Borosilicate glass-ceramic composites containing brannerite-type (CeTi2O6) or zirconolite-type (CaZrTi2O7) oxides were synthesized at different annealing temperatures and investigated after being implanted with high-energy Au ions to mimic radiation induced structural damage. Backscattered electron (BSE) images were collected to investigate the interaction of the brannerite crystallites with the glass matrix before and after implantation and showed that the morphology of the crystallites in the composite materials were not affected by radiation damage. Surface sensitive Ti K-edge glancing angle XANES spectra collected from the implanted composite materials showed that the structures of the CeTi2O6 and CaZrTi2O7 ceramics were damaged as a result of implantation; however, analysis of Si L2,3-edge XANES spectra indicated that the glass matrix was not affected by ion implantation.

  6. Investigation of the stability of glass-ceramic composites containing CeTi 2 O 6 and CaZrTi 2 O 7 after ion implantation

    Energy Technology Data Exchange (ETDEWEB)

    Paknahad, Elham; Grosvenor, Andrew P.

    2017-12-01

    Glass-ceramic composite materials have been investigated for nuclear waste sequestration applications due to their ability to incorporate large amounts of radioactive waste elements. A key property that needs to be understood when developing nuclear waste sequestration materials is how the structure of the material responds to radioactive decay of nuclear waste elements, which can be simulated by high energy ion implantation. Borosilicate glass-ceramic composites containing brannerite-type (CeTi2O6) or zirconolite-type (CaZrTi2O7) oxides were synthesized at different annealing temperatures and investigated after being implanted with high-energy Au ions to mimic radiation induced structural damage. Backscattered electron (BSE) images were collected to investigate the interaction of the brannerite crystallites with the glass matrix before and after implantation and showed that the morphology of the crystallites in the composite materials were not affected by radiation damage. Surface sensitive Ti K-edge glancing angle XANES spectra collected from the implanted composite materials showed that the structures of the CeTi2O6 and CaZrTi2O7 ceramics were damaged as a result of implantation; however, analysis of Si L2,3-edge XANES spectra indicated that the glass matrix was not affected by ion implantation.

  7. Room temperature magnetic and dielectric properties of cobalt doped CaCu3Ti4O12 ceramics

    Science.gov (United States)

    Mu, Chunhong; Song, Yuanqiang; Wang, Haibin; Wang, Xiaoning

    2015-05-01

    CaCu3Ti4-xCoxO12 (x = 0, 0.2, 0.4) ceramics were prepared by a conventional solid state reaction, and the effects of cobalt doping on the room temperature magnetic and dielectric properties were investigated. Both X-ray diffraction and energy dispersive X-ray spectroscopy confirmed the presence of Cu and Co rich phase at grain boundaries of Co-doped ceramics. Scanning electron microscopy micrographs of Co-doped samples showed a striking change from regular polyhedral particle type in pure CaCu3Ti4O12 (CCTO) to sheet-like grains with certain growth orientation. Undoped CaCu3Ti4O12 is well known for its colossal dielectric constant in a broad temperature and frequency range. The dielectric constant value was slightly changed by 5 at. % and 10 at. % Co doping, whereas the second relaxation process was clearly separated in low frequency region at room temperature. A multirelaxation mechanism was proposed to be the origin of the colossal dielectric constant. In addition, the permeability spectra measurements indicated Co-doped CCTO with good magnetic properties, showing the initial permeability (μ') as high as 5.5 and low magnetic loss (μ″ < 0.2) below 3 MHz. And the interesting ferromagnetic superexchange coupling in Co-doped CaCu3Ti4O12 was discussed.

  8. Uncertainty estimation of analysis of Fe, Ca, Zr, Ba, La, Ti and Ce in sediment sample using XRF method

    International Nuclear Information System (INIS)

    Sukirno; Agus Taftazani

    2010-01-01

    An uncertainty of analysis of Fe, Ca, Zr, Ba, La, Ti and Ce in river sediment of Panfuran Wariness sample by X RF method has been done. The result value of testing is meaningless if it isn't completed without uncertainty value. The calculation of Ba metal have been presented for example. The aim of the research is to get accreditation certificate of X-Ray Fluorescence method on laboratory of analytical PTAPB – BATAN as well as ISO guide 17025-2005. The result of calculation uncertainty of Fe, Zr, Ba, La, Ce, Ti and Ca analysis showed that the uncertainty components come from: preparation of sample and standard/comparator, purity of material, counting statistic (sample and standard ) and repeatability. The results showed that metals in river sediment of Pancuran Wonosari were Fe = 7.290%, Zr = 54.5 mg/kg, Ba = 1661.6 mg/kg, La = 22.9 mg/kg, Ce = 161.0 mg/kg, Ti = 3193.2 and Ca = 7.816%, and the result of uncertainty estimate of Fe, Zr, Ba, La, Ce, Ti and Ca were ± 0.60%, ± 4.5 mg/kg, ± 55 mg/kg, ± 1.4 mg/kg, 12.0 mg/kg, ± 208 mg/kg and ± 0.61%. (author)

  9. Rates for some reactions involving 42Ca and 44Ca

    International Nuclear Information System (INIS)

    Cheng, C.W.; King, J.D.

    1980-01-01

    Ground-state reaction rates have been deduced from recent cross section measurements for the 42 CA(α, n) 45 Ti, 42 Ca(p, γ) 43 Sc, and 44 Ca(p, n) 44 Sc reactions. Comparison of these rates with those calculated from a statistical model of nuclear reactions. (Woosley et al) shows good agreement for the first two, but the 44 Ca(p, n) rate is more than a factor of 2 less than the theoretical prediction. Stellar reaction rates have been derived from the ground-state rates by multiplying the ground-state rates by the ratio of stellar to ground-state rates given by the statistical model. Both ground-state and stellar rates have been represented by analytic functions of the temperature. The role of these reactions in the approach to quasi-equilibrium during explosive silicon burning is discussed

  10. In situ scanning tunneling microscopy study of Ca-modified rutile TiO2(110 in bulk water

    Directory of Open Access Journals (Sweden)

    Giulia Serrano

    2015-02-01

    Full Text Available Despite the rising technological interest in the use of calcium-modified TiO2 surfaces in biomedical implants, the Ca/TiO2 interface has not been studied in an aqueous environment. This investigation is the first report on the use of in situ scanning tunneling microscopy (STM to study calcium-modified rutile TiO2(110 surfaces immersed in high purity water. The TiO2 surface was prepared under ultrahigh vacuum (UHV with repeated sputtering/annealing cycles. Low energy electron diffraction (LEED analysis shows a pattern typical for the surface segregation of calcium, which is present as an impurity on the TiO2 bulk. In situ STM images of the surface in bulk water exhibit one-dimensional rows of segregated calcium regularly aligned with the [001] crystal direction. The in situ-characterized morphology and structure of this Ca-modified TiO2 surface are discussed and compared with UHV-STM results from the literature. Prolonged immersion (two days in the liquid leads to degradation of the overlayer, resulting in a disordered surface. X-ray photoelectron spectroscopy, performed after immersion in water, confirms the presence of calcium.

  11. Improvement in antibacterial properties of Ti by electrodeposition of biomimetic Ca-P apatite coat on anodized titania

    Energy Technology Data Exchange (ETDEWEB)

    Gad El-Rab, Sanaa M.F. [Biotechnology Department, Faculty of Science, Taif University, Taif (Saudi Arabia); Botany Department, Faculty of Science, Asuit University, Asuit (Egypt); Fadl-allah, Sahar A., E-mail: Sahar.fadlallah@yahoo.com [Materials and Corrosion Lab (MCL), Faculty of Science, Taif University, Taif (Saudi Arabia); Chemistry Department, Faculty of Science, Cairo University, Cairo (Egypt); Montser, A.A. [Materials and Corrosion Lab (MCL), Faculty of Science, Taif University, Taif (Saudi Arabia); Chemistry Department, Faculty of Science, South-Valley University (Egypt)

    2012-11-15

    Highlights: Black-Right-Pointing-Pointer Ca-P coating on titania titanium surface was directly fabricated successfully by electrochemical deposition. Black-Right-Pointing-Pointer Treatment the titanium surface by TiO{sub 2} could improve the adhesion strength between the Ca-P coating and the surface. Black-Right-Pointing-Pointer Anodization treatment in phosphoric acid is benefit to inhibit the oral bacteria. Black-Right-Pointing-Pointer According to the electrochemical corrosion test, corrosion resistance of Ti was improved by both anodization and electrodeposition of the Ca-P/titania coating. Black-Right-Pointing-Pointer Ca-P/titania sample is believed to be a functional biomaterial which combines antibacterial activity and good corrosion resistance in bioenvironment. - Abstract: Titanium metal (Ti) with antibacterial function was successfully developed in the present study by electrodeposition of biomimetic Ca-P coat in simple supersaturated calcium and phosphate solution (SCPS). The electrochemical behavior and corrosion resistance of Ca-P deposited on anodized titanium (AT) have been investigated in SCPS by using electrochemical impedance spectroscopy (EIS). The plate-counting method was used to evaluate the antibacterial performance against Staphylococcus aureus (ATCC6538). In vitro antibacterial activity study indicated a significantly reduced number of bacteria S. aureus on Ca-P/AT plate surface when compared with that on Ti or AT surfaces and the corresponding antibacterial mechanism is discussed. The morphology and chemical structure of different titanium samples were systematically investigated by scanning electron microscope (SEM) and energy dispersive X-ray analysis (EDX). The study confirmed that the antibacterial properties of the samples were related to chemical composition of sample surface.

  12. REACTION RATE SENSITIVITY OF 44Ti PRODUCTION IN MASSIVE STARS AND IMPLICATIONS OF A THICK TARGET YIELD MEASUREMENT OF 40Ca(α, γ)44Ti

    International Nuclear Information System (INIS)

    Hoffman, R. D.; Sheets, S. A.; Burke, J. T.; Scielzo, N. D.; Norman, E. B.; Tumey, S.; Brown, T. A.; Grant, P. G.; Hurst, A. M.; Stoyer, M. A.; Wooddy, T.; Fisker, J. L.; Bleuel, D.; Rauscher, T.; Phair, L.

    2010-01-01

    We evaluate two dominant nuclear reaction rates and their uncertainties that affect 44 Ti production in explosive nucleosynthesis. Experimentally we develop thick target yields for the 40 Ca(α, γ) 44 Ti reaction at E α = 4.13, 4.54, and 5.36 MeV using γ-ray spectroscopy. At the highest beam energy, we also performed an activation measurement which agrees with the thick target result. From the measured yields a stellar reaction rate was developed that is smaller than current statistical-model calculations and recent experimental results, which would suggest lower 44 Ti production in scenarios for the α-rich freezeout. Special attention has been paid to assessing realistic uncertainties of stellar reaction rates produced from a combination of experimental and theoretical cross sections. With such methods, we also develop a re-evaluation of the 44 Ti(α, p) 47 V reaction rate. Using these two rates we carry out a sensitivity survey of 44 Ti synthesis in eight expansions representing peak temperature and density conditions drawn from a suite of recent supernova explosion models. Our results suggest that the current uncertainty in these two reaction rates could lead to as large an uncertainty in 44 Ti synthesis as that produced by different treatments of stellar physics.

  13. Studies of the effects of TiCl3 in LiBH4/CaH2/TiCl3 reversible hydrogen storage system

    International Nuclear Information System (INIS)

    Liu Dongan; Yang Jun; Ni Jun; Drews, Andy

    2012-01-01

    Highlights: ► We systematically studied the effects of TiCl 3 in LiBH 4 /CaH 2 /TiCl 3 hydrogen storage system. ► It is found that adding 0.25 TiCl 3 produces fully reversible hydrogen absorption and desorption and a lower desorption temperature. ► LiCl experiences four different states, i.e. “formed-solid solution-molten solution-precipitation”, in the whole desorption process of the system. ► The incorporation of LiCl into LiBH 4 forms more viscous molten LiBH 4 ·LiCl, leading to fast kinetics. ► The precipitation and re-incorporation of LiCl into LiBH 4 lead to a fully reversible complex hydrogen storage system. - Abstract: In the present study, the effects of TiCl 3 on desorption kinetics, absorption/desorption reversibility, and related phase transformation processes in LiBH 4 /CaH 2 /TiCl 3 hydrogen storage system was studied systematically by varying its concentration (x = 0, 0.05, 0.15 and 0.25). The results show that LiCl forms during ball milling of 6LiBH 4 /CaH 2 /xTiCl 3 and that as temperature increases, o-LiBH 4 transforms into h-LiBH 4 , into which LiCl incorporates, forming solid solution of LiBH 4 ·LiCl, which melts above 280 °C. Molten LiBH 4 ·LiCl is more viscous than molten LiBH 4 , preventing the clustering of LiBH 4 and the accompanied agglomeration of CaH 2 , and thus preserving the nano-sized phase arrangement formed during ball milling. Above 350 °C, the molten solution LiBH 4 ·LiCl further reacts with CaH 2 , precipitating LiCl. The main hydrogen desorption reaction is between molten LiBH 4 ·LiCl and CaH 2 and not between molten LiBH 4 and CaH 2 . This alters the hydrogen reaction thermodynamics and lowers the hydrogen desorption temperature. In addition, the solid–liquid nano-sized phase arrangement in the nano-composites improves the hydrogen reaction kinetics. The reversible incorporation/precipitation of LiCl at the hydrogen reaction temperature and during temperature cycling makes the 6LiBH 4 /CaH 2 /0.25TiCl 3

  14. Enhanced Mechanical Properties of MgZnCa Bulk Metallic Glass Composites with Ti-Particle Dispersion

    Directory of Open Access Journals (Sweden)

    Pei Chun Wong

    2016-05-01

    Full Text Available Rod samples of Mg60Zn35Ca5 bulk metallic glass composites (BMGCs dispersed with Ti particles have been successfully fabricated via injection casting. The glass forming ability (GFA and the mechanical properties of these Mg-based BMGCs have been systematically investigated as a function of the volume fraction (Vf of Ti particles. The results showed that the compressive ductility increased with Vf. The mechanical performance of these BMGCs, with up to 5.4% compressive failure strain and 1187 MPa fracture strength at room temperature, can be obtained for the Mg-based BMGCs with 50 vol % Ti particles, suggesting that these dispersed Ti particles can absorb the energy of the crack propagations and can induce branches of the primary shear band into multiple secondary shear bands. It follows that further propagation of the shear band is blocked, enhancing the overall plasticity.

  15. Synthesis and Piezoelectric Properties of Li, Ca and Mn-codoped BaTiO3 by a Solvothermal Approach

    International Nuclear Information System (INIS)

    Kimura, T; Dong, Q; Yin, S; Sato, T; Hashimoto, T; Sasaki, A; Aisawa, S

    2013-01-01

    3 at.% Li-doped (Ba 1-x Ca x )(Ti 1-y Mn y )O 3 particles with the Ca 2+ mole fraction, x, of 0–0.09 and Mn mole fraction, y, of 0 and 0.0005 were synthesized by a solvothermal approach at 200°C. The products consisted of nanoparticles of 50–100 nm in diameter, and did not change very much depending on the amount of Li, Ca and Mn-codoping. The change in relative dielectric constant, Δε r , in around room temperature decreased by doping Ca 2+ , and the lowest Δε r (4.51%) could be realized at x value of 0.03. The mechanical quality factor, Q m , of 3 at.% Li-doped (Ba 0.97 Ca 0.03 )(Ti 0.9995 Mn 0.0005 )O 3 increased to 521, and Δε r decreased to 1.72%, while the piezoelectric constant, d 33 (234pC/N), and electromechanical coupling factor, k p (40.0%), did not change very much compared with 3 at.% Li-doped BaTiO 3

  16. Dielectric and piezoelectric properties of sol-gel derived Ca doped PbTiO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Chauhan, Arun Kumar Singh [Department of Physics and Astrophysics, University of Delhi, Delhi 110007 (India); Gupta, Vinay [Department of Physics and Astrophysics, University of Delhi, Delhi 110007 (India)]. E-mail: drvin_gupta@rediffmail.com; Sreenivas, K. [Department of Physics and Astrophysics, University of Delhi, Delhi 110007 (India)

    2006-06-15

    Synthesis of Ca doped PbTiO{sub 3} powder by a chemically derived sol-gel process is described. Crystallization characteristics of different compositions Pb{sub 1-x}Ca {sub x}TiO{sub 3} (PCT) with varying calcium (Ca) content in the range x = 0-0.45 has been investigated by DTA/TGA, X-ray diffraction and scanning electron microscopy. The crystallization temperature is found to decrease with increasing calcium content. X-ray diffraction reveals a tetragonal structure for PCT compositions with x {<=} 0.35, and a cubic structure for x = 0.45. Dielectric properties on sintered ceramics prepared with fine sol-gel derived powders have been measured. The dielectric constant is found to increase with increasing Ca content, and the dielectric loss decreases continuously. Sol-gel derived Pb{sub 1-x}Ca {sub x}TiO{sub 3} ceramics with x = 0.45 after poling exhibit infinite electromechanical anisotropy (k {sub t}/k {sub p}) with a high d {sub 33} = 80 pC/N, {epsilon}' = 298 and low dielectric loss (tan {delta} = 0.0041)

  17. PATRIMÔNIO CULTURAL E TURISMO: um estudo de caso do Filò Talian realizado em Caçador (SC

    Directory of Open Access Journals (Sweden)

    Kênia Zanella

    2017-09-01

    Full Text Available Este artigo tem como objetivo compreender como o Filò, costume dos imigrantes italianos, poderá ser preservado através da atividade turística no município de Caçador (SC. Trata-se de uma pesquisa qualitativa e exploratória, tendo como método o estudo de caso. Como resultados, verificou-se que o evento ainda se desenvolve de forma familiar e mantém muitas das características originais dos imigrantes, preservando a cultura dos antepassados e despertando o interesse da população local e de outros municípios. Constatou-se, também, que para se tornar um produto turístico, faz-se necessária a ampliação do evento e adaptações em relação à infraestrutura e mão de obra para o atendimento a um público maior ou então manter suas características originais e dedicá-lo ao turismo de experiência, onde o turista poderá vivenciar a realidade local e trocar saberes com a comunidade visitada.

  18. Study of new sheep bone and Zn/Ca ratio around TiAlV screw: PIXE RBS analysis

    Science.gov (United States)

    Guibert, G.; Munnik, F.; Langhoff, J. D.; Von Rechenberg, B.; Buffat, Ph. A.; Laub, D.; Faber, L.; Ducret, F.; Gerber, I.; Mikhailov, S.

    2008-03-01

    This study reports on in vivo particle induced X-ray emission (PIXE) measurements combined with Rutherford backscattering spectroscopy (RBS) analyses of new remodeled sheep bone formed around TiAlV screws. The implants (screws) were anodized by a modified TiMax™ process. The interface between the implant and the bone was carefully investigated. [Zn]/[Ca] in-depth composition profiles as well as Ca, Fe elemental maps were recorded. The thickness of new bone formed around the screw reached 300-400 μm. Osteon and Osteoid phases were identified in the new bone. A higher [Zn]/[Ca] ratio was observed in the new bone as compared to the mature bone. Blood vessels were observed in the bone in close contact with the screw. This study shows the potential of ion beam analysis for biological and biomedical characterization.

  19. Study of new sheep bone and Zn/Ca ratio around TiAlV screw: PIXE-RBS analysis

    International Nuclear Information System (INIS)

    Guibert, G.; Munnik, F.; Langhoff, J.D.; Von Rechenberg, B.; Buffat, Ph.A.; Laub, D.; Faber, L.; Ducret, F.; Gerber, I.; Mikhailov, S.

    2008-01-01

    This study reports on in vivo particle induced X-ray emission (PIXE) measurements combined with Rutherford backscattering spectroscopy (RBS) analyses of new remodeled sheep bone formed around TiAlV screws. The implants (screws) were anodized by a modified TiMax TM process. The interface between the implant and the bone was carefully investigated. [Zn]/[Ca] in-depth composition profiles as well as Ca, Fe elemental maps were recorded. The thickness of new bone formed around the screw reached 300-400 μm. Osteon and Osteoid phases were identified in the new bone. A higher [Zn]/[Ca] ratio was observed in the new bone as compared to the mature bone. Blood vessels were observed in the bone in close contact with the screw. This study shows the potential of ion beam analysis for biological and biomedical characterization

  20. Influence of Ti{sup 4+} on the magnetic state of CaRu{sub 1-x}Ti{sub x}O{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Zorkovska, A. [Centre of Low Temperature Physics of the Faculty of Science UPJS and Institute of Experimental Physics SAS, 04154 Kosice (Slovakia)]. E-mail: anna.zorkovska@upjs.sk; Baran, A. [Centre of Low Temperature Physics of the Faculty of Science UPJS and Institute of Experimental Physics SAS, 04154 Kosice (Slovakia); Bradaric, I. [' Vinca' Institute of Nuclear Sciences, 11001 Belgrade (Serbia and Montenegro); Savic, I. [Faculty of Physics, University of Belgrade, 11000 Belgrade (Serbia and Montenegro); Sebek, J. [Institute of Physics AS CR, 18221 Prague (Czech Republic); Santava, E. [Institute of Physics AS CR, 18221 Prague (Czech Republic); Svoboda, P. [Faculty of Mathematics and Physics, Charles University, DES, 12116 Prague (Czech Republic); Marincev, D. [Department of Physics, Military Academy, 11000 Belgrade (Serbia and Montenegro); Kohout, S. [Physik Inst. der Universitaet Zuerich, CH 80-57 Zurich (Switzerland); Keller, H. [Physik Inst. der Universitaet Zuerich, CH 80-57 Zurich (Switzerland); Feher, A. [Centre of Low Temperature Physics of the Faculty of Science UPJS and Institute of Experimental Physics SAS, 04154 Kosice (Slovakia)

    2007-09-15

    In order to shed more light on the character of magnetic correlations at low temperatures in CaRuO{sub 3}, the delicate effect of substituting nonmagnetic Ti{sup 4+} for Ru{sup 4+} in low concentrations (0.5-15%) has been investigated by magnetization, AC-susceptibility and specific heat measurements. Despite the clear features in magnetic measurement data at 34K no specific heat anomaly has been observed, nevertheless, two temperature regions with different magnetic characters have been identified. In pure CaRuO{sub 3} significant low-temperature upturn of C/T is visible below 15K. This feature is suppressed by Ti substitution.

  1. Interrelation between domain structures and polarization switching in hybrid improper ferroelectric Ca3(Mn,Ti)2O7

    Science.gov (United States)

    Gao, Bin; Huang, Fei-Ting; Wang, Yazhong; Kim, Jae-Wook; Wang, Lihai; Lim, Seong-Joon; Cheong, Sang-Wook

    2017-05-01

    Ca3Mn2O7 and Ca3Ti2O7 have been proposed as the prototypical hybrid improper ferroelectrics (HIFs), and a significant magnetoelectric (ME) coupling in magnetic Ca3Mn2O7 is, in fact, reported theoretically and experimentally. Although the switchability of polarization is confirmed in Ca3Ti2O7 and other non-magnetic HIFs, there is no report of switchable polarization in the isostructural Ca3Mn2O7. We constructed the phase diagram of Ca3Mn2-xTixO7 through our systematic study of a series of single crystalline Ca3Mn2-xTixO7 (x = 0, 0.1, 1, 1.5, and 2). Using transmission electron microscopy, we have unveiled the unique domain structure of Ca3Mn2O7: the high-density 90° stacking of a- and b-domains along the c-axis due to the phase transition through an intermediate Acca phase and the in-plane irregular wavy ferroelastic twin domains. The interrelation between domain structures and physical properties is unprecedented: the stacking along the c-axis prevents the switching of polarization and causes the irregular in-plane ferroelastic domain pattern. In addition, we have determined the magnetic phase diagram and found complex magnetism of Ca3Mn2O7 with isotropic canted moments. These results lead to negligible observable ME coupling in Ca3Mn2O7 and guide us to explore multiferroics with large ME coupling.

  2. A comparative study of the Aurivillius phase ferroelectrics CaBi 4Ti 4O 15 and BaBi 4Ti 4O 15

    Science.gov (United States)

    Tellier, J.; Boullay, Ph.; Manier, M.; Mercurio, D.

    2004-06-01

    The room temperature structures of the four-layer Aurivillius phase ferroelectrics CaBi 4Ti 4O 15 and BaBi 4Ti 4O 15 are determined by means of single crystal X-ray diffraction. Regarding the CaBi 4Ti 4O 15 phase, in agreement with the tolerance factor, a significant deformation of the perovskite blocks is observed. The rotation system of the octahedra is typical from even layer Aurivillius phases and leads to the use of the space group A2 1am. For the BaBi 4Ti 4O 15 phase, only a weak variation with respect to the F2 mm space group can be suggested from single crystal X-ray diffraction. A significant presence of Ba atoms in the [ M2O 2] slabs is confirmed in agreement with the previous works but specific Ba 2+ and Bi 3+ sites have to be considered due to the large difference in bounding requirement of these cations. Possible origins for the ferroelectric relaxor behavior of the Ba-based compound are discussed in view of the presented structural analyses.

  3. Phase evaluation of YSZ upon doping with Ta"5"+, Ti"4"+ and Ca"2"+ with combined Raman and XRD analysis

    International Nuclear Information System (INIS)

    Bhattacharya, A.; Shklover, V.; Wermelinger, T.

    2012-01-01

    To improve the phase stability of 7YSZ (7 wt%-Y_2O_3-doped ZrO_2), it has been doped with larger (Ca"2"+) and smaller (Ti"4"+ or Ta"5"+) ions. Complementary Raman and XRD studies of these stabilized systems have been performed. The tetragonal symmetry of the Ta"5"+-ion-doped YSZ sample and the Ti"4"+-doped YSZ sample, and the cubic symmetry of Ca"2"+-doped YSZ have been confirmed both by means of XRD and Raman analyses. Raman scattering measurements show shifts of characteristic peaks when the YSZ is doped with Ta"5"+, Ti"4"+ and Ca"2"+ cations. The peak shift increased with increasing dopant concentration in the ZrO_2 lattice. The Ta-doped YSZ sample heat-treated below 1500 C contained some YTaO_4 phase, which was confirmed by means of XRD as well as by Raman spectroscopy. The effect of Ca"2"+ ion doping on the Raman peak shift was much higher than that of Y"3"+ ion doping. In this work it has been highlighted that Raman spectroscopy is a useful tool complementing XRD, for qualitative comparison of the doping effect on the lattice parameters of ZrO_2.

  4. Investigation of structural and optical properties of CaTiO3 powders doped with Mg2+ and Eu3+ ions

    International Nuclear Information System (INIS)

    Oliveira, Larissa H.; Savioli, Julia; Moura, Ana P. de; Nogueira, Içamira C.; Li, Maximo S.; Longo, Elson; Varela, José A.; Rosa, Ieda L.V.

    2015-01-01

    In this work, CaTiO 3 powders doped with Mg 2+ ions and CaTiO 3 powders co-doped with Mg 2+ and Eu 3+ ions were prepared by the polymeric precursor method (PPM). These powders were characterized by different characterization techniques to study the influence of Mg 2+ doping as well as Mg 2+ and Eu 3+ co-doping in structural and optical properties of CaTiO 3 perovskite-type structure. The Rietveld refinement and Micro-Raman analyses suggested the substitution Mg 2+ and Eu 3+ ions in the A-site of CaTiO 3 perovskite. The influence of Mg 2+ doping can be detected by the displacement of calcium and oxygen atomic positions when compared to the non-doped CaTiO 3 powder. When Eu 3+ ions are added to the A-site of this perovskite the excess of positive charge can be compensated by the formation of calcium vacancies. Luminescence data showed that Ca 1-x Mg x TiO 3 and Ca 1x Mg x/2 Eu 2y/3 TiO 3 powders are potential materials for fabrication of lighting devices based on near-UV and blue LED using an excitation wavelength of 397 and/or 450 nm. - Highlights: • CaTiO 3 co-doped with Mg 2+ and Eu 3+ were obtained by the Polymeric Precursor Method. • Incorporation of Mg 2+ and Eu 3+ ions in the CaTiO 3 lattice. • Enhancement of the Eu 3+ photoluminescence

  5. Enhanced photoluminescence and thermal stability of divalent ions (Zn2+, Mg2+) assisted CaTiO3:Eu3+ perovskite phosphors for lighting applications

    Science.gov (United States)

    Singh, Dhananjay Kumar; Manam, J.

    2018-03-01

    Current study proposes the improved red emission of Zn2+ and Mg2+ ions incorporated CaTiO3:Eu3+ phosphors synthesized via the well-known solid-state reaction method. Under the 397 nm UV excitation, the Zn2+- and Mg2+-incorporated CaTiO3:0.15Eu3+ phosphor having orthorhombic structure with space group Pbnm exhibited an intense red emission at 619 nm. This can be credited to the hypersensitive 5D0 → 7F2 transition of Eu3+ ions, which is also indicative of the fact that the Eu3+ ions populated the non-inversion symmetry sites in the CaTiO3 lattices. The optimized composition CaTiO3:0.15Eu3+, 0.20Zn2+ and CaTiO3:0.15Eu3+, 0.10Mg2+ phosphors, pronounces in a magnificent enhancement of PL intensity by 5.5 and 2.5 times, respectively, as compared to CaTiO3:0.15 Eu3+ phosphor. From the temperature-dependent emission spectra, ΔEa were enunciated to be 0.101 and 0.086 eV for CaTiO3:0.15Eu3+, 0.20Zn2+ and CaTiO3:0.15Eu3+, 0.10Mg2+ phosphors, respectively, for thermal quenching. In addition, it can be better understood as related to the adequate thermal stability of 60% even at 450 and 420 K, respectively. Furthermore, the Judd-Ofelt theory was used to study the radiative intensity parameters of Eu3+ ions in the CaTiO3 lattices. The experimental results incited the bright prospects of synthesized ceramics as a promising candidate for lighting applications.

  6. Synthesis and luminescence enhancement of CaTiO{sub 3}:Bi{sup 3+} yellow phosphor by codoping Al{sup 3+}/B{sup 3+} ions

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Renping, E-mail: jxcrp@163.com; Fu, Ting; Xu, Haidong; Luo, Wenjie; Peng, Dedong; Chen, Zhiquan; Fu, Jingwei

    2016-07-25

    CaTiO{sub 3}:Bi{sup 3+} and CaTiO{sub 3}:Bi{sup 3+}, Al{sup 3+}/B{sup 3+} phosphors are synthesized by solid-state reaction method in air. With excitation 272 and 320 nm, broad PL band peaking at 555 nm with full width at half maximum ∼200 nm is observed in the range of 400–800 nm due to the {sup 3}P{sub 1,0} → {sup 1}S{sub 0} transitions of Bi{sup 3+} ion. PLE spectrum monitored at 555 nm contains two PLE band peaking at ∼272 and 320 nm within the range 230–420 nm owing to metal-to-metal charge-transfer and {sup 1}S{sub 0} → {sup 3}P{sub 1} transition of Bi{sup 3+} ion, respectively. The optimal Bi{sup 3+} doping concentration in CaTiO{sub 3}:Bi{sup 3+} phosphor is about 0.5 mol%. Luminescence properties of CaTiO{sub 3}:Bi{sup 3+} phosphor may be improved obviously by co-doping Al{sup 3+}/B{sup 3+} ions, and its emission intensity can be enhanced 13–15 times after Al{sup 3+} ion is co-doped. Luminous mechanism of CaTiO{sub 3}:Bi{sup 3+} phosphor is analyzed by energy level diagram of Bi{sup 3+} ion. Decay curve and time-resolved spectra confirm that only a single type of Bi{sup 3+} luminescence center exists in CaTiO{sub 3}:Bi{sup 3+} phosphor. - Graphical abstract: PL spectra of CaTiO{sub 3}:Bi{sup 3+} and CaTiO{sub 3}:Bi{sup 3+}, Al{sup 3+}/B{sup 3+} phosphors and the corresponding pictures under 365 nm UV lamp. - Highlights: • CaTiO{sub 3}:Bi{sup 3+} and CaTiO{sub 3}:Bi{sup 3+}, Al{sup 3+}/B{sup 3+} phosphors are synthesized by solid-state reaction in air. • Broadband emission with FWHM ∼200 nm is observed within the range 400–800 nm. • Luminescence properties of CaTiO{sub 3}:Bi{sup 3+} phosphor can be improved by codoping Al{sup 3+}/B{sup 3+} ions. • PL intensity of CaTiO{sub 3}:Bi{sup 3+} phosphor can be enhanced 13–15 times after Al{sup 3+} ion is codoped.

  7. Orientación de láminas delgadas de (Pb, CaTiO3

    Directory of Open Access Journals (Sweden)

    Mendiola, J.

    1999-06-01

    Full Text Available Calcium modified PbTiO3 thin films have been prepared on platinized Si, MgO and SrTiO3 substrates. The films were deposited from a sol-gel solution with a concentration of 0.3 M and with a 10% excess of PbO. Two deposits of this solution on the substrates were made by spin-coating, crystallizing each of them by a Rapid Thermal Processing. The resulting films present a single (Pb,CaTiO3 perovskite phase. All the films are textured, but the films deposited on MgO and SrTiO3 show a preferred orientation in the polar direction of the perovskite. As a result of this orientation, pyroelectric coefficients were measured, without any poling, for the films on MgO and SrTiO3. Pyroelectric measurements indicate the application of these films in infrarred sensors.Se han preparado láminas delgadas de PbTiO3 modificado con calcio sobre substratos de Si, MgO y SrTiO3 electrodados con Pt. Las películas se depositaron a partir de una solución sintetizada por sol-gel, con concentración 0.3 M y con un 10 % en exceso de PbO. En cada lámina se hicieron dos depósitos de la solución sobre el substrato mediante la técnica de “spin-coating”, cristalizando cada uno de ellos con un tratamiento térmico rápido. Todas las láminas resultantes presentaban como única fase cristalina la perovskita de (Pb,CaTiO3. Las láminas presentaron una cierta textura, observándose una orientación preferente en la dirección polar en el caso de las películas depositas sobre MgO y SrTiO3. Como resultado de esta orientación, se midieron coeficientes piroeléctricos, sin polarización previa, en las láminas sobre MgO y SrTiO3. Las medidas piroeléctricas de estos materiales evidencian su utilidad en dispositivos para sensores de infrarrojo.

  8. Synthesis and electrical characterization of Ca2Nd4Ti6O20 ceramics

    Directory of Open Access Journals (Sweden)

    Muhammad Raz

    2016-03-01

    Full Text Available Ca2Nd4Ti6O20, a layered perov skite structured material was synthesized via a chemical (citrate sol-gel route for the first time using nitrates and alkoxide precursors. Phase analysis of a sample sintered at 1625 °C revealed the formation of an orthorhombic (Pbn21 symmetry. The microstructure of the sample after sintering comprised rod-shaped grains of a size of 1.5 to 6.5µm. The room temperature dielectric constant of the sintered sample was 38 at 100 kHz. The remnant polarization (Pr and the coercive field (Ec were about 400 μC/cm2 and 8.4 kV/cm, respectively. Impedance spectroscopy revealed that the capacitance (13.7 pF and activation energy (1.39 eV of the grain boundary was greater than the capacitance (5.7 pF and activation energy (1.13 eV of the grain.

  9. Crystallographic and electronic structure of the Ca2TiMnO6 double perovskite

    International Nuclear Information System (INIS)

    López, J.P. Garzón; Cardona, R.; Santos, A. Sarmiento; Téllez, D.A. Landínez; Roa-Rojas, J.

    2014-01-01

    In this work, we report synthesis and crystalline structure study of the Ca 2 TiMnO 6 complex perovskite, by X-ray diffraction experiments and through the application of the Rietveld refinement using the GSAS code. Results revealed the crystallization of the system in a tetragonal perovskite with the characteristic structure given by I4/m (#87) space group and lattice parameters a=5.339(4) Å and c=7.736(6) Å. Ab initio calculations of density of states (DOS) and electronic structure were carried out for this perovskite-like system, by the Density Functional Theory (DFT) and using the Full-potential Linearized Augmented Plane Waves (FP-LAPW) method. The exchange-correlation potential was treated using the Generalized Gradient Approximation (GGA). All calculations were carried-out using spin polarization. For the up spin orientation the compound has a semiconducting behavior and for down spin polarization it behaves like a conductor. The calculated effective magnetic moment in cell was 4.02 μ B , which is close to the expected value calculated from Hund's rules

  10. PENGUKURAN NILAI DIELEKTRIK MATERIAL CALCIUM COPPER TITANAT ( CaCu3Ti4O12 MENGGUNAKAN SPEKTROSKOPI IMPEDANSI TERKOMPUTERISASI

    Directory of Open Access Journals (Sweden)

    Widodo Budi Kurniawan

    2017-05-01

    ABSTRACT   The measurement of the complex dielectric constant and the magnitude of the capacitor impedances of the ceramic materials Calcium Copper Titanate CaCu3Ti4O12 (CCTO with purity of 99% has been done by using the method of computerized impedance spectroscopy in the frequency range 5 kHz - 120 kHz. The highest dielectric constant of the material was found to be 745 at 5 kHz in the sample sintered 7000C and the highest impedance of capacitor occured in CCTO sample non sintered that is 150434Ω. The results showed that complex dielectric constant and impedance of the capacitor of the material under study was frequency dependent.   Keywords : impedance spectroscopy, CaCu3Ti4O12,complex dielectric constant and impedance of capacitor

  11. Persistent deNOx Ability of CaAl2O4:(Eu, Nd/TiO2-xNy Luminescent Photocatalyst

    Directory of Open Access Journals (Sweden)

    Li Huihui

    2011-01-01

    Full Text Available Abstract CaAl2O4:(Eu, Nd/TiO2-xNy composite luminescent photocatalyst was successfully synthesized by a simple planetary ball milling process. Improvement of photocatalytic deNOx ability of TiO2-xNy, together with the persistent photocatalytic activity for the decomposition of NO after turning off the light were realized, by coupling TiO2-xNy with long afterglow phosphor, CaAl2O4:(Eu, Nd. The novel persistent photocatalytic behavior was related to the overlap between the absorption wavelength of TiO2-xNy and the emission wavelength of the CaAl2O4:(Eu, Nd. It was found that CaAl2O4:(Eu, Nd/TiO2-xNy composites provided the luminescence to persist photocatalytic reaction for more than 3 h after turning off the light. Graphical Abstract CaAl2O4:(Eu, Nd/TiO2-xNy composite luminescent photocatalyst with persistent deNOx activity after turning off the light was successfully synthesized by a simple planetary ball milling process. The novel persistent photocatalytic behavior was related to the overlap between the absorption wavelength of TiO2-xNy and the emission wavelength of the CaAl2O4:(Eu, Nd. Additional file 1 Click here for file

  12. Room-temperature picosecond high-order stimulated Raman scattering in laser garnet crystal hosts Gd3Ga5O12, Gd3Sc2Ga3O12, and Ca3(Nb,Ga)2Ga3O12

    International Nuclear Information System (INIS)

    Kaminskii, Alexandr A; Eichler, H J; Findeisen, J; Ueda, Ken-ichi; Fernandez, J; Balda, R

    1998-01-01

    High-order Stokes and anti-Stokes generation in the visible and near-infrared in cubic laser crystal hosts Gd 3 Ga 5 O 12 , Gd 3 Sc 2 Ga 3 O 12 , and Ca 3 (Nb,Ga) 2 Ga 3 O 12 was observed for the first time. All scattering-laser components were identified and attributed to the SRS-active vibration modes of these garnet crystals. (letters to the editor)

  13. Propiedades dieléctricas de láminas delgadas de (Pb,CaTiO3 con alto contenido de Ca

    Directory of Open Access Journals (Sweden)

    Calzada, M. L.

    2004-04-01

    Full Text Available Lead titanate thin films modified with calcium, Pb1-xCaxTiO3, with x>35%, have been deposited onto Pt/TiO2/SiO2/(100Si y Pt/(100MgO substrates, by the sol-gel method and a rapid thermal processing (RTP. Properties similar to the counterpart bulk ceramics are planned, such as the decrease of the phase transition temperature and the increase of permittivity at room temperature. Films with Ca content close to 40 % and 50% exhibit at room temperature, high enough permittivity with reduced temperature dependence and a C-V behaviour that make them of interest for DRAM and high frequency devices.Se han preparado láminas delgadas de titanato de plomo modificado con calcio, Pb1-xCaxTiO3, (PTCa con x>35%, depositadas sobre substratos de Pt/TiO2/SiO2/(100Si y Pt/(100MgO, empleando la técnica de sol-gel y un horno rápido de procesado (RTP. Se intenta obtener propiedades cercanas al material cerámico masivo, como son la bajada de la temperatura de la transición ferro-paraeléctrica y el aumento de la permitividad, ε´ a temperatura ambiente. Así, se consiguen láminas de contenido de Ca próximas al 40% y 50% con valores altos de permitividad, poco dependientes de la temperatura, que presentan un alto carácter difuso en la transición para temperaturas próxima a ambiente y un comportamiento de la capacidad con el voltaje, C-V,que las hacen de interés en la fabricación de DRAM y dispositivos para alta frecuencia.

  14. Phase Identification and Dielectric Properties of Pb0.94 Ca0.06 TiO3 Ceramics

    International Nuclear Information System (INIS)

    Khin Thida; Tin Tin Aye; Aye Aye Phyu; Moe Moe Myint; Ko Ko Kyaw Soe

    2008-03-01

    The ferroelectric materials of Ca (6 mol %) doped PbTiO3 (abbreviated to PCT6) ceamics were prepared by using conventional solid solution method. Phase assignment is identified by XRD technique. The change in capacitance, the variation of dielectric constant and dielectric loss as a function of applied frequency modes (1 kHz-10 kHz)at zero bias voltage of PCT6 ceramics by using Cu and Ag electrodes were investigated.

  15. Microwave dielectric properties of (Ca0.8Sr0.2)(SnxTi1−x)O3 ceramics

    International Nuclear Information System (INIS)

    Hsu, Cheng-Hsing; Chang, Chia-Hao

    2013-01-01

    Highlights: ► New microwave dielectric properties of (Ca 0.8 Sr 0.2 )(Sn x Ti 1−x )O 3 ceramics were investigated. ► A single-phase solid solution containing orthorhombic Pbnm with different Sn contents was formed. ► A significant improvement of Q × f value and τ f were achieved by (Ca 0.8 Sr 0.2 )(Sn x Ti 1−x )O 3 system. ► Second phases were formed and affected the dielectric properties of (Ca 0.8 Sr 0.2 )(Sn x Ti 1−x )O 3 system. ► Low cost and suitable τ f value of (Ca 0.8 Sr 0.2 )(Sn x Ti 1−x )O 3 demonstrate a good potential for use in microwave device. -- Abstract: In this paper, we study the behavior of the B-site behavior with the incorporation of Sn 4+ ion in (Ca 0.8 Sr 0.2 )TiO 3 ceramics. An excess of Sn 4+ resulted in the formation of a secondary phase of CaSnO 3 and SrSnO 3 affecting the microwave dielectric properties of the (Ca 0.8 Sr 0.2 )(Sn x Ti 1−x )O 3 ceramics. The dielectric properties of the (Ca 0.8 Sr 0.2 )(Sn x Ti 1−x )O 3 ceramics were improved because of the solid solution of Sn 4+ substitution in the B-site. The temperature coefficient of resonant frequency (τ f ) of the (Ca 0.8 Sr 0.2 )(Sn x Ti 1−x )O 3 ceramics also improved with increasing Sn content

  16. Radiochemical study of 45Sc(n,p)45Ca and 89Y(n,p)89Sr reactions in the neutron energy range of 13.9 to 14.7 MeV

    International Nuclear Information System (INIS)

    Molla, N.I.; Basunia, S.; Miah, M.R.; Hossain, S.M.; Rahman, M.M.; Spellerberg, S.; Qaim, S.M.

    1998-01-01

    Cross sections for 45 Sc(n,p) 45 Ca and 89 Y(n,p) 89 Sr reactions were measured using the activation technique. Monoenergetic neutrons in the energy range of 13.9 to 14.7 MeV were produced using a D-T neutron generator. The purely β - emitting products 45 Ca and 89 Sr were separated radiochemically; their radioactivity was assayed via low-level β - counting. The measured data complement the available published experimental information, and agree with the results of statistical model calculations. (orig.)

  17. Bone bonding bioactivity of Ti metal and Ti-Zr-Nb-Ta alloys with Ca ions incorporated on their surfaces by simple chemical and heat treatments.

    Science.gov (United States)

    Fukuda, A; Takemoto, M; Saito, T; Fujibayashi, S; Neo, M; Yamaguchi, S; Kizuki, T; Matsushita, T; Niinomi, M; Kokubo, T; Nakamura, T

    2011-03-01

    Ti15Zr4Nb4Ta and Ti29Nb13Ta4.6Zr, which do not contain the potentially cytotoxic elements V and Al, represent a new generation of alloys with improved corrosion resistance, mechanical properties, and cytocompatibility. Recently it has become possible for the apatite forming ability of these alloys to be ascertained by treatment with alkali, CaCl2, heat, and water (ACaHW). In order to confirm the actual in vivo bioactivity of commercially pure titanium (cp-Ti) and these alloys after subjecting them to ACaHW treatment at different temperatures, the bone bonding strength of implants made from these materials was evaluated. The failure load between implant and bone was measured for treated and untreated plates at 4, 8, 16, and 26 weeks after implantation in rabbit tibia. The untreated implants showed almost no bonding, whereas all treated implants showed successful bonding by 4 weeks, and the failure load subsequently increased with time. This suggests that a simple and economical ACaHW treatment could successfully be used to impart bone bonding bioactivity to Ti metal and Ti-Zr-Nb-Ta alloys in vivo. In particular, implants heat treated at 700 °C exhibited significantly greater bone bonding strength, as well as augmented in vitro apatite formation, in comparison with those treated at 600 °C. Thus, with this improved bioactive treatment process these advantageous Ti-Zr-Nb-Ta alloys can serve as useful candidates for orthopedic devices. Copyright © 2010 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  18. Nature of potential barrier in (Ca 1/4,Cu 3/4)TiO 3 polycrystalline perovskite

    Science.gov (United States)

    Marques, V. P. B.; Bueno, P. R.; Simões, A. Z.; Cilense, M.; Varela, J. A.; Longo, E.; Leite, E. R.

    2006-04-01

    The nonohmic electrical features of (Ca 1/4,Cu 3/4)TiO 3 perovskite ceramics, which have very strong gigantic dielectric is believed originate from potential barriers at the grain boundaries. In the present study, we used the admittance and impedance spectroscopy technique to investigate (Ca 1/4,Cu 3/4)TiO 3 perovskite ceramics with low nonohmic electrical properties. The study was conducted under two different conditions: on as-sintered ceramics and on ceramics thermally treated in an oxygen-rich atmosphere. The results confirm that thermal treatment in oxygen-rich atmospheres influence the nonohmic properties. Annealing at oxygen-rich atmospheres improve the nonohmic behavior and annealing at oxygen-poor atmospheres decrease the nonohmic properties, a behavior already reported for common metal oxide nonohmic devices and here firstly evidenced for the (Ca 1/4,Cu 3/4)TiO 3 perovskite related materials. The results show that oxygen also influences the capacitance values at low frequencies, a behavior that is indicative of the Schottky-type nature of the potential barrier.

  19. Resolving surface chemical states in XPS analysis of first row transition metals, oxides and hydroxides: Sc, Ti, V, Cu and Zn

    International Nuclear Information System (INIS)

    Biesinger, Mark C.; Lau, Leo W.M.; Gerson, Andrea R.; Smart, Roger St.C.

    2010-01-01

    Chemical state X-ray photoelectron spectroscopic analysis of first row transition metals and their oxides and hydroxides is challenging due to the complexity of the 2p spectra resulting from peak asymmetries, complex multiplet splitting, shake-up and plasmon loss structure, and uncertain, overlapping binding energies. A review of current literature shows that all values necessary for reproducible, quantitative chemical state analysis are usually not provided. This paper reports a more consistent, practical and effective approach to curve-fitting the various chemical states in a variety of Sc, Ti, V, Cu and Zn metals, oxides and hydroxides. The curve-fitting procedures proposed are based on a combination of (1) standard spectra from quality reference samples, (2) a survey of appropriate literature databases and/or a compilation of the literature references, and (3) specific literature references where fitting procedures are available. Binding energies, full-width at half maximum (FWHM) values, spin-orbit splitting values, asymmetric peak-shape fitting parameters, and, for Cu and Zn, Auger parameters values are presented. The quantification procedure for Cu species details the use of the shake-up satellites for Cu(II)-containing compounds and the exact binding energies of the Cu(0) and Cu(I) peaks. The use of the modified Auger parameter for Cu and Zn species allows for corroborating evidence when there is uncertainty in the binding energy assignment. These procedures can remove uncertainties in analysis of surface states in nano-particles, corrosion, catalysis and surface-engineered materials.

  20. Resolving surface chemical states in XPS analysis of first row transition metals, oxides and hydroxides: Sc, Ti, V, Cu and Zn

    Energy Technology Data Exchange (ETDEWEB)

    Biesinger, Mark C., E-mail: biesingr@uwo.ca [Surface Science Western, University of Western Ontario, University of Western Ontario Research Park, Room LL31, 999 Collip Circle, London, Ontario, N6G 0J3 (Canada); ACeSSS (Applied Centre for Structural and Synchrotron Studies), University of South Australia, Mawson Lakes, SA 5095 (Australia); Lau, Leo W.M. [Surface Science Western, University of Western Ontario, University of Western Ontario Research Park, Room LL31, 999 Collip Circle, London, Ontario, N6G 0J3 (Canada); Department of Chemistry, University of Western Ontario, London, Ontario, N6A 5B7 (Canada); Gerson, Andrea R.; Smart, Roger St.C. [ACeSSS (Applied Centre for Structural and Synchrotron Studies), University of South Australia, Mawson Lakes, SA 5095 (Australia)

    2010-11-15

    Chemical state X-ray photoelectron spectroscopic analysis of first row transition metals and their oxides and hydroxides is challenging due to the complexity of the 2p spectra resulting from peak asymmetries, complex multiplet splitting, shake-up and plasmon loss structure, and uncertain, overlapping binding energies. A review of current literature shows that all values necessary for reproducible, quantitative chemical state analysis are usually not provided. This paper reports a more consistent, practical and effective approach to curve-fitting the various chemical states in a variety of Sc, Ti, V, Cu and Zn metals, oxides and hydroxides. The curve-fitting procedures proposed are based on a combination of (1) standard spectra from quality reference samples, (2) a survey of appropriate literature databases and/or a compilation of the literature references, and (3) specific literature references where fitting procedures are available. Binding energies, full-width at half maximum (FWHM) values, spin-orbit splitting values, asymmetric peak-shape fitting parameters, and, for Cu and Zn, Auger parameters values are presented. The quantification procedure for Cu species details the use of the shake-up satellites for Cu(II)-containing compounds and the exact binding energies of the Cu(0) and Cu(I) peaks. The use of the modified Auger parameter for Cu and Zn species allows for corroborating evidence when there is uncertainty in the binding energy assignment. These procedures can remove uncertainties in analysis of surface states in nano-particles, corrosion, catalysis and surface-engineered materials.

  1. First measurement of the nonlinear coefficient for Gd1-xLux Ca4O(BO3)3 and Gd1-xScxCa4O(BO3)3 crystals

    DEFF Research Database (Denmark)

    Andersen, Martin Thalbitzer; Mortensen, Jesper Liltorp; Germershausen, Sven

    2007-01-01

    The effective nonlinear coefficient and temperature acceptance bandwidth of three Lu and Sc co-doped GdCa4O(B03)3 type nonlinear crystals were measured. NCPM for SHG in to the blue-UV spectral region can be obtained by controlling the co-dopant concentration. Measurements were based on intra-cavi...

  2. Semiconductor-metal transition in CaMO3-CaTiO2 (M-Ru,Ir) systems

    International Nuclear Information System (INIS)

    Lazarev, V.B.; Shaplygin, I.S.

    1982-01-01

    Properties of CaRusub(x)Tisub(1-x)Osub(3) and CaIsub(2x)Tisub(1-x)Osub(3) solid solutions were studied in the whole range of concentrations by the methods of X-ray diffraction, electric conductivity and magnetic susceptibility. It was ascertained that the transition of semiconductor-metal type proceeded in the both families of solid solutions at x approximately 0.77 and 0.85 respectively and was accompanied by the change of structural type of solid solutions

  3. A -Site Ordered Double Perovskite CaMnTi 2 O 6 as a Multifunctional Piezoelectric and Ferroelectric–Photovoltaic Material

    Energy Technology Data Exchange (ETDEWEB)

    Gou, Gaoyang [Frontier Institute; Charles, Nenian [Department of Materials Science and Engineering, Drexel University, Philadelphia, Pennsylvania 19104, United States; Shi, Jing [MOE Key Laboratory; Rondinelli, James M. [Department; Materials Science Division, Argonne National Laboratory, Argonne, Illinois 60439, United States

    2017-09-11

    The double perovskite CaMnTi2O6, is a rare A site ordered perovskite oxide that exhibits a sizable ferroelectric polarization and relatively high Curie temperature. Using first-principles calculations combined with detailed symmetry analyses, we identify the origin of the ferroelectricity in CaMnTi2O6. We further explore the material properties of CaMnTi2O6, including its ferroelectric polarization, dielectric and piezoelectric responses, magnetic order, electronic structure, and optical absorption coefficient. It is found that CaMnTi2O6 exhibits room-temperature-stable ferroelectricity and moderate piezoelectric responses. Moreover, CaMnTi2O6 is predicted to have a semiconducting energy band gap similar to that of BiFeO3, and its band gap can further be tuned-via distortions of the planar Mn-O bond lengths. CaMnTi2O6 exemplifies a new class of single-phase semiconducting ferroelectric perovskites for potential applications in ferroelectric photovoltaic solar cells.

  4. Application and bioactive properties of CaTI, a trypsin inhibitor from Capsicum annuum seeds: membrane permeabilization, oxidative stress and intracellular target in phytopathogenic fungi cells.

    Science.gov (United States)

    Silva, Marciele S; Ribeiro, Suzanna Ff; Taveira, Gabriel B; Rodrigues, Rosana; Fernandes, Katia Vs; Carvalho, André O; Vasconcelos, Ilka Maria; Mello, Erica Oliveira; Gomes, Valdirene M

    2017-08-01

    During the last few years, a growing number of antimicrobial peptides have been isolated from plants and particularly from seeds. Recent results from our laboratory have shown the purification of a new trypsin inhibitor, named CaTI, from chilli pepper (Capsicum annuum L.) seeds. This study aims to evaluate the antifungal activity and mechanism of action of CaTI on phytopathogenic fungi and detect the presence of protease inhibitors in other species of this genus. Our results show that CaTI can inhibit the growth of the phytopathogenic fungi Colletotrichum gloeosporioides and C. lindemuthianum. CaTI can also permeabilize the membrane of all tested fungi. When testing the inhibitor on its ability to induce reactive oxygen species, an induction of reactive oxygen species (ROS) and nitric oxide (NO) particularly in Fusarium species was observed. Using CaTI coupled to fluorescein isothiocyanate (FITC), it was possible to determine the presence of the inhibitor inside the hyphae of the Fusarium oxysporum fungus. The search for protease inhibitors in other Capsicum species revealed their presence in all tested species. This paper shows the antifungal activity of protease inhibitors such as CaTI against phytopathogenic fungi. Antimicrobial peptides, among which the trypsin protease inhibitor family stands out, are present in different species of the genus Capsicum and are part of the chemical arsenal that plants use to defend themselves against pathogens. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  5. Investigation into the use of CaZrO3 as a facecoat material in the investment casting of TiAl alloys

    International Nuclear Information System (INIS)

    Yuan, C.; Cheng, X.; Withey, P.A.

    2015-01-01

    Research was carried out to determine the interactions between the filler and stucco materials in CaZrO 3 based facecoats during shell firing as well as between the facecoat and a TiAl alloy during the casting process. A ‘flash re-melting’ technique, which gives a similar heating profile to the actual investment casting process, was used to study the phase transformations in the shell moulds. The chemical inertness of the facecoat was then investigated using a sessile drop test using a Ti–45Al–2Nb–2Mn–0.2TiB alloy. In this study, the facecoat compositions and the interaction products between metal and shells were characterized using x-ray diffraction, scanning electron microscopy (SEM) and transmission electron microscopy (TEM). A severe interaction was found between CaZrO 3 filler and Al 2 O 3 stucco, which rapidly damaged the shell surface. As well as oxygen, zirconium and silicon ions from the shell moulds were also observed to penetrate into the TiAl metal to form (Ti, Zr) 5 (Al, Si) 3 phases in the metal/shell interfacial areas. - Highlights: • To determine the interactions between CaZrO 3 filler and stucco materials during shell firing. • To study the reaction between the CaZrO 3 facecoat and TiAl alloy during casting. • The Al 2 O 3 stucco can react with CaZrO 3 filler to form (Zr, Ca)O 2 and CaAl x O y at 1650 °C. • O, Zr and Si ions from the ceramic moulds were observed to penetrate into the TiAl metal. • The reaction products include (Ti, Zr) 5 (Al, Si) 3 and ZrAl 2 phase with high Ti ions solid solution

  6. Investigation of laser cladding high temperature anti-wear composite coatings on Ti6Al4V alloy with the addition of self-lubricant CaF2

    International Nuclear Information System (INIS)

    Xiang, Zhan-Feng; Liu, Xiu-Bo; Ren, Jia; Luo, Jian; Shi, Shi-Hong; Chen, Yao; Shi, Gao-Lian; Wu, Shao-Hua

    2014-01-01

    Highlights: • A novel high temperature self-lubricating wear-resistant coating was fabricated. • TiC carbides and self-lubricant CaF 2 were “in situ” synthesized in the coating. • The coating with the addition of CaF 2 possessed superior properties than without. - Abstract: To improve the high-temperature tribological properties of Ti–6Al–4V alloy, γ-NiCrAlTi/TiC and γ-NiCrAlTi/TiC/CaF 2 coatings were fabricated on Ti–6Al–4V alloy by laser cladding. The phase compositions and microstructure of the coatings were investigated using X-ray diffraction (XRD) and scanning electron microscope (SEM) equipped with energy dispersive spectroscopy (EDS). The tribological behaviors were evaluated using a ball-on-disk tribometer from ambient temperature to 600 °C under dry sliding wear conditions and the corresponding wear mechanisms were discussed. The results indicated that the γ-NiCrAlTi/TiC/CaF 2 coating consisted of α-Ti, the “in situ” synthesized TiC block particles and dendrite, γ-NiCrAlTi solid solution and spherical CaF 2 particles. The wear rates of γ-NiCrAlTi/TiC/CaF 2 coating were decreased greatly owing to the combined effects of the reinforced carbides and continuous lubricating films. Furthermore, the friction coefficients of γ-NiCrAlTi/TiC/CaF 2 coating presented minimum value of 0.21 at 600 °C, which was reduced by 43% and 50% compared to the substrate and γ-NiCrAlTi/TiC coating respectively. It was considered that the γ-NiCrAlTi/TiC/CaF 2 coating exhibited excellent friction-reducing and anti-wear properties at high temperature

  7. Investigation of laser cladding high temperature anti-wear composite coatings on Ti6Al4V alloy with the addition of self-lubricant CaF{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Xiang, Zhan-Feng [School of Mechanical and Electric Engineering, Soochow University, 178 East Ganjiang Road, Suzhou 215006 (China); Liu, Xiu-Bo, E-mail: liuxiubo@suda.edu.cn [School of Mechanical and Electric Engineering, Soochow University, 178 East Ganjiang Road, Suzhou 215006 (China); Ren, Jia; Luo, Jian; Shi, Shi-Hong; Chen, Yao [School of Mechanical and Electric Engineering, Soochow University, 178 East Ganjiang Road, Suzhou 215006 (China); Shi, Gao-Lian; Wu, Shao-Hua [Suzhou Institute of Industrial Technology, Suzhou 215104 (China)

    2014-09-15

    Highlights: • A novel high temperature self-lubricating wear-resistant coating was fabricated. • TiC carbides and self-lubricant CaF{sub 2} were “in situ” synthesized in the coating. • The coating with the addition of CaF{sub 2} possessed superior properties than without. - Abstract: To improve the high-temperature tribological properties of Ti–6Al–4V alloy, γ-NiCrAlTi/TiC and γ-NiCrAlTi/TiC/CaF{sub 2} coatings were fabricated on Ti–6Al–4V alloy by laser cladding. The phase compositions and microstructure of the coatings were investigated using X-ray diffraction (XRD) and scanning electron microscope (SEM) equipped with energy dispersive spectroscopy (EDS). The tribological behaviors were evaluated using a ball-on-disk tribometer from ambient temperature to 600 °C under dry sliding wear conditions and the corresponding wear mechanisms were discussed. The results indicated that the γ-NiCrAlTi/TiC/CaF{sub 2} coating consisted of α-Ti, the “in situ” synthesized TiC block particles and dendrite, γ-NiCrAlTi solid solution and spherical CaF{sub 2} particles. The wear rates of γ-NiCrAlTi/TiC/CaF{sub 2} coating were decreased greatly owing to the combined effects of the reinforced carbides and continuous lubricating films. Furthermore, the friction coefficients of γ-NiCrAlTi/TiC/CaF{sub 2} coating presented minimum value of 0.21 at 600 °C, which was reduced by 43% and 50% compared to the substrate and γ-NiCrAlTi/TiC coating respectively. It was considered that the γ-NiCrAlTi/TiC/CaF{sub 2} coating exhibited excellent friction-reducing and anti-wear properties at high temperature.

  8. Low Cost CaTiO3 Perovskite Synthesized from Scallop (Anadara granosa) Shell as Antibacterial Ceramic Material

    Science.gov (United States)

    Fatimah, Is; Nur Ilahi, Rico; Pratami, Rismayanti

    2018-01-01

    Research on perovskite CaTiO3 synthesis from scallop (Anadara granosa) shell and its test as material for antibacterial ceramic application have been conducted. The synthesis was performed by calcium extraction from the scallop shell followed by solid-solid reaction of obtained calcium with TiO2. Physicochemical character of the perovskite wasstudied by measurement of crystallinity using x-ray diffraction (XRD), diffuse-reflectance UV Visible spectrophotometry, scanning electrone microscope-energy dispersive x-ray (SEM-EDX) and Fourier-Transform InfraRed. Considering the future application of the perovskite as antibacterial agent, laboratory test of the peroskite as material in antibacterial ceramic preparation was also conducted. Result of research indicated that perovskite formation was obtained and the material demonstrated photocatalytic activity as identified by band gap energy (Eg) value. The significant activity was also reflected by the antibacterial action of formed ceramic.

  9. Electron paramagnetic resonance investigation of polycrystalline CaCu{sub 3}Ti{sub 4}O{sub 12}

    Energy Technology Data Exchange (ETDEWEB)

    Mozzati, Maria Cristina [INFM-Dipartimento di Fisica ' Alessandro Volta' , Universita di Pavia, via Bassi 6, I-27100 Pavia (Italy); Azzoni, Carlo Bruno [INFM-Dipartimento di Fisica ' Alessandro Volta' , Universita di Pavia, via Bassi 6, I-27100 Pavia (Italy); Capsoni, Doretta [Dipartimento di Chimica Fisica ' Mario Rolla' , Universita di Pavia and IENI-CNR, Sezione di Pavia, viale Taramelli 16, I-27100 Pavia (Italy); Bini, Marcella [Dipartimento di Chimica Fisica ' Mario Rolla' , Universita di Pavia and IENI-CNR, Sezione di Pavia, viale Taramelli 16, I-27100 Pavia (Italy); Massarotti, Vincenzo [Dipartimento di Chimica Fisica ' Mario Rolla' , Universita di Pavia and IENI-CNR, Sezione di Pavia, viale Taramelli 16, I-27100 Pavia (Italy)

    2003-11-05

    Electron paramagnetic resonance (EPR) measurements on pure polycrystalline CaCu{sub 3}Ti{sub 4}O{sub 12} have been performed and are discussed within a crystal-field approach. A symmetric signal centred at g = 2.15 is observed for T>25 K, with no evidence of hyperfine structure. At this temperature an antiferromagnetic transition is observed as confirmed by static magnetization data. Cu defective and 2% doped (V, Cr, Mn, La) samples were also prepared and considered, mainly to understand the nature of the observed paramagnetic centre. Substitutions in the octahedral sites, causing variations of the configuration in CuO{sub 4}-TiO{sub 6}-CuO{sub 4} complexes, change the magnetic and EPR features. To justify the EPR response a strong copper-hole delocalization is suggested.

  10. Preparation and characterizations of Ba0.8Ca0.2TiO3 by complex polymerization method (CPM)

    International Nuclear Information System (INIS)

    Motta, F.V.; Marques, A.P.A.; Escote, M.T.; Melo, D.M.A.; Ferreira, A.G.; Longo, E.; Leite, E.R.; Varela, J.A.

    2008-01-01

    Ba 0.8 Ca 0.2 TiO 3 (BCT) was prepared by the complex polymerization method (CPM) using Ba 0.8 Ca 0.2 CO 3 and [Ti[OCH(CH 3 ) 2 ] 4 as starting materials. The powders were crystallized at several temperatures from 400 to 1200 deg. C using different times (from 1 to 8 h). The phase evolution and the physical properties were characterized by X-ray diffraction, Raman and IR spectroscopy. Such results indicate that the precursor Ba 0.8 Ca 0.2 CO 3 used in the synthesis of Ba 0.8 Ca 0.2 TiO 3 promotes an effective complexation of the ions Ca 2+ in the matrix of BaTiO 3 . After heat treatment for 2 h at 600 deg. C the phase BCT was obtained with absence of the CaTiO 3 or BaCO 3 phases. The CPM is an efficient method in the synthesis of the BCT, using small reaction time and low temperature and cost for the preparation of these powders

  11. The CaO-TiO2-ZrO2 system at 1,200 degree C and the solubilities of Hf and Gd in zirconolite

    International Nuclear Information System (INIS)

    Swenson, D.; Nieh, T.G.; Fournelle, J.H.

    1995-12-01

    In recent years, significant technological advancements have been made in the Synroc scheme for the immobilization high-level nuclear waste. However, many basic scientific issues related to Synroc fabrication have yet to be addressed. The CaO-TiO 2 -ZrO 2 system is an integral part of the Synroc formulation. Phase equilibria are established in the CaO-TiO 2 -ZrO 2 system at 1,200 C, using X-ray diffraction and electron probe microanalysis. The existence of two previously reported ternary phases, zirconolite (CaZrTi 2 O 7 ) and calzirtite (Ca 2 Zr 5 Ti 2 O 16 ), is confirmed. Each of these phases exhibits a significant range of homogeneity between TiO 2 and ZrO 2 while maintaining a nearly constant concentration of CaO. The ternary solubilities of the constituent binary phases are found to be negligible, with the exceptions of the perovskites, which display mutual solubility of at least 22 mol.% and may in fact form a series of continuous solid solutions. The solubilities of Hf and Gd in zirconolite are also investigated. While Hf-bearing samples did not reach thermodynamic equilibrium under the experimental conditions employed, the existence of a Hf analog to zirconolite, CaHfTi 2 O 7 , is conclusively demonstrated. The phase is stable at the stoichiometric composition, and its lattice parameters are very close to those reported in the literature for stoichiometric zirconolite. A Gd-bearing sample of the composition Ca 0.88 Zr 0.88 Gd 9.24 Ti 2 O 7 is found to be essentially single phase zirconolite, in agreement with previous investigations at higher temperatures

  12. Pressure-driven phase transitions in TiOCl and the family (Ca, Sr, Ba)Fe2As2

    International Nuclear Information System (INIS)

    Zhang YuZhong; Opahle, Ingo; Jeschke, Harald O; ValentI, Roser

    2010-01-01

    Motivated by recent experimental measurements on pressure-driven phase transitions in Mott insulators as well as the new iron pnictide superconductors, we show that first principles Car-Parrinello molecular dynamics calculations are a powerful method to describe the microscopic origin of such transitions. We present results for (i) the pressure-induced insulator to metal phase transition in the prototypical Mott insulator TiOCl as well as (ii) the pressure-induced structural and magnetic phase transitions in the family of correlated metals AFe 2 As 2 (A = Ca, Sr, Ba). Comparison of our predictions with existing experimental results yields very good agreement.

  13. Trapping of oxygen vacancies on twin walls of CaTiO3: a computer simulation study

    International Nuclear Information System (INIS)

    Calleja, Mark; Dove, Martin T; Salje, Ekhard K H

    2003-01-01

    We have studied the atomic structure of [001] 90 deg. rotation twin walls in orthorhombic CaTiO 3 (symmetry Pbnm) at low temperature (10 K) and their effects on oxygen vacancies. The wall thickness was found to be 2.3 nm at T || T c and it was found that it is energetically favourable for such vacancies to reside in the wall, particularly when bridging titania ions in the (001) plane. The binding energy of an oxygen vacancy in the wall with respect to the bulk is calculated to be ≤ 1.2 eV

  14. Synthesis of CaTiO3:Pr persistent phosphors by a modified solid-state reaction

    International Nuclear Information System (INIS)

    Yin Shengyu; Chen Donghua; Tang Wanjun; Peng Yuhua

    2007-01-01

    Using tetra-n-butyl titanate and calcium nitrate as raw materials, the praseodymium-doped calcium titanates have been synthesized via a modified solid-state reaction. The decomposition process of the precursor, crystallization, and particle sizes of CaTiO 3 :Pr have been investigated by using thermal analysis, powder X-ray diffraction and transmission electron microscopy (TEM). TG-DTG curves and X-ray diffraction analysis indicate that crystalline calcium titanate has been synthesized at calcining temperature of 600 deg. C for 2 h. Photoluminescence and decay curves show that the sample obtained at the sintering temperature of 900 deg. C exhibited the optimal luminous property

  15. Investigation of CaTiO3:Pr3+ thin films deposited by radiofrequency reactive magnetron sputtering for electroluminescence application

    International Nuclear Information System (INIS)

    Sarakha, L; Bousquet, A; Tomasella, E; Boutinaud, P; Mahiou, R

    2010-01-01

    In this report we successfully deposited thin films of CaTiO 3 :Pr 3+ by radiofrequency magnetron sputtering. The films were studied and we tried to understand the evolution of their optical and electrical properties. We noticed that the annealing temperature and the deposition pressures have an important influence on these properties. Thin films with good optical and electrical properties have been obtained. These films are transparent and are characterized by an intense red photoluminescence and a low fixed charge density. They are well dedicated for electroluminescence purposes.

  16. Giant dielectric response in (Sr, Sb) codoped CaCu3Ti4O12 ceramics: A novel approach

    Science.gov (United States)

    Pradhan, M. K.; Rao, T. Lakshmana; Karna, Lipsarani; Dash, S.

    2018-04-01

    The CaCu3Ti4O12 (CCTO) remains as the best material for practical applications due to its high dielectric constant. To improve further the dielectric properties of CCTO to several orders in magnitude, a novel approach is adopted by codoping of Sr, Sb ions. The ceramic samples were fabricated by the conventional solid state route. The structure, morphology and detail dielectric properties were investigated systematically. All the samples crystalizes in a cubic symmetry with Im-3 space group. Sr substituted in Ca site can effectively suppress the grain growth, achieving a fine grained ceramic structure; however the grain size decreased slightly as Sb concentration increased further; whereas the dielectric permittivity of the ceramics increased drastically. The giant dielectric response was considered to be closely related with a reduction in the potential barrier height at grain boundaries (GBs) supported by the reduction in the activation energy for the conduction process.

  17. N = 3 - 3 Transitions of Ne-like Ions in the Iron Group, Especially Ca(10+) and Ti(12+)

    Energy Technology Data Exchange (ETDEWEB)

    Ishikawa, Y; Encarnacion, J L; Trabert, E

    2008-10-09

    The Ti XIII 2s{sup 2}2p{sup 5}3l-3l{prime} and 2s2p{sup 6}3l-3l{prime} transitions that have been discussed previously on the basis of beam-foil spectra and laser-produced plasmas in comparison to semi-empirically scaled computations have now been treated by accurate ab initio Multi-reference Moller-Plesset calculations. While most 2s{sup 2}2p{sup 5}3l-3l{prime} line identifications are supported by the new calculations, the 2s2p{sup 6}3l-3l{prime} transition arrays are revised. Theoretical level positions are given for all elements from Ca through Fe. The quality of the calculation is demonstrated on the beam-foil spectra of Ca.

  18. Proton-oxygen conductivity in substituted perovskites ATi0.95Mo0.05O3-α (A = Ca, Sr, Ba; M = Sc, Mg) in the reducing hydrogen-containing atmospheres

    International Nuclear Information System (INIS)

    Gorelov, V.P.; Balakireva, V.B.; Sharova, N.V.

    1999-01-01

    Electric conductivity depending on temperature, oxygen partial pressure, as well as the number of t i ion transfer and transfer hydrogen numbers in the perovskites ATi 0.95 Mo 0.05 O 3-α (A = Ca, Sr, Ba; M = Sc, Mg) in reducing hydrogen-containing atmospheres in the temperature range of 450-850 deg C have been measured. With the temperature decrease t i increases reaching 1.0 at a temperature of 550 deg C for all compositions. Proton conductivity under conditions of assumed concomitant transfer of either O 2- or OH - has been ascertained [ru

  19. Comportamiento dieléctrico de cerámicos de CaCu3Ti4O12

    Directory of Open Access Journals (Sweden)

    Castro, M. S.

    2011-08-01

    Full Text Available In this work, CaCu3Ti4O12 (CCTO ceramics were prepared by solid state reaction at 900°C for 12 h and sintered at 1100°C during 3 h. The main phase detected through X-ray diffraction (XRD was CCTO. Also, by means of Raman spectroscopy, it was observed a secondary phase rich in CuO. A dielectric constant higher than 13.000ε0 was obtained by Impedance spectroscopy measurements in the range between 25 to 106Hz. The value could be explained by the effect of dipolar and space charge polarization processes.En este trabajo se prepararon cerámicos basados en CaCu3Ti4O12 (CCTO por reacción en estado sólido a 900°C y posterior sinterizado a 1100°C. Mediante difracción de rayos X (DRX se comprobó la presencia de CCTO. A través de espectroscopía Raman se observó la presencia de una fase secundaria rica en CuO. Las mediciones de espectroscopía de impedancia demostraron que este material presenta una constante dieléctrica mayor a 13.000ε0 en el intervalo comprendido entre 25 y 106 Hz. Este valor es atribuido a la presencia de mecanismos de polarización de carga espacial y dipolar.

  20. Dielectric properties, impedance analysis and modulus behavior of CaTiO{sub 3} ceramic prepared by solid state reaction

    Energy Technology Data Exchange (ETDEWEB)

    Wong, Y.J., E-mail: yjeng_86@hotmail.com [Department of Physics, Faculty of Science, Universiti Putra Malaysia, 43400 Serdang, Selangor (Malaysia); Hassan, J., E-mail: jumiah@science.upm.edu.my [Department of Physics, Faculty of Science, Universiti Putra Malaysia, 43400 Serdang, Selangor (Malaysia); Advanced Materials and Nanotechnology Laboratory, Institute of Advanced Technology (ITMA), Universiti Putra Malaysia, 43400 Serdang, Selangor (Malaysia); Hashim, M., E-mail: mansor@science.upm.edu.my [Department of Physics, Faculty of Science, Universiti Putra Malaysia, 43400 Serdang, Selangor (Malaysia); Advanced Materials and Nanotechnology Laboratory, Institute of Advanced Technology (ITMA), Universiti Putra Malaysia, 43400 Serdang, Selangor (Malaysia)

    2013-09-15

    Highlights: •A single phase orthorhombic CaTiO{sub 3} structure with sub-micron grains is produced. •The frequency exponent ‘s’ is temperature dependent and explained by CBH model. •The dielectric constant and loss tangent are frequency and temperature dependent. •The modulus plot reveals the presence of thermally activated dielectric relaxation. •Cole-cole plot reveals two primary relaxation processes exist in the sample. -- Abstract: Calcium titanate (CaTiO{sub 3}) with the general formula for perovskites, ABO{sub 3}, is of technological importance, particularly with regard to dielectric properties. In this work, CaTiO{sub 3} ceramic material was prepared by the conventional solid state reaction method. The dielectric properties, impedance characteristics and modulus behavior of the CaTiO{sub 3} ceramic material sintered at 1240 °C were investigated in the frequency range of 10{sup −2}–10{sup 6} Hz and temperature range of 100–250 °C. The XRD analysis of the sintered CaTiO{sub 3} shows that it is an orthorhombic structure with lattice parameters a = 5.4398 Å, b = 7.6417 Å, and c = 5.3830 Å. The FESEM micrograph shows a significant difference in grain size distribution ranging from 0.26 to 2.32 μm. The AC conductivity, σ{sub AC}, is found to increase with increasing temperature within the frequency range of 10{sup −2}–10{sup 6} Hz confirming the hopping of electrons to be the conduction mechanism. Due to the decreasing values of the frequency exponent s with increasing temperature, the results of the σ{sub AC} are discussed using the correlated barrier height (CBH) model. For dielectric studies, the dielectric constant, ε′ is found to decrease with increasing frequency. In the whole temperature range of 100–250 °C, high and low frequency plateau are observed. Each converges at high frequency (>10{sup 5} Hz) for all the temperatures. The frequency dependence of loss tangent, tan δ, decreases with rise in temperature, with the

  1. Mn-Doped CaBi4Ti4O15/Pb(Zr,TiO3 Ultrasonic Transducers for Continuous Monitoring at Elevated Temperatures

    Directory of Open Access Journals (Sweden)

    Makiko Kobayashi

    2017-11-01

    Full Text Available Continuous ultrasonic in-situ monitoring for industrial applications is difficult owing to the high operating temperatures in industrial fields. It is expected that ultrasonic transducers consisting of a CaBi4Ti4O15(CBT/Pb(Zr,TiO3(PZT sol-gel composite could be one solution for ultrasonic nondestructive testing (NDT above 500 °C because no couplant is required and CBT has a high Curie temperature. To verify the high temperature durability, CBT/PZT sol-gel composite films were fabricated on titanium substrates by spray coating, and the CBT/PZT samples were tested in a furnace at various temperatures. Reflected echoes with a high signal-to-noise ratio were observed up to 600 °C. A thermal cycle test was conducted from room temperature to 600 °C, and no significant deterioration was found after the second thermal cycle. To investigate the long-term high-temperature durability, a CBT/PZT ultrasonic transducer was tested in the furnace at 600 °C for 36 h. Ultrasonic responses were recorded every 3 h, and the sensitivity and signal-to-noise ratio were stable throughout the experiment.

  2. Theoretical study of phase stability and elastic properties of T0.75Y0.75B14 (T  =  Sc, Ti, V, Y, Zr, Nb, Si)

    International Nuclear Information System (INIS)

    Hunold, Oliver; Music, Denis; Schneider, Jochen M

    2016-01-01

    In this study the phase stability, elastic properties, and plastic behaviour of icosahedral transition metal borides T 0.75 Y 0.75 B 14 (T  =  Sc, Ti, V, Y, Zr, Nb, Si) have been investigated using density functional theory. Phase stability critically depends on the charge transferred by T and Y to the B icosahedra. For the metal sublattice occupancy investigated here, the minimum energy of formation is identified at an effective B icosahedra charge of  −1.8  ±  0.1. This charge corridor encompasses the highest phase stability among all the reported icosahedral transition metal boride systems so far. This data provides guidance for future experimental efforts: from a wear-resistance point of view, Sc 0.75 Y 0.75 B 14 , Ti 0.75 Y 0.75 B 14 , and Zr 0.75 Y 0.75 B 14 exhibit a rather unique and attractive combination of large Young’s modulus values ranging from 488 to 514 GPa with the highest phase stability for icosahedral transition metals borides reported so far. (paper)

  3. Optical spectroscopy and band gap analysis of hybrid improper ferroelectric Ca{sub 3}Ti{sub 2}O{sub 7}

    Energy Technology Data Exchange (ETDEWEB)

    Cherian, Judy G.; Harms, Nathan C. [Department of Chemistry, University of Tennessee, Knoxville, Tennessee 37996 (United States); Birol, Turan; Vanderbilt, David [Department of Physics and Astronomy, Rutgers, The State University of New Jersey, Piscataway, New Jersey 08854 (United States); Gao, Bin; Cheong, Sang-Wook [Department of Physics and Astronomy, Rutgers, The State University of New Jersey, Piscataway, New Jersey 08854 (United States); Rutgers Center for Emergent Materials, Rutgers, The State University of New Jersey, Piscataway, New Jersey 08854 (United States); Musfeldt, Janice L., E-mail: musfeldt@utk.edu [Department of Chemistry, University of Tennessee, Knoxville, Tennessee 37996 (United States); Department of Physics, University of Tennessee, Knoxville, Tennessee 37996 (United States)

    2016-06-27

    We bring together optical absorption spectroscopy, photoconductivity, and first principles calculations to reveal the electronic structure of the room temperature ferroelectric Ca{sub 3}Ti{sub 2}O{sub 7}. The 3.94 eV direct gap in Ca{sub 3}Ti{sub 2}O{sub 7} is charge transfer in nature and noticeably higher than that in CaTiO{sub 3} (3.4 eV), a finding that we attribute to dimensional confinement in the n = 2 member of the Ruddlesden-Popper series. While Sr substitution introduces disorder and broadens the gap edge slightly, oxygen deficiency reduces the gap to 3.7 eV and gives rise to a broad tail that persists to much lower energies.

  4. Preparation of high dielectric constant thin films of CaCu3 Ti4 by sol ...

    Indian Academy of Sciences (India)

    WINTEC

    group Im3 in which the Ti. 4+ ions occupy centrosymmetric position in the octahedral sites. The angle of tilt is suffi- ciently large that the Cu. 2+ ions occupy an essentially square-planer environment (Adams et al 2006). High di- electric constant, as shown by CCTO, is usually found in ferroelectric materials; however, no ...

  5. Radiolabeling of DOTATOC with the long-lived positron emitter {sup 44}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Pruszynski, Marek; Majkowska-Pilip, Agnieszka [Centre of Radiochemistry and Nuclear Chemistry, Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warszawa (Poland); Loktionova, Natalia S.; Eppard, Elisabeth [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany); Roesch, Frank, E-mail: frank.roesch@uni-mainz.de [Institute of Nuclear Chemistry, Johannes Gutenberg-University of Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany)

    2012-06-15

    The positron-emitting radionuclide {sup 44}Sc with a half-life of 3.97 h and a {beta}{sup +} branching of 94.3% is of potential interest for clinical PET. As so far it is available from a {sup 44}Ti/{sup 44}Sc generator in Mainz, where long-lived {sup 44}Ti decays to no-carrier-added (nca) {sup 44}Sc. The {sup 44}Sc is a trivalent metal cation and should be suitable for complexation with many well established bifunctional chelators conjugated to peptides or other molecular targeting vectors. Thus, the aim of this work was to investigate the potential of {sup 44}Sc for labeling of DOTA-conjugated peptides. DOTA-D-Phe{sup 1}-Tyr{sup 3}-octreotide (DOTATOC) was used as a model molecule to study and optimize labeling procedure. Reaction parameters such as buffer conditions, concentration of peptide, pH range, reaction temperature and time were optimized. Addition of 21 nmol of DOTATOC to {sup 44}Sc in ammonium acetate buffer pH 4.0 provided labeling yields >98% within 25 min of heating in an oil-bath at 95 Degree-Sign C. This time can be reduced to 3 min only by applying microwave supported heating. {sup 44}Sc-DOTATOC was found to be stable in 0.9% NaCl, PBS pH 7.4, fetal calf and human serums, and also in the presence of competing metal cations (Fe{sup 3+}, Ca{sup 2+}, Cu{sup 2+}, Mg{sup 2+}), as well as other ligand competitors, like EDTA and DTPA, even after almost 25 h incubation at 37 Degree-Sign C. Present study shows that nca {sup 44}Sc forms stable complexes with the macrocyclic ligand DOTA and that {sup 44}Sc-DOTATOC and analog targeting vectors may be synthesized for further preclinical and clinical investigations. - Highlights: Black-Right-Pointing-Pointer Labeling of somatostatin analouges with positron emitter {sup 44}Sc was tested. Black-Right-Pointing-Pointer DOTATOC was labeled with {sup 44}Sc isotope. Black-Right-Pointing-Pointer Optimal conditions for {sup 44}Sc-DOTATOC synthesis were found. Black-Right-Pointing-Pointer Stability of {sup 44}Sc

  6. Ion-microprobe measurements of Mg, Ca, Ti and Fe isotopic ratios and trace element abundance in hibonite-bearing inclusions in primitive meteorites

    International Nuclear Information System (INIS)

    Fahey, A.J.

    1988-01-01

    This thesis reports the isotopic abundances of Mg, Ca, and Ti and rare earth element (REE) abundances in 19 hibonite-bearing inclusions from primative meteorites. The isotopic ratios of Fe were measured in one of the samples, Lance HH-1. These measurements were made by means of secondary ion mass spectrometry (CAMECA IMS-3f). The novel hardware and software developments that made this work possible are described in detail. The samples were studied in thin section in order to investigate the relationship between the inclusions and their mineralogical environments. Inclusions from a number of different meteorites, specifically, Mighei, Murray, Murchison, Lance, Efremovka, Vigarano, Qingzhen, Dhajala, and Semarkona, were studied. The isotopes of Ca and Ti show large and correlated abundance anomalies in their most neutron-rich isotopes, 48 Ca and 50 Ti. The largest anomalies among the samples studied here are in the Murray inclusion MY-F6, with a 4.6% deficit in 48 Ca and a 5.2% deficit in 50 Ti, and Lance HH-1, with 3.3% and 6.0% deficits in 48 Ca and 50 Ti respectively. Correlated excesses of 48 Ca and 50 Ti, up to 2.4% and 1.4% respectively, are found in some other samples studied here. The fact that there is a correlation of isotopic anomalies in two different elements is clear evidence for a nucleosynthetic origin of these effects. Various possibilities for the origin of these isotopic anomalies are discussed and it is shown that a Cosmic Chemical Memory-like model of the incomplete mixing of dust grains from one or several supernovae is sufficient to explain the data. Magnesium isotopes show excesses of 26 Mg, attributable to the in-situ decay of 26 Al, in 7 of these inclusions

  7. Photocatalytic characteristics for the nanocrystalline TiO{sub 2} on the Ag-doped CaAl{sub 2}O{sub 4}:(Eu,Nd) phosphor

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jung-Sik, E-mail: jskim@uos.ac.kr; Sung, Hyun-Je; Kim, Bum-Joon

    2015-04-15

    Highlights: • The photocatalytic reactivity of the TiO{sub 2}-coated on the Ag-doped long-lasting phosphor (CaAl{sub 2}O{sub 4}:Eu{sup 2+},Nd{sup 3+}). • The photodecomposition of benzene gas under visible light irradiation. • The TiO{sub 2}-coated on the Ag-doped long-lasting phosphor showed much higher photocatalytic reactivity. • The light emitted from the long-lasting phosphors contributed to the photo generation of TiO{sub 2}. - Abstract: This study investigated the photocatalytic behavior of nanocrystalline TiO{sub 2} deposited on Ag-doped long-lasting phosphor (CaAl{sub 2}O{sub 4}:Eu{sup 2+},Nd{sup 3+}). The CaAl{sub 2}O{sub 4}:Eu{sup 2+},Nd{sup 3+} phosphor powders were prepared via conventional sintering using CaCO{sub 3}, Al{sub 2}O{sub 3}, Eu{sub 2}O{sub 3}, and Nd{sub 2}O{sub 3} as raw materials according to the appropriate molar ratios. Silver nanoparticles were loaded on the phosphor by mixing with an aqueous Ag-dispersion solution. Nanocrystalline TiO{sub 2} was deposited on Ag-doped CaAl{sub 2}O{sub 4}:Eu{sup 2+},Nd{sup 3+} powders via low-pressure chemical vapor deposition (LPCVD). The TiO{sub 2} coated on the phosphor was actively photo-reactive under irradiation with visible light and showed much faster benzene degradation than pure TiO{sub 2}, which is almost non-reactive. The coupling of TiO{sub 2} with phosphor may result in an energy band bending in the junction region, which then induces the TiO{sub 2} crystal at the interface to be photo-reactive under irradiation with visible light. In addition, the intermetallic compound of CaTiO{sub 3} that formed at the interface between TiO{sub 2} and the CaAl{sub 2}O{sub 4}:(Eu{sup 2+},Nd{sup 3+}) phosphor results in the formation of oxygen vacancies and additional electrons that promote the photodecomposition of benzene gas. The addition of Ag nanoparticles enhanced the photocatalytic reactivity of the TiO{sub 2}/CaAl{sub 2}O{sub 4}:Eu{sup 2+},Nd{sup 3+} phosphor. TiO{sub 2} on the Ag

  8. Crystal structure and ferroelectric properties of Ca(Cu3−xMx)Ti4O12 (M = Fe and Ni) ceramics

    International Nuclear Information System (INIS)

    Moriyama, Tohru; Kan, Akinori; Ogawa, Hirotaka

    2013-01-01

    Highlights: ► M-substituted Ca(Cu 3−x M x )Ti 4 O 12 (CCMTO) ceramics, where M = Fe and Ni, were synthesized. ► The influence of M substitution for Cu on crystal structure and ferroelectric properties of CCMTO ceramics were investigated. ► Analysis of CCMTO ceramics revealed the single phase of CCMTO ceramics belongs to I23 non-centrosymmetric space group of I23. ► As a result, the P r and E c values of CCFTO ceramics at x = 0.05 were 1.8 μC/cm 2 and 40 kV/cm, respectively. -- Abstract: M-substituted Ca(Cu 3−x M x )Ti 4 O 12 (CCMTO) ceramics, where M = Fe and Ni, were synthesized and the influence of M substitutions for Cu on the crystal structure and ferroelectric properties of CCMTO ceramics were investigated in this study. From the variations in the lattice parameters of CCMTO ceramics, the solubility limit of Ni substitution for Cu in CaCu 3−x Ni x Ti 4 O 12 (CCNTO) ceramics was x = 0.2, whereas that of CaCu 3−x Fe x Ti 4 O 12 (CCFTO) ceramics was x = 0.05. The crystal structural analysis of CCMTO ceramics revealed that the single phase of CCMTO ceramics belongs to the I23 non-centrosymmetric space group of I23; as a result, the P r and E c values of CCFTO ceramics at x = 0.05 were 1.8 μC/cm 2 and 40 kV/cm, respectively. The ferroelectric behavior of CCMTO ceramics by the M substitutions for Cu may be related to the displacement of a Ti 4+ cation in the TiO 6 octahedra and tilting of the Ti–O–Ti angle because of the non-centrosymmetric space group

  9. Investigation into the use of CaZrO{sub 3} as a facecoat material in the investment casting of TiAl alloys

    Energy Technology Data Exchange (ETDEWEB)

    Yuan, C., E-mail: c.yuan@bham.ac.uk [School of Metallurgy and Materials, The University of Birmingham, B152TT (United Kingdom); Cheng, X. [School of Metallurgy and Materials, The University of Birmingham, B152TT (United Kingdom); School of Material Science and Engineering, Beihang University, No, 37 Xueyuan Street, Haidian District, Beijing 100191 (China); Withey, P.A. [School of Metallurgy and Materials, The University of Birmingham, B152TT (United Kingdom); Rolls-Royce plc. (United Kingdom)

    2015-04-01

    Research was carried out to determine the interactions between the filler and stucco materials in CaZrO{sub 3} based facecoats during shell firing as well as between the facecoat and a TiAl alloy during the casting process. A ‘flash re-melting’ technique, which gives a similar heating profile to the actual investment casting process, was used to study the phase transformations in the shell moulds. The chemical inertness of the facecoat was then investigated using a sessile drop test using a Ti–45Al–2Nb–2Mn–0.2TiB alloy. In this study, the facecoat compositions and the interaction products between metal and shells were characterized using x-ray diffraction, scanning electron microscopy (SEM) and transmission electron microscopy (TEM). A severe interaction was found between CaZrO{sub 3} filler and Al{sub 2}O{sub 3} stucco, which rapidly damaged the shell surface. As well as oxygen, zirconium and silicon ions from the shell moulds were also observed to penetrate into the TiAl metal to form (Ti, Zr){sub 5}(Al, Si){sub 3} phases in the metal/shell interfacial areas. - Highlights: • To determine the interactions between CaZrO{sub 3} filler and stucco materials during shell firing. • To study the reaction between the CaZrO{sub 3} facecoat and TiAl alloy during casting. • The Al{sub 2}O{sub 3} stucco can react with CaZrO{sub 3} filler to form (Zr, Ca)O{sub 2} and CaAl{sub x}O{sub y} at 1650 °C. • O, Zr and Si ions from the ceramic moulds were observed to penetrate into the TiAl metal. • The reaction products include (Ti, Zr){sub 5}(Al, Si){sub 3} and ZrAl{sub 2} phase with high Ti ions solid solution.

  10. High temperature crystallographic and thermodynamic investigations on synthetic calzirtite (Ca2Zr5Ti2O16)

    International Nuclear Information System (INIS)

    Jafar, M.; Phapale, S.; Achary, S.N.; Mishra, R.; Tyagi, A.K.

    2016-01-01

    Immobilization of actinides in the high level waste (HLW) produced from nuclear reactors in durable host matrix is one of the important concerns in nuclear power technology. Rock analogue (SYNROC) ceramic composites of titanates and zirconates namely zirconolite, calzirtite etc. have been proposed as alternate host matrix for disposal of long lived fission products. These minerals have ability to incorporate or immobilize a wider variety of ions simultaneously without further segregation to any other phases and are stable in geothermal conditions. Knowledge of thermodynamic stability of these minerals is important for their deployment as host matrix for actinide waste disposal. In this work crystal structure and thermodynamic parameters of a mineral analogous titanate termed as calzirtite (Ca 2 Zr 5 Ti 2 O 16 ) has been determined

  11. Electromagnetic behavior of radar absorbing materials based on Ca hexaferrite modified with Co-Ti ions and doped with La

    Directory of Open Access Journals (Sweden)

    Valdirene Aparecida da Silva

    2009-06-01

    Full Text Available Radar Absorbing Materials (RAM are compounds that absorb incidental electromagnetic radiation in tuned frequencies and dissipate it as heat. Its preparation involves the adequate processing of polymeric matrices filled with compounds that act as radar absorbing centers in the microwave range. This work shows the electromagnetic evaluation of RAM based on CoTi and La doped Ca hexaferrite. Vibrating Sample Magnetization analyses show that ion substitution promoted low values for the parameters of saturation magnetization (123.65 Am2/kg and coercive field (0.07 T indicating ferrite softening. RAM samples obtained using different hexaferrite concentrations (40-80 per cent, w/w show variations in complex permeability and permittivity parameters and also in the performance of incidental radiation attenuation. Microwave attenuation values between 40 and 98 per cent were obtained.

  12. Application of CaCu3Ti4O12 based quadruple perovskites as a promising candidate for optoelectronic devices

    Science.gov (United States)

    Pal, Kamalesh; Jana, Rajkumar; Dey, Arka; Ray, Partha P.; Seikh, Md Motin; Gayen, Arup

    2018-05-01

    We report the synthesis of nanosized (40-50 nm) CaCu3-xMnxTi4-xMnxO12 (x = 0, 0.5 and 1) quadruple perovskite (QP) semiconductor via a modified combustion method for use as Schottky barrier diode (SBD) at the Al/QP junction. The fabricated SBD is analysed on the basis of thermionic emission theory to observe its quality and some important diode parameters. For insight analysis of charge transport mechanism through metal-semiconductor junction, theory of space charge limited currents is applied and discussed in the light of parameters like carrier concentration, mobility-lifetime product and diffusion length. The Mn-doped exhibit better device performance compared to parent material.

  13. Effect of sintering time on the physical characteristics of CaCu_3Ti_4O_1_2

    International Nuclear Information System (INIS)

    Carvalho, E. de; Muccillo, E.N.S.

    2011-01-01

    Polycrystalline CaCu_3Ti_4O_1_2 (CCTO) with the perovskite type structure has a high dielectric constant that can do up to 10"5, at room temperature, which make it an interesting material to be applied at several microelectronic devices. In this work, CCTO was prepared by the conventional solid state method, in order to identify the influence of process parameters in its properties. Powders were homogenized in a mechanical mixer, calcined at 900 °C for 18 hours, pressed into 10 mm diameter pellets and sintered at 1050 °C for 12 and 18 hours. Density achieved was 94 and 87%, pellets sintered for 12 and 18 hours, respectively. X-ray diffraction confirms the presence of the cubic phase of perovskite type. The observation of micrographs shows an increase of the grain size with the sintering time. Dielectric properties present a dependence on the sample process. (author)

  14. Role of strained nano-regions in the formation of subgrains in CaCu3Ti4O12

    Science.gov (United States)

    Fang, Tsang-Tse; Wang, Yong-Huei; Kuo, Jui-Chao

    2011-07-01

    Single-phase CaCu3Ti4O12 (CCTO) was synthesized by solid-state reaction. Electron backscatter diffraction, scanning electron microscopy, and atomic force microscopy were adopted to characterize the grain orientation, microstructure, and surface morphology of the CCTO samples with or without thermal etching. Bump strained nano-regions induced by the local compositional disorder at a nano-scale have been discovered, being the origin of the formation of subgrains in CCTO. The proposed mechanism for the formation of subgrains involves the formation of etched pits and subboundaries pertaining to the strained nano-regions rather than dislocation displacement. The dielectric response inside the grains of CCTO relevant to the strained nano-regions is also discussed.

  15. Effect of orthorhombic distortion on dielectric and piezoelectric properties of CaBi4Ti4O15 ceramics

    International Nuclear Information System (INIS)

    Tanwar, Amit; Sreenivas, K.; Gupta, Vinay

    2009-01-01

    High temperature bismuth layered piezoelectric and ferroelectric ceramics of CaBi 4 Ti 4 O 15 (CBT) have been prepared using the solid state route. The formation of single phase material with orthorhombic structure was verified from x-ray diffraction and Raman spectroscopy. The orthorhombic distortion present in the CBT ceramic sintered at 1200 deg. C was found to be maximum. A sharp phase transition from ferroelectric to paraelectric was observed in the temperature dependent dielectric studies of all CBT ceramics. The Curie's temperature (T c =790 deg. C) was found to be independent of measured frequency. The behavior of ac conductivity as a function of frequency (100 Hz-1 MHz) at low temperatures ( 33 ). The observed results indicate the important role of orthorhombic distortion in determining the improved property of multicomponent ferroelectric material.

  16. Structural, electronic and elastic properties of the cubic CaTiO{sub 3} under pressure: A DFT study

    Energy Technology Data Exchange (ETDEWEB)

    Tariq, Saad, E-mail: saadigi@hotmail.com; Ahmed, Afaq; Tariq, Samar [Centre of Excellence in Solid State Physics, University of Punjab, Lahore, 54000 (Pakistan); Saad, Saher [Centre for High Energy Physics, University of the Punjab, Lahore (Pakistan)

    2015-07-15

    Using highly accurate FP-LAPW method with GGA approximation structural, electronic and elastic properties of cubic CaTiO{sub 3} have been calculated from 0-120 GPa range of pressure. It is observed that lattice constant, bond length and anisotropy factor decrease with increase in pressure. Also the brittle nature and indirect band-gap of the compound become ductile and direct band-gap respectively at 120 GPa. Moduli of elasticity, density of the material, Debye temperature and wave elastic wave velocities increase with increase in pressure. Spin dependent DOS’s plots show invariant anti-ferromagnetic nature of the compound under pressure. Our calculated results are in good agreement with available theoretical and experimental results.

  17. Structural, electronic and elastic properties of the cubic CaTiO3 under pressure: A DFT study

    Directory of Open Access Journals (Sweden)

    Saad Tariq

    2015-07-01

    Full Text Available Using highly accurate FP-LAPW method with GGA approximation structural, electronic and elastic properties of cubic CaTiO3 have been calculated from 0-120 GPa range of pressure. It is observed that lattice constant, bond length and anisotropy factor decrease with increase in pressure. Also the brittle nature and indirect band-gap of the compound become ductile and direct band-gap respectively at 120 GPa. Moduli of elasticity, density of the material, Debye temperature and wave elastic wave velocities increase with increase in pressure. Spin dependent DOS’s plots show invariant anti-ferromagnetic nature of the compound under pressure. Our calculated results are in good agreement with available theoretical and experimental results.

  18. Experimental and numerical investigation of a ceramic dielectric resonator (DRA): CaCu3Ti4O12 (CCTO)

    International Nuclear Information System (INIS)

    Almeida, A.F.L.; Silva, R.R.; Rocha, H.H.B.; Fechine, P.B.A.; Cavalcanti, F.S.A.; Valente, M.A.; Freire, F.N.A.; Sohn, R.S.T.M.

    2008-01-01

    In this study, the CaCu 3 Ti 4 O 12 (CCTO) ceramic phase was synthesized by microwave heating in a much shorter time compared to the conventional heating methods. The results indicate that microwave processing is a promising method for preparing CCTO ceramics. CCTO was prepared using a domestic microwave oven operated at 2.45 GHz with 800 W. After a few minutes of microwave irradiation the formation of CCTO was confirmed by X-ray powder diffraction. The CCTO ceramic was studied in the medium-frequency (MF) range (100 Hz-1 MHz) and in the microwave range of frequencies. The experimental and theoretical characteristics of the dielectric resonator antenna are investigated

  19. The 15th Internatonal Conference Quality in Resarch (Qir) 2017 Preparation and Ionic Conductivity of Li3.9Ca0.1Ti5O12 Using Waste Chicken Eggshells as ca Source for Anode Material of Lithium-Ion Batteries

    Science.gov (United States)

    Subhan, Achmad; Setiawan, Dedy; Ahmiatri Saptari, Sitti

    2018-03-01

    Li3.9Ca0.1Ti5O12 has been synthesized as anode material for lithium-ion batteries parallel with Li4Ti5O12 anode material using solid state reaction method in an air atmosphere. LiOH.H2O, TiO2, and waste chicken eggshells in the form of CaCO3 were chosen as sources of Li, Ti, and Ca respectively and prepared using stoichiometric. The phase structure, morphology, and electrochemical impedance of as-prepared samples were characterized using XRD, SEM, and EIS. The XRD characterization revealed that in Li3.9Ca0.1Ti5O12 sample, all amount of dopant had entered the lattice structure of Li4Ti5O12. The EDX image also detect the existence of Ca in the structure of Li3.9Ca0.1Ti5O12. The EIS characterization revealed that the Li3.9Ca0.1Ti5O12 sample had lower electrochemical impedance compared to the Li4Ti5O12 sample. The diffusion coefficient were obtained by Faraday’s method, and exhibited that the Li3.9Ca0.1Ti5O12 sample (1.46986 × 10-12 cm2/s) had higher ionic conductivity than the Li4Ti5O12 sample (4.40995 × 10-16 cm2/s). According to the cycle performance test, the Li3.9Ca0.1Ti5O12 sample also had higher charge-discharge capacity and stability compared to the Li4Ti5O12 sample.

  20. Investigating the solubility and cytocompatibility of CaO-Na2 O-SiO2 /TiO2 bioactive glasses.

    Science.gov (United States)

    Wren, Anthony W; Coughlan, Aisling; Smith, Courtney M; Hudson, Sarah P; Laffir, Fathima R; Towler, Mark R

    2015-02-01

    This study aims to investigate the solubility of a series of titanium (TiO2 )-containing bioactive glasses and their subsequent effect on cell viability. Five glasses were synthesized in the composition range SiO2 -Na2 O-CaO with 5 mol % of increments TiO2 substituted for SiO2 . Glass solubility was investigated with respect to (1) exposed surface area, (2) particle size, (3) incubation time, and (4) compositional effects. Ion release profiles showed that sodium (Na(+) ) presented high release rates after 1 day and were unchanged between 7 and 14 days. Calcium (Ca(2+) ) release presented a significant change at each time period and was also composition dependent, where a reduction in Ca(2+) release is observed with an increase in TiO2 concentration. Silica (Si(4+) ) release did not present any clear trends while no titanium (Ti(4+) ) was released. Cell numbers were found to increase up to 44%, compared to the growing control population, with a reduction in particle size and with the inclusion of TiO2 in the glass composition. © 2014 Wiley Periodicals, Inc.

  1. Charge transfer-type fluorescence of Ti-doped Ca{sub 14}Al{sub 10}Zn{sub 6}O{sub 35}

    Energy Technology Data Exchange (ETDEWEB)

    Satoh, Yuta; Takemoto, Minoru, E-mail: takemoto@chem.kanagawa-it.ac.jp

    2017-05-15

    The calcium aluminum zincates Ca{sub 14}(Al{sub 1-2x}Ti{sub x}Zn{sub x}){sub 10}Zn{sub 6}O{sub 35}, in which Al{sup 3+} sites in the host material Ca{sub 14}Al{sub 10}Zn{sub 6}O{sub 35} are simultaneously substituted by Ti{sup 4+} and Zn{sup 2+}, were synthesized by a polymerized complex method. Al{sup 3+} ions could be replaced up to an x value of 0.1. The host material does not exhibit fluorescence, while the cation-substituted samples show an emission band centered at 383 nm under excitation by UV light at 243 nm. The emission intensity increases with x up to 0.1 and then gradually decreases as x is further increased. The emission wavelength also becomes longer with increasing temperature. Based on the properties of other Ti{sup 4+}-containing fluorescent materials, the emission of Ca{sub 14}(Al{sub 1-2x}Ti{sub x}Zn{sub x}){sub 10}Zn{sub 6}O{sub 35} is attributed to charge transfer-type fluorescence resulting from [TiO{sub 6}] octahedra.

  2. Enhanced ferro-and piezoelectric properties of Bi4Ti3O12-CaBi4Ti4O15 thin film on Pt(111)/Ti/SiO2/Si substrate

    Science.gov (United States)

    Yan, J.; Hu, G. D.

    2018-05-01

    Bi4Ti3O12-CaBi4Ti4O15 (BT-CBTi) film was fabricated on Pt(111)/Ti/SiO2/Si substrate by the sol-gel method. The intergrowth structure was demonstrated to be obtained both in the film and corresponding powder sample according to x-ray diffraction (XRD) patterns. The good fatigue resistance as well as a strong charge-retaining ability can be obtained in the intergrowth BT-CBTi film. The remanent polarization (P r ) and coercive field (E c ) for BT-CBTi film was about 28 μC cm‑2 and 150 kV cm‑1 under an electric field of 540 kV cm‑1, respectively. The P r value of purely (100)-oriented BT-CBTi film can be roughly estimated to be higher than 50 μC cm‑2 based on both the volume fraction of (100)-oriented grains and the piezoelectric properties. The P r value of BT-CBTi film is about 50 μC cm‑2 under an electric field of 1100 kV cm‑1 in predominently (100)-oriented BT-CBTi film. It means that it is reasonable to predict the performance of (100)-oriented BT-CBTi films based on the ferroelectric and piezoelectric properties of the polycrystalline BT-CBTi film. The spontaneous polarization is larger than 80 μC cm‑2 under an electric field of 1100 kV cm‑1.

  3. Fabrication of lead-free piezoelectric Li2CO3-added (Ba,Ca)(Ti,Sn)O3 ceramics under controlled low oxygen partial pressure and their properties

    Science.gov (United States)

    Noritake, Kouta; Sakamoto, Wataru; Yuitoo, Isamu; Takeuchi, Teruaki; Hayashi, Koichiro; Yogo, Toshinobu

    2018-02-01

    Reduction-resistant lead-free (Ba,Ca)(Ti,Sn)O3 piezoceramics with high piezoelectric constants were fabricated by optimizing the amount of Li2CO3 added. Oxygen partial pressure was controlled during the sintering of (Ba,Ca)(Ti,Sn)O3 ceramics in a reducing atmosphere using H2-CO2 gas. Enhanced grain growth and a high-polarization state after poling treatment were achieved by adding Li2CO3. Optimizing the amount of Li2CO3 added to (Ba0.95Ca0.05)(Ti0.95Sn0.05)O3 ceramics sintered under a low oxygen partial pressure resulted in improved piezoelectric properties while maintaining the high sintered density. The prepared Li2CO3-added ceramic samples had homogeneous microstructures with a uniform dispersion of each major constituent element. However, the residual Li content in the 3 mol % Li2CO3-added (Ba0.95Ca0.05)(Ti0.95Sn0.05)O3 ceramics after sintering was less than 0.3 mol %. Sintered bodies of this ceramic prepared in a CO2 (1.5%)-H2 (0.3%)/Ar reducing atmosphere (PO2 = 10-8 atm at 1350 °C), exhibited sufficient electrical resistivity and a piezoelectric constant (d 33) exceeding 500 pC/N. The piezoelectric properties of this nonreducible ceramic were comparable or superior to those of the same ceramic sintered in air.

  4. Effects of Fuel to Synthesis of CaTiO3 by Solution Combustion Synthesis for High-Level Nuclear Waste Ceramics.

    Science.gov (United States)

    Jung, Choong-Hwan; Kim, Yeon-Ku; Han, Young-Min; Lee, Sang-Jin

    2016-02-01

    A solution combustion process for the synthesis of perovskite (CaTiO3) powders is described. Perovskite is one of the crystalline host matrics for the disposal of high-level radioactive wastes (HLW) because it immobilizes Sr and Lns elements by forming solid solutions. Solution combustion synthesis, which is a self-sustaining oxi-reduction reaction between nitrate and organic fuel, the exothermic reaction, and the heat evolved convert the precursors into their corresponding oxide products above 1100 degrees C in air. To investigate the effects of amino acid on the combustion reaction, various types of fuels were used; a glycine, amine and carboxylic ligand mixture. Sr, La and Gd-nitrate with equivalent amounts of up to 20% of CaTiO3 were mixed with Ca and Ti nitrate and amino acid. X-ray diffraction analysis, SEM and TEM were conducted to confirm the formed phases and morphologies. While powders with an uncontrolled shape are obtained through a general oxide-route process, Ca(Sr, Lns)TiO3 powders with micro-sized soft agglomerates consisting of nano-sized primary particles can be prepared using this method.

  5. X-ray photoemission spectroscopy investigation of CaTiO3:Eu for luminescence property: effect of Eu3+ ion

    International Nuclear Information System (INIS)

    Wang, Kaichen; Zhao, Baijun; Gao, Lu

    2016-01-01

    Graphical abstract: The influence on the photoluminescent performance due to the electronic structure change in Eu-doped CaTiO 3 of the specific core-level and valence band spectrum via X-ray photoemission spectroscopy were characterized. - Highlights: • Single phase CaTiO 3 and CaTiO 3 : Eu crystals were prepared under mild hydrothermal method. • Crystal structure, doping level and the relations to their luminescent property were discussed. • Charge compensation mechanism was discussed via valance band spectrum by XPS. - Abstract: Charge compensation of on-site Eu 4f–5d transition that determines the luminescent performance was confirmed with valance band spectrum. Influence of photoelectrons from CaTiO 3 : Eu to the corresponding luminescent performance was discussed based on the crystal structure, doping level and the relations to their luminescent property. This paper is important to further optimize the luminescent performance for improving the efficiency and reducing the cost in light emitting diode industry.

  6. Microstructure and wear behavior of γ/Al4C3/TiC/CaF2 composite coating on γ-TiAl intermetallic alloy prepared by Nd:YAG laser cladding

    International Nuclear Information System (INIS)

    Liu Xiubo; Shi Shihong; Guo Jian; Fu Geyan; Wang Mingdi

    2009-01-01

    As a further step in obtaining high performance elevated temperature self-lubrication anti-wear composite coatings on TiAl alloy, a novel Ni-P electroless plating method was adopted to encapsulate the as-received CaF 2 in the preparation of precursor NiCr-Cr 3 C 2 -CaF 2 mixed powders with an aim to decrease its mass loss and increase its compatibility with the metal matrix during a Nd:YAG laser cladding. The microstructure of the coating was examined using X-ray diffraction (XRD), scanning electron microscope (SEM) and energy dispersive spectroscopy (EDS) and the friction and wear behavior of the composite coatings sliding against the hardened 0.45% C steel ring was evaluated using a block-on-ring wear tester at room temperature. It was found that the coating had a unique microstructure consisting of primary dendrites TiC and block Al 4 C 3 carbides reinforcement as well as fine isolated spherical CaF 2 solid lubrication particles uniformly dispersed in the NiCrAlTi (γ) matrix. The good friction-reducing and anti-wear abilities of the laser clad composite coating was suggested to the Ni-P electroless plating and the attendant reduction of mass loss of CaF 2 and the increasing of it's wettability with the NiCrAlTi (γ) matrix during the laser cladding process

  7. High homogeneity powder of Ti-Ba-Ca-Cu-O (2223) prepared by Freeze-Drying method

    International Nuclear Information System (INIS)

    Al-Shakarchi, Emad Kh.; Toma, Ziad A.

    1999-01-01

    Full text.Homogeneous high temerature superconductor ceramic powder of TI-Ba-Ca-Cu-O with transition temperature [Tc=123K] have been successfully prepared from the mixture of nitrate salts [TlNO 3 , Ba(NO 3 ) 2 , Ca(NO 3 ) 2 .4H 2 O and Cu(NO 3 ) 2 .3H 2 O] by using freeze-drying method. Freeze-dryer that was used in this work designed locally in our laboratory. This technique consider a better to get a fine powder of ceramic materials by depending on the procedure of frozen droplets with present of liquid nitrogen. SEM pictures showed the size of grains of about [0.8 μm]. We conclude that the high sintering temperature, for the prepared powders in this technique, for long time [120 hrs] will increase the inter diffusion between the grains ahich caused the decreasing in the density of the sample which may be given a better results than the obtained in a previous works

  8. Shape Memory Characteristics of Ti(sub 49.5)Ni(sub 25)Pd(sub 25)Sc(sub 0.5) High-Temperature Shape Memory Alloy After Severe Plastic Deformation

    Science.gov (United States)

    Atli, K. C.; Karaman, I.; Noebe, R. D.; Garg, A.; Chumlyakov, Y. I.; Kireeva, I. V.

    2011-01-01

    A Ti(49.5)Ni25Pd25Sc(0.5) high-temperature shape memory alloy is thermomechanically processed to obtain enhanced shape-memory characteristics: in particular, dimensional stability upon repeated thermal cycles under constant loads. This is accomplished using severe plastic deformation via equal channel angular extrusion (ECAE) and post-processing annealing heat treatments. The results of the thermomechanical experiments reveal that the processed materials display enhanced shape memory response, exhibiting higher recoverable transformation and reduced irrecoverable strain levels upon thermal cycling compared with the unprocessed material. This improvement is attributed to the increased strength and resistance of the material against defect generation upon phase transformation as a result of the microstructural refinement due to the ECAE process, as supported by the electron microscopy observations.

  9. Density functional study of the stability and magnetic behaviour of Au{sub n}TM{sup +} clusters (TM=Au,Sc,Ti,V,Cr,Mn,Fe; 1{<=}n{<=}9)

    Energy Technology Data Exchange (ETDEWEB)

    Torres, M.B. [Dpto. de Matematicas y Computacion, Univ. de Burgos, Avda. de Cantabria s/n, 09006-Burgos (Spain); Fernandez, E.M.; Balbas, L.C. [Dpto. de Fisica Teorica, Univ. de Valladolid, Prado de la Magdalena s/n, 47011-Valladolid (Spain)

    2005-03-01

    We study the element- and size-dependent electron stability of Au{sub n}TM{sup +} clusters (TM=Sc,Ti,V,Cr,Mn,Fe,Au; 1{<=}n{<=}9) by means of first-principles density functional calculations. The interplay between the cluster atomic arrangements and their electronic and magnetic structure is investigated for the few lower energy isomeric-states in dependence of the TM-atom and its environment in the cluster. We explain the experimental magic-numbers, observed recently, as well as the trend of the impurity local magnetic moment in dependence with the size of the cluster and the position of the impurity in the host. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  10. Polarization fatigue resistance of Ca-doped Pb(Zr0.52Ti0.48)O3 thin films prepared by the sol-gel method

    International Nuclear Information System (INIS)

    Wei, T.; Wang, Y.; Zhu, C.; Dong, X.W.; Xia, Y.D.; Zhu, J.S.; Liu, J.-M.

    2008-01-01

    The ferroelectric and polarization fatigue characteristics of Pb 1-x Ca x (Zr 0.52 Ti 0.48 )O 3 (PCZT) thin films prepared using the sol-gel method were studied. The Ca-doping slightly suppresses the ferroelectricity of Pb(Zr 0.52 Ti 0.48 )O 3 (PZT) because of the quantum paraelectric behavior of CaTiO 3 . Compared with PZT thin films, the PCZT (x=0.2) thin films show enhanced fatigue resistance at room temperature, further emphasized by the almost fatigue-free behavior at 100 K. The temperature-dependent dc-conductivity suggests a decrease of the oxygen vacancy density by almost 20 times and a slightly declined activation energy U for oxygen vacancies, upon increasing of the Ca-doping content from 0.0 to 0.2. It is argued that the improved fatigue endurance is ascribed to the decreasing density of oxygen vacancies due to the Ca-doping, although the lowered activation energy of oxygen vacancies is unfavorable. (orig.)

  11. DFT investigation of NH{sub 3}, PH{sub 3}, and AsH{sub 3} adsorptions on Sc-, Ti-, V-, and Cr-doped single-walled carbon nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Buasaeng, Prayut; Rakrai, Wandee [Computational Chemistry Center for Nanotechnology and Department of Chemistry, Faculty of Science and Technology, Rajabhat Maha Sarakham University, Maha Sarakham, 44000 (Thailand); Wanno, Banchob [Center of Excellence for Innovation in Chemistry and Supramolecular Chemistry Research Unit, Department of Chemistry, Faculty of Science, Mahasarakham University, Maha Sarakham, 44150 (Thailand); Tabtimsai, Chanukorn, E-mail: tabtimsai.c@gmail.com [Computational Chemistry Center for Nanotechnology and Department of Chemistry, Faculty of Science and Technology, Rajabhat Maha Sarakham University, Maha Sarakham, 44000 (Thailand)

    2017-04-01

    Highlights: • Transition metal-doped single wall carbon nanotubes and their adsorption with NH{sub 3}, PH{sub 3} and AsH{sub 3} molecules were investigated using a DFT method. • Adsorptions of NH{sub 3}, PH{sub 3} and AsH{sub 3} molecules on pristine single wall carbon nanotubeswere improved by transition metal doping. • Structural and electronic properties of single wall carbon nanotubes were significantly changed by transition metal doping and gas adsorptions. - Abstract: The adsorption properties of ammonia (NH{sub 3}), phosphine (PH{sub 3}), and arsine (AsH{sub 3}) on pristine and transition metal- (TM = Sc, Ti, V, and Cr) doped (5,5) armchair single-walled carbon nanotubes (SWCNTs) were theoretically investigated. The geometric and electronic properties and adsorption abilities for the most stable configuration of NH{sub 3}, PH{sub 3}, and AsH{sub 3} adsorptions on pristine and TM-doped SWCNTs were calculated. It was found that the binding abilities of TMs to the SWCNT were in the order: Cr > V > Sc > Ti. However, the adsorption energy showed that the pristine SWCNT weakly adsorbed gas molecules and its electronic properties were also insensitive to gas molecules. By replacing a C atom with TM atoms, all doping can significantly enhance the adsorption energy of gas/SWCNT complexes and their adsorption ability was in the same order: NH{sub 3} > PH{sub 3} > AsH{sub 3}. A remarkable increase in adsorption energy and charge transfer of these systems was expected to induce significant changes in the electrical conductivity of the TM-doped SWCNTs. This work revealed that the sensitivity of SWCNT-based chemical gas adsorptions and sensors can be greatly improved by introducing an appropriate TM dopant. Accordingly, TM-doped SWCNTs are more suitable for gas molecule adsorptions and detections than the pristine SWCNT.

  12. Stability, elastic properties and fracture toughness of Al0.75X0.75B14 (X=Sc, Ti, V, Cr, Y, Zr, Nb, Mo) investigated using ab initio calculations

    International Nuclear Information System (INIS)

    Emmerlich, Jens; Thieme, Niklas; To Baben, Moritz; Music, Denis; Schneider, Jochen M

    2013-01-01

    The effect of the transition metal valence electron concentration on the energy of formation, effective charge of B icosahedra, elastic properties, surface energy and fracture toughness was calculated using density functional theory for icosahedral transition metal borides of AlXB 14 (X=Sc, Ti, V, Cr, Y, Zr, Nb, Mo). Consistent with previous work on AlYB 14 (Kölpin et al 2009 J. Phys.: Condens. Matter 21 355006) it is shown that phase stability is generally dependent on the effective charge of the icosahedral transition metal borides. Also, ionization potential and electronegativity are identified as parameters affecting the effective charge of B icosahedra suitable for use in predicting the phase stability. Al 0.75 Y 0.75 B 14 , Al 0.75 Sc 0.75 B 14 and Al 0.75 Zr 0.75 B 14 have been identified as promising phases for application as protective coatings as they exhibit high phase stability and stiffness combined with a comparatively high fracture toughness. (paper)

  13. Structural studies of five layer Aurivillius oxides: A2Bi4Ti5O18 (A=Ca, Sr, Ba and Pb)

    International Nuclear Information System (INIS)

    Ismunandar; Kamiyama, T.; Hoshikawa, A.; Zhou, Q.; Kennedy, B.J.; Kubota, Y.; Kato, K.

    2004-01-01

    The room temperature structures of the five layer Aurivillius phases A 2 Bi 4 Ti 5 O 18 , (A=Ca, Sr, Ba and Pb) have been refined from powder neutron diffraction data using the Rietveld method. The structures consist of [Bi 2 O 2 ] 2+ layers interleaved with perovskite-like [A 2 Bi 2 Ti 5 O 16 ] 2- blocks. The structures were refined in the orthorhombic space group B2eb (SG. No. 41), Z=4, and the unit cell parameters of the oxides are a=5.4251(2), b=5.4034(1), c=48.486(1); a=5.4650(2), b=5.4625(3), c=48.852(1); a=5.4988(3), b=5.4980(4), c=50.352(1); a=5.4701(2), b=5.4577(2), c=49.643(1) for A=Ca, Sr, Ba and Pb, respectively. The structural features of the compounds were found similar to n=2-4 layers bismuth oxides. The strain caused by mismatch of cell parameter requirements for the [Bi 2 O 2 ] 2+ layers and perovskite-like [A 2 Bi 2 Ti 5 O 16 ] 2- blocks were relieved by tilting of the TiO 6 octahedra. Variable temperature synchrotron X-ray studies for Ca and Pb compounds showed that the orthorhombic structure persisted up to 675 and 475K, respectively. Raman spectra of the compounds are also presented

  14. Improved structure stability, optical and magnetic properties of Ca and Ti co-substituted BiFeO{sub 3} nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Vijay; Singh, Satyendra, E-mail: satyambd@gmail.com

    2016-11-15

    Graphical abstract: (a) UV–vis absorption spectra and (b) Tauc’s plots to determine the band gap of the Bi{sub 1-x}Ca{sub x}Fe{sub 1-x}Ti{sub x}O{sub 3} nanoparticles for x = 0 (S1), 0.05 (S2), 0.10 (S3), 0.15 (S4), 0.20 (S5) and 0.25 (S6), respectively (c) Variation of band gap with x for Bi{sub 1-x}Ca{sub x}Fe{sub 1-x}Ti{sub x}O{sub 3} nanoparticles. Display Omitted - Highlights: • First report on synthesis of Bi{sub 1-x}Ca{sub x}Fe{sub 1-x}Ti{sub x}O{sub 3}, nanoparticles (0 ≤ x ≤ 0.25). • Ca and Ti co-substitutions control the formation of secondary phases and improved the stability of perovskite phase. • Strong absorption of visible light with a small optical band gap (1.77–2.26 eV). • Improved M{sub r} and H{sub c} due to the release of the latent magnetization locked within the toroidal spin structure. • May be useful for data storage, spintronics and optoelectronics. - Abstract: We report the optical and magnetic properties of single-crystalline Ca and Ti co-substituted bismuth ferrite, Bi{sub 1-x}Ca{sub x}Fe{sub 1-x}Ti{sub x}O{sub 3}, nanoparticles, synthesized by a facile sol–gel methodology in the compositional range wherein 0 ≤ x ≤ 0.25. X-ray diffraction (XRD) and transmission electron microscopy (TEM) investigations show that all samples possess a rhombohedrally distorted perovskite structure with space group R3c. Ca and Ti co-substitution controls the formation of secondary phases and improved the stability of perovskite phase of BiFeO{sub 3}. The average particle size was estimated by Williamson Hall plot, confirmed by TEM, and found to be about 59, 50, 46, 41, 40 and 38 nm of Bi{sub 1-x}Ca{sub x}Fe{sub 1-x}Ti{sub x}O{sub 3} for x = 0, 0.05, 0.10, 0.15, 0.20 and 0.25, respectively. The UV–vis absorption study reveal the strong absorption of visible light with a small optical band gap (1.77–2.25 eV) for 0 ≤ x ≤ 0.25 indicates a possibility of utilizing for photocatalytic activities. The magnetic study at room

  15. Solid-state reaction mechanism and microwave dielectric properties of CaTiO{sub 3}–LaAlO{sub 3} ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Juan [Ministry of Education Key Laboratory for the Green Preparation and Application of Functional Materials, Faculty of Materials Science & Engineering, Hubei University, Wuhan 430062 (China); Hubei Collaborative Innovation Center for Advanced Organic Chemical Materials, Hubei University, Wuhan 430062 (China); Fang, Danhua; Lu, Chao; Dou, Zhanming; Wang, Gan; Zhang, Fan [Ministry of Education Key Laboratory for the Green Preparation and Application of Functional Materials, Faculty of Materials Science & Engineering, Hubei University, Wuhan 430062 (China); Zhang, Tianjin, E-mail: zhangtj@hubu.edu.cn [Ministry of Education Key Laboratory for the Green Preparation and Application of Functional Materials, Faculty of Materials Science & Engineering, Hubei University, Wuhan 430062 (China); Hubei Collaborative Innovation Center for Advanced Organic Chemical Materials, Hubei University, Wuhan 430062 (China)

    2015-07-25

    Highlights: • CaTiO{sub 3}–LaAlO{sub 3} perovskite ceramics were prepared by four sintering reaction routes. • The solid-state reaction mechanism was investigated by XRD and TG/DSC techniques. • Sintering routes had more influence on the parameters of Q × f and τ{sub f} than on ε{sub r}. - Abstract: 0.675CaTiO{sub 3}–0.325LaAlO{sub 3} perovskite ceramics were prepared by a conventional sintering process through four reaction routes. The solid-state reaction mechanisms were investigated by X-ray diffraction and thermogravimetric/differential scanning calorimetric analysis techniques. The results show that interactions occurred between mixtures of CaCO{sub 3} and TiO{sub 2} as well as La{sub 2}O{sub 3} and Al{sub 2}O{sub 3}, and they can influence the sintering behavior of the mixtures. Prior to the formation of solid solutions, the perovskite phases CaTiO{sub 3} and LaAlO{sub 3} were formed regardless of the combination of oxide powders used as reagents. From the powder mixtures which were calcined at 1200 °C, a Ca-rich Ca{sub 9}Al{sub 6}O{sub 18} phase was present at 1400 °C if free La{sub 2}O{sub 3} and Al{sub 2}O{sub 3} used in the reaction mixtures. Ca-rich phases were also formed at higher temperature (1450 °C) if LaAlO{sub 3} was present. The densities of the ceramics obtained by the four routes were different at specific sintering temperatures, and the highest density was obtained for the reaction route two. Results indicated that the preparation pathways had more influence on Q × f and temperature coefficient of the resonant frequency (τ{sub f}) than on the dielectric constants (ε{sub r}), and Q × f decreased and τ{sub f} increased rapidly when the secondary phase presented. Route four is considered as an optimal pathway for the preparation of 0.675CaTiO{sub 3}–0.325LaAlO{sub 3} ceramics.

  16. Solid-state reaction mechanism and microwave dielectric properties of CaTiO3–LaAlO3 ceramics

    International Nuclear Information System (INIS)

    Jiang, Juan; Fang, Danhua; Lu, Chao; Dou, Zhanming; Wang, Gan; Zhang, Fan; Zhang, Tianjin

    2015-01-01

    Highlights: • CaTiO 3 –LaAlO 3 perovskite ceramics were prepared by four sintering reaction routes. • The solid-state reaction mechanism was investigated by XRD and TG/DSC techniques. • Sintering routes had more influence on the parameters of Q × f and τ f than on ε r . - Abstract: 0.675CaTiO 3 –0.325LaAlO 3 perovskite ceramics were prepared by a conventional sintering process through four reaction routes. The solid-state reaction mechanisms were investigated by X-ray diffraction and thermogravimetric/differential scanning calorimetric analysis techniques. The results show that interactions occurred between mixtures of CaCO 3 and TiO 2 as well as La 2 O 3 and Al 2 O 3 , and they can influence the sintering behavior of the mixtures. Prior to the formation of solid solutions, the perovskite phases CaTiO 3 and LaAlO 3 were formed regardless of the combination of oxide powders used as reagents. From the powder mixtures which were calcined at 1200 °C, a Ca-rich Ca 9 Al 6 O 18 phase was present at 1400 °C if free La 2 O 3 and Al 2 O 3 used in the reaction mixtures. Ca-rich phases were also formed at higher temperature (1450 °C) if LaAlO 3 was present. The densities of the ceramics obtained by the four routes were different at specific sintering temperatures, and the highest density was obtained for the reaction route two. Results indicated that the preparation pathways had more influence on Q × f and temperature coefficient of the resonant frequency (τ f ) than on the dielectric constants (ε r ), and Q × f decreased and τ f increased rapidly when the secondary phase presented. Route four is considered as an optimal pathway for the preparation of 0.675CaTiO 3 –0.325LaAlO 3 ceramics.

  17. Studies of the effects of TiCl{sub 3} in LiBH{sub 4}/CaH{sub 2}/TiCl{sub 3} reversible hydrogen storage system

    Energy Technology Data Exchange (ETDEWEB)

    Liu Dongan [Ford Motor Company, Research and Advanced Engineering, MD 1170/RIC, Dearborn, MI 48121 (United States); Department of Mechanical Engineering, University of Michigan, 1023 H. H. Dow Building 2350 Hayward Street, Ann Arbor, MI 48109-2125 (United States); Yang Jun, E-mail: jyang27@ford.com [Ford Motor Company, Research and Advanced Engineering, MD 1170/RIC, Dearborn, MI 48121 (United States); Ni Jun [Department of Mechanical Engineering, University of Michigan, 1023 H. H. Dow Building 2350 Hayward Street, Ann Arbor, MI 48109-2125 (United States); Drews, Andy [Ford Motor Company, Research and Advanced Engineering, MD 1170/RIC, Dearborn, MI 48121 (United States)

    2012-02-15

    Highlights: Black-Right-Pointing-Pointer We systematically studied the effects of TiCl{sub 3} in LiBH{sub 4}/CaH{sub 2}/TiCl{sub 3} hydrogen storage system. Black-Right-Pointing-Pointer It is found that adding 0.25 TiCl{sub 3} produces fully reversible hydrogen absorption and desorption and a lower desorption temperature. Black-Right-Pointing-Pointer LiCl experiences four different states, i.e. 'formed-solid solution-molten solution-precipitation', in the whole desorption process of the system. Black-Right-Pointing-Pointer The incorporation of LiCl into LiBH{sub 4} forms more viscous molten LiBH{sub 4}{center_dot}LiCl, leading to fast kinetics. Black-Right-Pointing-Pointer The precipitation and re-incorporation of LiCl into LiBH{sub 4} lead to a fully reversible complex hydrogen storage system. - Abstract: In the present study, the effects of TiCl{sub 3} on desorption kinetics, absorption/desorption reversibility, and related phase transformation processes in LiBH{sub 4}/CaH{sub 2}/TiCl{sub 3} hydrogen storage system was studied systematically by varying its concentration (x = 0, 0.05, 0.15 and 0.25). The results show that LiCl forms during ball milling of 6LiBH{sub 4}/CaH{sub 2}/xTiCl{sub 3} and that as temperature increases, o-LiBH{sub 4} transforms into h-LiBH{sub 4}, into which LiCl incorporates, forming solid solution of LiBH{sub 4}{center_dot}LiCl, which melts above 280 Degree-Sign C. Molten LiBH{sub 4}{center_dot}LiCl is more viscous than molten LiBH{sub 4}, preventing the clustering of LiBH{sub 4} and the accompanied agglomeration of CaH{sub 2}, and thus preserving the nano-sized phase arrangement formed during ball milling. Above 350 Degree-Sign C, the molten solution LiBH{sub 4}{center_dot}LiCl further reacts with CaH{sub 2}, precipitating LiCl. The main hydrogen desorption reaction is between molten LiBH{sub 4}{center_dot}LiCl and CaH{sub 2} and not between molten LiBH{sub 4} and CaH{sub 2}. This alters the hydrogen reaction thermodynamics and

  18. Formation of Ca/P ceramic coatings by Plasma Electrolytic Oxidation (PEO) on Ti6Al4V ELI alloy

    Science.gov (United States)

    Rodriguez-Jaimes, Y.; Naranjo, D. I.; Blanco, S.; García-Vergara, S. J.

    2017-12-01

    The formation of PEO ceramic coatings on Ti6Al4V ELI alloy was investigated using a phosphate/calcium containing electrolyte at 300 and 400V at 310K for different times. The Plasma Electrolytic Oxidation (PEO) coated specimens were then heat treated at 873 and 1073K for 2 hours. Scanning electron microscopy, Energy Dispersive X-Ray Spectroscopy (EDS) and X-ray diffraction analysis were used to study the composition and the morphology of the ceramic coatings. The corrosion behaviour of the coatings was studied by Electrochemical Impedance Spectroscopy (EIS) in Simulated Body Fluid (SBF). The PEO-treated specimens primarily revealed a porous structure with thickness between 4 and 12μm, according to the voltage and process time used. The coatings are mainly composed of hydroxyapatite; however, as the voltage and anodizing time increase, the Ca/P ratio decreases. Generally, the corrosion resistance of the alloy was improved by the PEO-treated coatings, although the specimens treated at 1073K showed the presence of cracks that reduced the protective effect of the coatings.

  19. Calcium titanate (CaTiO{sub 3}) dielectrics prepared by plasma spray and post-deposition thermal treatment

    Energy Technology Data Exchange (ETDEWEB)

    Ctibor, Pavel [Materials Engineering Department, Institute of Plasma Physics ASCR, v.v.i., Za Slovankou 3, Prague 8 (Czech Republic); Kotlan, Jiri, E-mail: kotlan@ipp.cas.cz [Materials Engineering Department, Institute of Plasma Physics ASCR, v.v.i., Za Slovankou 3, Prague 8 (Czech Republic); Department of Electrotechnology, Faculty of Electrical Engineering, Czech Technical University in Prague, Technicka 2, Prague 6 (Czech Republic); Pala, Zdenek [Materials Engineering Department, Institute of Plasma Physics ASCR, v.v.i., Za Slovankou 3, Prague 8 (Czech Republic); Sedlacek, Josef [Department of Electrotechnology, Faculty of Electrical Engineering, Czech Technical University in Prague, Technicka 2, Prague 6 (Czech Republic); Hajkova, Zuzana; Grygar, Tomas Matys [Institute of Inorganic Chemistry ASCR, v.v.i., Husinec-Rez 1001, Rez (Czech Republic)

    2015-12-15

    Highlights: • Calcium titanate was sprayed by two different plasma spray systems. • Significant improvement of dielectric properties after annealing was observed. • Calcium titanate self-supporting parts can be fabricated by plasma spraying. - Abstract: This paper studies calcium titanate (CaTiO{sub 3}) dielectrics prepared by plasma spray technology. A water stabilized plasma gun (WSP) as well as a widely used gas stabilized plasma gun (GSP) were employed in this study to deposit three sample sets at different spray conditions. Prepared specimens were annealed in air at atmospheric pressure for 2 h at various temperatures from 530 to 1170 °C. X-ray diffraction (XRD), Raman spectroscopy and porosity measurements were used for sample characterization. Dielectric spectroscopy was applied to obtain relative permittivity, conductivity and loss factor frequency dependence. Band gap energy was estimated from reflectance measurements. The work is focused on the explanation of changes in microstructure and properties of a plasma sprayed deposit after thermal annealing. Obtained results show significant improvement of dielectric properties after thermal annealing.

  20. Crystallographic and electronic structure of the Ca{sub 2}TiMnO{sub 6} double perovskite

    Energy Technology Data Exchange (ETDEWEB)

    López, J.P. Garzón [Grupo de Física de Nuevos Materiales, Departamento de Física, Universidad Nacional de Colombia, AA 5997 Bogotá DC (Colombia); Grupo de Estudios de Materiales – GEMA, Departamento de Física, Universidad Nacional de Colombia, AA 5997 Bogotá DC (Colombia); Cardona, R. [Grupo de Estudios de Materiales – GEMA, Departamento de Física, Universidad Nacional de Colombia, AA 5997 Bogotá DC (Colombia); Santos, A. Sarmiento [Grupo de Superficies, Electroquímica y Corrosión, Universidad Pedagógica y Tecnológica de Colombia, Tunja (Colombia); Téllez, D.A. Landínez [Grupo de Física de Nuevos Materiales, Departamento de Física, Universidad Nacional de Colombia, AA 5997 Bogotá DC (Colombia); Roa-Rojas, J., E-mail: jroar@unal.edu.co [Grupo de Física de Nuevos Materiales, Departamento de Física, Universidad Nacional de Colombia, AA 5997 Bogotá DC (Colombia)

    2014-12-15

    In this work, we report synthesis and crystalline structure study of the Ca{sub 2}TiMnO{sub 6} complex perovskite, by X-ray diffraction experiments and through the application of the Rietveld refinement using the GSAS code. Results revealed the crystallization of the system in a tetragonal perovskite with the characteristic structure given by I4/m (#87) space group and lattice parameters a=5.339(4) Å and c=7.736(6) Å. Ab initio calculations of density of states (DOS) and electronic structure were carried out for this perovskite-like system, by the Density Functional Theory (DFT) and using the Full-potential Linearized Augmented Plane Waves (FP-LAPW) method. The exchange-correlation potential was treated using the Generalized Gradient Approximation (GGA). All calculations were carried-out using spin polarization. For the up spin orientation the compound has a semiconducting behavior and for down spin polarization it behaves like a conductor. The calculated effective magnetic moment in cell was 4.02 μ{sub B}, which is close to the expected value calculated from Hund's rules.

  1. Effect of orthorhombic distortion on dielectric and piezoelectric properties of CaBi4Ti4O15 ceramics

    Science.gov (United States)

    Tanwar, Amit; Sreenivas, K.; Gupta, Vinay

    2009-04-01

    High temperature bismuth layered piezoelectric and ferroelectric ceramics of CaBi4Ti4O15 (CBT) have been prepared using the solid state route. The formation of single phase material with orthorhombic structure was verified from x-ray diffraction and Raman spectroscopy. The orthorhombic distortion present in the CBT ceramic sintered at 1200 °C was found to be maximum. A sharp phase transition from ferroelectric to paraelectric was observed in the temperature dependent dielectric studies of all CBT ceramics. The Curie's temperature (Tc=790 °C) was found to be independent of measured frequency. The behavior of ac conductivity as a function of frequency (100 Hz-1 MHz) at low temperatures (<500 °C) follows the power law and is attributed to hopping conduction. The presence of large orthorhombic distortion in the CBT ceramic sintered at 1200 °C results in high dielectric constant, low dielectric loss, and high piezoelectric coefficient (d33). The observed results indicate the important role of orthorhombic distortion in determining the improved property of multicomponent ferroelectric material.

  2. Research Update: Polyimide/CaCu3Ti4O12 nanofiber functional hybrid films with improved dielectric properties

    Directory of Open Access Journals (Sweden)

    Yang Yang

    2013-11-01

    Full Text Available This work reports the excellent dielectric properties of polyimide (PI embedded with CaCu3Ti4O12 (CCTO nanofibers. The dielectric behaviors were investigated over a frequency of 100 Hz–1 MHz. It is shown that embedding CCTO nanofibers with high aspect ratio (67 is an effective means to enhance the dielectric permittivity and reduce the percolation threshold. The dielectric permittivity of PI/CCTO nanofiber composites is 85 with 1.5 vol.% loading of filler, also the dielectric loss is only 0.015 at 100 Hz. Monte Carlo simulation was used to investigate the percolation threshold of CCTO nanofibers reinforced polyimide matrix by using excluded volume theory and soft, hard-core models. The results are in good agreement with the percolation theory and the hard-core model can well explain the percolation phenomena in PI/CCTO nanofiber composites. The dielectric properties of the composites will meet the practical requirements for the application in high dielectric constant capacitors and high energy density materials.

  3. Comportamiento eléctrico del compuesto Bi5FeTi3O15 y de sus soluciones sólidas con CaBi4Ti4O15

    Directory of Open Access Journals (Sweden)

    Durán, P.

    1999-12-01

    Full Text Available Bi5FeTi3O15 (BiFT compound has been prepared by solid state reaction between the corresponding oxides. Its crystalline structure has been established by X ray Diffraction, (XRD. Ceramic samples with apparent density > 95% Dth have been sintered. On these samples, electrical conductivity and Curie temperature have been measured. Solid solutions of Bi5FeTi3O15 (BiFT and CaBi4Ti4O15 (CBiT have been prepared. On poled samples of these solid solutions, piezoelectric parameters have been established. The BiFT compound shows electrical conductivity values very similar to those of the Bi4Ti3O12 (BiT compound. The electrical conductivity of solid solutions is a function of CBiT amount. A possible electrical conductivity mechanism which is different of that accepted for the BiT compound is discussed.Se ha preparado Bi5FeTi3O15 (BiFT por reacción en estado sólido de los óxidos correspondientes. Se ha determinado su estructura cristalina por Difracción de Rayos X (DRX. Se han preparado compactos sinterizados con densidades superiores al 95%. Se ha determinado su temperatura de Curie, y la conductividad eléctrica entre 150 y 850ºC. Se han preparado soluciones sólidas de Bi5FeTi3O15 con CaBi4Ti4O15, (CBiT y se han determinado los mismos parámetros de temperatura de Curie y de conductividad para ellas. En las soluciones sólidas se han determinado los parámetros Piezoeléctricos de muestras polarizadas Debe destacarse que el compuesto Bi5FeTi3O15 presenta unos valores de conducción eléctrica más próximos a los correspondientes al Bi4Ti3O12 (BiT que a los de los compuestos MeBi4Ti4O15. La conductividad eléctrica de las soluciones sólidas varía con el contenido de CBiT. Se discute la posible existencia de un modelo de conducción eléctrica que difiere del aceptado hasta el momento para el BiT, basado en los defectos localizados en las capas Bi2O2 2-.

  4. Sorption properties and reversibility of Ti(IV) and Nb(V)-fluoride doped-Ca(BH4)2-MgH2 system

    International Nuclear Information System (INIS)

    Bonatto Minella, Christian; Garroni, Sebastiano; Pistidda, Claudio; Baró, Maria Dolors; Gutfleisch, Oliver; Klassen, Thomas; Dornheim, Martin

    2015-01-01

    Highlights: • Faster desorption reaction for doped materials vs. the pure composite system. • Kinetic improvement concerning re-hydrogenation reaction showed by the addition of NbF 5 . • Full characterization of the de-hydrogenation reaction pathway by means of both SR-PXD and 11 B{ 1 H} MAS-NMR. • Study of the evolution of the chemical state of the additives upon both milling and sorption reactions. - Abstract: In the last decade, alkaline and alkaline earth metal tetrahydroborates have been the focuses of the research due to their high gravimetric and volumetric hydrogen densities. Among them, Ca(BH 4 ) 2 and the Ca(BH 4 ) 2 + MgH 2 reactive hydride composites (RHC), were calculated to have the ideal thermodynamic properties which fall within the optimal range for mobile applications. In this study, the addition of NbF 5 or TiF 4 to the Ca(BH 4 ) 2 + MgH 2 reactive hydride composite system was attempted aiming to obtain a full reversible system with the simultaneous suppression of CaB 12 H 12 . Structural characterization of the specimens was performed by means of in-situ Synchrotron Radiation Powder X-ray diffraction (SR-PXD) and 11 B{ 1 H} Solid State Magic Angle Spinning-Nuclear Magnetic Resonance (MAS-NMR). The evolution of the chemical state of the Nb- and Ti-based additives was monitored by X-ray Absorption Near Edge Structure (XANES). The addition of NbF 5 or TiF 4 to the Ca(BH 4 ) 2 + MgH 2 system have not suppressed completely the formation of CaB 12 H 12 and only a slight improvement concerning the reversible reaction was displayed just in the case of Nb-doped composite material

  5. Evaluated (n,p) cross sections of 46Ti, 47Ti and 48Ti

    International Nuclear Information System (INIS)

    Philis, C.; Bersillon, O.; Smith, D.; Smith, A.

    1977-01-01

    Microscopic evaluated neutron cross sections for the reactions 46 Ti(n;p) 46 Sc, 47 Ti(n;p) 47 Sc and 48 Ti(n;p) 48 Sc are obtained from threshold (or zero energy) to 20 MeV. The results are presented in graphical and numerical (ENDF format) form. The microscopic evaluated cross sections are compared with measured fission-spectrum-averaged values

  6. Effect of TiO2 on thermal, structural and third-order nonlinear optical properties of Ca-La-B-O glass system

    International Nuclear Information System (INIS)

    Biswas, Kaushik; Sontakke, Atul D.; Annapurna, K.

    2010-01-01

    A series of calcium lanthanum metaborate glasses in the composition (wt%) of 23.88CaO-28.33La 2 O 3 -47.79B 2 O 3 modified with TiO 2 up to 20 wt% are prepared by a melt quenching technique to study the influence of TiO 2 on their thermal, structural, linear and nonlinear optical properties. The differential thermal analysis (DTA) studies have demonstrated significant effects due to the presence of TiO 2 on the glass forming ability and crystallization situations. The glass with 15 wt% TiO 2 has achieved a eutectic composition and also exhibited a better glass forming ability among the glasses studied. The FT-IR spectra of these glasses show mainly vibration modes corresponding to stretching of BO 3 trigonal, BO 4 tetrahedral units and of B-O-B bending bonds. At higher concentrations of TiO 2 , development of vibration band around 400 cm -1 has indicated the formation of TiO 6 structural units in the glass network. The red shift of optical absorption edge (UV cutoff) shows a monotonous decrease in direct and indirect optical band gap energies (E opt ) with an increase of TiO 2 content in the glasses based on their absorption spectra. The optical transparency of these glasses is found to be varied from 64 to 87% within the wavelength range 450-1100 nm depending on the TiO 2 content. Besides these studies, linear refractive indices, the nonlinear optical properties of these glasses have also been evaluated.

  7. Luminescent properties of CaTiO3:Pr thin-film phosphor deposited on ZnO/ITO/glass substrate

    International Nuclear Information System (INIS)

    Chung, Sung Mook; Han, Sang Hyuk; Song, Kuk Hyun; Kim, Eung Soo; Kim, Young Jin

    2005-01-01

    Red-emitting CaTiO 3 :Pr phosphor thin films were deposited on glass, ZnO/ITO/glass, and ITO/glass substrates by RF magnetron sputtering. The effects of various substrates and heat treatment on the structural and luminous properties were investigated. The films deposited on ZnO/ITO/glass exhibited superior crystallinity and more enhanced PL and CL properties compared with those on ITO/glass. The intermediate ZnO layer between phosphor film and ITO contributed to the growing behaviors and the roughening of CaTiO 3 :Pr phosphor thin films, and consequently, to the excellent luminescence. The luminescent properties of the films were improved by following heat-treatment due to a combination of factors, namely the transformation from amorphous to poly crystalline phases, the activation of the activators, and the elimination of microdefects

  8. Photoluminescence characteristics of Li-doped CaTiO{sub 3}:Pr{sup 3+} thin films grown on Si (100) substrate by PLD

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hyun Kyoung; Chung, Jong Won; Moon, Byung Kee; Choi, Byung Chun [Department of Physics, Pukyong National University, Busan 608-737 (Korea, Republic of); Jeong, Jung Hyun, E-mail: jhjeong@pknu.ac.k [Department of Physics, Pukyong National University, Busan 608-737 (Korea, Republic of); Jang, Ki-wan; Lee, Ho Sueb [Department of Physics, Changwon National University, Changwon 641-773 (Korea, Republic of); Yi, Soung Soo [Department of Electronic Materials Engineering, Silla University, Busan, 617-736 (Korea, Republic of); Kim, Kwang Ho [School of Materials Science and Engineering, Pusan National University, Busan, 609-735 (Korea, Republic of)

    2010-09-01

    The effects of Li-doped CaTiO{sub 3}:Pr{sup 3+} thin films have been investigated by varying the lithium ion concentrations from 0 to 5 wt.%. The films have been deposited on Si (100) substrate using a pulsed laser deposition technique. Structural properties of these films have been studied by the measurement of their XRD, SEM, and AFM. The variation of Li{sup +} concentration influences the crystallinity and surface morphology of the CaTiO{sub 3}:Pr{sup 3+} thin films. As Li{sup +} content increases from 0 to 1 wt.%, the crystallinity and intensity of emission increases. The dominant emission is from {sup 1}D{sub 2} {yields} {sup 3}H{sub 4} transition at 613 nm. The {sup 1}D{sub 2} emission quenching has also been observed in highly doped sample and is related to the cross-relaxation process between Pr{sup 3+} ions.

  9. Effect of structure on nonlinear optical properties in CaCu{sub 3}Ti{sub 4}O{sub 12} films

    Energy Technology Data Exchange (ETDEWEB)

    Ning, Tingyin [School of Physics and Electronics, Shandong Normal University, Jinan 250014 (China); Zhou, Yueliang, E-mail: ylzhou@iphy.ac.cn [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China)

    2015-12-21

    We report the third-order nonlinear optical properties of CaCu{sub 3}Ti{sub 4}O{sub 12} films with different preferred growth orientations on MgO and fused silica substrates. The films have (310)- and (220)-orientation on MgO and fused silica, respectively, due to the lattice-mismatch. Raman spectra further indicate different atom-bonding states in the films. The nonlinear optical measurements show the films possess the same self-defocusing behavior but with different values of nonlinear refraction, and changed signs of nonlinear absorption. The difference of optical nonlinearity in CaCu{sub 3}Ti{sub 4}O{sub 12} films is ascribed to different lattice parameters and intermediate levels induced by structure.

  10. Transforming n=1 members of the Ruddlesden-Popper phases to a n=3 member through metathesis: synthesis of a new layered perovskite, Ca2La2CuTi2O10

    International Nuclear Information System (INIS)

    Sivakumar, T.; Lofland, S.E.; Ramanujachary, K.V.; Ramesha, K.; Subbanna, G.N.; Gopalakrishnan, J.

    2004-01-01

    We report the formation of a new n=3 Ruddlesden-Popper (R-P) layered perovskite oxide, Ca 2 La 2 CuTi 2 O 10 (I), in the metathesis reaction between NaLaTiO 4 and Ca 2 CuO 2 Cl 2 (n=1 R-P phases) at 700 deg. C in air. Rietveld refinement of powder XRD data shows that I is isostructural with Sr 4 Ti 3 O 10 (space group I4/mmm; a=3.8837(5), c=27.727(6) A), consisting of triple perovskite CuTi 2 O 10 sheets wherein Cu and Ti are ordered at the central and terminal octahedral sites, respectively. Magnetization data provide support for the presence of strong antiferromagnetically coupled CuO 2 sheets in the structure. I is metastable decomposing at higher temperatures (∼950 deg. C) to a mixture of perovskite-like CaLa 2 CuTi 2 O 9 and CaO. Interestingly, the reaction between NaLaTiO 4 and Sr 2 CuO 2 Cl 2 follows a different metathesis route, 2NaLaTiO 4 +Sr 2 CuO 2 Cl 2 →La 2 CuO 4 +2SrTiO 3 +2NaCl, revealing multiplicity of reaction pathways for solid-state metathesis reactions

  11. High-pressure crystal structure of elastically isotropic CaTiO3 perovskite under hydrostatic and non-hydrostatic conditions.

    Science.gov (United States)

    Zhao, Jing; Ross, Nancy L; Wang, Di; Angel, Ross J

    2011-11-16

    The structural evolution of orthorhombic CaTiO3 perovskite has been studied using high-pressure single-crystal x-ray diffraction under hydrostatic conditions up to 8.1 GPa and under a non-hydrostatic stress field formed in a diamond anvil cell (DAC) up to 4.7 GPa. Under hydrostatic conditions, the TiO6 octahedra become more tilted and distorted with increasing pressure, similar to other 2:4 perovskites. Under non-hydrostatic conditions, the experiments do not show any apparent difference in the internal structural variation from hydrostatic conditions and no additional tilts and distortions in the TiO6 octahedra are observed, even though the lattice itself becomes distorted due to the non-hydrostatic stress. The similarity between the hydrostatic and non-hydrostatic cases can be ascribed to the fact that CaTiO3 perovskite is nearly elastically isotropic and, as a consequence, its deviatoric unit-cell volume strain produced by the non-hydrostatic stress is very small; in other words, the additional octahedral tilts relevant to the extra unit-cell volume associated with the deviatoric unit-cell volume strain may be totally neglected. This study further addresses the role that three factors--the elastic properties, the crystal orientation and the pressure medium--have on the structural evolution of an orthorhombic perovskite loaded in a DAC under non-hydrostatic conditions. The influence of these factors can be clearly visualized by plotting the three-dimensional distribution of the deviatoric unit-cell volume strain in relation to the cylindrical axis of the DAC and indicates that, if the elasticity of a perovskite is nearly isotropic as it is for CaTiO3, the other two factors become relatively insignificant.

  12. High-pressure crystal structure of elastically isotropic CaTiO3 perovskite under hydrostatic and non-hydrostatic conditions

    International Nuclear Information System (INIS)

    Zhao Jing; Ross, Nancy L; Wang, Di; Angel, Ross J

    2011-01-01

    The structural evolution of orthorhombic CaTiO 3 perovskite has been studied using high-pressure single-crystal x-ray diffraction under hydrostatic conditions up to 8.1 GPa and under a non-hydrostatic stress field formed in a diamond anvil cell (DAC) up to 4.7 GPa. Under hydrostatic conditions, the TiO 6 octahedra become more tilted and distorted with increasing pressure, similar to other 2:4 perovskites. Under non-hydrostatic conditions, the experiments do not show any apparent difference in the internal structural variation from hydrostatic conditions and no additional tilts and distortions in the TiO 6 octahedra are observed, even though the lattice itself becomes distorted due to the non-hydrostatic stress. The similarity between the hydrostatic and non-hydrostatic cases can be ascribed to the fact that CaTiO 3 perovskite is nearly elastically isotropic and, as a consequence, its deviatoric unit-cell volume strain produced by the non-hydrostatic stress is very small; in other words, the additional octahedral tilts relevant to the extra unit-cell volume associated with the deviatoric unit-cell volume strain may be totally neglected. This study further addresses the role that three factors-the elastic properties, the crystal orientation and the pressure medium-have on the structural evolution of an orthorhombic perovskite loaded in a DAC under non-hydrostatic conditions. The influence of these factors can be clearly visualized by plotting the three-dimensional distribution of the deviatoric unit-cell volume strain in relation to the cylindrical axis of the DAC and indicates that, if the elasticity of a perovskite is nearly isotropic as it is for CaTiO 3 , the other two factors become relatively insignificant. (paper)

  13. Dielectric properties of Zr doped CaCu{sub 3}Ti{sub 4}O{sub 12} synthesized by sol-gel route

    Energy Technology Data Exchange (ETDEWEB)

    Jesurani, S. [Department of Physics, Jeyaraj Annapackium College for Women, Periyakulam 625 601, Tamil Nadu (India); Center for Material Science and Nano Devices, Department of Physics, SRM University, Kattankulathur 603 203, Tamil Nadu (India); Kanagesan, S., E-mail: kanagu1980@gmail.com [Materials Synthesis and Characterization Laboratory (MSCL), Institute of Advanced Technology (ITMA), Universiti Putra Malaysia, 43400 Serdang, Selangor (Malaysia); Hashim, M. [Materials Synthesis and Characterization Laboratory (MSCL), Institute of Advanced Technology (ITMA), Universiti Putra Malaysia, 43400 Serdang, Selangor (Malaysia); Physics Department, Faculty of Science, Universiti Putra Malaysia, 43400 Serdang, Selangor (Malaysia); Ismail, I. [Materials Synthesis and Characterization Laboratory (MSCL), Institute of Advanced Technology (ITMA), Universiti Putra Malaysia, 43400 Serdang, Selangor (Malaysia)

    2013-02-25

    Highlights: Black-Right-Pointing-Pointer Zr doped CaCu{sub 3}Ti{sub 4}O{sub 12} samples have been synthesized using sol-gel process. Black-Right-Pointing-Pointer The particle size of the powder ranges from 47 to 85 nm. Black-Right-Pointing-Pointer Less sintering at 1040 Degree-Sign C results in high density and high dielectric constant. - Abstract: Zr substituted CaCu{sub 3}Ti{sub 4-x}Zr{sub x}O{sub 12} (CCTZO) with x = 0.00, 0.02, 0.10, 0.20 and 0.50 mol% were prepared by sol-gel route from the metal nitrate solutions, Titanium isoproxide, and zirconium oxy chloride. XRD analysis confirmed the formation of a single phase material in the samples calcinated at 800 Degree-Sign C for 3 h. The crystal structure did not change on doping with zirconium and it remained cubic in all the four studied compositions. The permittivity and dielectric loss of 0.1 mol% Zr doped CaCu{sub 3}Ti{sub 4}O{sub 12} were improved for K Almost-Equal-To 6020 and tan {delta} Almost-Equal-To 0.52 at 1 kHz after the sample had been sintered at 1040 Degree-Sign C for 4 h. AFM studies showed that the particle size of the CCTZO powder ranged from 47 to 85 nm. FE-SEM micrographs of the CaCu{sub 3}Ti{sub 4-x}Zr{sub x}O{sub 12} samples showed that the grain size was in the range of 250 nm to 5 {mu}m for these samples. EDX studies showed the presence of calcium, copper, titanium, oxygen and zirconium. Remarkably, the dielectric constant increased and dielectric loss had lower values compared to the undoped CCTO.

  14. Luminescent characteristics of UV excited Sr_0_._5Ca_0_._5TiO_3: Pr"3"+ reddish-orange phosphor

    International Nuclear Information System (INIS)

    Vidyadharan, Viji; Mohan P, Remya; Joseph, Cyriac; Unnikrishnan, N.V.; Biju, P.R.

    2016-01-01

    Pr"3"+ doped Sr_0_._5Ca_0_._5TiO_3 phosphors were synthesised by solid state reaction process. The structure, surface morphology and photoluminescence of the prepared phosphors were analysed using XRD, SEM and photoluminescence spectroscopy respectively. The XRD pattern confirmed orthorhombic perovskite structure of the Sr_0_._5Ca_0_._5TiO_3: x Pr"3"+ phosphor. Agglomeration of particles with irregular shapes is observed from the SEM images. The emission spectra of Sr_0_._5Ca_0_._5TiO_3: x Pr"3"+ phosphor shows the samples can be effectively excited with UV light at 336 nm and exhibit a strong reddish-orange emission at 611 nm. Concentration dependence of emission intensity shows concentration quenching effect on increasing Pr"3"+ concentration after x = 0.1 because of dipole–dipole interaction. Using Blasse's formula, critical distance for energy transfer was calculated. The CIE co-ordinates, CCT, colour purity and luminescence decay of the prepared phosphors were also calculated. These results offer the prepared phosphor as a suitable candidate for various photonic applications. - Highlights: • Sr_0_._5Ca_0_._5TiO_3: x Pr"3"+ perovskite structured phosphors were synthesized. • Under UV excitation, the PL spectra show strong reddish-orange emission. • The emission from "3P_J levels of Pr"3"+ were absent due to the presence of IVCT band. • Concentration quenching due to dipole–dipole interaction was observed. • For x = 0.1, sample shows a maximum emission intensity with 91.7% colour purity.

  15. Microstructure and wear behavior of {gamma}/Al{sub 4}C{sub 3}/TiC/CaF{sub 2} composite coating on {gamma}-TiAl intermetallic alloy prepared by Nd:YAG laser cladding

    Energy Technology Data Exchange (ETDEWEB)

    Liu Xiubo [School of Mechanical and Electronic Engineering, 178 Ganjiang East Road, Soochow University, Suzhou 215021 (China)], E-mail: liubobo0828@yahoo.com.cn; Shi Shihong [School of Mechanical and Electronic Engineering, 178 Ganjiang East Road, Soochow University, Suzhou 215021 (China); Guo Jian [School of Materials and Chemical Engineering, Zhongyuan Institute of Technology, 41 Zhongyuan West Road, Zhengzhou 450007 (China); Fu Geyan; Wang Mingdi [School of Mechanical and Electronic Engineering, 178 Ganjiang East Road, Soochow University, Suzhou 215021 (China)

    2009-03-15

    As a further step in obtaining high performance elevated temperature self-lubrication anti-wear composite coatings on TiAl alloy, a novel Ni-P electroless plating method was adopted to encapsulate the as-received CaF{sub 2} in the preparation of precursor NiCr-Cr{sub 3}C{sub 2}-CaF{sub 2} mixed powders with an aim to decrease its mass loss and increase its compatibility with the metal matrix during a Nd:YAG laser cladding. The microstructure of the coating was examined using X-ray diffraction (XRD), scanning electron microscope (SEM) and energy dispersive spectroscopy (EDS) and the friction and wear behavior of the composite coatings sliding against the hardened 0.45% C steel ring was evaluated using a block-on-ring wear tester at room temperature. It was found that the coating had a unique microstructure consisting of primary dendrites TiC and block Al{sub 4}C{sub 3} carbides reinforcement as well as fine isolated spherical CaF{sub 2} solid lubrication particles uniformly dispersed in the NiCrAlTi ({gamma}) matrix. The good friction-reducing and anti-wear abilities of the laser clad composite coating was suggested to the Ni-P electroless plating and the attendant reduction of mass loss of CaF{sub 2} and the increasing of it's wettability with the NiCrAlTi ({gamma}) matrix during the laser cladding process.

  16. Crystallization and sintering characteristics of CaO-Al2O3-SiO2 glasses in the presence of TiO2, CaF2 and ZrO2

    International Nuclear Information System (INIS)

    Banijamali, S.; Eftekhari Yekta, B.; Rezaie, H.R.; Marghussian, V.K.

    2009-01-01

    In this study, the effects of different amounts of TiO 2 , ZrO 2 and CaF 2 nucleating agents on sinterability, crystallization, mechanical properties and chemical resistance of glass-ceramics belonging to the CaO-Al 2 O 3 -SiO 2 system were investigated, using differential thermal analysis (DTA), X-ray diffractometry (XRD), scanning electron microscopy (SEM), mechanical and chemical resistance measurements. It was found that in CaF 2 containing samples, the sinterability, crystallization and mechanical properties were improved by increasing of CaF 2 amount. However, addition of ZrO 2 and TiO 2 increases the firing temperature required for complete densification of specimens. Our experiments showed that fluctuations of chemical composition of the residual glass phases during sintering were responsible for these dissimilar trends and greatly influenced mechanical and chemical properties. According to the obtained results, appropriate sinterability, acceptable mechanical and chemical properties, as well as desirable whiteness of the most promising specimens make them suitable choices for floor tile applications. The main crystallization phases in all fully sintered glass-ceramics were wollastonite, anorthite and calcium aluminum silicate.

  17. Uniformly Porous Nanocrystalline CaMgFe1.33Ti3O12 Ceramic Derived Electro-Ceramic Nanocomposite for Impedance Type Humidity Sensor

    Science.gov (United States)

    Tripathy, Ashis; Pramanik, Sumit; Manna, Ayan; Shasmin, Hanie Nadia; Radzi, Zamri; Abu Osman, Noor Azuan

    2016-01-01

    Since humidity sensors have been widely used in many sectors, a suitable humidity sensing material with improved sensitivity, faster response and recovery times, better stability and low hysteresis is necessary to be developed. Here, we fabricate a uniformly porous humidity sensor using Ca, Ti substituted Mg ferrites with chemical formula of CaMgFe1.33Ti3O12 as humidity sensing materials by solid-sate step-sintering technique. This synthesis technique is useful to control the grain size with increased porosity to enhance the hydrophilic characteristics of the CaMgFe1.33Ti3O12 nanoceramic based sintered electro-ceramic nanocomposites. The highest porosity, lowest density and excellent surface-hydrophilicity properties were obtained at 1050 °C sintered ceramic. The performance of this impedance type humidity sensor was evaluated by electrical characterizations using alternating current (AC) in the 33%–95% relative humidity (RH) range at 25 °C. Compared with existing conventional resistive humidity sensors, the present sintered electro-ceramic nanocomposite based humidity sensor showed faster response time (20 s) and recovery time (40 s). This newly developed sensor showed extremely high sensitivity (%S) and small hysteresis of humidity sensors. PMID:27916913

  18. Thermal conductivity in Pr{sub 1-x}Ca{sub x}MnO{sub 3} and SrTiO{sub 3} thin film systems

    Energy Technology Data Exchange (ETDEWEB)

    Wiedigen, Stefanie; Kramer, Thilo; Mangipudi, Kodanda R.; Hoffmann, Joerg; Volkert, Cynthia A.; Jooss, Christian [Institute for Materials Physics, University of Goettingen (Germany); Feuchter, Manuel; Kamlah, Marc [Institute for Applied Materials, Karlsruhe Institute of Technology (Germany)

    2012-07-01

    Epitaxial multilayers and superlattices are one recent approach for the design of efficient thermoelectrics. To study the effect of phonon blocking and scattering on thermal conductivity of oxide multilayers, a combination of two perovskites with promising thermoelectric properties is selected: the orthorhombic Pr{sub 1-x}Ca{sub x}MnO{sub 3} and the cubic SrTiO{sub 3}. In order to investigate the effect of microstructure, interfaces and acoustic impedance mismatch on thermal conductivity {kappa} high preparation quality is needed. Our thin films were prepared by ion-beam and magnetron sputtering. Structural analysis is done by XRD and TEM and is presented in combination with thermal conductivity measurements using the 3{omega} method. Single layers of Pr{sub 1-x}Ca{sub x}MnO{sub 3} show low {kappa} values and no significant increase of thermal conductivity with increasing doping. In homoepitaxial single layers of SrTiO{sub 3} preparation conditions have a high impact on {kappa}, most probably due to different concentrations of point defects. Pr{sub 1-x}Ca{sub x}MnO{sub 3}/SrTiO{sub 3} multilayers show a {kappa} decreases systematically with increasing number of double layers. The results are discussed in the light of the theoretically calculated phonon dispersion and the experimentally observed microstructure.

  19. Hybrid improper ferroelectricity in Ruddlesden-Popper Ca{sub 3}(Ti,Mn){sub 2}O{sub 7} ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Liu, X. Q., E-mail: xqliu@zju.edu.cn, E-mail: xmchen59@zju.edu.cn; Wu, J. W.; Shi, X. X.; Zhao, H. J.; Zhou, H. Y.; Chen, X. M., E-mail: xqliu@zju.edu.cn, E-mail: xmchen59@zju.edu.cn [Laboratory of Dielectric Materials, School of Materials Science and Engineering, Zhejiang University, 38 Zheda Road, Hangzhou 310027 (China); Qiu, R. H.; Zhang, W. Q. [Department of Physics, Shanghai University, 99 Shangda Road, Shanghai 200444 (China)

    2015-05-18

    The hybrid improper ferroelectricity (HIF) has been proposed as a promising way to create multiferroic materials with strong magnetoelectric coupling by the first-principle calculation, and the experimental evidences of HIF in Ruddlesden-Poper Ca{sub 3}(Ti{sub 1−x}Mn{sub x}){sub 2}O{sub 7} (x = 0, 0.05, 0.1, and 0.15) ceramics have been shown in the present work. The room temperature ferroelectric hysteresis loops are observed in these ceramics, and a polar orthorhombic structure with two oxygen tilting modes has been confirmed by the X-ray powder diffraction. A first-order phase transition around 1100 K in Ca{sub 3}Ti{sub 2}O{sub 7} was evidenced, and the temperatures of phase transitions decrease linearly with increasing of the contents of Mn{sup 4+} ions. Based on the result of first-principle calculations, the polarization should be reversed by switching through the mediated Amam phase in Ca{sub 3}Ti{sub 2}O{sub 7} ceramics.

  20. Enhanced luminescence in Mg{sup 2+} codoped CaTiO{sub 3}:Eu{sup 3+} phosphor prepared by solid state reaction

    Energy Technology Data Exchange (ETDEWEB)

    Vandana, C. Sai; Rudramadevi, B. Hemalatha [Department of Physics, Sri Venkateswara University, Tirupati-517 502 (India)

    2016-05-23

    CaTiO{sub 3} phosphors doped with Eu{sup 3+} and codoped with Mg{sup 2+} were prepared by Solid State Reaction method. The powders were characterized by X-ray diffraction, SEM with EDS, Raman scattering, and photoluminescence spectroscopy. The Crystalline phase and vibrational modes of the phosphors were studied using XRD pattern and Raman Spectrum respectively. The morphological studies of the phosphor samples were carried out using SEM analysis. From PL spectra we have observed two prominent red emission peaks around at 595 nm ({sup 5}D{sub 0}→{sup 7}F{sub 1}), 619 nm ({sup 5}D{sub 0}→{sup 7}F{sub 2}) with the excitation of 399 nm for Eu{sup 3+} doped CaTiO{sub 3} powders. The PL intensity of CaTiO{sub 3}:Eu{sup 3+} phosphor is enhanced significantly on codoping with Mg{sup 2+}. The observed enhanced emissions are due to energy transfer from Mg{sup 2+} to Eu{sup 3+}, which is due to radiative recombination. Eu{sup 3+} doped phosphors are well known to be promising materials for electroluminescent devices, optical amplifiers, and lasers.

  1. Detector de IR de lámina ferroeléctrica de (Pb,CaTiO3

    Directory of Open Access Journals (Sweden)

    González, A.

    2002-02-01

    Full Text Available A sol-gel (Pb0.76Ca0.24TiO3 solution was deposited onto Pt/MgO(100 substrates. Previous thermal treatment of the substrate and the high rate of crystallization heating promote an important preferred orientation along the polar axis, and therefore selfpolarization , very convenient for the use of IR pyroelectric detectors. By depositing circular electrodes, 7.10-3 cm2 of area, an array of small capacitors are developed which are characterized as detectors in standard conditions: radiation from a black-body at 500 K, modulated between 1-20 Hz, a lock-in amplifier and an electronic circuit to sense and treat the electrical response. Three main factors affecting the detector performances are analyzed: a Figures of merit of the pyroelectric material; b assembly of the whole parts of detector (substrate, electrodes, leads, frame, etc and c electronic circuitry to sense and amplify signals. Thermal isolation is concluding as the most important fact to improve responsivity.Se han obtenido depósitos multicapa de titanato de plomo modificado con calcio, (Pb0.76Ca0.24TiO3, mediante un método de sol-gel, sobre substratos de Pt/MgO(100. El tratamiento térmico del substrato y la cristalización de las multicapas mediante tasas de calentamiento rápidas causan el desarrollo de una importante orientación preferente según el eje polar, perpendicular al mismo, lo que supone una autopolarización muy rentable para su empleo en detectores piroeléctricos de radiación infrarroja. Mediante una configuración de electrodos discretos se fabrican minicondensadores de 7.10-3 cm2 de área con los que se caracteriza ópticamente el detector para condiciones estándar: cuerpo negro a 500 K, modulación mecánica de la radiación entre 1-20 Hz, una electrónica de acondicionamiento de la señal de respuesta y un amplificador sintonizado para medir la respuesta en voltaje. Se analiza el efecto de los tres factores que intervienen en la fabricación del detector: a

  2. Energy dependence of thermoluminescent response of CaSO{sub 4}:Dy, LiF:Mg and micro LiF:Mg,Ti in clinical beams of electrons by using different simulator objects; Dependencia energetica da resposta TL de dosimetros de CaSO{sub 4}:Dy, LiF:Mg e microLiF:Mg,Ti em feixes clinicos de eletrons utilizando diferentes objetos simuladores

    Energy Technology Data Exchange (ETDEWEB)

    Bravim, Amanda; Campos, Leticia Lucente, E-mail: abravin@ipen.b, E-mail: rsakuraba@einstein.b, E-mail: lcrodri@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Sakuraba, Roberto K.; Cruz, Jose Carlos da, E-mail: rsakuraba@einstein.b, E-mail: josecarlosc@einstein.b [Hospital Israelita Albert Einstein (HIAE), Sao Paulo, SP (Brazil)

    2011-10-26

    Yet not so widely applied in radiotherapy, the calcium sulfate doped with dysprosium (CaSO{sub 4}:Dy) is used in radioprotection and studies has been demonstrated its great potential for the dosimetry in radiotherapy. This work evaluates the energy dependence of the thermoluminescent answer of the CaSO{sub 4}:D, LiF:Mg,Ti (TLD-100) and micro LiF:Mg,Ti in clinical beams of electrons by using water simulators, PMMA and solid water

  3. Application of gradient-corrected density functional theory to the structures and thermochemistries of ScF3, TiF4, VF5, and CrF6

    International Nuclear Information System (INIS)

    Russo, T.V.; Martin, R.L.; Jeffrey Hay, P.

    1995-01-01

    Density functional theory (DFT) and Hartree--Fock (HF) calculations are reported for the family of transition metal fluorides ScF 3 , TiF 4 , VF 5 , and CrF 6 . Both HF and the local-density approximation (LDA) yield excellent agreement with experimental bond lengths, while the B-LYP gradient-corrected density functional gives bond lengths 0.04-0.05 A too long. An investigation of various combinations of exchange and correlation functionals shows that, for this series, the origin of this behavior lies in the Becke exchange functional. Much improved bond distances are found using the hybrid HF/DFT functional advocated by Becke. This approximation also leads to much improved thermochemistries. The LDA overestimates average bond energies in this series by 30-40 kcal/mol, whereas the B-LYP functional overbinds by only ∼8-12 kcal/mol, and the hybrid HF/DFT method overbinds by only ∼2 kcal/mol. The hybrid method predicts the octahedral isomer of CrF 6 to be more stable than the trigonal prismatic form by 14 kcal/mol. Comparison of theoretical vibrational frequencies with experiment supports the assignment of an octahedral geometry

  4. Effect of Ca2+ Ions on Electrical Properties of Ba1-x Ca x Ti0.90Sn0.10O3-0.05Y2O3 Ceramics

    Science.gov (United States)

    Chen, Zhi-hui; Li, Zhi-wei; Ding, Jian-ning; Zhao, Tian-xiang; Qiu, Jian-hua; Zhu, Ke-qian; Xu, Jiu-jun; Zhang, Bing

    2018-03-01

    Ba1-x Ca x Ti0.90Sn0.10O3-0.05Y2O3 (BCTSY) lead-free piezoceramics with x = 0.02 to 0.10 have been fabricated by solid-state sintering method at 1420°C. The effects of Ca2+ ions on the microstructure and electrical properties of the samples were studied. X-ray diffraction analysis showed that all samples possessed pure perovskite structure with Ca2+ ions diffused into the matrix lattice. The rhombohedral phase and tetragonal phase coexisted in the composition range of 0.02 ceramic became more homogeneous with addition of Ca2+ ions, and the average grain size of the samples decreased from 97 μm (x = 0.02) to 18 μm (x = 0.10). Addition of Ca2+ remarkably improved the piezoelectric properties, enhanced the dielectric frequency dispersion, and increased the Curie temperature of the ceramics. The piezoelectric properties of the ceramics were optimized at x = 0.04 with d 33 and K p values of 579 pC/N and 52.7%, respectively.

  5. Review of Liquidus Surface and Phase Equilibria in the TiO2-SiO2-Al2O3-MgO-CaO Slag System at PO2 Applicable in Fluxed Titaniferous Magnetite Smelting

    Science.gov (United States)

    Goso, Xolisa; Nell, Johannes; Petersen, Jochen

    The current liquidus surface and phase equilibria established in air for fluxed titaniferous magnetite (titanomagnetite) slags conforming to a composition of 37.19% TiO2, 19.69% SiO2, 13.12% Al2O3, and 30.00% of various ratios of CaO+MgO were reviewed at applicable PO2 using FactSage simulation and phase composition of a real plant titanomagnetite slag. The testwork included the incorporation into FactSage of a private MgTi2O5-Al2TiO5 pseudobrookite solution model. The results of the investigation showed that the liquidus surface and Ti3+/ Ti4+ mass fraction ratio increased with decreasing the PO2, At low PO2, perovskite crystallizes as a primary phase at high CaO content. The spinel solution, i.e. (Mg)(Al,Ti)O4, generally crystallizes as the primary phase at high MgO contents, though it is replaced by MgTi2O5-Al2TiO5 solution at PO2 of 10-10 atm to 10-15 atm. An intermediate equilibrium phase diagram established at PO2 of 10-16 atm is proposed. This phase diagram does not show the observed primary phase crystallization competition, however, the phase composition of a real titanomagnetite slag produced by Evraz Highveld Steel and Vanadium Corporation in South Africa does show primary phase crystallization competition between (Mg)(Al,Ti)2O4 and MgTi2O5-Al2TiO5. Smelting involving such slags is likely conducted around the transition PO2, i.e. PO2 of about 10-16 atm. Complex modelling with MgTi2O5, Al2TiO5 and Ti3O5 end members and experiments are underway to verify and update the intermediate phase diagram.

  6. Epitaxial phase diagrams of SrTiO3, CaTiO3, and SrHfO3: Computational investigation including the role of antiferrodistortive and A -site displacement modes

    Science.gov (United States)

    Angsten, Thomas; Asta, Mark

    2018-04-01

    Ground-state epitaxial phase diagrams are calculated by density functional theory (DFT) for SrTiO3, CaTiO3, and SrHfO3 perovskite-based compounds, accounting for the effects of antiferrodistortive and A -site displacement modes. Biaxial strain states corresponding to epitaxial growth of (001)-oriented films are considered, with misfit strains ranging between -4 % and 4%. Ground-state structures are determined using a computational procedure in which input structures for DFT optimizations are identified as local minima in expansions of the total energy with respect to strain and soft-mode degrees of freedom. Comparison to results of previous DFT studies demonstrates the effectiveness of the computational approach in predicting ground-state phases. The calculated results show that antiferrodistortive octahedral rotations and associated A -site displacement modes act to suppress polarization and reduce the epitaxial strain energy. A projection of calculated atomic displacements in the ground-state epitaxial structures onto soft-mode eigenvectors shows that three ferroelectric and six antiferrodistortive displacement modes are dominant at all misfit strains considered, with the relative contributions from each varying systematically with the strain. Additional A -site displacement modes contribute to the atomic displacements in CaTiO3 and SrHfO3, which serve to optimize the coordination of the undersized A -site cation.

  7. Characterization of Ti6Al7Nb alloy foams surface treated in aqueous NaOH and CaCl2 solutions.

    Science.gov (United States)

    Bütev, Ezgi; Esen, Ziya; Bor, Şakir

    2016-07-01

    Ti6Al7Nb alloy foams having 53-73% porosity were manufactured via evaporation of magnesium space holders. A bioactive 1µm thick sodium hydrogel titanate layer, NaxH2-xTiyO2y+1, formed after 5M NaOH treatment, was converted to crystalline sodium titanate, Na2TiyO2y+1, as a result of post-heat treatment. On the other hand, subsequent CaCl2 treatment of NaOH treated specimens induced calcium titanate formation. However, heat treatment of NaOH-CaCl2 treated specimens led to the loss of calcium and disappearance of the titanate phase. All of the aforementioned surface treatments reduced yield strengths due to the oxidation of the cell walls of the foams, while elastic moduli remained mostly unchanged. Accordingly, equiaxed dimples seen on the fracture surfaces of as-manufactured foams turned into relatively flat and featureless fracture surfaces after surface treatments. On the other hand, Ca- and Na-rich coating preserved their mechanical stabilities and did not spall during fracture. The relation between mechanical properties of foams and macro-porosity fraction were found to obey a power law. The foams with 63 and 73% porosity met the desired biocompatibility requirements with fully open pore structures and elastic moduli similar to that of bone. In vitro tests conducted in simulated body fluid (SBF) showed that NaOH-heat treated surfaces exhibit the highest bioactivity and allow the formation of Ca-P rich phases having Ca/P ratio of 1.3 to form within 5 days. Although Ca-P rich phases formed only after 15 days on NaOH-CaCl2 treated specimens, the Ca/P ratio was closer to that of apatite found in bone. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. Influence of interface point defect on the dielectric properties of Y doped CaCu3Ti4O12 ceramics

    Directory of Open Access Journals (Sweden)

    Jianming Deng

    2016-03-01

    Full Text Available CaCu3Ti4−xYxO12 (0≤x≤0.12 ceramics were fabricated with conventional solid-state reaction method. Phase structure and microstructure of prepared ceramics were characterized by X-ray diffraction (XRD and scanning electron microscopy (SEM, respectively. The impedance and modulus tests both suggested the existence of two different relaxation behavior, which were attributed to bulk and grain boundary response. In addition, the conductivity and dielectric permittivity showed a step-like behavior under 405K. Meanwhile, frequency independence of dc conduction became dominant when above 405K. In CCTO ceramic, rare earth element Y3+ ions as an acceptor were used to substitute Ti sites, decreasing the concentration of oxygen vacancy around grain-electrode and grain boundary. The reason to the reduction of dielectric behavior in low frequencies range was associated with the Y doping in CCTO ceramic.

  9. Dependence of annealing time on structural and morphological properties of Ca(Zr0.05Ti0.95)O3 thin films

    International Nuclear Information System (INIS)

    Cavalcante, L.S.; Simoes, A.Z.; Orlandi, M.O.; Santos, M.R.M.C.; Varela, J.A.; Longo, E.

    2008-01-01

    Ca(Zr 0.05 Ti 0.95 )O 3 (CZT) thin films were prepared by the polymeric precursor method by spin-coating process. The films were deposited on Pt(1 1 1)/Ti/SiO 2 /Si(1 0 0) substrates and annealed at 650 deg. C for 2, 4, and 6 h in oxygen atmosphere. Structure and morphology of the CZT thin films were characterized by the X-ray diffraction (XRD), Fourier-transform infrared spectroscopy (FT-IR), atomic force microscopy (AFM) and field-emission scanning electron microscopy (FEG-SEM). XRD revealed that the film is free of secondary phases and crystallizes in the orthorhombic structure. The annealing time influences the grain size, lattices parameter and in the film thickness

  10. Ferroelectricity-induced resistive switching in Pb(Zr0.52Ti0.48)O3/Pr0.7Ca0.3MnO3/Nb-doped SrTiO3 epitaxial heterostructure

    Science.gov (United States)

    Md. Sadaf, Sharif; Mostafa Bourim, El; Liu, Xinjun; Hasan Choudhury, Sakeb; Kim, Dong-Wook; Hwang, Hyunsang

    2012-03-01

    We investigated the effect of a ferroelectric Pb(Zr0.52Ti0.48)O3 (PZT) thin film on the generation of resistive switching in a stacked Pr0.7Ca0.3MnO3 (PCMO)/Nb-doped SrTiO3 (Nb:STO) heterostructure forming a p-n junction. To promote the ferroelectric effect, the thin PZT active layer was deposited on an epitaxially grown p-type PCMO film on a lattice-matched n-type Nb:STO single crystal. It was concluded that the observed resistive switching behavior in the all-perovskite Pt/PZT/PCMO/Nb:STO heterostructure was related to the modulation of PCMO/Nb:STO p-n junction's depletion width, which was caused either by the PZT ferroelectric polarization field effect, the electrochemical drift of oxygen ions under an electric field, or both simultaneously.

  11. Sorption properties and reversibility of Ti(IV) and Nb(V)-fluoride doped-Ca(BH{sub 4}){sub 2}-MgH{sub 2} system

    Energy Technology Data Exchange (ETDEWEB)

    Bonatto Minella, Christian, E-mail: christian.minella@kit.edu [Institute for Metallic Materials, IFW Dresden, Helmholtzstrasse 20, D-01069 Dresden (Germany); Technische Universität Dresden, D-01062 Dresden (Germany); Garroni, Sebastiano [Dipartimento di Chimica e Farmacia, Universitá di Sassari and INSTM, Via Vienna 2, I-07100 Sassari (Italy); Pistidda, Claudio [Institute of Materials Research, Materials Technology, Helmholtz-Zentrum Geesthacht, Zentrum für Material- und Küstenforschung GmbH, Max Planck Str. 1, D-21502 Geesthacht (Germany); Baró, Maria Dolors [Departament de Física, Universitat Autònoma de Barcelona, E-08193 Bellaterra (Spain); Gutfleisch, Oliver [Materials Science, Technische Universität Darmstadt, Alarich-Weiss-Str. 16, 64287 Darmstadt (Germany); Klassen, Thomas; Dornheim, Martin [Institute of Materials Research, Materials Technology, Helmholtz-Zentrum Geesthacht, Zentrum für Material- und Küstenforschung GmbH, Max Planck Str. 1, D-21502 Geesthacht (Germany)

    2015-02-15

    Highlights: • Faster desorption reaction for doped materials vs. the pure composite system. • Kinetic improvement concerning re-hydrogenation reaction showed by the addition of NbF{sub 5}. • Full characterization of the de-hydrogenation reaction pathway by means of both SR-PXD and {sup 11}B{"1H} MAS-NMR. • Study of the evolution of the chemical state of the additives upon both milling and sorption reactions. - Abstract: In the last decade, alkaline and alkaline earth metal tetrahydroborates have been the focuses of the research due to their high gravimetric and volumetric hydrogen densities. Among them, Ca(BH{sub 4}){sub 2} and the Ca(BH{sub 4}){sub 2} + MgH{sub 2} reactive hydride composites (RHC), were calculated to have the ideal thermodynamic properties which fall within the optimal range for mobile applications. In this study, the addition of NbF{sub 5} or TiF{sub 4} to the Ca(BH{sub 4}){sub 2} + MgH{sub 2} reactive hydride composite system was attempted aiming to obtain a full reversible system with the simultaneous suppression of CaB{sub 12}H{sub 12}. Structural characterization of the specimens was performed by means of in-situ Synchrotron Radiation Powder X-ray diffraction (SR-PXD) and {sup 11}B{"1H} Solid State Magic Angle Spinning-Nuclear Magnetic Resonance (MAS-NMR). The evolution of the chemical state of the Nb- and Ti-based additives was monitored by X-ray Absorption Near Edge Structure (XANES). The addition of NbF{sub 5} or TiF{sub 4} to the Ca(BH{sub 4}){sub 2} + MgH{sub 2} system have not suppressed completely the formation of CaB{sub 12}H{sub 12} and only a slight improvement concerning the reversible reaction was displayed just in the case of Nb-doped composite material.

  12. Fabrication and characterization of polyvinyl alcohol/metal (Ca, Mg, Ti) doped zirconium phosphate nanocomposite films for scaffold-guided tissue engineering application

    International Nuclear Information System (INIS)

    Kalita, Himani; Pal, Pallabi; Dhara, Santanu; Pathak, Amita

    2017-01-01

    Nanocomposite films of polyvinyl alcohol (PVA) and zirconium phosphate (ZrP)/doped ZrP (doped with Ca, Mg, Ti) nanoparticles have been developed by solvent casting method to assess their potential as matrix material in scaffold-guided tissue engineering application. The prepared ZrP and doped ZrP nanoparticles as well as the nanocomposite films were characterized by various spectroscopic and microscopic techniques. Nanoindentation studies revealed improved nanomechanical properties in the PVA/doped ZrP nanocomposite films (highest for PVA/Ti doped ZrP: hardness = 262.4 MPa; elastic modulus = 5800 MPa) as compared to the PVA/ZrP and neat PVA films. In-vitro cell culture experiments carried out to access the cellular viability, attachment, proliferation, and migration on the substrates, using mouse fibroblast (3T3) cell lines, inferred enhanced bioactivity in the PVA/doped ZrP nanocomposite films (highest for PVA/Ca doped ZrP) in contrast to PVA/ZrP and neat PVA films. Controlled biodegradability as well as swelling behavior, superior bioactivity and improved mechanical properties of the PVA/doped ZrP nanocomposite films make them promising matrix materials for scaffold-guided tissue engineering application. - Highlights: • PVA/ZrP (undoped/doped with Ca, Mg and Ti) nanocomposite scaffolds were developed. • The nanocomposites were prepared via solvent casting method. • PVA/doped ZrP films exhibited enhanced mechanical properties than PVA/undoped ZrP. • Excellent bioactivity was observed in the PVA/doped ZrP films than PVA/undoped ZrP.

  13. Fabrication and characterization of polyvinyl alcohol/metal (Ca, Mg, Ti) doped zirconium phosphate nanocomposite films for scaffold-guided tissue engineering application

    Energy Technology Data Exchange (ETDEWEB)

    Kalita, Himani [Department of Chemistry, Indian Institute of Technology Kharagpur, West Bengal 721302 (India); Pal, Pallabi; Dhara, Santanu [School of Medical Science and Technology, Indian Institute of Technology Kharagpur, West Bengal 721302 (India); Pathak, Amita, E-mail: ami@chem.iitkgp.ernet.in [Department of Chemistry, Indian Institute of Technology Kharagpur, West Bengal 721302 (India)

    2017-02-01

    Nanocomposite films of polyvinyl alcohol (PVA) and zirconium phosphate (ZrP)/doped ZrP (doped with Ca, Mg, Ti) nanoparticles have been developed by solvent casting method to assess their potential as matrix material in scaffold-guided tissue engineering application. The prepared ZrP and doped ZrP nanoparticles as well as the nanocomposite films were characterized by various spectroscopic and microscopic techniques. Nanoindentation studies revealed improved nanomechanical properties in the PVA/doped ZrP nanocomposite films (highest for PVA/Ti doped ZrP: hardness = 262.4 MPa; elastic modulus = 5800 MPa) as compared to the PVA/ZrP and neat PVA films. In-vitro cell culture experiments carried out to access the cellular viability, attachment, proliferation, and migration on the substrates, using mouse fibroblast (3T3) cell lines, inferred enhanced bioactivity in the PVA/doped ZrP nanocomposite films (highest for PVA/Ca doped ZrP) in contrast to PVA/ZrP and neat PVA films. Controlled biodegradability as well as swelling behavior, superior bioactivity and improved mechanical properties of the PVA/doped ZrP nanocomposite films make them promising matrix materials for scaffold-guided tissue engineering application. - Highlights: • PVA/ZrP (undoped/doped with Ca, Mg and Ti) nanocomposite scaffolds were developed. • The nanocomposites were prepared via solvent casting method. • PVA/doped ZrP films exhibited enhanced mechanical properties than PVA/undoped ZrP. • Excellent bioactivity was observed in the PVA/doped ZrP films than PVA/undoped ZrP.

  14. Dielectric and infrared response of Ba.sub.0.77./sub.Ca.sub.0.23./sub.TiO.sub.3./sub..

    Czech Academy of Sciences Publication Activity Database

    Savinov, Maxim; Trepakov, Vladimír; Kamba, Stanislav; Kapphan, S. E.; Petzelt, Jan; Pankrath, R.; Kislova, I. L.; Kutshenko, A. B.; Jastrabík, Lubomír

    2003-01-01

    Roč. 295, - (2003), s. 31-38 ISSN 0015-0193 R&D Projects: GA MŠk LN00A015; GA AV ČR IAA1010213; GA ČR GA202/01/0612 Grant - others:NATO(XX) PST.CLG.977348; NATO(XX) LGPST.CLG.977561 Institutional research plan: CEZ:AV0Z1010914 Keywords : dielectric permittivity * infrared spectroscopy * Ba 1-x Ca x TiO 3 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.406, year: 2003

  15. Thermal expansion analysis and structural characteristics of the (Pb, Ca)TiO{sub 3} solid solutions from 150 to 570 K; Analise da expansao termica volumetrica e das caracteristicas estruturais de solucoes solidas de (Pb, Ca)TiO{sub 3} entre 150 e 570 K

    Energy Technology Data Exchange (ETDEWEB)

    Estrada, F.R.; Eiras, J.A.; Garcia, D., E-mail: frestrada@df.ufscar.br, E-mail: eiras@df.ufscar.br, E-mail: ducinei@df.ufscar.br [Universidade Federal de Sao Carlos (UFSCar), SP (Brazil). Departamento de Fisica. Grupo de Materiais Ferroicos

    2017-01-15

    Ceramic samples of lead modified calcium titanate (Pb{sub 1-x}Ca{sub x} TiO{sub 3}) with calcium concentration between 0.24≤x≤0.55 were prepared and analyzed in order to determine the structural origin of the negative thermal expansion observed in this ferroelectric system. The Rietveld structural refinement method was used to assess the thermal evolution of the structural parameters using powder X-ray diffraction data collected between 150 and 570 K. Since the Pb{sub 1-x}Ca{sub x} TiO{sub 3} phase diagram and space groups are still unknown for the temperature range investigated, the structural analyses were based on adjustments of the refinement protocol. The results revealed the existence of a correlation between symmetry transitions and anomalies in the thermal expansion of the unit cell, being such transitions not necessarily of the ferroelectric-paraelectric nature. (author)

  16. Effect of Sintering Time and Diameter on Bi-Pb-Sr-Ca-Cu-O Superconducting Wire Formation with TiO2 Dopant by Silver (Ag Tube

    Directory of Open Access Journals (Sweden)

    Cindy Al Kindi

    2018-01-01

    Full Text Available Pengaruh waktu sintering dan diameter terhadap pembentukan kawat superkonduktor Bi-Pb-Sr-Ca-Cu-O dengan dopan TiO2 menggunakan tabung perak (Ag menjadi penting untuk dibahas karena hal ini berpengaruh terhadap adanya suhu kritis yang merupakan syarat penting superkonduktor. Pada penelitian ini ada beberapa tahap yang dilakukan yaitu preparasi bahan, proses permesinan, penarikan kawat dan proses perlakuan panas. Serbuk BPSCCO dengan dopan TiO2 dimasukkan ke dalam tabung perak (Ag dan dikalsinasi pada temperatur 820oC selama 20 jam, lalu proses penarikan (Rolling sampai diameter 6 mm dan 2,6 mm serta sintering dilakukan pada temperatur 850oC selama 9 jam dan 30 jam untuk masing-masing ukuran diameter dengan dua kali proses sintering. Hasil penelitian menunjukkan bahwa kawat superkonduktor memiliki suhu kritis yaitu Tc onset = 99 K dan Tc zero = 70 K. Waktu yang sangat berpengaruh pada pembentukan fasa superkonduktor yaitu sintering selama 9 jam sedangkan untuk ukuran diameter kawat yang memiliki suhu kritis yaitu 6 mm, sedangkan waktu sintering selama 30 jam dapat merubah fasa BPSCCO sehingga tidak terbentuk superkonduktor melainkan konduktor dan semikonduktor. Pada diameter 2,6 mm belum menjadi ukuran yang tepat pada pembentukan kawat superkonduktor.   The influence of sintering time and diameter on the formation of Bi-Pb-Sr-Ca-Cu-O superconducting wire with doped TiO2 by silver (Ag tube becomes important to be discussed because of the presence of critical temperature which is an essential condition in superconductors. In this research there are several steps must be done that is: material preparation, machine process, wire drawing and heat process. BPSCCO powder with dopant TiO2 filled into silver (Ag tube with calcination temperature at 820oC for 20 h, then rolling process to diameter 6 mm and 2,6 mm with sintering temperature at 850oC for 9 h and 30 h for each size of diameter by twice sintering process. The results showed that

  17. Enhanced electrical and magnetic properties in La0.7Sr0.3MnO3 thin films deposited on CaTiO3-buffered silicon substrates

    Directory of Open Access Journals (Sweden)

    C. Adamo

    2015-06-01

    Full Text Available We investigate the suitability of an epitaxial CaTiO3 buffer layer deposited onto (100 Si by reactive molecular-beam epitaxy (MBE for the epitaxial integration of the colossal magnetoresistive material La0.7Sr0.3MnO3 with silicon. The magnetic and electrical properties of La0.7Sr0.3MnO3 films deposited by MBE on CaTiO3-buffered silicon (CaTiO3/Si are compared with those deposited on SrTiO3-buffered silicon (SrTiO3/Si. In addition to possessing a higher Curie temperature and a higher metal-to-insulator transition temperature, the electrical resistivity and 1/f noise level at 300 K are reduced by a factor of two in the heterostructure with the CaTiO3 buffer layer. These results are relevant to device applications of La0.7Sr0.3MnO3 thin films on silicon substrates.

  18. Growth of Ca, Zr co-doped BaTiO3 lead-free ferroelectric single crystal and its room-temperature piezoelectricity

    Directory of Open Access Journals (Sweden)

    Donglin Liu

    2017-09-01

    Full Text Available Lead-free Ca, Zr co-doped BaTiO3 (BCZT single crystal with a dimension up to 2mm×2mm×2mm was grown by a spontaneous nucleation technique using KF as the flux. The composition of the studied single crystal was defined to be Ba0.798Ca0.202Zr0.006Ti0.994O3, corresponding to a tetragonal phase at room temperature. The oriented single crystal exhibited a quasi-static piezoelectric constant of approximately 232 pC/N. The effective piezoelectric coefficient d33* of the single domain crystal obtained under a unipolar electric field of 35 kV/cm was 179 pm/V. Rayleigh analysis was used to identify the intrinsic and extrinsic contributions to the room-temperature piezoelectricity of BCZT single crystal. The extrinsic contribution was estimated up to 40% due to the irreversible domain wall movement. Furthermore a sixth-order polynomial of Landau expansion was employed to analyze the intrinsic contribution to piezoelectricity of BCZT single crystal. The large energy barriers inhibited polarization rotations, leading to the relatively low piezoelectricity.

  19. Assessment of CaSO4:Dy and LiF:Mg,Ti thermoluminescent dosimeters performance in the dosimetry of clinical electron beams

    International Nuclear Information System (INIS)

    Nunes, Maira Goes

    2008-01-01

    The assessment of the performance of CaS0 4 :Dy thermoluminescent detectors produced by IPEN in the dosimetry of clinical electron beams aims to propose an alternative to the LiF:Mg,Ti commercial dosimeters (TLD-100) largely applied in radiation therapy. The two types of thermoluminescent dosimeters were characterised with the use of PMMA, RMI-457 type solid water and water phantoms in radiation fields of 4, 6, 9, 12 and 16 MeV electrons of nominal energies in which the dose-response curves were obtained and the surface and depth doses were determined. The thermoluminescent response dependency with the electron nominal energies and the applied phantom were studied. The CaS0 4 :Dy presented the same behaviour than the LiF:Mg,Ti in such a way that its application as an alternative to the TLD-100 pellets in the radiation therapy dosimetry of electron beams is viable and presents the significantly higher sensitivity to the electron radiation as its main advantage. (author)

  20. Impedance spectroscopy studies on lead free (Ba0.85Ca0.15(Ti0.9Zr0.1O3 ceramics

    Directory of Open Access Journals (Sweden)

    Ahcène Chaouchi

    2012-12-01

    Full Text Available The AC complex impedance spectroscopy technique has been used to obtain the electrical parameters of polycrystalline sample of (Ba0.85Ca0.15(Ti0.9Zr0.1O3 in a wide frequency range at different temperatures. This sample was prepared by a high temperature solid-state reaction technique and single phase formation was confirmed by X-ray diffraction technique. This study was carried out by the means of simultaneous analysis of impedance, modulus, and electrical conductivity. The Cole-Cole (Nyquist plots suggest that the grains and grain boundaries are responsible in the conduction mechanism of the material at high temperature. The ColeCole (Nyquist plot studies revealed the presence of grain and grain boundary effect at 485 °C. On the other hand, it showed only the presence of grain boundary component of the resistivity at 535 °C. Complex impedance analysis indicated the presence of non-Debye type dielectric relaxation. The bulk resistance of the material decreases with rise in temperature similar to a semiconductor, and the Cole-Cole (Nyquist plot showed the negative temperature coefficient of resistance (NTCR character of (Ba0.85Ca0.15(Ti0.9Zr0.1O3. The value of activation energy is found to be 0.7433 eV, which suggests that the conduction may be the result of defect and charge carriers present in the materials.

  1. Influence of CaCO3, Al2O3, and TiO2 microfillers on physico-mechanical properties of Luffa cylindrica/polyester composites

    Directory of Open Access Journals (Sweden)

    Vinay Kumar Patel

    2016-06-01

    Full Text Available The development of natural fibre reinforced polymer composites has gained popularity in many applications due to their environment friendly characteristics over the synthetic fibre based polymer composites. This paper describes the fabrication and physical, mechanical, three-body abrasive wear and water absorption behaviour of Luffa fibre reinforced polyester composites with and without addition of micro-fillers of Al2O3, CaCO3 and TiO2. The ranking of the composite materials has been made by using Technique for order preference by similarity to ideal solution (TOPSIS method with output parameters of their physical, mechanical and abrasive wear and water absorption attributes. The addition of microfillers has enhanced greatly the physical and mechanical properties of Luffa-fibre based composites. The addition of microfillers has influenced the physico-mechanical properties of Luffa-fibre based polyester composites in descending order of CaCO3, Al2O3, and TiO2.

  2. Analysis of Fe, Ca, Ti, Ba, Ce, Zr and La element in the Sea sediment at Muria peninsula by X RF method

    International Nuclear Information System (INIS)

    Sukirno and Sri Murniasih

    2009-01-01

    he analysis of metals (Fe, Ca, Ti, Ba, Ce, Zr and La) in the sea sediment environmental samples at Muria peninsula has been carried out with X-Ray Fluorescence (XRF) method. The aim of this analysis is to know the distribution metals which accommodate the recent environmental data in supporting the license of site and Environmental Impact Assessment (EIA) for the Nuclear Power Plants (NPP). Samples taken preparation and analysis based on the procedures of environmental analysis. The result analysis that contents of mayor elements in 7 sea sediment location of sampling were Ca, Ti and Fe with concentration are (6.74 – 11.69 ) %; (0.74 – 6.89 ) % and (0.45 -1.94 ) % successively; while minor elements were Ba, Ce, Zr and La with concentration are 451.4 – 1331.6 ) mg/kg; (201.8 – 427.3) mg/kg; (192.3 – 338.5) mg/kg dan (171.7 – 298.4) mg/kg. The statistic test result shows that sampling location there is a significant difference all of element with the level significant of 95 %. (author)

  3. AC Electroluminescent Processes in Pr3+-Activated (Ba0.4Ca0.6TiO3 Diphase Polycrystals

    Directory of Open Access Journals (Sweden)

    Nan Gao

    2017-05-01

    Full Text Available We investigated the properties of alternating current (AC-driven electroluminescence from (Ba0.4Ca0.6TiO3:Pr3+ diphase polycrystal-based device. The results of crystal phases and micrographs, and the symmetrical dual emissions in one AC cycle, indicate the spontaneous formation of a dielectric/phosphor/dielectric sandwich microstructure in (Ba0.4Ca0.6TiO3:Pr3+. The electroluminescent device emits a red light of 617 nm, which is attributed to the 1D2-3H4 transition of Pr3+ in the phosphor phase. At a fixed AC frequency, the intensity of electroluminescence exhibits a steep enhancement when applying an increased driving electric field that is beyond a threshold. In a fixed driving electric field, the intensity of electroluminescence shows a rapid rise at low frequencies, but reaches saturation at high frequencies. Based on a double-injection model, we discussed systematically the electroluminescent processes in a whole cycle of AC electric field, which matched well with the experimental data. Our investigation is expected to expand our understanding of such a diphase electroluminescent device, thereby promoting their applications in lighting and displays.

  4. Fabrication and characterization of polyvinyl alcohol/metal (Ca, Mg, Ti) doped zirconium phosphate nanocomposite films for scaffold-guided tissue engineering application.

    Science.gov (United States)

    Kalita, Himani; Pal, Pallabi; Dhara, Santanu; Pathak, Amita

    2017-02-01

    Nanocomposite films of polyvinyl alcohol (PVA) and zirconium phosphate (ZrP)/doped ZrP (doped with Ca, Mg, Ti) nanoparticles have been developed by solvent casting method to assess their potential as matrix material in scaffold-guided tissue engineering application. The prepared ZrP and doped ZrP nanoparticles as well as the nanocomposite films were characterized by various spectroscopic and microscopic techniques. Nanoindentation studies revealed improved nanomechanical properties in the PVA/doped ZrP nanocomposite films (highest for PVA/Ti doped ZrP: hardness=262.4MPa; elastic modulus=5800MPa) as compared to the PVA/ZrP and neat PVA films. In-vitro cell culture experiments carried out to access the cellular viability, attachment, proliferation, and migration on the substrates, using mouse fibroblast (3T3) cell lines, inferred enhanced bioactivity in the PVA/doped ZrP nanocomposite films (highest for PVA/Ca doped ZrP) in contrast to PVA/ZrP and neat PVA films. Controlled biodegradability as well as swelling behavior, superior bioactivity and improved mechanical properties of the PVA/doped ZrP nanocomposite films make them promising matrix materials for scaffold-guided tissue engineering application. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. Concurrent ionic migration and electronic effects at the memristive TiO x /La1/3Ca2/3MnO3-x interface

    Science.gov (United States)

    Román Acevedo, W.; Ferreyra, C.; Sánchez, M. J.; Acha, C.; Gay, R.; Rubi, D.

    2018-03-01

    The development of reliable redox-based resistive random-access memory devices requires understanding and disentangling concurrent effects present at memristive interfaces. We report on the fabrication and electrical characterization of TiO x /La1/3Ca2/3MnO3-x microstructured interfaces and on the modeling of their memristive behavior. We show that a careful tuning of the applied external electrical stimuli allows controlling the redox process between both layers, obtaining multilevel non-volatile resistance states. We simulate the oxygen vacancies dynamics at the interface between both oxides, and successfully reproduce the experimental electrical behavior after the inclusion of an electronic effect, related to the presence of an n-p diode at the interface. The formation of the diode is due to the n- and p-character of TiO x and La1/3Ca2/3MnO3-x , respectively. Our analysis indicates that oxygen vacancies migration between both layers is triggered after the diode is polarized either in forward mode or in reverse mode above breakdown. Electrical measurements at different temperatures suggest that the diode can be characterized as Zener-type. The advantages of our junctions for their implementation in RRAM devices are finally discussed.

  6. Optical and vibrational spectroscopy of Ba0.85Ca0.15Zr0.1Ti0.9O3 modified lithium borate glass ceramics

    Science.gov (United States)

    Viswanath, Pamarti; Prashanth, Sadhu Sai Pavan; Molli, Muralikrishna; Wicram, Jaschin Prem; Sai Muthukumar, V.

    2018-04-01

    Glass ceramics are excellent replacement for single crystalline materials which are expensive and difficult to fabricate. In this context, we have attempted to fabricate glass nanocomposites comprising of Lithium Borate glass matrix embedded with lead free ferroelectric Ba0.85Ca0.15Zr0.1Ti0.9O3 (BCZT). Both of these functional materials are known to exhibit excellent ferroelectric behavior and are currently explored for various device applications. We have prepared these novel glass nanocomposite using melt-quenching techniquein various chemical composition involving different molar ratio. x(Ba0.85Ca0.15Zr0.1Ti0.9O3)-(1-x)(Li2O.2B2O3) where (x=0.1,0.2,0.3,0.4). The as-quenched samples exhibited amorphous nature as revealed by X-ray Diffraction studies. With the increase in BCZT content we have observed significant alteration in optical bandgap and Urbach energy. The tailoring of optical properties by tuning the structure was probed by Raman vibrational spectroscopy which confirmed the dominant role played by BCZT as a network modifier in these borate glasses. Concomitantly, these glass nanocomposites were found to be excellent UV absorbers.

  7. A-site substitution effect of strontium on bismuth layered CaBi4Ti4O15 ceramics on electrical and piezoelectric properties

    International Nuclear Information System (INIS)

    Tanwar, Amit; Verma, Maya; Gupta, Vinay; Sreenivas, K.

    2011-01-01

    Strontium substituted CaBi 4 Ti 4 O 15 ceramics with the chemical formula Ca 1-x Sr x Bi 4 Ti 4 O 15 (CSBT) (x = 0.0-1.0) have been prepared through conventional solid state route. The formation of single phase material with orthorhombic structure was verified from X-ray diffraction with incorporation of Sr substitution. Decrease in a-axis displacement of Bi ion in the perovskite structure in the CSBT ceramics were observed from the relative changes in soft mode (20 cm -1 ) in the Raman spectra, and increase in Sr incorporation shows the shift in ferroelectric to paraelectric phase transition temperature. The dielectric properties for all the CSBT ceramic compositions are studied as a function of temperature over the frequency range of 100 Hz-1 MHz. Curie's temperature was found to be function of Sr substitution and with increase in the Sr concentration the phase transition becomes sharper and phase transition temperature gets shifted towards lower temperature (790-545 deg. C). The behavior of ac conductivity as a function of frequency (100 Hz-1 MHz) at low temperature ( 33 ) whereas piezoelectric charge coefficient values were found comparable to that of PZT at room temperature. Relative changes in soft modes due to Sr incorporation results in high piezoelectricity in the CSBT ceramics.

  8. CaCu3Ti4O12: A Bifunctional Perovskite Electrocatalyst for Oxygen Evolution and Reduction Reaction in Alkaline Medium

    International Nuclear Information System (INIS)

    Kushwaha, H.S.; Halder, Aditi; Thomas, P.; Vaish, Rahul

    2017-01-01

    Highlights: •A cost effective double perovskite CaCu 3 Ti 4 O 12 have been synthesized using oxalate precursor method. •CCTO electrocatalyst exhibit enhanced bifunctional electrocatalytic activities. •CCTO electrocatalyst have lower overpotential and higher mass activity as compared to noble metal oxide and well-known perovskite catalysts. •Electrochemical impedance spectroscopy investigations of oxygen reactions on perovskite surfaces. -- Abstract: Perovskite oxides are prominent materials as the bifunctional electrocatalysts for both oxygen reduction/evolution reactions (ORR/OER) for the electrochemical energy conversion and storage using regenerative fuel cells and rechargeable metal-air batteries. In this work, a quadruple perovskite CaCu 3 Ti 4 O 12 has been synthesized oxalate precursor route. X-ray diffraction pattern shows phase purity of the synthesized electrocatalyst. The synthesized CCTO electrocatalyst have crystallite size of 26 nm. Electrochemical investigations reveal that CCTO exhibit efficient catalytic activity. More interestingly, an extremely high OER activity is observed for CCTO electrocatalysts which is found superior than similar class of perovskites. Additionally, CCTO shows efficient ORR activity with an onset potential of 0.83 V which is better than that of Pt/C catalyst (≈0.94 V). These results demonstrate the significant potential of CCTO perovskite as a bifunctional electrode material for alkaline fuel cells and metal-air batteries.

  9. Preparation and characterization of RF magnetron sputtered CuO/CaTi{sub 4}O{sub 9} thin films with enhanced third-order nonlinear optical properties

    Energy Technology Data Exchange (ETDEWEB)

    Yin, Congfei; Liang, Xiaojuan, E-mail: lxj6126@126.com; Hu, Guangcai; Hu, Xie; Chen, Xipeng; Li, Pengzhi; Xiang, Weidong, E-mail: xiangweidong001@126.com

    2017-04-15

    The titanate, is a material of interest for various energy applications, including photovoltaics, catalysts, and high-rate energy storage devices. Herein, its related materials, CuO/CaTi{sub 4}O{sub 9} [CCTO] thin films, were successfully fabricated on SrTiO{sub 3} (100) substrates by RF magnetron sputtering assisted with subsequent oxygen annealing. This obtained CCTO thin films were then systemically studied by X-ray powder diffraction (XRD), atomic force microscopy (AFM), scan electron microscopy (SEM), X-ray photoelectron spectroscopy (XPS) and high-resolution transmission electron microscopy (HRTEM). It was found that CuO and CaTi{sub 4}O{sub 9} (001) particles were closely accumulated together on the surface of the substrate in the annealing process after comparing with that of the as-prepared thin film, which was verified by SEM and AFM results. Furthermore, we investigated the third-order nonlinear optical (NLO) properties of the as-prepared and annealed CCTO thin film by means of the Z-scan technique using 650 nm femtosecond laser pulse. Post-deposition oxygen annealing was found to modify the morphological characteristics of the films, resulting in enhancing their NLO properties. The observation of NLO performance of annealed CCTO thin film indicates that RF magnetron sputtering is a feasible method for the fabrication of optical thin films, which can be expanded to fabricate other NLO materials from the corresponding dispersions. Naturally, we concluded that the CCTO thin film occupy a better NLO property, and thus enlarge its application in nonlinear optics. - Highlights: • The CCTO thin film was prepared using the RF magnetron sputtering and oxygen annealing. • The film was prepared on the SrTiO{sub 3}(100) substrates with a Ca{sub 2}CuO{sub 3} target. • The oxygen annealing was found can effectively enhance the film quality and NLO property. • The film was characterized using XPS, SEM, AFM, TEM, XRD and Z-scan techniques.

  10. Magnetic behavior of La2/3Ca1/3MnO3 / BaTiO3 bilayers

    Science.gov (United States)

    Ordonez, John E.; Gomez, Maria E.; Lopera, Wilson; Marin, Lorena; Pardo, Jose A.; Morellon, Luis; Algarabel, Pedro; Prieto, Pedro

    2013-03-01

    We have grown ferroelectric BaTiO3(BTO) and ferromagnetic La2/3Ca1/3MnO3 (LCMO) onto (001) SrTiO3 and Nb:SrTiO3 by pulsed laser deposition (PLD) at pure oxygen atmosphere, and a substrate temperature of 820° C, seeking for a multiferroic behavior in this structure. From x-ray diffraction (XRD) we found lattice parameter aBTO=4.068 Å, and aLCMO=3.804 Å, for each individual layer. In the BTO/LCMO bilayer, (002)-Bragg peak for BTO maintain its position whereas (002) LCMO peak shift to lower Bragg angle indicating a strained LCMO film. Magnetization measurements reveal an increase in the Curie temperature from 170 K to 220 K for the bilayer when LCMO (t = 47 nm) is deposited on BTO (t=52 nm) film, while depositing the BTO (50 nm) above LCMO (48 nm) the Curie temperature remains at values close to that obtained for a LCMO single layer (~175 K), deposited under identical growth parameters This work has been supported by Instituto de Nanociencias de Aragón, Zaragoza, Spain, ``El Patrimonio Autónomo Fondo Nacional de Financiamiento para CT&I FJC'' COLCIENCIAS-CENM Contract RC 275-2011 and Research Project COLCIENCIAS-UNIVALLE.

  11. Elastic properties of amorphous T0.75Y0.75B14 (T   =  Sc, Ti, V, Y, Zr, Nb) and the effect of O incorporation on bonding, density and elasticity (T ′  =  Ti, Zr)

    International Nuclear Information System (INIS)

    Hunold, Oliver; Keuter, Philipp; Bliem, Pascal; Music, Denis; Wittmers, Friederike; Ravensburg, Anna L; Schneider, Jochen M; Primetzhofer, Daniel

    2017-01-01

    We have systematically studied the effect of transition metal valence electron concentration (VEC) of amorphous T 0.75 Y 0.75 B 14 (a- T 0.75 Y 0.75 B 14 , T   =  Sc, Ti, V, Y, Zr, Nb) on the elastic properties, bonding, density and electronic structure using ab initio molecular dynamics. As the transition metal VEC is increased in both periods, the bulk modulus increases linearly with molar- and mass density. This trend can be understood by a concomitant decrease in cohesive energy. T ′  =  Ti and Zr were selected to validate the predicted data experimentally. A-Ti 0.74 Y 0.80 B 14 and a-Zr 0.75 Y 0.75 B 14 thin films were synthesized by high power pulsed magnetron sputtering. Chemical composition analysis revealed the presence of up to 5 at.% impurities, with O being the largest fraction. The measured Young’s modulus values for a-Ti 0.74 Y 0.80 B 14 (301  ±  8 GPa) and a-Zr 0.75 Y 0.75 B 14 (306  ±  9 GPa) are more than 20% smaller than the predicted ones. The influence of O incorporation on the elastic properties for these selected systems was theoretically studied, exemplarily in a-Ti 0.75 Y 0.75 B 12.75 O 1.25 . Based on ab initio data, we suggest that a-Ti 0.75 Y 0.75 B 14 exhibits a very dense B network, which is partly severed in a-Ti 0.75 Y 0.75 B 12.75 O 1.25 . Upon O incorporation, the average coordination number of B and the molar density decrease by 9% and 8%, respectively. Based on these data the more than 20% reduced Young’s modulus obtained experimentally for films containing impurities compared to the calculated Young’s modulus for a-Ti 0.75 Y 0.75 B 14 (without incorporated oxygen) can be rationalized. The presence of oxygen impurities disrupts the strong B network causing a concomitant decrease in molar density and Young’s modulus. Very good agreement between the measured and calculated Young’s modulus values is obtained if the presence of impurities is considered in the calculations. The

  12. CERN: SC-33

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    On 22 April a forward-looking CERN also looked back for a day, when the 'SC-33' event reviewed the achievements of CERN's first machine, the 600 MeV SynchroCyclotron (SC), which closed down on 17 December after 33 years of valiant service

  13. CERN: SC-33

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1991-06-15

    On 22 April a forward-looking CERN also looked back for a day, when the 'SC-33' event reviewed the achievements of CERN's first machine, the 600 MeV SynchroCyclotron (SC), which closed down on 17 December after 33 years of valiant service.

  14. S-C Mylonites

    NARCIS (Netherlands)

    Lister, G.S.; Snoke, A.W.

    1984-01-01

    Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C

  15. Occurrence of low-Ca clinopyroxene and the role of deformation in the formation of pyroxene-Fe-Ti oxide symplectites

    Science.gov (United States)

    Barton, Michael; Sheets, Julia Meyer; Lee, William E.; van Gaans, Chris

    1991-07-01

    Pyroxene-Fe-Ti oxide symplectites in a norite from the leuconoritic phase of the Bjerkreim-Sokndal lopolith, SW Norway, have been studied using EMPA (electron microprobe analysis) and TEM (transmission electron microscopy) techniques. Textural and mineralchemical data indicate that the symplectites formed under subsolidus conditions at T=720 736°C and fo 2=10-17 bars. Solidus temperatures are estimated as 981 1060° C. Two models of formation are proposed: non-isochemical replacement of olivine, and growth at boundaries between exsolving grains of orthomagmatic high-Ca pyroxene and Fe-Ti oxide. TEM reveals the presence of low-Ca clinopyroxene and this formed in response to strain and/or shear stress. Comparison with published experimental data indicates that strain rates of up to 10-12 s-1 are necessary to explain the occurrence of low-Ca clinopyroxene. The transition from orthopyroxene to low-Ca clinopyroxene may be related to deformation which accompanied intrusion of the leuconoritic phase of the Bjerkreim-Sokndal lopolith or to local post-intrusive faulting and/or shearing. Selected-area diffraction shows that the Fe-Ti oxide lamellae are oriented with respect to the pyroxene such that (111)oxide/(100)pyroxene. the planes of closest oxygen packing in the constituent phases are thus adjacent to one another which leads to minimal misfit between the structures and to low interfacial strain energy. The same topotactic relationship exists in both lamellar and vermicular parts of symplectites (but is not continuous along the total length of the interface), indicating that the form of the intergrowths is a primary growth feature that to some extent can be explained in terms of growth models for duplex cells. Deformation during growth is probably necessary to account for the lattice distortion observed in the symplectites. Supercooling is necessary for nucleation and growth of the symplectites. A period of cooling under static, fluid-absent conditions allows

  16. Structure, tribocorrosion and biocide characterization of Ca, P and I containing TiO{sub 2} coatings developed by plasma electrolytic oxidation

    Energy Technology Data Exchange (ETDEWEB)

    Sáenz de Viteri, V., E-mail: virginia.saenzdeviteri@tekniker.es [IK4-Tekniker, Polo Tecnológico de Eibar, Calle Iñaki Goenaga, 5, Eibar 20600 (Spain); Bayón, R.; Igartua, A. [IK4-Tekniker, Polo Tecnológico de Eibar, Calle Iñaki Goenaga, 5, Eibar 20600 (Spain); Barandika, G. [Departamento de Química Inorgánica, Facultad de Ciencia y Tecnología, Universidad del País Vasco, UPV/EHU, Apartado 644, Bilbao E-48080 (Spain); Moreno, J. Esteban; Peremarch, C. Pérez-Jorge; Pérez, M. Martínez [Department of Clinical Microbiology, IIS-Fundación Jiménez Díaz, Av. Reyes Católicos 2, Madrid 28040 (Spain)

    2016-03-30

    Graphical abstract: - Highlights: • Ca, P and I doped TiO{sub 2} coatings were developed by means of plasma electrolytic oxidation (PEO) technique. • Microstructure and chemical composition of the developed coating were in depth analyzed. • The effect of wear-corrosion synergy was studied through tribocorrosion tests. • Antibacterial efficiency of iodine as biocide agent was analyzed by means of bacterial adhesion study. • A TiO{sub 2} coating with improved wear-corrosion resistance, suitable surface for cell adhesion and biocide properties was achieved. - Abstract: In hip joint implants, in particular in the stems, wear-corrosion effects can accelerate the degradation of the biomaterial. The lack of osseointegration and the risk of contracting implant-associated infections may be other reasons for a premature failure of the implant. In this work, TiO{sub 2} coatings have been developed by means of plasma electrolytic oxidation (PEO) technique in order to achieve wear-resistant hard coatings with osseointegration ability and biocide characteristics. During the PEO process, elements that favor cell growth, like Ca and P, were introduced into the coating. With the purpose of providing the coating with antibacterial properties iodine was added like biocide agent. The microstructure and chemical composition of the developed coatings were analyzed in order to see if the surface of the films was suitable for the cell attachment. The effect of wear-corrosion synergy was studied by means of tribocorrosion tests. Finally, the biocide capacity of iodine against Staphylococcus aureus and Staphylococcus epidermidis was analyzed through bacterial adhesion tests. High wear and corrosion resistance was shown in one of the developed coatings. The achieved surface microstructures seem to be appropriate to improve the osseointegration with proper pore size and porosity index. The antibacterial capacity of iodine was confirmed for S. epidermidis.

  17. Low sintering temperature and high piezoelectric properties of Li-doped (Ba,Ca)(Ti,Zr)O3 lead-free ceramics

    International Nuclear Information System (INIS)

    Chen, Xiaoming; Ruan, Xuezheng; Zhao, Kunyun; He, Xueqing; Zeng, Jiangtao; Li, Yongsheng; Zheng, Liaoying; Park, Chul Hong; Li, Guorong

    2015-01-01

    Highlights: • Li-doped Ba 0.85 Ca 0.15 Ti 0.9 Zr 0.1 O 3 (BCZT) lead-free piezoceramics were prepared by the two-step synthesis and solid-state reaction method. • Their sintering temperature decreases from about 1540 °C down to about 1400 °C. • With the proper addition of Li, the densities and grain sizes of ceramics increase. • The ceramics not only have the characteristics of hard piezoceramics but also possesses the features of soft piezoceramics at low sintering temperature. - Abstract: Li-doped Ba 0.85 Ca 0.15 Ti 0.9 Zr 0.1 O 3 (BCZT) lead-free piezoelectric ceramics were prepared by the two-step synthesis and the solid-state reaction method. The density and grain size of ceramics sufficiently increases by Li-doped sintering aid, and their sintering temperature decreases from about 1540 °C down to about 1400 °C. X-ray diffraction reveals that the phase structure of Li-doped BCTZ ceramics is changed with the sintering temperature, which is consistent with their phase transition observed by the temperature-dependent dielectric curves. The well-poled Li-doped BCZT ceramics show a high piezoelectric constant d 33 (512 pC/N) and a planar electromechanical coupling factor k p (0.49), which have the characteristics of soft Pb(Zr,Ti)O 3 (PZT) piezoceramic, on the other hand, the mechanical quality factor Q m is about 190, which possesses the features of hard PZT piezoceramics. The enhanced properties of the Li-doped BCZT are explained by the combination of Li-doped effect and sintering effect on the microstructure and the phase transition around room temperature

  18. Effects of Nb doping level on the electronic transport, photoelectric effect and magnetoresistance across La0.5Ca0.5MnO3/Nb:SrTiO3 junctions

    Science.gov (United States)

    Wang, J. F.; Jiang, Y. C.; Chen, M. G.; Gao, J.

    2013-12-01

    Heterojunctions composed of La0.5Ca0.5MnO3 and Nb doped SrTiO3 were fabricated, and the effects of the Nb doping level on their electronic transport, photoelectric effect, and magnetoresistance were investigated. A lower doping concentration of Nb led to better rectifying properties and higher open circuit voltages. The I-V curves for La0.5Ca0.5MnO3/0.7 wt. % Nb-SrTiO3 showed a negligible response to magnetic fields for all temperatures, whereas La0.5Ca0.5MnO3/0.05 wt. % Nb-SrTiO3 exhibited distinct magnetoresistance, which depended on both the bias voltage and temperature. These results are discussed with the assistance of conventional semiconductor theories.

  19. Enhancing Properties and Performance of Cellulose Acetate/Polyethylene Glycol (CA/PEG Membrane with the addition of Titanium Dioxide (TiO2 by Using Surface Coating Method

    Directory of Open Access Journals (Sweden)

    Nurkhamidah Siti

    2018-01-01

    Full Text Available In this study, cellulose acetate/polyethylene glycol (CA/PEG membrane with composition 80/20 was prepared by phase inversion method. Titanium dioxide with different number has been added by using surface coating. Hydrophilicity, morphology, flux permeate and salt rejection of membranes has been studied. The hydrophilicity is determined by Fourier-Transformed Infra-Red (FTIR spectra and contact angle analysis. Surface and fractured morphology are identified by using Scanning Electron Microscopy (SEM. The experiment results show that hydrophilicity of CA/PEG membrane increases with the addition and the increasing of TiO2 contents. However, with further increasing of TiO2, hydrophilicity of CPT membrane decreases. The optimum membrane is CA/PEG/TiO2 80/20/1,25 g/L solvent (CPT 3 with flux permeate of 111,82 L.m-2h-1 and salt rejection of 48,30%.

  20. Bony integration of titanium implants with a novel bioactive calcium titanate (Ca4Ti3O10) surface treatment in a rabbit model.

    Science.gov (United States)

    Haenle, Maximilian; Lindner, Tobias; Ellenrieder, Martin; Willfahrt, Manfred; Schell, Hanna; Mittelmeier, Wolfram; Bader, Rainer

    2012-10-01

    Nowadays total joint replacement is an indispensable component of modern medicine. The surfaces characteristics of cementless prostheses may be altered to achieve an accelerated and enduring bony integration. Classic surface coatings bear the risk of loosening or flaking from the implant body. This risk is excluded by the chemical conversion of the naturally existing TiO(2) surface layer into calcium titanate. The aim of this experimental animal study was to investigate the bony integration of implants with a new calcium titanate surface (Ca(4)Ti(3)O(10)) compared with a conventional standard Ti6Al4V surface. Cylindrical implants, made of titanium alloy (Ti6Al4V) were implanted in both lateral femoral condyles of New Zealand white rabbits. In each animal, an implant with and without surface treatment was inserted in a blinded manner. Animals were sacrificed after 4, 12, and 36 weeks, respectively. The axial pull-off forces were determined for 25 animals using a universal testing machine (Zwick Z010, Ulm, Germany). Furthermore, a histological analysis of the bony integration of the implants was performed in 12 specimens. In general, the pull-off forces for untreated and treated implants increased with longer survival times of the rabbits. No significant difference could be shown after 4 weeks between treated and untreated implants. After 12 weeks, the treated implants revealed a statistical significant higher pull-off force. After 36 weeks, the pull-off forces for treated and untreated implants aligned again. Titanium implants treated with calcium titanate, may offer an interesting and promising implant surface modification for endoprosthetic implants. They might lead to an accelerated osseointegration of total hip and knee replacements. Copyright © 2012 Wiley Periodicals, Inc.

  1. EIS, Mott Schottky and EFM analysis of the electrochemical stability and dielectric properties of Ca-P-Ag and Ca-P-Si-Ag coatings obtained by plasma electrolytic oxidation in Ti6Al4V

    Directory of Open Access Journals (Sweden)

    Sara María Leal-Marin

    2017-01-01

    Full Text Available El Ti6Al4V ELI (ASTM F136 es una de las aleaciones más empleadas en dispositivos de osteosíntesis y reemplazo articular. Sin embargo, las propiedades de esta aleación pueden ser mejoradas respecto a su biocompatibilidad y osteointegración con el tejido óseo a través de recubrimientos. El objetivo de este trabajo fue evaluar el comportamiento electroquímico de un recubrimiento obtenido por oxidación por plasma electrolítico sobre Ti6Al4V ELI empleando soluciones electrolíticas enriquecidas con iones de PO4 2-, Ca+2, Si+4 y varias concentraciones de Ag+1. Los recubrimientos se caracterizaron mediante espectroscopia de impedancia electroquímica (EIS y Mott-Schottky (M-S en una celda de tres electrodos con una solución fisiológica simulada. El comportamiento electroquímico se contrastó con microscopía de fuerza electrostática (EFM, donde se analizó el potencial eléctrico del recubrimiento. Los resultados de EIS mostraron mejores propiedades de estabilidad frente a la corrosión en los sustratos recubiertos con Ca- P-Ag, comparados con los recubiertos con Ca-P-Si-Ag. Los espectros de Nyquist y Bode mostraron relajaciones relacionadas con la transferencia de carga hacia la doble capa electroquímica como reflejo de los cambios microestructurales y de conductividad de los recubrimientos, dada por la presencia particular en cada caso, de los elementos contenidos en estos. De acuerdo con los resultados de M-S, todas las muestras ensayadas presentaron un comportamiento con dopado tipo n, cuya conductividad incrementó con la inclusión de plata. Mediante EFM se observaron mayores contrastes en el potencial, fase y la amplitud de los recubrimientos con mayor cantidad de plata respecto al Ti6Al4V sin recubrir.

  2. Microwave dielectric properties of CaCu{sub 3}Ti{sub 4}O{sub 12}-Al{sub 2}O{sub 3} composite

    Energy Technology Data Exchange (ETDEWEB)

    Rahman, Mohd Fariz Ab; Abu, Mohamad Johari; Zaman, Rosyaini Afindi; Ahmad, Zainal Arifin [School of Materials and Mineral Resources Engineering, Engineering Campus, Universiti Sains Malaysia, 14300 Nibong Tebal, Penang (Malaysia); Karim, Saniah Ab; Mohamed, Julie Juliewatty, E-mail: juliewatty.m@umk.edu.my [Advance Materials Research Cluster, Faculty of Earth Sciences, Universiti Malaysia Kelantan, Jeli Campus, 17600 Jeli, Kelantan (Malaysia); Ain, Mohd Fadzil [School of Electrical and Electronic Engineering, Engineering Campus, Universiti Sains Malaysia, 14300 Nibong Tebal, Penang (Malaysia)

    2016-07-19

    (1-x)CaCu{sub 3}Ti{sub 4}O{sub 12} + (x)Al{sub 2}O{sub 3} composite (0 ≤ x ≤0.25) was prepared via conventional solid-state reaction method. The fabrication of sample was started with synthesizing stoichiometric CCTO from CaCO{sub 3}, CuO and TiO{sub 2} powders, then wet-mixed in deionized water for 24 h. The process was continued with calcined CCTO powder at 900 °C for 12 h before sintered at 1040 °C for 10 h. Next, the calcined CCTO powder with different amount of Al{sub 2}O{sub 3} were mixed for 24 h, then palletized and sintered at 1040 °C for 10. X-ray diffraction analysis on the sintered samples showed that CCTO powder was in a single phase, meanwhile the trace of secondary peaks which belong to CaAl{sub 2}O{sub 4} and Corundum (Al{sub 2}O{sub 3}) could be observed in the other samples Scanning electron microscopy analysis showed that the grain size of the sample is firstly increased with addition of Al{sub 2}O{sub 3} (x = 0.01), then become smaller with the x > 0.01. Microwave dielectric properties showed that the addition of Al{sub 2}O{sub 3} (x = 0.01) was remarkably reduced the dielectric loss while slightly increased the dielectric permittivity. However, further addition of Al{sub 2}O{sub 3} was reduced both dielectric loss and permittivity at least for an order of magnitude.

  3. Isospin diffusion in binary collisions of 32S+Ca,4840 and 32S+48Ti at 17.7 MeV/nucleon

    Science.gov (United States)

    Piantelli, S.; Valdré, S.; Barlini, S.; Casini, G.; Colonna, M.; Baiocco, G.; Bini, M.; Bruno, M.; Camaiani, A.; Carboni, S.; Cicerchia, M.; Cinausero, M.; D'Agostino, M.; Degerlier, M.; Fabris, D.; Gelli, N.; Gramegna, F.; Gruyer, D.; Kravchuk, V. L.; Mabiala, J.; Marchi, T.; Morelli, L.; Olmi, A.; Ottanelli, P.; Pasquali, G.; Pastore, G.

    2017-09-01

    The systems 32S+Ca,4840 and 32S+48Ti at 17.7 MeV/nucleon were investigated with the setup general array for fragment identification and for emitted light particles in dissipative collisions (GARFIELD) plus ring counter (RCo) at Laboratori Nazionali di Legnaro (LNL) of Istituto Nazionale di Fisica Nucleare (INFN). Fusion evaporation (FE), fusion fission (FF), and deep inelastic (DIC) events were identified, also through the comparison with the prediction of a transport model (stochastic mean field, SMF), coupled to GEMINI++ as an afterburner. This work mainly deals with the study of isospin transport phenomena in DIC events. In particular, the isospin diffusion is highlighted by comparing the average isotopic content of the quasiprojectile (QP) remnants observed when the target is the N =Z nucleus 40Ca and when it is the neutron-rich 48Ca. Also, the d /p and t /p ratios for particles forward emitted with respect to the QP were found to increase with increasing N /Z of the target.

  4. Room temperature single-crystal diffuse scattering and ab initio lattice dynamics in CaTiSiO5.

    Science.gov (United States)

    Gutmann, M J; Refson, K; Zimmermann, M V; Swainson, I P; Dabkowski, A; Dabkowska, H

    2013-08-07

    Single-crystal diffuse scattering data have been collected at room temperature on synthetic titanite using both neutrons and high-energy x-rays. A simple ball-and-springs model reproduces the observed diffuse scattering well, confirming its origin to be primarily due to thermal motion of the atoms. Ab initio phonons are calculated using density-functional perturbation theory and are shown to reproduce the experimental diffuse scattering. The observed diffuse x-ray and neutron scattering patterns are consistent with a summation of mode frequencies and displacement eigenvectors associated with the entire phonon spectrum, rather than with a simple, short-range static displacement. A band gap is observed between 600 and 700 cm(-1) with only two modes crossing this region, both associated with antiferroelectric Ti-O motion along a. One of these modes (of Bu symmetry), displays a large LO-TO mode-splitting (562-701.4 cm(-1)) and has a dominant component coming from Ti-O bond-stretching and, thus, the mode-splitting is related to the polarizability of the Ti-O bonds along the chain direction. Similar mode-splitting is observed in piezo- and ferroelectric materials. The calculated phonon dispersion model may be of use to others in future to understand the phase transition at higher temperatures, as well as in the interpretation of measured phonon dispersion curves.

  5. Effect of defect on the nonlinear and dielectric property of Ca(1–x)SrxCu3Ti4O12 ceramics synthesized by sol–gel process

    International Nuclear Information System (INIS)

    Li, Tao; Liu, Dewei; Dai, Haiyang; Xiang, Huiwen; Chen, Zhenping; He, Huifang; Chen, Zhiquan

    2014-01-01

    Highlights: • Ca (1−x) Sr x Cu 3 Ti 4 O 12 ceramics are synthesized by sol–gel process. • Positron annihilation lifetime spectra is used to investigate the defects of samples. • Nonlinear and dielectric properties are controlled by density and defects of samples. - Abstract: Ca (1−x) Sr x Cu 3 Ti 4 O 12 (x = 0, 0.05, 0.1, 0.15, 0.2, 0.3 and 0.4) ceramics are synthesized by sol–gel process. The XRD patterns show that weak peaks of Sr 4 Ti 3 O 10 , TiO 2 and Ca 1.7 Sr 0.3 CuO 3 begin to appear at x ⩾ 0.2. Sr-doping is conductive to increase the density and reduce the defect concentration Ca (1−x) Sr x Cu 3 Ti 4 O 12 ceramics as x ⩽ 0.15. With increasing x (0.2 ⩽ x ⩽ 0.4), Sr-doping reduces the density and enhances the concentration of defects for the ceramics. The nonlinear coefficient value increases and reaches a maximum 13.5 at x = 0.15, and then decreases gradually with increasing x. The dielectric properties demonstrate that, as x ⩽ 0.15, Sr-doping not only increases the dielectric permittivity value and decreases the dielectric loss but also reduces the dependence on frequency at low frequencies. With increasing x (0.2 ⩽ x ⩽ 0.4), Sr-doping begins to lead to an inverse result in dielectric behaviors. The nonlinear and dielectric properties of Ca (1−x) Sr x Cu 3 Ti 4 O 12 ceramics are directly controlled by the density and defects

  6. Dielectric behaviour of (Ba0.77Ca0.23(Ti0.98Dy0.02O3 ceramics

    Directory of Open Access Journals (Sweden)

    Abdul Moquim

    2015-06-01

    Full Text Available In this study, BaTiO3 is modified with Ca2+ and in addition doped with Dy3+ at the B site lattice. The main idea is to search for new lead-free ferroelectric material and improve their properties. For this purpose, the barium calcium titanate (BCT as a host and the rare earth element Dy3+ as an activator were used to fabricate a multifunctional material. The obtained ceramics was found to be homogeneous, dense and a single phase material with no evidence of secondary phases. The dielectric study showed that TC increases with the addition of dopants and the obtained ceramics behaves like a relaxor ferroelectric. Some important structural parameters and dielectric properties of dysprosium modified barium (calcium titanate ceramics are presented.

  7. Interaction of two counterpropagating waves in a Ca:Ga:Bi12TiO20 crystal upon photoinduced absorption of light

    International Nuclear Information System (INIS)

    Mart'yanov, A G; Ageev, E Yu; Shandarov, S M; Mandel', A E; Bochanova, N V; Ivanova, N V; Kargin, Yu F; Volkov, V V; Egorysheva, A V; Shepelevich, V V

    2003-01-01

    It is shown that the interaction of counterpropagating coherent light beams at a wavelength of 633 nm in a Bi 12 TiO 20 :Ca:Ga crystal leads to the formation of a holographic reflection grating, which is a combination of phase and amplitude components related to photoinduced perturbations of the refractive index and absorption coefficient of the crystal. The formation of the grating is accompanied by a photoinduced decrease in the absorption coefficient of light Δα by -0.07 cm -1 . Photoinduced bleaching of the crystal occurs when the crystal is exposed to incoherent radiation at 600 nm (Δα= -0.12 cm -1 ), while an increase in absorption is observed upon irradiation at 570 nm. (nonlinear optical phenomena)

  8. Characterization and study of dielectric and electrical properties of CaBi4Ti4O_1_5 (CBT) added with Bi_2O_3

    International Nuclear Information System (INIS)

    Freitas, D.B.; Campos Filho, M.C.; Sales, J.C.; Silva, P.M.O.; Sombra, A.S.

    2011-01-01

    The ceramic perovskite CaBi_4Ti_4O_1_5 (CBT) of space group A21am, Aurivillius family with deficiency A_5B_4O_1_5 cation has been prepared by solid state method in a planetary ball mill of high energy. The reagents samples were ground and calcined and then added with Bi_2O_3 (2% wt.) This work aims to characterize by X-ray diffraction to study the electrical properties and dielectric properties of (CBT). The x-ray diffraction revealed the formation of single orthorhombic phase. As for the dielectric properties (dielectric constant and dielectric loss) were measured at 30 deg C to 450 deg C, through which can be verified the presence of thermally activated processes. This phase has properties very relevant for possible use in capacitive devices, miniaturized filters, dielectric resonators antennas and oscillators. (author)

  9. Pyrochlore type semiconducting ceramic oxides in Ca-Ce-Ti-M-O system (M = Nb or Ta)-Structure, microstructure and electrical properties

    International Nuclear Information System (INIS)

    Deepa, M.; Prabhakar Rao, P.; Radhakrishnan, A.N.; Sibi, K.S.; Koshy, Peter

    2009-01-01

    A new series of pyrochlore type ceramic semiconducting oxides in Ca-Ce-Ti-M-O (M = Nb or Ta) system has been synthesized by the conventional ceramic route. The electrical conductivity measurements show that these oxides exhibit semiconducting behavior and the conductivity increases with the Ce content in the compound. Activation energy of the current carriers is in the range of 0.5-1.6 eV. The electrical conductivity in these oxides is due to the presence of Ce 3+ , which remains in the reduced state without being oxidized to Ce 4+ by structural stabilization. The photoluminescence and X-ray photoelectron spectroscopy analysis corroborate the presence of Ce in the 3+ state. Impedance spectral analysis is carried out to evaluate the transport properties and indicates that the conduction in these compounds is mainly due to electronic contribution. The X-ray powder diffraction and Raman spectroscopy analysis establishes that these oxides belong to a cubic pyrochlore type structure.

  10. Preparation and dielectric properties of Ba0.95Ca0.05Ti0.8Zr0.2O3-polyethersulfone composites

    International Nuclear Information System (INIS)

    Wang Fajun; Li Wen; Jiang Hongliu; Xue Mingshan; Lu Jinshan; Yao Junping

    2010-01-01

    We report the preparation and dielectric properties of ceramic-polymer composites using Ba 0.95 Ca 0.05 Ti 0.8 Zr 0.2 O 3 (BCTZ) as a ceramic filler and polyethersulfone (PES) as a polymer matrix. The BCTZ powders were synthesized by a sol-gel method to fabricate BCZT-PES composites. The composites with various BCTZ volume fractions were prepared by a solution mixing and hot-pressing method. The composite with 50 vol % BCTZ showed high dielectric constant (ε=48.80) and low loss (tan δ=0.042) at 1 kHz and room temperature. Such excellent dielectric properties of the composites displayed an acceptable stability within a wide range of temperature (from 20 to 150 deg. C) and frequency (from 100 Hz to 100 kHz). The present work indicates that the BCTZ-PES composite can be a candidate for embedded capacitors.

  11. Structural, microstructural, dielectric and ferroelectric properties of lead free Ba0.85Ca0.15Zr0.1Ti0.9O3 ceramic

    Science.gov (United States)

    Sharma, Sarita; Sharma, Hakikat; Negi, N. S.

    2018-05-01

    Lead free Ba0.85Ca0.15Zr0.1Ti0.9O3(BCTZ) ceramic has been synthesized by sol-gel method. Properties of material are studied at different sintering temperatures for 5 hours. Structural and microstructural properties are analyzed by using X-ray diffractrometer (XRD) and scanning electron microscopy (SEM) at annealing temperature of 850°C and 1050°C XRD pattern confirm the perovskite structure of the material without any unwanted phases crystalinity increased with increase of sintering temperature so as roughness and porosity is decreased as shown by SEM micrographs. There is large improvement in density with rise of sintering temperature which also leads to drastic change in ferroelectric and dielectric properties.

  12. Thermally stimulated depolarization currents and dielectric properties of Mg0.95Ca0.05TiO3 filled HDPE composites

    Science.gov (United States)

    Shi, Yunzhou; Zhang, Li; Zhang, Jie; Yue, Zhenxing

    2017-12-01

    Mg0.95Ca0.05TiO3 (MCT) filled high density polyethylene (HDPE) composites were prepared by twin-screw extrusion followed by hot pressing technique. The thermally stimulated depolarization current (TSDC) measurement was performed to analyze the contribution of charge distribution and interfacial characteristics to the dielectric loss. TSDC spectra under different polarization conditions show that the introduction of ceramic fillers engenders shallow traps in the vicinity of ceramic-polymer interface, which hinders the injection of space charge from the electrode into the polymer matrix. In the composite materials applied to an external field, charges tend to be captured by these traps. The temperature dependence of relative permittivity and dielectric loss of the composites was measured, and a strong reliance of dielectric loss on temperature was observed. In the heating process, the release of charges accumulating at interfacial region is considered to contribute to the rise in dielectric loss with the increase of temperature.

  13. Optical potentials and isoscalar transition rates from 104 MeV alpha-particle scattering by the N=28 isotopes 48Ca, 50Ti and 52Cr

    International Nuclear Information System (INIS)

    Friedman, E.; Pesl, R.; Gils, H.J.; Rebel, H.; Buschmann, J.; Klewe-Nebenius, H.; Zagromski, S.

    1983-02-01

    Precisely measured differential cross sections for elastic and inelastic scattering from 104 MeV alpha-particles by 48 Ca, 50 Ti and 52 Cr are reported. The analyses aim primarily at the determination of strength, radial shapes and deformation of the scattering potentials, looking for isotonic differences of N = 28 isotones. The mean square radii of the (real) potentials are discussed in terms of mean square radius differences of the matter distributions. The isoscalar transition rates derived by coupled channel analyses of the measured cross sections are compared with electromagnetic rates. In addition to the analyses on the basis of a slightly generalized extended optical model a semi-microscopic deformed folding model has been applied, using a density-dependent effective alpha-bound nucleon interaction. Though an excellent description of the data over the full angular range is obtained the resulting values of the deformation parameters appear to be not consistent with results from various different methods. (orig.) [de

  14. Thermal activation energies and peak temperatures in thermoluminescence of LiF (Mg, Ti) and CaF2:Mn at low temperatures

    International Nuclear Information System (INIS)

    Jain, V.K.; Jahan, M.S.

    1987-01-01

    Low temperature thermoluminescence (TL) of LiF (TLD-100) and CaF 2 :Mn is studied. The TLD-100 is dosimetry grade LiF manufactured by Harshaw-Filtrol Partnership. It is believed that it contains about 200 ppm Mg and 7 ppm Ti as impurities. In each case the glow curve shows several peaks. Some of these peaks are quite strong and develop with dose. Others are weak. Kinetic parameters are calculated for the former using the initial rise method and Chen's modified formula. The two sets of values are found to be different. Some authors have suggested empirical formulae connecting peak temperature, T m , and activation energy, E. The empirical relations are tried for the values of E calculated, as well as those available in literature (for T m above room temperature). It is found that a fairly reasonable relation existed between E and T m . (author)

  15. Synthesis, morphological, electromechanical characterization of (CaMgFex)Fe1-xTi3O12-δ/PDMS nanocomposite thin films for energy storage application

    Science.gov (United States)

    Tripathy, Ashis; Sharma, Priyaranjan; Sahoo, Narayan

    2018-03-01

    At the present time, flexible and stretchable electronics has intended to use the new cutting-edge technologies for advanced electronic application. Currently, Polymers are being employed for such applications but they are not effective due to their low dielectric constant. To enhance the dielectric properties of polymer for energy storage application, it is necessary to add ceramic material of high dielectric constant to synthesize a polymer-ceramic composite. Therefore, a novel attempt has been made to enhance the dielectric properties of the Polydimethylsiloxane (PDMS) polymer by adding (CaMgFex)Fe1-xTi3O12-δ(0ceramic powder. The newly developed CMFTO2/PDMS composite based thin film shows a higher dielectric constant (ε‧) value (~350), extremely low tangent loss (tanδ) ( 90%), which can make it a potential material for advanced flexible electronic devices, energy storage and biomedical applications.

  16. Observation of indium ion migration-induced resistive switching in Al/Mg_0_._5Ca_0_._5TiO_3/ITO

    International Nuclear Information System (INIS)

    Lin, Zong-Han; Wang, Yeong-Her

    2016-01-01

    Understanding switching mechanisms is very important for resistive random access memory (RRAM) applications. This letter reports an investigation of Al/Mg_0_._5Ca_0_._5TiO_3 (MCTO)/ITO RRAM, which exhibits bipolar resistive switching behavior. The filaments that connect Al electrodes with indium tin oxide electrodes across the MCTO layer at a low-resistance state are identified. The filaments composed of In_2O_3 crystals are observed through energy-dispersive X-ray spectroscopy, high-resolution transmission electron microscopy, nanobeam diffraction, and comparisons of Joint Committee on Powder Diffraction Standards (JCPDS) cards. Finally, a switching mechanism resulting from an electrical field induced by In"3"+ ion migration is proposed. In"3"+ ion migration forms/ruptures the conductive filaments and sets/resets the RRAM device.

  17. Role of doping and CuO segregation in improving the giant permittivity of CaCu3Ti4O12

    International Nuclear Information System (INIS)

    Capsoni, D.; Bini, M.; Massarotti, V.; Chiodelli, G.; Mozzatic, M.C.; Azzoni, C.B.

    2004-01-01

    The dopant role on the electric and dielectric properties of the perovskite-type CaCu 3 Ti 4 O 12 (CCTO) compound is evidenced. Impedance spectroscopy measurements show that the relevant permittivity value attributed to sintered CCTO is due to grain boundary (g.b.) effects. The g.b. permittivity value of the pure CCTO can be increased of 1-2 orders of magnitude by cation substitution on Ti site and/or segregation of CuO phase, while the bulk permittivity keeps values 90εr180. Bulk and g.b. conductivity contributions are discussed: electrons are responsible for the charge transport and a mean bulk activation energy of 0.07eV is obtained at room temperature for all the examined samples. The g.b. activation energy ranges between 0.54 and 0.76eV. Defect models related to the transport properties are proposed, supported by electron paramagnetic resonance measurements

  18. Exceptionally High Piezoelectric Coefficient and Low Strain Hysteresis in Grain-Oriented (Ba, Ca)(Ti, Zr)O3 through Integrating Crystallographic Texture and Domain Engineering.

    Science.gov (United States)

    Liu, Yingchun; Chang, Yunfei; Li, Fei; Yang, Bin; Sun, Yuan; Wu, Jie; Zhang, Shantao; Wang, Ruixue; Cao, Wenwu

    2017-09-06

    Both low strain hysteresis and high piezoelectric performance are required for practical applications in precisely controlled piezoelectric devices and systems. Unfortunately, enhanced piezoelectric properties were usually obtained with the presence of a large strain hysteresis in BaTiO 3 (BT)-based piezoceramics. In this work, we propose to integrate crystallographic texturing and domain engineering strategies into BT-based ceramics to resolve this challenge. [001] c grain-oriented (Ba 0.94 Ca 0.06 )(Ti 0.95 Zr 0.05 )O 3 (BCTZ) ceramics with a texture degree as high as 98.6% were synthesized by templated grain growth. A very high piezoelectric coefficient (d 33 ) of 755 pC/N, and an extremely large piezoelectric strain coefficient (d 33 * = 2027 pm/V) along with an ultralow strain hysteresis (H s ) of 4.1% were simultaneously achieved in BT-based systems for the first time, which are among the best values ever reported on both lead-free and lead-based piezoceramics. The exceptionally high piezoelectric response is mainly from the reversible contribution, and can be ascribed to the piezoelectric anisotropy, the favorable domain configuration, and the formation of smaller sized domains in the BCTZ textured ceramics. This study paves a new pathway to develop lead-free piezoelectrics with both low strain hysteresis and high piezoelectric coefficient. More importantly, it represents a very exciting discovery with potential application of BT-based ceramics in high-precision piezoelectric actuators.

  19. Control of retention and fatigue-free characteristics in CaBi4Ti4O15 thin films prepared by chemical method

    International Nuclear Information System (INIS)

    Simoes, A.Z.; Ramirez, M.A.; Gonzalez, A.H.M.; Riccardi, C.S.; Ries, A.; Longo, E.; Varela, J.A.

    2006-01-01

    Ferroelectric CaBi 4 Ti 4 O 15 (CBTi144) thin films were deposited on Pt/Ti/SiO 2 /Si substrates by the polymeric precursor method. The films present a single phase of layered-structured perovskite with polar axis orientation after annealing at 700 deg. C for 2 h in static air and oxygen atmosphere. The a/b-axis orientation of the ferroelectric film is considered to be associated with the preferred orientation of the Pt bottom electrode. It is noted that the films annealed in static air showed good polarization fatigue characteristics at least up to 10 10 bipolar pulse cycles and excellent retention properties up to 10 4 s. On the other hand, oxygen atmosphere seems to be crucial in the decrease of both, fatigue and retention characteristics of the capacitors. Independently of the applied electric field, the retained switchable polarization approached a nearly steady-state value after a retention time of 10 s. - Graphical abstract: Fatigue of CBTi144 thin film obtained by polymeric precursor method

  20. Research on sintering behavior and microwave dielectric property of (Mg0.95Ca0.05)TiO3 ceramics for cross coupling filter

    Science.gov (United States)

    Luo, Chunya; Ma, Zhichao; Hu, Laisheng; Hu, Mingzhe; Huang, Xiaomin

    2015-12-01

    The microwave dielectric properties of 0.95%MgTiO3-0.05%CaTiO3 (abbreviated as 95MCT hereafter) ceramics have been studied for application in dielectric cross coupling filters. ZnO and Nb2O5 were selected as liquid sintering aids to lower the sintering temperature and enhance the Qf value of 95MCT and simultaneously we varied the mole ratio of ZnO : Nb2O5 to tune the microwave dielectric properties of 95MCT. When the ZnO : Nb2O5 mole ratio was 1.5 and the co-doping content was 0.25 wt.%, the optimal sintering temperature of 95MCT ceramic could be lowered from 1400∘C to 1320∘C and the Qf value could be improved by about 7.7%. The optimal microwave dielectric properties obtained under this condition were Qf = 72730 GHz (6.8 GHz), ɛr = 20.29 and τf = -6.84ppm/∘C, which demonstrated great potential usage in ceramic industry. High values of Qf ceramic were used to design the dielectric cross coupling filter. The dielectric filter measured at 2.35 GHz exhibited a 6.7% bandwidth (insert loss > -3 dB) of center frequency.

  1. Dielectric properties of Ca(Zr0.05Ti0.95)O3 thin films prepared by chemical solution deposition

    International Nuclear Information System (INIS)

    Cavalcante, L.S.; Simoes, A.Z.; Santos, L.P.S.; Santos, M.R.M.C.; Longo, E.; Varela, J.A.

    2006-01-01

    Ca(Zr 0.05 Ti 0.95 )O 3 (CZT) thin films were grown on Pt(111)/Ti/SiO 2 /Si(100) substrates by the soft chemical method. The films were deposited from spin-coating technique and annealed at 928K for 4h under oxygen atmosphere. CZT films present orthorhombic structure with a crack free and granular microstructure. Atomic force microscopy and field-emission scanning electron microscopy showed that CZT present grains with about 47nm and thickness about 450nm. Dielectric constant and dielectric loss of the films was approximately 210 at 100kHz and 0.032 at 1MHz. The Au/CZT/Pt capacitor shows a hysteresis loop with remnant polarization of 2.5μC/cm 2 , and coercive field of 18kV/cm, at an applied voltage of 6V. The leakage current density was about 4.6x10 -8 A/cm 2 at 3V. Dielectric constant-voltage curve is located at zero bias field suggesting the absence of internal electric fields

  2. A miniaturized Microwave Bandpass Filter Based on Modified (Mg0.95Ca0.05TiO3 Substrate

    Directory of Open Access Journals (Sweden)

    Hu Mingzhe

    2016-01-01

    Full Text Available A microwave miniaturized bandpass filter using (Mg0.95Ca0.05TiO3 (abbreviated as 95MCT hereafter ceramic substrate is investigated in the present paper. The paper studies the sintering and microwave dielectric properties of Al2O3, La2O3 and SiO2 co-doped 95MCT. The XRD pattern shows that a secondary phase MgTi2O5 is easily segregated in 95MCT ceramic, however, through co-doping it can be effectively suppressed, and the microwave dielectric properties, especially, the Qf value can be significantly improved. Through optimizing the co-doping ratio of Al2O3, La2O3 and SiO2, the sintering temperature of 95MCT ceramic can be lowered by 80°C, and the microwave dielectric properties can reach Qf=61856GHz and εr=19.84, which indicates the modified 95MCT ceramic have a great potential application in microwave communication devices. Based on this, we also designed a miniaturized microwave bandpass filter (BPF on modified 95MCT substrate. Through a full wave electromagnetic structure simulation, the results show that the center frequency of the BPF is 2.45GHz and the relative bandwidth is 4.09% with the insertion loss of less than 0.2dB in the whole bandpass.

  3. In situ transmission electron microscopy studies of microstructure evolution in Ba(Zr0.2Ti0.8)O3-x(Ba0.7Ca0.3)TiO3 piezoceramic

    International Nuclear Information System (INIS)

    Zakhozheva, Marina

    2016-01-01

    The purpose of this work is to understand the microstructural features which contribute to the strong electromechanical properties of the lead-free Ba (Zr 0.2 Ti 0.8 )O 3 -x(Ba 0.7 Ca 0.3 )TiO 3 (BZT-xBCT) piezoelectric ceramic. Detailed conventional transmission electron microscopy (TEM) studies on a broad variety of BZT - xBCT were performed in order to demonstrate the composition dependent structural changes. Moreover, several in situ TEM techniques, including in situ hot- and cold-stage, in situ electric field and in situ electric field with simultaneous cooling, were successfully applied in order to monitor the domain morphology evolution in real time. By means of in situ temperature dependent TEM experiments it was shown that during rhombohedral → orthorhombic → tetragonal phase transition the domain morphology changed according to the crystal structure present. During in situ electric field investigations the displacement of the domain walls and changes in the domain configuration during electrical poling were observed, which indicates a high extrinsic contribution to the piezoelectric response in all BZT - xBCT compositions studied. From the results of in situ electric field TEM experiments with simultaneous cooling, we obtained experimental evidence that the further the composition deviates from the polymorphic phase boundary, the higher the electric field required to fully pole the material.

  4. Significant increase of Curie temperature and large piezoelectric coefficient in Ba(Ti0.80Zr0.20)O3-0.5(Ba0.70Ca0.30)TiO3 nanofibers

    Science.gov (United States)

    Fu, Bi; Yang, Yaodong; Gao, Kun; Wang, Yaping

    2015-07-01

    Ba(Ti0.80Zr0.20)O3-0.5(Ba0.7Ca0.3)TiO3 (abbreviated as BTZ-0.5BCT) is a piezoelectric ceramic with a high piezoelectric coefficient d33 (˜620 pC N-1) and has been regarded as one of the most promising candidates to replace PZT-based materials (200-710 pC N-1). However, its Curie temperature TC is relatively low (93 °C) limiting its application. In this letter, we found a temperature dependent Raman spectrum in BTZ-0.5BCT nanofibers (NFs), demonstrating a diffused tetragonal-to-cubic phase transition at 300 °C. This means that the TC of the NFs is nearly 207 °C higher than that of the normal bulk material. The increased TC is considered to be associated with the size effect of BTZ-0.5BCT nanoceramic subunits and the nanoporous nature of the fiber, resulting in discontinuous physical properties. The variation of the ferro/piezoelectricity over the fiber surface is attributed to the polycrystalline structure. The d33 (173.32 pm V-1) is improved in terms of the decreased Q factor result in an increase in d33 of 236.54 pm V-1 after polarization. With a high TC and a very large d33, BTZ-0.5BCT NFs are capable of providing electromechanical behavior used in moderate temperatures.

  5. Investigation of structural, ferroelectric, piezoelectric and dielectric properties of Ba0.92Ca0.08TiO3-BaTi0.96Zr0.04O3 lead-free electroceramics

    Science.gov (United States)

    Keswani, Bhavna C.; Patil, S. I.; Kolekar, Y. D.

    2018-04-01

    Lead free ferroelectric with composition 0.55Ba0.92Ca0.08TiO3-0.45BaTi0.96Zr0.04O3 (BCT8-BZT4) was synthesized by solid state reaction method and investigated their structural, ferroelectric, piezoelectric and dielectric properties. X-ray diffraction analysis shows that BCT8-BZT4 ceramic possess both tetragonal (space group P4mm) and orthorhombic (space group Amm2) crystal structure which was further confirmed from Raman spectra spectroscopy. The micronized grains were observed from scanning electron micrographs while the presence of polarization-electric field hysteresis loop confirms ferroelectric nature of BCT8-BZT4 ceramic. Higher values of maximum polarization (Pmax = 22.27 μC/cm2), remnant polarization (Pr = 11.61 μC/cm2), coercive electric field (Ec = 4.77 kV/cm) and direct piezoelectric coefficient (d33) approximately 185 pC/N were observed. The real part of dielectric constant with frequency shows the usual dielectric dispersion behaviour at RT. The observed properties show that the lead free BCT8-BZT4 ceramic is suitable for ferroelectric memory device, piezoelectric sensor, capacitor, etc. applications.

  6. A brief review of Ba(Ti0.8Zr0.2)O3-(Ba0.7Ca0.3)TiO3 based lead-free piezoelectric ceramics: Past, present and future perspectives

    Science.gov (United States)

    Zhang, Yong; Sun, Huajun; Chen, Wen

    2018-03-01

    As one kind of most crucial and emerging lead-free piezoelectric systems, Ba(Ti0.8Zr0.2)O3-(Ba0.7Ca0.3)TiO3 (BCZT) based lead-free piezoceramics have attracted worldwide attention in recent years. Much progress has been made, however, a summary which covers both the recent progress and the remained problems is urgently needed to further push this field forward. In this review, a brief background of the development of BCZT based lead-free piezoceramics was illustrated firstly. Then, the internal mechanism for the high piezoelectric response would be elaborated. Current research status was discussed in detail in the third section. Various strategies including: (1) Using distinct synthesis routes, (2) adopting different sintering techniques, (3) doping with foreign ions and/or second components, (4) grain size control, were exploited to improve the comprehensive performance and in turn broaden their application areas. In this part, some recently representative works were touched in detail and several existing problems were pointed out. Last, some critical comments (some thoughts related to the potential and future development of BCZT system) were given based on the current research status and existing problems. All in all, this review is devoted to summarizing the milestones in the past, classifying selected recent works and analyzing the prospects of BCZT based ceramics. It can be expected that, this first review that concentrates on BCZT based ceramics obviously would provide useful guidance for the research community.

  7. Raman spectra of the solid-solution between Rb sub 2 La sub 2 Ti sub 3 O sub 1 sub 0 and RbCa sub 2 Nb sub 3 O sub 1 sub 0

    CERN Document Server

    Kim, H J; Yun, H S

    2001-01-01

    A site preference of niobium atom in Rb sub 2 sub - sub x La sub 2 Ti sub 3 sub - sub x Nb sub x O sub 1 sub 0 (0.0<=x<=1.0) and RbLa sub 2 sub - sub x Ca sub x Ti sub 2 sub - sub x Nb sub 1 sub + sub x O sub 1 sub 0 (0.0<=x<= 2.0), which are the solid-solutions between Rb sub 2 La sub 2 Ti sub 3 O sub 1 sub 0 are RbCa sub 2 Nb sub 3 O sub 1 sub 0 , has been investigated by Raman spectroscopy. The Raman spectra of Rb sub 2 sub - sub x La sub 2 Ti sub 3 sub - sub x Nb sub x O sub 1 sub 0 (0.0<=x<=1.0) gave an evidence that niobium atoms substituted for titanium atoms preferably occupy the highly distorted outer octahedral sites rather than the central ones in triple-octahedral perovskite layers. In contrast, the Raman spectra of RbLa sub 2 sub - sub x Ca sub x Ti sub 2 sub - sub x Nb sub 1 sub + sub x O sub 1 sub 0 (0.0<=x<= 2.0) showed no clear information for the cationic arrangement in perovskite slabs. This difference indicated that a site preference of niobium atoms is observed onl...

  8. Temperature compensation effects of TiO2 on Ca[(Li1/3Nb2/3)0.8Sn0.2]O3-δ microwave dielectric ceramic

    Science.gov (United States)

    Hu, Mingzhe; Wei, Huanghe; Xiao, Lihua; Zhang, Kesheng; Hao, Yongde

    2017-10-01

    The crystal structure and dielectric properties of TiO2-modified Ca[(Li1/3Nb2/3)0.8Sn0.2]O3-δ microwave ceramics are investigated in the present paper. The crystal structure is probed by XRD patterns and their Rietveld refinement, results show that a single perovskite phase is formed in TiO2-modified Ca[(Li1/3Nb2/3)0.8Sn0.2]O3-δ ceramics with the crystal structure belonging to the orthorhombic Pbnm 62 space group. Raman spectra results indicate that the B-site order-disorder structure transition is a key point to the dielectric loss of TiO2-modified Ca[(Li1/3Nb2/3)0.8Sn0.2]O3-δ ceramics at microwave frequencies. After properly modified by TiO2, the large negative temperature coefficient of Ca[(Li1/3Nb2/3)0.8Sn0.2]O3-δ ceramic can be compensated and the optimal microwave dielectric properties can reach 𝜀r = 25.66, Qf = 18,894 GHz and TCF = -6.3 ppm/∘C when sintered at 1170∘C for 2.5 h, which manifests itself for potential use in microwave dielectric devices for modern wireless communication.

  9. Management of the pig iron Si and slag CaO/SiO2 technological indicators in order to produce pig iron with a titanium content below 0,02 %Ti

    Directory of Open Access Journals (Sweden)

    C. Kolmasiak

    2014-10-01

    Full Text Available The article present the developed method for production of pig iron with a very low titanium content of Ti 2 basicity, to obtain pig iron with a [Ti] content below 0,02 %. Based on the data from the preliminary test, proper tests were carried out with a pig iron Si content in the range from 1,0 % to 1,6 % and a slag CaO/SiO2 basicity in the range from 0,96 to 1,10. Data obtained from those tests enabled a statistical model to be established in the form of regression planes of two independent variables, [Si] and (CaO/SiO2. The regression equation of the first degree, [Ti] = f[(Si, (CaO/SiO2], defined the plane that gave the process engineer the answer to the question of how to manage the [Si] and (CaO/SiO2 indicators so as to obtain pig iron with the desired [Ti] content below 0,02 %.

  10. Structural and luminescence properties of CaTiO{sub 3}:Eu{sup 3+} phosphor synthesized by chemical co-precipitation method for the application of solid state lighting devices

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Dhananjay Kumar, E-mail: dksism89@gmail.com; Manam, J., E-mail: jairam.manam@gmail.com [Department of Applied Physics, Indian School of Mines, Dhanbad-826004 (India)

    2016-05-06

    The present work report a series of trivalent Europium (Eu{sup 3+}) doped well crystallized perovskite CaTiO{sub 3} phosphors successfully synthesized by chemical co-precipitation method. The crystal structure was confirmed by X-ray diffraction (XRD) which is in good agreement with pure orthorhombic phase with space group Pbnm, and it also indicated that the incorporation of the dopant did not affect the crystal structure. The impact of doping on the photoluminescence performances of the sample has been investigated by emission, excitation, and diffuse reflectance spectra at the room temperature. Photoluminescence spectra of Eu{sup 3+} doped CaTiO{sub 3} nanophosphor revealed the characteristic emission peak around wavelength 618 nm in the visible region upon the excitation of near-UV light at wavelength 397 nm due to {sup 5}D{sub 0} → {sup 7}F{sub 2} transition in Eu{sup 3+}. It was further proved that the dipole– dipole interactions results in the concentration quenching of Eu{sup 3+} in CaTiO{sub 3}:Eu{sup 3+} nanophosphors. The elemental composition of sample carried out by energy dispersive spectroscopy (EDS). EDS analysis reveals that the Eu{sup 3+} doped successfully into host CaTiO{sub 3}. The experimental result reveals that prepared nanophosphor can be used in the application of solid state lighting devices.

  11. CaMn0.875Ti0.125O3 as oxygen carrier for chemical-looping combustion with oxygen uncoupling (CLOU)—Experiments in a continuously operating fluidized-bed reactor system

    KAUST Repository

    Rydé n, Magnus; Lyngfelt, Anders; Mattisson, Tobias

    2011-01-01

    Particles of the perovskite material CaMn0.875Ti0.125O3 has been examined as oxygen carrier for chemical-looping with oxygen uncoupling, and for chemical-looping combustion of natural gas, by 70h of experiments in a circulating fluidized-bed reactor

  12. Proteomic Profiling of Hematopoietic Stem/Progenitor Cells after a Whole Body Exposure of CBA/CaJ Mice to Titanium (48Ti Ions

    Directory of Open Access Journals (Sweden)

    Kanokporn Noy Rithidech

    2015-07-01

    Full Text Available Myeloid leukemia (ML is one of the major health concerns from exposure to radiation. However, the risk assessment for developing ML after exposure to space radiation remains uncertain. To reduce the uncertainty in risk prediction for ML, a much increased understanding of space radiation-induced changes in the target cells, i.e., hematopoietic stem/progenitor cells (HSPCs, is critically important. We used the label-free quantitative mass spectrometry (LFQMS proteomic approach to determine the expression of protein in HSPC-derived myeloid colonies obtained at an early time-point (one week and a late time-point (six months after an acute whole body exposure of CBA/CaJ mice to a total dose of 0, 0.1, 0.25, or 0.5 Gy of heavy-ion titanium (48Ti ions, which are the important component of radiation found in the space environment. Mice exposed to 0 Gy of 48Ti ions served as non-irradiated sham controls. There were five mice per treatment groups at each harvest time. The Trans-Proteomic Pipeline (TPP was used to assign a probability of a particular protein being in the sample. A proof-of-concept based Ingenuity Pathway Analysis (IPA was used to characterize the functions, pathways, and networks of the identified proteins. Alterations of expression levels of proteins detected in samples collected at one week (wk post-irradiation reflects acute effects of exposure to 48Ti ions, while those detected in samples collected at six months (mos post-irradiation represent protein expression profiles involved in the induction of late-occurring damage (normally referred to as genomic instability. Our results obtained by using the IPA analyses indicate a wide array of signaling pathways involved in response to 1 GeV/n 48Ti ions at both harvest times. Our data also demonstrate that the patterns of protein expression profiles are dose and time dependent. The majority of proteins with altered expression levels are involved in cell cycle control, cellular growth and

  13. Effect of nanoporous TiO2 coating and anodized Ca2+ modification of titanium surfaces on early microbial biofilm formation

    Directory of Open Access Journals (Sweden)

    Wennerberg Ann

    2011-03-01

    Full Text Available Abstract Background The soft tissue around dental implants forms a barrier between the oral environment and the peri-implant bone and a crucial factor for long-term success of therapy is development of a good abutment/soft-tissue seal. Sol-gel derived nanoporous TiO2 coatings have been shown to enhance soft-tissue attachment but their effect on adhesion and biofilm formation by oral bacteria is unknown. Methods We have investigated how the properties of surfaces that may be used on abutments: turned titanium, sol-gel nanoporous TiO2 coated surfaces and anodized Ca2+ modified surfaces, affect biofilm formation by two early colonizers of the oral cavity: Streptococcus sanguinis and Actinomyces naeslundii. The bacteria were detected using 16S rRNA fluorescence in situ hybridization together with confocal laser scanning microscopy. Results Interferometry and atomic force microscopy revealed all the surfaces to be smooth (Sa ≤ 0.22 μm. Incubation with a consortium of S. sanguinis and A. naeslundii showed no differences in adhesion between the surfaces over 2 hours. After 14 hours, the level of biofilm growth was low and again, no differences between the surfaces were seen. The presence of saliva increased the biofilm biovolume of S. sanguinis and A. naeslundii ten-fold compared to when saliva was absent and this was due to increased adhesion rather than biofilm growth. Conclusions Nano-topographical modification of smooth titanium surfaces had no effect on adhesion or early biofilm formation by S. sanguinis and A. naeslundii as compared to turned surfaces or those treated with anodic oxidation in the presence of Ca2+. The presence of saliva led to a significantly greater biofilm biovolume but no significant differences were seen between the test surfaces. These data thus suggest that modification with sol-gel derived nanoporous TiO2, which has been shown to improve osseointegration and soft-tissue healing in vivo, does not cause greater biofilm

  14. Low sintering temperature and high piezoelectric properties of Li-doped (Ba,Ca)(Ti,Zr)O{sub 3} lead-free ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Xiaoming [Key Laboratory of Inorganic Functional Materials and Devices, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai 200050 (China); University of Chinese Academy of Sciences, Beijing 100039 (China); School of Materials Science and Engineering, East China University of Science and Technology, Shanghai 200237 (China); Ruan, Xuezheng; Zhao, Kunyun [Key Laboratory of Inorganic Functional Materials and Devices, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai 200050 (China); He, Xueqing [School of Materials and Metallurgy, Northeastern University, Shenyang 110004 (China); Zeng, Jiangtao, E-mail: zjt@mail.sic.ac.cn [Key Laboratory of Inorganic Functional Materials and Devices, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai 200050 (China); Li, Yongsheng [School of Materials Science and Engineering, East China University of Science and Technology, Shanghai 200237 (China); Zheng, Liaoying [Key Laboratory of Inorganic Functional Materials and Devices, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai 200050 (China); Park, Chul Hong [Department of Physics Education, Pusan National University, Pusan 609735 (Korea, Republic of); Li, Guorong [Key Laboratory of Inorganic Functional Materials and Devices, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai 200050 (China)

    2015-05-25

    Highlights: • Li-doped Ba{sub 0.85}Ca{sub 0.15}Ti{sub 0.9}Zr{sub 0.1}O{sub 3} (BCZT) lead-free piezoceramics were prepared by the two-step synthesis and solid-state reaction method. • Their sintering temperature decreases from about 1540 °C down to about 1400 °C. • With the proper addition of Li, the densities and grain sizes of ceramics increase. • The ceramics not only have the characteristics of hard piezoceramics but also possesses the features of soft piezoceramics at low sintering temperature. - Abstract: Li-doped Ba{sub 0.85}Ca{sub 0.15}Ti{sub 0.9}Zr{sub 0.1}O{sub 3} (BCZT) lead-free piezoelectric ceramics were prepared by the two-step synthesis and the solid-state reaction method. The density and grain size of ceramics sufficiently increases by Li-doped sintering aid, and their sintering temperature decreases from about 1540 °C down to about 1400 °C. X-ray diffraction reveals that the phase structure of Li-doped BCTZ ceramics is changed with the sintering temperature, which is consistent with their phase transition observed by the temperature-dependent dielectric curves. The well-poled Li-doped BCZT ceramics show a high piezoelectric constant d{sub 33} (512 pC/N) and a planar electromechanical coupling factor k{sub p} (0.49), which have the characteristics of soft Pb(Zr,Ti)O{sub 3} (PZT) piezoceramic, on the other hand, the mechanical quality factor Q{sub m} is about 190, which possesses the features of hard PZT piezoceramics. The enhanced properties of the Li-doped BCZT are explained by the combination of Li-doped effect and sintering effect on the microstructure and the phase transition around room temperature.

  15. Unexpected metal-insulator transition in thick Ca1-xSrxVO3 film on SrTiO3 (100) single crystal

    Science.gov (United States)

    Takayanagi, Makoto; Tsuchiya, Takashi; Namiki, Wataru; Ueda, Shigenori; Minohara, Makoto; Horiba, Koji; Kumigashira, Hiroshi; Terabe, Kazuya; Higuchi, Tohru

    2018-03-01

    Epitaxial Ca1-xSrxVO3 (0 ≦ x ≦ 1) thin films were grown on (100)-oriented SrTiO3 substrates by using the pulsed laser deposition technique. In contrast to the previous report that metal-insulator transition (MIT) in Ca1-xSrxVO3 (CSVO) was achieved only for extremely thin films (several nm thick), MIT was observed at 39, 72, and 113 K for films with a thickness of 50 nm. The electronic structure was investigated by hard and soft X-ray photoemission spectroscopy (HX-PES and SX-PES). The difference between these PES results was significant due to the variation in an escape depth of photoelectrons of PES. While HX-PES showed that the V 2p3/2 spectra consisted of four peaks (V5+, V4+, V3+, and V2+/1+), SX-PES showed only three peaks (V5+, V4+, and V3+). This difference can be caused by a strain from the substrate, which leads to the chemical disorder (V5+, V4+, V3+, and V2+/1+). The thin film near the substrate is affected by the strain. The positive magnetoresistance is attributed to the effect of electron-electron interactions in the disorder system. Therefore, the emergence of MIT can be explained by the electron-electron interactions from the chemical disorder due to the strain.

  16. A percepção dos gestores operacionais sobre os impactos gerados nos processos de trabalho após a implementação das melhores práticas de governança de TI no TRE/SC

    Directory of Open Access Journals (Sweden)

    Rosangela Klumb

    2014-08-01

    Full Text Available Este estudo objetivou compreender a percepção dos gestores operacionais da Secretaria de Tecnologia da Informação (STI do TRE/SC acerca dos impactos gerados nos processos de trabalho internos do órgão após a implementação das melhores práticas de governança de TI. Em termos metodológicos, trata-se de um estudo de caso descritivo-avaliativo, de abordagem qualitativa no que concerne às características e ao modo de investigação. Como resultados, verificou-se que até março de 2013 foram implementados oito dos 24 processos de governança de TI baseados no modelo Cobit, versão 4.1, definidos como meta do Planejamento Estratégico de TI para 2013. Concluiu-se que a percepção dos gestores é positiva em relação à governança de TI, embora existam algumas falhas, como na comunicação intra e interáreas e na centralização de informações por alguns setores.

  17. Investigating the addition of SiO₂-CaO-ZnO-Na₂O-TiO₂ bioactive glass to hydroxyapatite: Characterization, mechanical properties and bioactivity.

    Science.gov (United States)

    Yatongchai, Chokchai; Placek, Lana M; Curran, Declan J; Towler, Mark R; Wren, Anthony W

    2015-11-01

    Hydroxyapatite (Ca10(PO4)6(OH)2) is widely investigated as an implantable material for hard tissue restoration due to its osteoconductive properties. However, hydroxyapatite in bulk form is limited as its mechanical properties are insufficient for load-bearing orthopedic applications. Attempts have been made to improve the mechanical properties of hydroxyapatite, by incorporating ceramic fillers, but the resultant composite materials require high sintering temperatures to facilitate densification, leading to the decomposition of hydroxyapatite into tricalcium phosphate, tetra-calcium phosphate and CaO phases. One method of improving the properties of hydroxyapatite is to incorporate bioactive glass particles as a second phase. These typically have lower softening points which could possibly facilitate sintering at lower temperatures. In this work, a bioactive glass (SiO2-CaO-ZnO-Na2O-TiO2) is incorporated (10, 20 and 30 wt%) into hydroxyapatite as a reinforcing phase. X-ray diffraction confirmed that no additional phases (other than hydroxyapatite) were formed at a sintering temperature of 560 ℃ with up to 30 wt% glass addition. The addition of the glass phase increased the % crystallinity and the relative density of the composites. The biaxial flexural strength increased to 36 MPa with glass addition, and there was no significant change in hardness as a function of maturation. The pH of the incubation media increased to pH 10 or 11 through glass addition, and ion release profiles determined that Si, Na and P were released from the composites. Calcium phosphate precipitation was encouraged in simulated body fluid with the incorporation of the bioactive glass phase, and cell culture testing in MC-3T3 osteoblasts determined that the composite materials did not significantly reduce cell viability. © The Author(s) 2015.

  18. Structural and thermal characterization of La5Ca9Cu24O41 thin films grown by pulsed laser deposition on (1 1 0) SrTiO3 substrates

    International Nuclear Information System (INIS)

    Svoukis, E.; Athanasopoulos, G.I.; Altantzis, Th.; Lioutas, Ch.; Martin, R.S.; Revcolevschi, A.; Giapintzakis, J.

    2012-01-01

    In the present study stoichiometric, b-axis oriented La 5 Ca 9 Cu 24 O 41 thin films were grown by pulsed laser deposition on (1 1 0) SrTiO 3 substrates in the temperature range 600–750 °C. High resolution transmission electron microscopy was employed to investigate the growth mechanism and the epitaxial relationship between the SrTiO 3 substrates and the La 5 Ca 9 Cu 24 O 41 films grown at 700 °C. The 3-ω method was used to measure the cross-plane thermal conductivity of La 5 Ca 9 Cu 24 O 41 films in the temperature range 50–350 K. The observed glass-like behavior is attributed to atomic-scale defects, grain boundaries and an interfacial layer formed between film and substrate.

  19. Assessment of CaSO{sub 4}:Dy and LiF:Mg,Ti thermoluminescent dosimeters performance in the dosimetry of clinical electron beams; Avaliacao do desempenho dos detectores termoluminesncetes de CaSO{sub 4}:Dy e LiF:Mg,Ti na dosimetria de feixes clinicos de eletrons

    Energy Technology Data Exchange (ETDEWEB)

    Nunes, Maira Goes

    2008-07-01

    The assessment of the performance of CaS0{sub 4}:Dy thermoluminescent detectors produced by IPEN in the dosimetry of clinical electron beams aims to propose an alternative to the LiF:Mg,Ti commercial dosimeters (TLD-100) largely applied in radiation therapy. The two types of thermoluminescent dosimeters were characterised with the use of PMMA, RMI-457 type solid water and water phantoms in radiation fields of 4, 6, 9, 12 and 16 MeV electrons of nominal energies in which the dose-response curves were obtained and the surface and depth doses were determined. The thermoluminescent response dependency with the electron nominal energies and the applied phantom were studied. The CaS0{sub 4}:Dy presented the same behaviour than the LiF:Mg,Ti in such a way that its application as an alternative to the TLD-100 pellets in the radiation therapy dosimetry of electron beams is viable and presents the significantly higher sensitivity to the electron radiation as its main advantage. (author)

  20. DiSC-OPAL

    DEFF Research Database (Denmark)

    Kemal, Mohammed Seifu; Pedersen, Rasmus; Iov, Florin

    2017-01-01

    of such systems. The simulation tool should be able to model Electrical Grid and flexible assets with different time scales and resolution levels fulfilling specific functionalities. In this paper DiSC-OPAL, an OPAL-RT compatible toolbox library for modelling of assets is presented. The library is suitable...

  1. SC tuning fork

    CERN Document Server

    The tuning fork used to modulate the radiofrequency system of the synchro cyclotron (SC) from 1957 to 1973. This piece is an unused spare part. The SC was the 1st accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990. In the SC the magnetic field did not change with time, and the particles were accelerated in successive pulses by a radiofrequency voltage of some 20kV which varied in frequency as they spiraled outwards towards the extraction radius. The frequency varied from 30MHz to about 17Mz in each pulse. The tuning fork vibrated at 55MHz in vacuum in an enclosure which formed a variable capacitor in the tuning circuit of the RF system, allowing the RF to vary over the appropriate range to accelerate protons from the centre of the macine up to 600Mev at extraction radius. In operation the tips of the tuning fork blade had an amplitude of movement of over 1 cm. The SC accelerator underwent extensive improvements from 1973 to 1975, including the installation of a...

  2. Cyclotron production of {sup 43}Sc for PET imaging

    Energy Technology Data Exchange (ETDEWEB)

    Walczak, Rafał [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Krajewski, Seweryn [Synektik S.A., Research and Development Center, Warsaw (Poland); Szkliniarz, Katarzyna [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Sitarz, Mateusz [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Abbas, Kamel [Nuclear Security Unit, Joint Research Centre, Institute for Transuranium Elements, European Commission, Ispra (Italy); Choiński, Jarosław; Jakubowski, Andrzej; Jastrzębski, Jerzy [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Majkowska, Agnieszka [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland); Simonelli, Federica [Nuclear Decommissioning Unit, Joint Research Centre, Ispra Site Management Directorate, European Commission, Ispra (Italy); Stolarz, Anna; Trzcińska, Agnieszka [Heavy Ion Laboratory, University of Warsaw, Warsaw (Poland); Zipper, Wiktor [Department of Nuclear Physics, University of Silesia, Katowice (Poland); Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Dorodna 16, 03-195 Warsaw (Poland)

    2015-12-04

    Recently, significant interest in {sup 44}Sc as a tracer for positron emission tomography (PET) imaging has been observed. Unfortunately, the co-emission by {sup 44}Sc of high-energy γ rays (E{sub γ} = 1157, 1499 keV) causes a dangerous increase of the radiation dose to the patients and clinical staff. However, it is possible to produce another radionuclide of scandium—{sup 43}Sc—having properties similar to {sup 44}Sc but is characterized by much lower energy of the concurrent gamma emissions. This work presents the production route of {sup 43}Sc by α irradiation of natural calcium, its separation and purification processes, and the labeling of [DOTA,Tyr3] octreotate (DOTATATE) bioconjugate. Natural CaCO{sub 3} and enriched [{sup 40}Ca]CaCO{sub 3} were irradiated with alpha particles for 1 h in an energy range of 14.8–30 MeV at a beam current of 0.5 or 0.25 μA. In order to find the optimum method for the separation of {sup 43}Sc from irradiated calcium targets, three processes previously developed for {sup 44}Sc were tested. Radiolabeling experiments were performed with DOTATATE radiobioconjugate, and the stability of the obtained {sup 43}Sc-DOTATATE was tested in human serum. Studies of {sup nat}CaCO{sub 3} target irradiation by alpha particles show that the optimum alpha particle energies are in the range of 24–27 MeV, giving 102 MBq/μA/h of {sup 43}Sc radioactivity which creates the opportunity to produce several GBq of {sup 43}Sc. The separation experiments performed indicate that, as with {sup 44}Sc, due to the simplicity of the operations and because of the chemical purity of the {sup 43}Sc obtained, the best separation process is when UTEVA resin is used. The DOTATATE conjugate was labeled by the obtained {sup 43}Sc with a yield >98 % at elevated temperature. Tens of GBq activities of {sup 43}Sc of high radionuclidic purity can be obtainable for clinical applications by irradiation of natural calcium with an alpha beam.

  3. Microwave dielectric properties of (1 − x)Mg0.95Zn0.05TiO3–(x)Ca0.6La0.8/3TiO3 ceramic composites

    International Nuclear Information System (INIS)

    Rajput, Shailendra Singh; Keshri, Sunita; Gupta, Vibha Rani

    2013-01-01

    Highlights: ► This report presents the microwave dielectric properties of (1 − x)MZT–(x)CLT samples. ► The 0.79MZT-0.21CLT composite sample shows a nearly zero τ f ∼ −0.8 ppm/°C. ► A dielectric resonator antenna has been fabricated using 0.79MZT-0.21CLT sample. ► The probe fed DRA provides higher gain as compared to the microstrip line fed DRA. -- Abstract: In this paper the structural and microwave dielectric properties of the (1 − x)(Mg 0.95 Zn 0.05 )TiO 3 –(x)(Ca 0.6 La 0.8/3 )TiO 3 ceramic composites have been investigated with the variation of x as well as sintering temperature. The grown samples have been characterized by means of X-ray diffraction (XRD), scanning electron microscope (SEM) and energy dispersive X-ray (EDX) spectroscopy analysis. The Rietveld analysis of the XRD data has been carried out for structure refinement of the phases. The relative permittivity (∊ r ), quality factor (Q) and temperature coefficient of resonant frequency τ f of the grown samples have been thoroughly studied. Out of all samples of this series, the sample with x = 0.21 shows excellent dielectric properties with ∊ r ∼26.26, Q × f ∼ 60,738 GHz (at 6.44 GHz) and a nearly zero τ f ∼ −0.8 ppm/°C. Two types of dielectric resonator antennas with different feeding mechanisms have been fabricated using this sample to study their performance. The experimental results have been compared with the simulated results obtained using Ansoft High Frequency Structure Simulator software

  4. Volatility of V15Cr5Ti fusion reactor alloy

    International Nuclear Information System (INIS)

    Neilson, R.M. Jr.

    1986-01-01

    One potential hazard from the presence of activation products in fusion facilities is accidental oxidation-driven volatility of those activation products. Scoping experiments were conducted to investigate the oxidation and elemental volatility of candidate fusion reactor alloy V15Cr5Ti as a function of time, temperature, and test atmosphere. Experiments in air and in argon carrier gases containing 10 4 to 10 1 Pa (10 -1 to 10 -4 atm) oxygen were conducted to investigate the lower oxygen partial pressure limit for the formation of a low melting point (approximately 650 0 C), high volatility, oxide layer and its formation rate. Experiments to determine the elemental volatility of alloy constituents in air at temperatures of 700 0 C to greater than 1600 0 C. Some of these volatility experiments used V15Cr5Ti that was arc-remelted to incorporate small quantities (<0.1 wt. %) of Sc and Ca. Incorporation of Sc and Ca in test specimens permitted volatility measurement of radioactive constituents present only after activation of V15Cr5Ti

  5. Cubic-tetragonal phase transition in Ca sub 0 sub . sub 0 sub 4 Sr sub 0 sub . sub 9 sub 6 TiO sub 3 a combined specific heat and neutron diffraction study

    CERN Document Server

    Gallardo, M C; Romero, F J; Cerro, J D; Seifert, F; Redfern, S A T

    2003-01-01

    The specific heat corresponding to the tetragonal-to-cubic transition in Ca sub 0 sub . sub 0 sub 4 Sr sub 0 sub . sub 9 sub 6 TiO sub 3 perovskite has been measured by conduction calorimetry. The order parameter of the transition has been obtained by means of neutron diffraction at low temperatures. Comparison of calorimetric data with the evolution of the order parameter indicates that this transition seems to follow a mean field Landau potential as in SrTiO sub 3. The linear behaviour of the excess of entropy versus temperature suggests that a 2-4 Landau potential is sufficient to describe the transition.

  6. Effect of Ca{sup 2+} substitution on impedance and electrical conduction mechanism of Ba{sub 1−x}Ca{sub x}Zr{sub 0.1}Ti{sub 0.9}O{sub 3} (0.00≤x≤0.20) ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Mondal, Tanusree [Functional Ceramics Laboratory, Department of Applied Physics, Indian Institute of Technology (ISM), Dhanbad 826004 (India); Das, Sayantani [Department of Physics, University of Calcutta, 92, Acharya Prafulla Chandra Road, Kolkata 700009 (India); Badapanda, T. [Department of Physics, C.V. Raman College of Engineering, Bhubaneswar, Odisha 7520544 (India); Sinha, T.P. [Department of Physics, Bose Institute, 93/1, Acharya Prafulla Chandra Road, Kolkata 700009 (India); Sarun, P.M., E-mail: sarun.res@gmail.com [Functional Ceramics Laboratory, Department of Applied Physics, Indian Institute of Technology (ISM), Dhanbad 826004 (India)

    2017-03-01

    The Ca modified Ba{sub 1−x}Ca{sub x}Zr{sub 0.1}Ti{sub 0.9}O{sub 3} (BCZT) system for x=0.00–0.20 is synthesized by the high-temperature conventional solid state reaction method. The morphotropic phase boundary (MPB) between the tetragonal and cubic structure is obtained at room temperature for the composition x=0.15. The doping of Ca facilitates the enhancement of the homogeneity of microstructure and growth of the grain size. The phase transition is also confirmed by Raman spectroscopy. In order to explore the effect of Ca concentration variation on the conduction mechanism of BaZr{sub 0.1}Ti{sub 0.9}O{sub 3} (BZT) ceramic, the frequency dependent ac impedance spectroscopy technique is used at various temperatures. The effect of Ca doping on the electrical properties of BZT is clearly noticeable. The resistance of the grain (bulk) and the grain boundary is increased as a consequence of the increase in the activation energy of Ca substituted BZT samples. The enhanced resistivity of the Ca substituted BZT ceramics is explained in terms of the decrease in the mobility of the charge carriers associated with the lattice distortion. The electric modulus analysis reveals the enhanced capacitance of BCZT ceramics which is in good agreement with the results obtained from complex impedance analysis.

  7. Creating Two-Dimensional Electron Gas in Nonpolar/Nonpolar Oxide Interface via Polarization Discontinuity: First-Principles Analysis of CaZrO3/SrTiO3 Heterostructure.

    Science.gov (United States)

    Nazir, Safdar; Cheng, Jianli; Yang, Kesong

    2016-01-13

    We studied strain-induced polarization and resulting conductivity in the nonpolar/nonpolar CaZrO3/SrTiO3 (CZO/STO) heterostructure (HS) system by means of first-principles electronic structure calculations. By modeling four types of CZO/STO HS-based slab systems, i.e., TiO2/CaO and SrO/ZrO2 interface models with CaO and ZrO2 surface terminations in each model separately, we found that the lattice-mismatch-induced compressive strain leads to a strong polarization in the CZO film and that as the CZO film thickness increases there exists an insulator-to-metal transition. The polarization direction and critical thickness of the CZO film for forming interfacial metallic states depend on the surface termination of CZO film in both types of interface models. In the TiO2/CaO and SrO/ZrO2 interface models with CaO surface termination, the strong polarization drives the charge transfer from the CZO film to the first few TiO2 layers in the STO substrate, leading to the formation of two-dimensional electron gas (2DEG) at the interface. In the HS models with ZrO2 surface termination, two polarization domains with opposite directions are in the CZO film, which results in the charge transfer from the middle CZO layer to the interface and surface, respectively, leading to the coexistence of the 2DEG on the interface and the two-dimensional hole gas (2DHG) at the middle CZO layer. These findings open a new avenue to achieve 2DEG (2DHG) in perovskite-based HS systems via polarization discontinuity.

  8. Raman scattering, microstructural and dielectric studies on Ba{sub 1-x}Ca{sub x}Bi{sub 4}Ti{sub 4}O{sub 15} ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Sunil; Kundu, Swarup [Materials Research Centre, Indian Institute of Science, Bangalore 560012 (India); Ochoa, D.A.; Garcia, J.E. [Department of Applied Physics, Universitat Politecnica de Catalunya, 08034 Barcelona (Spain); Varma, K.B.R., E-mail: kbrvarma@mrc.iisc.ernet.in [Materials Research Centre, Indian Institute of Science, Bangalore 560012 (India)

    2012-10-15

    Polycrystalline powders of Ba{sub 1-x}Ca{sub x}Bi{sub 4}Ti{sub 4}O{sub 15} (where x = 0, 0.25, 0.50, 0.75 and 1) were prepared via the conventional solid-state reaction route. X-ray diffraction (XRD) and Raman scattering techniques have been employed to probe into the structural changes on changing x. XRD analyses confirmed the formation of monophasic bismuth layered structure of all the above compositions with an increase in orthorhombic distortion with increase in x. Raman spectra revealed a redshift in A{sub 1g} peak and an increase in the B{sub 2g}/B{sub 3g} splitting with increasing Ca content. The average grain size was found to increase with increasing x. The temperature of the maximum dielectric constant (T{sub m}) increased linearly with increasing Ca-content whereas the diffuseness of the phase transition was found to decrease with the end member CaBi{sub 4}Ti{sub 4}O{sub 15} showing a frequency independent sharp phase transition around 1048 K. Ca doping resulted in a decrease in the remnant polarization and an increase in the coercive field. Ba{sub 0.75}Ca{sub 0.25}Bi{sub 4}Ti{sub 4}O{sub 15} ceramics showed an enhanced piezoelectric coefficient d{sub 33} of 15 pC N{sup -1} at room temperature. Low values of dielectric losses and tunability of temperature coefficient of dielectric constant ({tau}{sub {epsilon}}) in the present solid-solution suggest that these compounds can be of potential use in microwave dielectrics at high temperatures. Highlights: Black-Right-Pointing-Pointer Ba{sub 1-x}Ca{sub x}Bi{sub 4}Ti{sub 4}O{sub 15} (0 {<=} x {<=} 1) ceramics with four-layer Aurivillius structure were fabricated. Black-Right-Pointing-Pointer X-ray diffraction and Raman scattering techniques have been employed to probe into the structural changes on changing x. Black-Right-Pointing-Pointer Curie temperature (T{sub C}) was found to increase with increase in Ca-doping whereas the diffuseness of phase transition decreased. Black-Right-Pointing-Pointer Temperature

  9. Ti-dopant-enhanced photocatalytic activity of a CaFe{sub 2}O{sub 4}/MgFe{sub 2}O{sub 4} bulk heterojunction under visible-light irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Borse, Pramod H. [International Advanced Research Center for Powder Metallurgy and New Materials, Hyderabad (India); Kim, Jae Y.; Lee, Jae S. [Pohang University of Science and Technology, Pohang (Korea, Republic of); Lim, Kwon T. [Pukyong National University, Busan (Korea, Republic of); Jeong, Euh D.; Bae, Jong S.; Yoon, Jang H.; Yu, Seong M.; Kim, Hyun G. [Korea Basic Science Institute, Busan (Korea, Republic of)

    2012-07-15

    The effect substitution of Ti{sup 4+} at the Fe{sup 3+} site in a CaFe{sub 2}O{sub 4{sup -}}MgFe{sub 2}O{sub 4} bulk hetero-junction (BH) lattice photocatalyst was explored and the Ti ion concentration was optimized to fabricate an efficient photocatalyst. A BH consisting of an optimum dopant concentration (Ti{sup +4}) level of x = 0.03 exhibited an increased band gap and generated a 1.5 times higher photocurrent. The newly fabricated Ti ion doped photocatalyst showed an enhanced quantum yield (up to ∼13.3%) for photodecomposition of a H{sub 2}O-CH{sub 3}OH mixture, as compared to its undoped BH counterpart under visible light (λ ≥ 420 nm). In contrast, the material doped with a very high Ti-dopant concentration displayed deteriorated photochemical properties. An efficient charge-separation induced by Ti-ion doping seems to be responsible for the higher photocatalytic activity in a doped bulk BH.

  10. Lead-free Ba0.8Ca0.2(ZrxTi1−x)O3 ceramics with large electrocaloric effect

    International Nuclear Information System (INIS)

    Asbani, B.; Dellis, J.-L.; Lahmar, A.; Gagou, Y.; El Marssi, M.; Courty, M.; Djellab, K.; Amjoud, M.; Mezzane, D.; Kutnjak, Z.

    2015-01-01

    The electrocaloric effect was investigated in lead-free Zr doped Ba 0.8 Ca 0.2 (Zr x Ti 1−x )O 3 (BCTZ) ceramics synthesized by a conventional sintering process. Room-temperature x-ray diffraction analysis showed that the tetragonal structure is obtained in BCTZ for x ≤ 0.08 and a pseudo cubic phase for x > 0.08. The dielectric spectroscopy and calorimetry revealed that the Curie temperature decreases as a consequence of Zr doping and that the BCTZ exhibits a first order ferroelectric phase transition. The electrocaloric effect was determined by the calculation of the electrocaloric change of temperature (ΔT) using the Maxwell relation based on the P–E hysteresis loops measured at different temperatures. A large electrocaloric responsivity ΔT/ΔE = 0.34 × 10 −6  Km/V was found for x = 0.04, which significantly exceeds of values found so far in other lead-free electrocaloric materials

  11. Novel magnetic–dielectric composite ceramic obtained from Y{sub 3}Fe{sub 5}O{sub 12} and CaTiO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Paiva, D.V.M. [Grupo de Química de Materiais Avançados (GQMAT), Departamento de Química Analítica e Físico-Química, Universidade Federal do Ceará – UFC, Campus do Pici, CP 12100, CEP 60451-970 Fortaleza, CE (Brazil); Silva, M.A.S. [Laboratório de Telecomunicações e Ciência e Engenharia de Materiais (LOCEM), Departamento de Física, Universidade Federal do Ceará (Brazil); Ribeiro, T.S.; Vasconcelos, I.F. [Laboratório de Magnetismo e Materiais Magnéticos, Departamento de Engenharia Metalúrgica e de Materiais, UFC (Brazil); Sombra, A.S.B.; Góes, J.C. [Laboratório de Telecomunicações e Ciência e Engenharia de Materiais (LOCEM), Departamento de Física, Universidade Federal do Ceará (Brazil); Fechine, P.B.A., E-mail: fechine@ufc.br [Grupo de Química de Materiais Avançados (GQMAT), Departamento de Química Analítica e Físico-Química, Universidade Federal do Ceará – UFC, Campus do Pici, CP 12100, CEP 60451-970 Fortaleza, CE (Brazil)

    2015-09-25

    Highlights: • The density of composites was improved with addition of CTO. • Dielectric permittivity of the composites presented values above the expected. • The composites presented magnetic permeability higher than YIG after 500 MHz. - Abstract: This work investigates the microstructure and magnetic–dielectric properties of the CaTiO{sub 3} (CTO) and Y{sub 3}Fe{sub 5}O{sub 12} (YIG) composite ceramic. CTO is a paramagnetic ceramic, presents a positive value of Resonant Frequency Temperature Coefficients (τ{sub f}) and has high dielectric permittivity (ε{sub r}) while YIG is ferromagnetic, has low ε{sub r} and negative τ{sub f} values. Therefore, it is expected that the composite from these individual phase shows new properties, or a mix of them derived from each component. X-ray powder diffraction (XRPD), Scanning Electron Microscope (SEM), Raman and {sup 57}Fe Mössbauer spectroscopy were performed to confirm the phases of the composites. The dielectric and magnetic properties in Radio-Microwave frequencies were studied by impedance spectroscopy using different geometries. It was observed a densification improvement resulting from the insertion of the CTO in composites and a chemical reaction between YIG and CTO phases. This new composite has potential applications in bulk and thick/thin films devices.

  12. Pyrochlore type semiconducting ceramic oxides in Ca-Ce-Ti-M-O system (M = Nb or Ta)-Structure, microstructure and electrical properties

    Energy Technology Data Exchange (ETDEWEB)

    Deepa, M. [Materials and Minerals Division, National Institute for Interdisciplinary Science and Technology (NIIST), Trivandrum 695019 (India); Prabhakar Rao, P., E-mail: padala_rao@yahoo.com [Materials and Minerals Division, National Institute for Interdisciplinary Science and Technology (NIIST), Trivandrum 695019 (India); Radhakrishnan, A.N.; Sibi, K.S.; Koshy, Peter [Materials and Minerals Division, National Institute for Interdisciplinary Science and Technology (NIIST), Trivandrum 695019 (India)

    2009-07-01

    A new series of pyrochlore type ceramic semiconducting oxides in Ca-Ce-Ti-M-O (M = Nb or Ta) system has been synthesized by the conventional ceramic route. The electrical conductivity measurements show that these oxides exhibit semiconducting behavior and the conductivity increases with the Ce content in the compound. Activation energy of the current carriers is in the range of 0.5-1.6 eV. The electrical conductivity in these oxides is due to the presence of Ce{sup 3+}, which remains in the reduced state without being oxidized to Ce{sup 4+} by structural stabilization. The photoluminescence and X-ray photoelectron spectroscopy analysis corroborate the presence of Ce in the 3+ state. Impedance spectral analysis is carried out to evaluate the transport properties and indicates that the conduction in these compounds is mainly due to electronic contribution. The X-ray powder diffraction and Raman spectroscopy analysis establishes that these oxides belong to a cubic pyrochlore type structure.

  13. Competition and coexistence of polar and non-polar states in Sr1-x Ca x TiO3: an investigation using pressure dependent Raman spectroscopy

    Science.gov (United States)

    Tyagi, Shekhar; Sharma, Gaurav; Sathe, Vasant G.

    2018-03-01

    The competition and cooperation between ferroelectric and anti-ferro-distortion (AFD) instabilities are studied using pressure dependent Raman spectroscopy on polycrystalline powder samples of Sr1-x Ca x TiO3(x  =  0.0, 0.06, 0.25, 0.35). For x  =  0.0 composition, a broad polar mode is detected in the Raman spectra above 6 GPa, while for x  =  0.06 composition, the polar modes appear well above 9 GPa where the AFD modes showed strong suppression. In x  =  0.25 and 0.35 composition, the application of small pressure resulted in the appearance of strong AFD modes suppressing the polar modes. At elevated pressures, re-entrant polar modes are observed along with the broad AFD modes and some new peaks are also observed, signifying the lowering of local symmetry. The reappearance of polar modes is found to be related to pressure induced symmetry disorder at local level, suggesting its electronic origin. The re-entrant polar modes observed at higher pressure values are found to be significantly broad and asymmetric in nature, signifying the development of ferroelectric micro regions/nano domains coexisting with AFD. The lower symmetry at local length scale provides a conducive atmosphere for coexisting AFD and FE instabilities.

  14. Effect of microwave-assisted sintering on dielectric properties of CaCu{sub 3}Ti{sub 4}O{sub 12} ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Rani, Suman, E-mail: sumanranigju@gmail.com; Ahlawat, Neetu; Punia, R.; Kundu, R. S. [Department of Applied Physics, Guru Jambheshwar University of Science & Technology, Hissar 125001, Haryana (India); Ahlawat, N. [Matu Ram Institute of Engineering and Management, Rohtak (India)

    2016-05-23

    In this present work, CaCu{sub 3}Ti{sub 4}O{sub 12} (CCTO) was synthesized by conventional solid-state reaction technique. The synthesis process was carried out in two phases; by conventional process (calcination and sintering at 1080°C for 10 hours) and phase II involves the micro assisted pre sintering of conventionally calcined CCTO for very short soaking time of 30 min at 1080°C in a microwave furnace followed by sintering at 1080°C for 10 hours in conventional furnace. X-ray diffraction (XRD) patterns confirmed the formation of single phase ceramic. Dielectric properties were studied over the frequency range from 50Hz -5MHz at temperatures (273K-343K). It was observed that pre- microwave sintering enhance the dielectric constant values from 10900 to 11893 and respectively reduces the dielectric loss values from 0.49 to 0.34 at room temperature(1 KHz). CCTO ceramics which are found desirable for many technological applications. The effect is more pronounced at low frequencies of applied electric field.

  15. Design and Development for Capacitive Humidity Sensor Applications of Lead-Free Ca,Mg,Fe,Ti-Oxides-Based Electro-Ceramics with Improved Sensing Properties via Physisorption

    Science.gov (United States)

    Tripathy, Ashis; Pramanik, Sumit; Manna, Ayan; Bhuyan, Satyanarayan; Azrin Shah, Nabila Farhana; Radzi, Zamri; Abu Osman, Noor Azuan

    2016-01-01

    Despite the many attractive potential uses of ceramic materials as humidity sensors, some unavoidable drawbacks, including toxicity, poor biocompatibility, long response and recovery times, low sensitivity and high hysteresis have stymied the use of these materials in advanced applications. Therefore, in present investigation, we developed a capacitive humidity sensor using lead-free Ca,Mg,Fe,Ti-Oxide (CMFTO)-based electro-ceramics with perovskite structures synthesized by solid-state step-sintering. This technique helps maintain the submicron size porous morphology of the developed lead-free CMFTO electro-ceramics while providing enhanced water physisorption behaviour. In comparison with conventional capacitive humidity sensors, the presented CMFTO-based humidity sensor shows a high sensitivity of up to 3000% compared to other materials, even at lower signal frequency. The best also shows a rapid response (14.5 s) and recovery (34.27 s), and very low hysteresis (3.2%) in a 33%–95% relative humidity range which are much lower values than those of existing conventional sensors. Therefore, CMFTO nano-electro-ceramics appear to be very promising materials for fabricating high-performance capacitive humidity sensors. PMID:27455263

  16. Effect of processing routes on microstructure, electrical and dielectric behavior of Mg-doped CaCu3Ti4O12 electro-ceramic

    Science.gov (United States)

    Singh, Laxman; Rai, U. S.; Mandal, K. D.; Rai, Alok Kumar

    2013-09-01

    In the present communication, data on magnesium-doped calcium copper titanate CaCu2.90Mg0.10Ti4O12 (CCMTO) electro-ceramic, synthesized by the semi-wet route (SWR), ball-milled route (BMR) and solid-state route (SSR), is characterized by TG-DTA, XRD, SEM, EDX and TEM techniques. XRD confirmed the formation of single phase in CCMTO ceramic. The CuO phase present at grain boundaries in SWR ceramic was shown by the SEM micrograph, which was verified by EDX. The TEM image of SWR ceramic shows nanocrystalline particles in the range 80±20 nm. The value of the dielectric constant of SWR ( ɛ r ˜20091) ceramic is higher than those of BMR and SSR ( ɛ r ˜1247) ceramics at 1 kHz at 450 K. A dielectric relaxation has been observed in the frequency range 100 Hz-100 kHz. The high-temperature dielectric dispersion shows one large low-frequency response and two Debye-type relaxations. The impedance and modulus studies show the highest grain-boundary resistance for BMR ceramic.

  17. Preparation of textured CaBi4Ti4O15 based ceramics and dielectric properties optimized with La3+ doping

    Directory of Open Access Journals (Sweden)

    ZHENG Qianqian

    2012-12-01

    Full Text Available A batch of 001>textured CaBi4Ti4O15(x=0,0.1,0.2,0.3,0.4 (CBLT-x ceramics were fabricated by a two-step sintering method:synthesizing seed-crystal platelets by molten-salt method with oxide mixture as precursor,and then sintering the platelets via grain orientation technique (OCAP.Microstructural characterization by SEM was performed to establish the effect of increased doping of La3+ and sintering temperature on grain growth and texture development.Increasing La3+(to x=0.4 resulted in dielectric constant improvement up to 570 sintered at 1150℃ in the direction perpendicular to the tapecasting plan.The dielectric constant as well as loss of CBLT-x samples in the perpendicular direction is higher than that of parallel plane.The mechanism controlling the texture and grain growth in CBLT-xceramics is firstly discussed by 3D patterns in this letter.

  18. Multiferroic behavior on nanometric La2/3Ca1/3MnO3 / BaTiO3 bilayers

    Science.gov (United States)

    Prieto, Pedro; Ordoñez, John Edward; Gomez, Maria Elena; Lopera, Wilson

    2014-03-01

    We have deposited bilayers of the FM La2/3Ca1/3MnO3 and FE BaTiO3 as a route to design systems with artificial magnetoelectric coupling on LCMO/BTO/Nb:STO system. We maintain a fixed magnetic layer thickness (tLCMO = 48 nm) and varying the thickness of the ferroelectric layer (tBTO = 20, 50, 100 nm). We analyze the influence of the thickness ratio (tBTO/ tLCMO) in electrical and magnetic properties of manganite. From X-ray diffraction analysis we observed that the samples grew textured. Magnetization and transport measurements indicate a possible multiferroic behavior in the bilayer. We found an increase in the Curie and metal-insulator transition temperature in the bilayer in comparison with those for LCMO (48nm)/STO. Hysteresis loops on bilayers show ferromagnetic behavior. This work has been supported by the ``El Patrimonio Autónomo Fondo Nacional de Financiamiento para CT&I FJC'' Colciencias-CENM Research Projects: No. 1106-48-925531 and CI7917-CC 10510 contract 0002-2013 COLCIENCIAS-UNIVALLE.

  19. PDMS-SiO{sub 2}-TiO{sub 2}-CaO hybrid materials – Cytocompatibility and nanoscale surface features

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, J. Carlos [CICECO - Aveiro Institute of Materials, Department of Materials and Ceramic Engineering, University of Aveiro, 3810-193 Aveiro (Portugal); Wacha, András [Research Centre for Natural Sciences, Hungarian Academy of Sciences, Magyar Tudósok körútja 2, Budapest 1117 (Hungary); Gomes, Pedro S.; Fernandes, M. Helena R. [Laboratory for Bone Metabolism and Regeneration, Faculdade de Medicina Dentária, Universidade do Porto (Portugal); Fernandes, M. Helena Vaz [CICECO - Aveiro Institute of Materials, Department of Materials and Ceramic Engineering, University of Aveiro, 3810-193 Aveiro (Portugal); Salvado, Isabel M. Miranda, E-mail: isabelmsalvado@ua.pt [CICECO - Aveiro Institute of Materials, Department of Materials and Ceramic Engineering, University of Aveiro, 3810-193 Aveiro (Portugal)

    2016-07-01

    Two PDMS-SiO{sub 2}-TiO{sub 2}-CaO porous hybrid materials were prepared using the same base composition, precursors, and solvents, but following two different sol-gel procedures, based on the authors' previous works where for the first time, in this hybrid system, calcium acetate was used as calcium source. The two different procedures resulted in monolithic materials with different structures, microstructures, and surface wettability. Even though both are highly hydrophobic (contact angles of 127.2° and 150.6°), and present different filling regimes due to different surface topographies, they have demonstrated to be cytocompatible when tested with human osteoblastic cells, against the accepted idea that high-hydrophobic surfaces are not suitable to cell adhesion and proliferation. At the nanoscale, the existence of hydrophilic silica domains containing calcium, where water molecules are physisorbed, is assumed to support this capability, as discussed. - Highlights: • Two hybrid materials were prepared following two different sol-gel procedures. • Both are highly hydrophobic but demonstrated to be cytocompatible. • Different filling regimes were observed.

  20. Dielectric behavior of CaCu3Ti4O12: Poly Vinyl Chloride ceramic polymer composites at different temperature and frequencies

    Directory of Open Access Journals (Sweden)

    Ajay Pratap Singh

    2016-12-01

    Full Text Available In this study, the efforts have been made to obtain relatively high dielectric constant polymer-ceramic composite by incorporating the giant dielectric constant material, calcium copper titanate (CCTO in a PVC polymer matrix. We have prepared composites of CaCu3Ti4O12 (CCTO ceramic and Poly Vinyl Chloride (PVC polymer in various ratios (by volume in addition to pure CCTO. For this, CCTO was prepared by the conventional oxide route (solid-state reaction method. The structural, the microstructural and the dielectric properties of the composites were studied using X-ray diffraction, Scanning Electron Microscope, and impedance analyzer respectively. The study of dielectric constant and dielectric loss of the pure CCTO and the composites reveal that there is good range of dielectric constants and dielectric losses for the studied composites. The pure sample of CCTO exhibits giant dielectric constant at low frequency within the studied temperature range. As frequency increases, dielectric constant drastically decreases and approaching a constant value at 1 MHz. Above the intermediate temperature, the dielectric constant and dielectric loss for pure CCTO is more frequency dependent than its composites.

  1. Soft antiphase tilt of oxygen octahedra in the hybrid improper multiferroic Ca3Mn1.9Ti0.1O7

    Science.gov (United States)

    Ye, Feng; Wang, Jinchen; Sheng, Jieming; Hoffmann, C.; Gu, T.; Xiang, H. J.; Tian, Wei; Molaison, J. J.; dos Santos, A. M.; Matsuda, M.; Chakoumakos, B. C.; Fernandez-Baca, J. A.; Tong, X.; Gao, Bin; Kim, Jae Wook; Cheong, S.-W.

    2018-01-01

    We report a single crystal neutron and x-ray diffraction study of the hybrid improper multiferroic Ca3Mn1.9Ti0.1O7 (CMTO), a prototypical system where the electric polarization arises from the condensation of two lattice distortion modes. With increasing temperature (T ), the out-of-plane, antiphase tilt of MnO6 decreases in amplitude while the in-plane, in-phase rotation remains robust and experiences abrupt changes across the first-order structural transition. Application of hydrostatic pressure (P ) to CMTO at room temperature shows a similar effect. The consistent behavior under both T and P reveals the softness of antiphase tilt and highlights the role of the partially occupied d orbital of the transition-metal ions in determining the stability of the octahedral distortion. Polarized neutron analysis indicates the symmetry-allowed canted ferromagnetic moment is less than the 0.04 μB/Mn site, despite a substantial out-of-plane tilt of the MnO6 octahedra.

  2. Role of A-site Ca and B-site Zr substitution in BaTiO3 lead-free compounds: Combined experimental and first principles density functional theoretical studies

    Science.gov (United States)

    Keswani, Bhavna C.; Saraf, Deepashri; Patil, S. I.; Kshirsagar, Anjali; James, A. R.; Kolekar, Y. D.; Ramana, C. V.

    2018-05-01

    We report on the combined experimental and theoretical simulation results of lead-free ferroelectrics, Ba(1-x)CaxTiO3 (x = 0.0-0.3) and BaTi(1-y)ZryO3 (y = 0.0-0.2), synthesized by standard solid state reaction method. First principles density functional calculations are used to investigate the electronic structure, dynamical charges, and spontaneous polarization of these compounds. In addition, the structural, ferroelectric, piezoelectric, and dielectric properties are studied using extensive experiments. The X-ray diffraction and temperature dependent Raman spectroscopy studies indicate that the calcium (Ca) substituted compositions exhibit a single phase crystal structure, while zirconium (Zr) substituted compositions are biphasic. The scanning electron micrographs reveal the uniform and highly dense microstructure. The presence of polarization-electric field and strain-electric field hysteresis loops confirms the ferroelectric and piezoelectric nature of all the compositions. Our results demonstrate higher values for polarization, percentage strain, piezoelectric coefficients, and electrostrictive coefficient compared to those existing in the literature. For smaller substitutions of Ca and Zr in BaTiO3, a direct piezoelectric coefficient (d33) is enhanced, while the highest d33 value (˜300 pC/N) is observed for BaTi0.96Zr0.04O3 due to the biphasic ferroelectric behavior. Calculation of Born effective charges indicates that doping with Ca or Zr increases the dynamical charges on Ti as well as on O and decreases the dynamical charge on Ba. An increase in the dynamical charges on Ti and O is ascribed to the increase in covalency of Ti-O bond that reduces the polarizability of the crystal. A broader range of temperatures is demonstrated to realize the stable phase in the Ca substituted compounds. The results indicate enhancement in the temperature range of applicability of these compounds for device applications. The combined theoretical and experimental study is

  3. Characterization and study of dielectric and electrical properties of CaBi4Ti4O{sub 15} (CBT) added with Bi{sub 2}O{sub 3}; Caracterizacao e estudo das propriedades eletricas e dieletricas do CaBi{sub 4}Ti{sub 4}O{sub 15} (CBT) adicionado com Bi{sub 2}O{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Freitas, D.B.; Campos Filho, M.C.; Sales, J.C.; Silva, P.M.O.; Sombra, A.S. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil)

    2011-07-01

    The ceramic perovskite CaBi{sub 4}Ti{sub 4}O{sub 15} (CBT) of space group A21am, Aurivillius family with deficiency A{sub 5}B{sub 4}O{sub 15} cation has been prepared by solid state method in a planetary ball mill of high energy. The reagents samples were ground and calcined and then added with Bi{sub 2}O{sub 3} (2% wt.) This work aims to characterize by X-ray diffraction to study the electrical properties and dielectric properties of (CBT). The x-ray diffraction revealed the formation of single orthorhombic phase. As for the dielectric properties (dielectric constant and dielectric loss) were measured at 30 deg C to 450 deg C, through which can be verified the presence of thermally activated processes. This phase has properties very relevant for possible use in capacitive devices, miniaturized filters, dielectric resonators antennas and oscillators. (author)

  4. Effect of defect on the nonlinear and dielectric property of Ca{sub (1–x)}Sr{sub x}Cu{sub 3}Ti{sub 4}O{sub 12} ceramics synthesized by sol–gel process

    Energy Technology Data Exchange (ETDEWEB)

    Li, Tao; Liu, Dewei; Dai, Haiyang; Xiang, Huiwen [Department of Technology and Physics, Zhengzhou University of Light Industry, Zhengzhou 450002 (China); Chen, Zhenping, E-mail: chaodaotai@126.com [Department of Technology and Physics, Zhengzhou University of Light Industry, Zhengzhou 450002 (China); He, Huifang; Chen, Zhiquan [Department of Physics, Hubei Nuclear Solid Physics Key Laboratory, Wuhan University, Wuhan 430072 (China)

    2014-06-25

    Highlights: • Ca{sub (1−x)}Sr{sub x}Cu{sub 3}Ti{sub 4}O{sub 12} ceramics are synthesized by sol–gel process. • Positron annihilation lifetime spectra is used to investigate the defects of samples. • Nonlinear and dielectric properties are controlled by density and defects of samples. - Abstract: Ca{sub (1−x)}Sr{sub x}Cu{sub 3}Ti{sub 4}O{sub 12} (x = 0, 0.05, 0.1, 0.15, 0.2, 0.3 and 0.4) ceramics are synthesized by sol–gel process. The XRD patterns show that weak peaks of Sr{sub 4}Ti{sub 3}O{sub 10}, TiO{sub 2} and Ca{sub 1.7}Sr{sub 0.3}CuO{sub 3} begin to appear at x ⩾ 0.2. Sr-doping is conductive to increase the density and reduce the defect concentration Ca{sub (1−x)}Sr{sub x}Cu{sub 3}Ti{sub 4}O{sub 12} ceramics as x ⩽ 0.15. With increasing x (0.2 ⩽ x ⩽ 0.4), Sr-doping reduces the density and enhances the concentration of defects for the ceramics. The nonlinear coefficient value increases and reaches a maximum 13.5 at x = 0.15, and then decreases gradually with increasing x. The dielectric properties demonstrate that, as x ⩽ 0.15, Sr-doping not only increases the dielectric permittivity value and decreases the dielectric loss but also reduces the dependence on frequency at low frequencies. With increasing x (0.2 ⩽ x ⩽ 0.4), Sr-doping begins to lead to an inverse result in dielectric behaviors. The nonlinear and dielectric properties of Ca{sub (1−x)}Sr{sub x}Cu{sub 3}Ti{sub 4}O{sub 12} ceramics are directly controlled by the density and defects.

  5. Effect of the internal pressure and the anti-site disorder on the structure and magnetic properties of ALaFeTiO6 (A=Ca, Sr, Ba) double perovskite oxides

    International Nuclear Information System (INIS)

    Elbadawi, A.A.; Yassin, O.A.; Gismelseed, Abbasher A.

    2013-01-01

    Successful preparation of double perovskite oxides of chemical formula ALaFeTiO 6 (A=Ba, Sr and Ca) has been achieved by following the precursor method. The samples were studied by means of X-ray diffraction and Mössbauer spectroscopy. The Rietveld analysis of the X-ray diffraction data showed that all the samples have anti-site disorder. The presence of anti-site disorder has altered the electronic environment around the Fe ion sites which creates electric field gradient between two different sites. Observation of quadruple splitting in the ideal cubic perovskite BaLaFeTiO 6 (its tolerance factor equals 1) is the evidence of this anti-site generated electric field gradient. The valence state of the Fe atom determined from the measurements of the Mössbauer effect of 57 Fe at room temperature and 80 K showed that the iron ion has the Fe 3+ high spin state as extracted from the values of the isomer shift for all the samples. It is evidenced that the anti-site disorder has no appreciable effect on the spin state of the Fe ion, but alters the charge densities at the Fe sites and influences the hyperfine parameters of the present samples. Weak ferromagnetism is observed in CaLaFeTiO 6 and SrLaFeTiO 6 and is related to both the internal pressure and the anti-site effect which facilitate the occurrence of the Fe 3+ ↑−O−Fe 3+ ↓ antiferromagnetic interaction with canted spin. - Highlights: ► Anti-site disorder was revealed in (Ca,Sr,Ba)LaFeTiO 6 double perovskites. ► Mössbauer spectroscopy revealed a dependence of the quadruple splitting and the cation size mismatch. ► Weak ferromagnetism is evidenced due to internal pressure and anti-site disorder.

  6. Tunable magnetocaloric effect in Sr{sub 1-x}Ca{sub x}Mn{sub 0.5}Ti{sub 0.5}O{sub 3} perovskites

    Energy Technology Data Exchange (ETDEWEB)

    Shanmugapriya, K.; Palanivel, Balan [Pondicherry Engineering College, Department of Physics, Puducherry (India); Radheep, D.M.; Murugan, Ramaswamy [Pondicherry University, Department of Physics, Puducherry (India)

    2017-07-15

    Sr{sub 1-x}Ca{sub x}Mn{sub 0.5}Ti{sub 0.5}O{sub 3} (x = 0.25, 0.5 and 0.75) polycrystalline samples were synthesized by conventional solid-state reaction. Magnetic characterizations of Sr{sub 1-x}Ca{sub x}Mn{sub 0.5}Ti{sub 0.5}O{sub 3} revealed signature of antiferromagnetic ordering at temperatures (T{sub N}) ∝ 19, 25 and 29.5 K for x = 0.25, x = 0.5 and for x = 0.75, respectively. Sr{sub 1-x}Ca{sub x}Mn{sub 0.5}Ti{sub 0.5}O{sub 3} (x = 0.75) exhibits field-induced antiferromagnetic to ferromagnetic transition at ∝ 30 K with applied magnetic field of 4 and 5 T. Magnetocaloric change (ΔS{sub M}) increases from 3.5 to 19 J/kg K by increasing calcium concentration in the A-site. Those ΔS{sub M} values are relatively very high in these classes of antiferromagnetic perovskite systems and equal to the magnetisation values of the ferromagnetic perovskite manganites. This is the first report for the Sr{sub 1-x}Ca{sub x}Mn{sub 0.5}Ti{sub 0.5}O{sub 3} (x = 0.75) having large magnetic entropy changes induced by the low magnetic field. (orig.)

  7. Luminescent characteristics of UV excited Sr{sub 0.5}Ca{sub 0.5}TiO{sub 3}: Pr{sup 3+} reddish-orange phosphor

    Energy Technology Data Exchange (ETDEWEB)

    Vidyadharan, Viji; Mohan P, Remya; Joseph, Cyriac; Unnikrishnan, N.V.; Biju, P.R., E-mail: prb.mgu@gmail.com

    2016-02-15

    Pr{sup 3+} doped Sr{sub 0.5}Ca{sub 0.5}TiO{sub 3} phosphors were synthesised by solid state reaction process. The structure, surface morphology and photoluminescence of the prepared phosphors were analysed using XRD, SEM and photoluminescence spectroscopy respectively. The XRD pattern confirmed orthorhombic perovskite structure of the Sr{sub 0.5}Ca{sub 0.5}TiO{sub 3}: x Pr{sup 3+} phosphor. Agglomeration of particles with irregular shapes is observed from the SEM images. The emission spectra of Sr{sub 0.5}Ca{sub 0.5}TiO{sub 3}: x Pr{sup 3+} phosphor shows the samples can be effectively excited with UV light at 336 nm and exhibit a strong reddish-orange emission at 611 nm. Concentration dependence of emission intensity shows concentration quenching effect on increasing Pr{sup 3+} concentration after x = 0.1 because of dipole–dipole interaction. Using Blasse's formula, critical distance for energy transfer was calculated. The CIE co-ordinates, CCT, colour purity and luminescence decay of the prepared phosphors were also calculated. These results offer the prepared phosphor as a suitable candidate for various photonic applications. - Highlights: • Sr{sub 0.5}Ca{sub 0.5}TiO{sub 3}: x Pr{sup 3+} perovskite structured phosphors were synthesized. • Under UV excitation, the PL spectra show strong reddish-orange emission. • The emission from {sup 3}P{sub J} levels of Pr{sup 3+} were absent due to the presence of IVCT band. • Concentration quenching due to dipole–dipole interaction was observed. • For x = 0.1, sample shows a maximum emission intensity with 91.7% colour purity.

  8. Moessbauer Study of the Ni/Ca0.8Sr0.2Ti1-xFexO3-α Catalyst System for Partial Oxidation of Methane to Synthesis Gas

    International Nuclear Information System (INIS)

    Homonnay, Z.; Nomura, K.; Hamakawa, S.; Hayakawa, T.; Juhasz, G.; Kuzmann, E.; Vertes, A.

    2002-01-01

    The Ni/Ca 0.8 Sr 0.2 TiO 3 catalyst system prepared by the citrate method shows high activity in partial oxidation of methane to synthesis gas. It is assumed that the interaction of Ni with the perovskite lattice may be responsible for the increased catalytic activity. 1% 57 Fe dopant substituted for Ti was used in order to see if the presence of Ni has any perturbation effect on the structure of the perovskite. One may expect systematic changes in the Moessbauer parameters of the substitutional Fe impurity as a function of the NiO content if the bulk properties of the perovskite are affected. Samples with different Ni/Ca 0.8 Sr 0.2 Ti 0.99 57 Fe 0.01 O 3-α ratios from 0:1 to 1:1, and others having Fe substitutions for Ti up to 30%, all prepared by the citrate method, have been investigated. The Moessbauer spectra contained doublets of paramagnetic Fe 3+ and Fe 4+ species as well as paramagnetically relaxed Fe 3+ . These species were assigned to the bulk perovskite, the perovskite surface and the NiO/perovskite interface. The perturbation of the perovskite structure by Ni could not be verified.

  9. Study of LiF:Mg,Ti and CaSO4:Dy dosimeters TL response to electron beams of 6 MeV applied to radiotherapy using PMMA and solid water phantoms

    International Nuclear Information System (INIS)

    Bravim, A.; Sakuraba, R.K.; Cruz, J.C.; Campos, L.L.

    2011-01-01

    The performance of CaSO 4 :Dy and LiF:Mg,Ti dosimeters to electron beams applied to radiotherapy was investigated. The TL response of these dosimeters was studied for 6 MeV electron beams using PMMA and Solid Water (SW) phantoms. The dosimeters were previously separated in groups according to their TL individual sensitivities to 60 Co gamma-radiation in air under electronic equilibrium conditions. After that, they were irradiated with 6 MeV electron doses of 0.1, 0.5, 1, 5 and 10 Gy using a linear accelerator Clinac 2100C Varian of Hospital Israelita Albert Einstein – HIAE. The electron beam irradiations were performed using a 10 × 10 cm 2 field size, 100 cm source-phantom surface distance and the dosimeters were positioned at the depth of maximum dose (1.2 cm). The TL readings were carried out between 24 and 32 h after irradiation using a Harshaw 3500 TL reader. The TL dose–response of both type of dosimeters and phantoms presented linear behavior on the electron dose range from 0.1 to 5 Gy CaSO 4 :Dy dosimeter is 21 times more sensitive than LiF:Mg,Ti, dosimeter commonly used in clinical dosimetry. The obtained results indicate that the performance of CaSO 4 :Dy dosimeters is similar to LiF:Mg,Ti dosimeters and this material can be an alternative dosimetric material to be used to clinical electron beams dosimetry.

  10. Microstructure and enhanced dielectric properties of yttrium and zirconium co-doped CaCu{sub 3}Ti{sub 4}O{sub 12} ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Zunping, E-mail: xzp16213@163.com [Faculty of Materials and Energy, Southwest University, Chongqing 400715 (China); Qiang, Hua [College of Electromechanical Engineering, Chongqing College of Humanities, Science and Technology, Chongqing 401524 (China); Chen, Yi; Chen, Zhiqian [Faculty of Materials and Energy, Southwest University, Chongqing 400715 (China)

    2017-04-15

    CaCu{sub 3}Ti{sub 4}O{sub 12} (CCTO) ceramics doped with Y{sub 2}O{sub 3}, ZrO{sub 2}, and (Y{sub 2}O{sub 3}+ZrO{sub 2}) were prepared by the citrate-nitrate combustion derived powders in order to investigate the effect of dopants on the microstructure and electrical properties. The results showed that giant dielectric response was enhanced by co-doping of Y{sup 3+} and Zr{sup 4+} ions at the Ti site. Y{sub 2}O{sub 3} and ZrO{sub 2} additive can inhibit the grain growth. Compared with other samples, (Y{sub 2}O{sub 3}+ZrO{sub 2}) co-doped ceramics exhibit a dense and homogenous fine-grained microstructure. A much better temperature and frequency stability of dielectric properties were realized in these ceramics. The dielectric loss (tan δ) < 0.05 in the frequency range of 200 Hz–60 kHz at room temperature, and in the temperature range of 15–72 °C at 10 kHz was successfully accomplished in (Y{sub 2}O{sub 3}+ZrO{sub 2}) co-doped CCTO ceramics. Low tan δ ∼0.039 and high dielectric constant (ε{sub r} ∼10196) were observed at room temperature and 10 kHz for the above ceramic samples, and the characteristic frequency shifts to higher frequency with increasing measuring temperature. The present results indicate that (Y{sub 2}O{sub 3}+ZrO{sub 2}) co-doping may improve the dielectric properties and increase the grain boundary resistance of CCTO. - Highlights: • Y and Zr co-doped CCTO exhibits a dense and homogenous fine-grained microstructure. • Y and Zr co-doped CCTO performs a lower dielectric loss in wide-range of frequency. • Temperature and frequency stability of dielectric properties were greatly enhanced.

  11. Optimization of reaction conditions for the radiolabeling of DOTA and DOTA-peptide with (44m/44)Sc and experimental evidence of the feasibility of an in vivo PET generator.

    Science.gov (United States)

    Huclier-Markai, S; Kerdjoudj, R; Alliot, C; Bonraisin, A C; Michel, N; Haddad, F; Barbet, J

    2014-05-01

    Among the number of generator systems providing radionuclides with decay parameters promising for imaging and treatment applications, there is the (44)Ti (T1/2=60 years)/(44)Sc (T1/2=3.97 h) generator. This generator provides a longer-lived daughter for extended PET/CT measurements compared to the chemically similar system (68)Ge/(68)Ga. Scandium also exists as (47)Sc, a potential therapeutic radionuclide. It is possible to produce (44)Sc in a cyclotron using, for example, the (44)Ca (d, n) (44)Sc nuclear reaction. In that case, the isomeric state (44 m)Sc (T1/2=58.6h) is co-produced and may be used as an in vivo(44 m)Sc/(44)Sc generator. The aim of this study is to evaluate the feasibility of this in vivo(44 m)Sc/(44)Sc generator and to demonstrate that the daughter radionuclide stays inside the chelator after decay of the parent radionuclide. Indeed, the physico-chemical process occurring after the primary radioactive decay (EC, IT, Auger electron …) has prevented in many cases the use of in-vivo generator, because of the post-effect as described in the literature. The DOTA macrocyclic ligand forms stable complexes with many cations and has been shown to be the most suitable chelating moiety for scandium. Initially, the radiolabeling of DOTA and a DOTA-peptide (DOTATATE) with Sc was performed and optimized as a function of time, pH, metal-to-ligand ratio and temperature. Next, the physico-chemical processes that could occur after the decay (post-effect) were studied. (44 m)Sc(III)-labeled DOTA-peptide was quantitatively adsorbed on a solid phase matrix through a hydrophobic interaction. Elutions were then performed at regular time intervals using a DTPA solution at various concentrations. Finally, the radiolabelled complex stability was studied in serum. Radiolabeling yields ranged from 90% to 99% for metal-to-ligand ratio ranging from 1:10 to 1:500 for DOTA or DOTATATE respectively. The optimum physico-chemical parameters were pH=4-6, t=20 min, T=70°C. Then

  12. Dielectric and magnetic properties of xCoFe{sub 2}O{sub 4}–(1 − x)[0.5Ba(Zr{sub 0.2}Ti{sub 0.8})O{sub 3}–0.5(Ba{sub 0.7}Ca{sub 0.3})TiO{sub 3}] composites

    Energy Technology Data Exchange (ETDEWEB)

    Rani, Jyoti [Smart Materials Research Laboratory, Department of Physics, Indian Institute of Technology Roorkee, Roorkee 247667 (India); Yadav, K.L., E-mail: klyadav35@yahoo.com [Smart Materials Research Laboratory, Department of Physics, Indian Institute of Technology Roorkee, Roorkee 247667 (India); Prakash, Satya [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Roorkee, Roorkee 247667 (India)

    2014-12-15

    Highlights: • Spinel–perovskite xCoFe{sub 2}O{sub 4}–(1 − x)(0.5Ba(Zr{sub 0.2}Ti{sub 0.8})O{sub 3}–0.5(Ba{sub 0.7}Ca{sub 0.3})TiO{sub 3}) composites have been synthesized by solid state reaction method. • Two anomalies in dielectric constant have been identified, and the composites show relaxor behaviour. • The magnetic properties of the composites improve with increasing concentration of CoFe{sub 2}O{sub 4}. • Enhanced magnetodielectric effect is found, and magnetoelectric coupling has been confirmed by Δϵ ∼ γM{sup 2} relation. • Optical band gap energy of these composites has been reported for the first time. - Abstract: xCoFe{sub 2}O{sub 4}–(1 − x)(0.5Ba(Zr{sub 0.2}Ti{sub 0.8})O{sub 3}–0.5(Ba{sub 0.7}Ca{sub 0.3})TiO{sub 3}) composites with x = 0.1, 0.2, 0.3 and 0.4 have been synthesized by solid state reaction method. X-ray diffraction analysis and field emission secondary electron microscopy have been used for structural and morphological analysis, respectively. The spinel CoFe{sub 2}O{sub 4} and perovskite 0.5Ba(Zr{sub 0.2}Ti{sub 0.8})O{sub 3}–0.5(Ba{sub 0.7}Ca{sub 0.3})TiO{sub 3} phase could be identified in the composites. Two anomalies in dielectric constant have been identified: first one is close to ferroelectric to paraelectric phase transition of 0.5Ba(Zr{sub 0.2}Ti{sub 0.8})O{sub 3}–0.5(Ba{sub 0.7}Ca{sub 0.3})TiO{sub 3} ceramic and the other lies near the magnetic transition temperature of CoFe{sub 2}O{sub 4}. There is an increase in magnetocapacitance and saturation magnetization of the composites at room temperature with increase in CoFe{sub 2}O{sub 4} content. The magnetoelectric coupling coefficient (γ) was approximated by Δϵ ∼ γM{sup 2} relation. The optical band gap energy of the composites decreases with increase in CoFe{sub 2}O{sub 4} content.

  13. Enhanced piezoelectric properties and excellent thermal stabilities of cobalt-modified Aurivillius-type calcium bismuth titanate (CaBi_4Ti_4O_1_5)

    International Nuclear Information System (INIS)

    Zhao, Tian-Long; Wang, Chun-Ming; Wang, Chun-Lei; Wang, Yi-Ming; Dong, Shuxiang

    2015-01-01

    Highlights: • Cobalt oxide modified CBT-based ceramics were prepared and investigated in detail. • XRPD analysis revealed Co ions enter into B-site of CBT-based ceramics. • CBT-Co4 ceramics show the enhanced d_3_3 of 14 pC/N and T_c of 782 °C. • CBT-Co4 ceramics present the improved high-temperature resistivity. • Thermal depoling behavior indicates CBT-Co4 ceramics exhibit good thermal stability. - Abstract: Bismuth layer-structured ferroelectric (BLSF) calcium bismuth titanate (CaBi_4Ti_4O_1_5, CBT) piezoelectric ceramics with 0.0–1.0 wt.% cobalt oxide (Co_2O_3) have been prepared via a conventional solid-state reaction method. Microstructural morphology and electrical properties of cobalt oxide-modified CBT ceramics were investigated in detail. X-ray powder diffraction (XRPD) analysis revealed that the cobalt oxide-modified CBT ceramics have a pure four-layer Aurivillius-type structure. The piezoelectric properties of CBT ceramics were significantly enhanced by cobalt oxide modifications. The piezoelectric coefficient d_3_3 and Curie temperature T_c of 0.2 wt.% cobalt oxide-modified CBT ceramics (CBT-Co4) are 14 pC/N and 782 °C, respectively. The DC resistivity and thermal depoling behavior at elevated temperature indicated that the CBT-Co4 ceramics exhibit good thermal stability, demonstrating that the CBT-Co4 ceramics are potential materials for high temperature piezoelectric applications.

  14. New separation method of no-carrier-added {sup 47}Sc from titanium targets

    Energy Technology Data Exchange (ETDEWEB)

    Bartos, B.; Majkowska, A.; Kasperek, A.; Krajewski, S.; Bilewicz, A. [Institute of Nuclear Chemistry and Technology, Warszawa (Poland). Nuclear Chemistry and Radiochemistry Center

    2012-07-01

    Radionuclides with medium energy beta emission and a several day half-life are attractive candidates for radioimmunotherapy. Among the most promising in this category is {sup 47}Sc produced by fast neutron irradiation (E{sub n} > 1 MeV) of titanium target with high energy neutrons in {sup 47}Ti(n,p){sup 47}Sc nuclear reaction. In the previously reported production scheme the dissolution of the TiO{sub 2} target in hot concentrated H{sub 2}SO{sub 4} and evaporation of the resulting solution were the most time-consuming steps. The present paper describes new, simple and efficient production method of {sup 47}Sc, where the slow dissolution of the target is avoided. After irradiation in fast neutron flux {sup 47}TiO{sub 2} and Li{sub 2}{sup 47}TiF{sub 6} targets were dissolved in HF solutions. Next {sup 47}Sc was separated from the target using anion exchange resin Dowex 1 with 0.4 M HF + 0.06 M HNO{sub 3} solution as eluent. The eluted {sup 47}Sc was adsorbed on cation exchange resin and eluted with 0.5 M of ammonium acetate. The 47Sc separation yield in the proposed procedure is about 90% with the separation time less than 2 h. The obtained no-carrier-added {sup 47}Sc was used to label DOTATATE conjugate with 96% labeling yield. (orig.)

  15. Lifetime and g-factor measurements in 44Sc

    International Nuclear Information System (INIS)

    Chevallier, A.; Chavallier, J.; Gross, J.L.; Haas, B.; Schulz, N.; Styczen, J.; Toulemonde, M.

    1975-01-01

    The lifetimes of the 235 keV, 2 - state and 350 keV, 4 + state in 44 Sc have been measured via the 44 Ca(p, n) 44 Sc reaction with a pulsed proton beam. The time integral perturbed angular distribution technique with an external field was used to measure the precession angles of the 2 - and 4 + states populated by the 30 Si( 16 O, pnγ) 44 Sc reaction. The following values for the mean-lives and g-factors were obtained: π(2 - ) = 8.83(33) ns, g(2 - ) = 0.30(13) and π(4 + ) = 4.52(27)ns, g(4 + ) = 0.90(12). The results for the 2 - state support a rotational description of the negative parity states in 44 Sc. The magnetic moment of the 4 + state is compared to shell model predictions. (orig.) [de

  16. An orange emitting phosphor Lu2−xCaMg2Si2.9Ti0.1O12:xCe with pure garnet phase for warm white LEDs

    International Nuclear Information System (INIS)

    Chu, Yaoqing; Zhang, Qinghong; Xu, Jiayue; Li, Yaogang; Wang, Hongzhi

    2015-01-01

    A new silicate garnet phosphor, Lu 2−x CaMg 2 Si 2.9 Ti 0.1 O 12 :xCe was synthesized by a high temperature solid-state reaction under reductive atmosphere. X-ray diffraction (XRD) showed that the powder was pure garnet phase. The emission and excitation spectrum indicated that the Lu 2−x CaMg 2 Si 2.9 Ti 0.1 O 12 :xCe phosphors could absorb blue light in the spectral range of 400–550 nm efficiently and exhibit bright yellow–orange emission in the range of 520–750 nm. With the increase of Ce 3+ concentration, the emission band of Ce 3+ showed a red shift. Interestingly, the concentration quenching occurred when the Ce 3+ concentration exceeded 4 mol%. The temperature-dependent luminescent properties of the phosphors were discussed and the Lu 1.96 CaMg 2 Si 2.9 Ti 0.1 O 12 :0.04Ce phosphors showed good performances in color temperature (2430 K) and potential applications for warm white LEDs. - Graphical Abstract: This image shows that the phosphor of Lu 1.96 CaMg 2 Si 2.9 Ti 0.1 O 12 :0.04Ce can generate a uniform yellow tint under natural light illumination and emit orange–red light when excited by blue light. With a fixed 467 nm emission light, warm white light can be produced by this phosphor, which indicates that the phosphor is potentially applicable in warm white light emitting diodes based on GaN chips. - Highlights: • A new silicate garnet phosphor was synthesized by solid-state method. • Secondary phases can be avoided when a small amount of Si 4+ were replaced by Ti 4+ . • A broad emission band of Ce 3+ in the phosphors was described. • The phosphors are potentially applicable in warm white light emitting diodes

  17. Characterisation and dissolution studies on the uranium pyrochlore mineral betafite (Ca,U)_2(Nb,Ti,Ta)_2O_7

    International Nuclear Information System (INIS)

    McMaster, S.; Ram, R.; Tardio, J.; Bhargava, S.

    2014-01-01

    The pyrochlore group mineral, betafite (nominally (Ca,U)_2(Nb,Ti,Ta)_2O_7); is a refractory uranium mineral found in many ore deposits, including the currently mined deposit at Rössing, Namibia and the currently unmined deposit at Saima Massif, China. The decreasing abundance of “easy to leach” uranium minerals (i.e. uraninite), has led to interest in the extraction of uranium from refractory uranium minerals such as betafite. In the current study, three naturally occurring betafite mineral samples (obtained from Ambatofotsky and Miarinarivo, Madagascar (BAM and BMM respectively) and Silver Crater Mine, Canada (BSC)) were characterised using ex-situ high temperature X-Ray Diffraction (XRD), multi acid digestion / ICP-MS analysis (composition) and X-Ray Photoelectron Spectroscopy (XPS). Dissolution of the three samples was also investigated under conditions similar to those used in commercial tank based uranium leaching processes. XRD analysis showed that all three samples were highly metamict. Samples BMM and BSC showed no assignable diffraction lines before heat treating, whereas the XRD pattern obtained for sample BAM contained diffraction lines that confirmed the presence of crystalline anatase (TiO_2). Heat treatment studies on the samples showed that the betafite in the samples was converted into a crystalline form at 700°C in all 3 samples. Gangue minerals, rutile, Nb-rutile, UTiNb_2O_1_0, and studitite were also found to be present in the heat treated samples. Multi acid digestion ICP-MS analysis showed the natural samples contained between 16 and 26% w/w uranium as well as all the major elements present typically in betafite. XPS analysis was conducted on the unheated betafite samples. XPS analysis showed that the uranium in the samples was predominately in U"5"+ oxidation state. Some U"6"+ was also identified though this was most likely restricted to the outer surface of the samples. Dissolution studies (batch mode) were conducted under the following

  18. Non-isothermal crystallization kinetics of Fe{sub 2}O{sub 3}–CaO–SiO{sub 2} glass containing nucleation agent P{sub 2}O{sub 5}/TiO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Li, Bin, E-mail: stra-ceo@163.com; Wang, Yongya; Luo, Wenqin; Li, Jingfen [Huzhou University, Department of Material Chemistry (China); Li, Jianyou [Huzhou Central Hospital, Orthopedic Department (China)

    2017-03-15

    Fe{sub 2}O{sub 3}–CaO–SiO{sub 2} glass ceramics containing nucleation agent P{sub 2}O{sub 5}/TiO{sub 2} were prepared by sol-gel method. The samples were characterized by X-ray diffraction (XRD) and differential scanning calorimetry (DSC). The activation energy and kinetic parameters for crystallization of the samples were calculated by the Johnson-Mehi-Avrami (JMA) model and Augis-Bennett method according to the results of DSC. The results showed that the crystallization mechanism of Fe{sub 2}O{sub 3}–CaO–SiO{sub 2} glass, whose non-isothermal kinetic parameter n = 2.3, was consistent with surface crystallization of the JMA model. The kinetics model function of Fe{sub 2}O{sub 3}–CaO–SiO{sub 2} glass, f(α) = 2.3(1–α)[–ln(1–α)]{sup 0.57}, was also obtained. The addition of nucleation agent P{sub 2}O{sub 5}/TiO{sub 2} could reduce the activation energy, which made the crystal growth modes change from onedimensional to three-dimensional.

  19. Application of the Functional Theory in studying the adsorption of carbon monoxide on the TiO2 rutile surface of 110, defected surface and the surface modified by some metallic ions

    International Nuclear Information System (INIS)

    Le Kim Long; Phung Manh Quan; Tran Thi Thanh Van

    2012-01-01

    Density functional theory (DFT) is used to investigate properties of TiO 2 (110) surface with defects and metal-doped TiO 2 . The results of our calculations of structure of TiO 2 surface have been shown in good agreement with those of experiments and other ab-initio calculations. The differences of band structure between TiO 2 (110) and TiO 2 surface defected show that visible light can excite surface with defects easily. We also investigate density of states (DOS) of metal-doped surface (Li, Ca, Sc, V, Mo, Mn, Fe, Co, Ni) and find that the Mo-doped surface has very small band gap (∼ 0 eV). This surface may have higher photo-chemical activity in visible light. (author)

  20. Effect of porosity on the ferroelectric and piezoelectric properties of (Ba0.85Ca0.15)(Zr0.1Ti0.9)O3 piezoelectric ceramics

    DEFF Research Database (Denmark)

    Yap, Emily W.; Glaum, Julia; Oddershede, Jette

    2018-01-01

    The ferroelectric and piezoelectric properties of (Ba0.85Ca0.15)(Zr0.1Ti0.9)O3 (BCZT) ceramics were measured as a function of porosity. Porous BCZT ceramics were fabricated using the sacrificial fugitive technique. Two different pore morphologies were induced by adding polymeric microspheres...... and fibres as the pore-forming agents. Increasing porosity led to decreasing ferroelectric and piezoelectric properties due to a reduction of polarisable BCZT ceramic available. With the benefit of being a lead-free piezoelectric material, porous BCZT ceramics may be considered for acoustic impedance...

  1. The effects of boron in TiAl/Ti3Al

    International Nuclear Information System (INIS)

    Feng, C.R.; Michel, D.J.; Crowe, C.R.

    1989-01-01

    The authors discuss the TiAl/Ti 3 Al interfacial misfit dislocations structures investigated by TEM in Ti-45Al alloy and Ti-45Al/TiB 2 composite. For TiAl with c/a = 1.02, only a single set of misfit dislocation arrays are crystallographically possible; these were observed in Ti-45Al alloy. However, the observation of three sets of misfit dislocation arrays in the Ti-45Al/TiB 2 composite suggests that the occupation of octahedral sites in the TiAl structure by excess boron was responsible for a decrease in the c/a ratio leading to an increased fcc character of the TiAl at the TiAl/Ti 3 Al interface

  2. Structural studies of CaAl{sub 12}O{sub 19}, SrAl{sub 12}O{sub 19}, La{sub 2/3+δ}Al{sub 12-δ}O{sub 19}, and CaAl{sub 10}NiTiO{sub 19} with the hibonite structure; indications of an unusual type of ferroelectricity

    Energy Technology Data Exchange (ETDEWEB)

    Li, Jun; Medina, Elena A.; Sleight, Arthur W.; Subramanian, M.A. [Oregon State University, Corvallis, OR (United States). Dept. of Chemistry; Stalick, Judith K. [National Institute of Standards and Technology (NIST), Gaithersburg, MD (United States). Center for Neutron Research

    2016-08-01

    Various oxides with the hibonite structure were synthesized and structurally analyzed using powder neutron diffraction. The structure of CaAl{sub 12}O{sub 19} at 298 and 11 K shows dipoles that are apparently too dilute to order unless subjected to a suitable electric field. Magnetoplumbites, such as BaFe{sub 12}O{sub 19}, are isostructural with hibonite. These compounds possess ferromagnetic properties, which combined with the electric dipoles may influence multiferroic behavior. Our SrAl{sub 12}O{sub 19} sample showed two distinct hexagonal phases, a major phase with the normal hibonite structure and a minor phase having a closely related structure. Our sample of the defect hibonite phase La{sub 2/3+δ}Al{sub 12-δ}O{sub 19} shows a distinctly higher δ value (0.25) vs. that reported (∝ 0.15) for samples made from the melt. Finally, we used to advantage the negative scattering length of Ti to determine the site occupancies of Ni and Ti in CaAl{sub 10}NiTiO{sub 19}.

  3. Resistive switching in different forming states of Ti/Pr{sub 0.48}Ca{sub 0.52}MnO{sub 3} junctions

    Energy Technology Data Exchange (ETDEWEB)

    Park, Chanwoo; Herpers, Anja; Bruchhaus, Rainer; Dittmann, Regina [PGI-7, FZ Juelich (Germany); Verbeeck, Johan; Egoavil, Ricardo [EMAT, University of Antwerp (Belgium); Borgatti, Francesco [ISMN-CNR, Bologna (Italy); Panaccione, Giancarlo [Laboratorio Nazionale TASC-INFM-CNR, Trieste (Italy); Offi, Francesco [CNISM, Rome (Italy); Dipartimento di Fisica, Universita Roma Tre, Rome (Italy)

    2012-07-01

    The properties of thin oxide films and multilayers are strongly influenced by defects and, therefore, can be controllably tuned by the defect concentration at the interface. For example, due to the charge discontinuity at the SrTiO{sub 3}/KO-KNbO{sub 3}-NbO{sub 2}/SrTiO{sub 3} interface only one direction of polarization in KNbO{sub 3} film is stable. A switchable polarization in KNbO{sub 3} can be realized by creating (oxygen) defects at the interfaces. We carried out density functional theory (DFT) calculations based on the full potential linearized augmented planewave (FLAPW) method as implemented in the FLEUR code for studying the polar interface SrTiO{sub 3}/KNbO{sub 3} and a SrRuO{sub 3}/SrTiO{sub 3}/KNbO{sub 3} tunnel junction. The electronic transport properties of the switchable multiferroic SrRuO{sub 3}/SrTiO{sub 3}/KO-KNbO{sub 3}-NbO{sub 3}/SrTiO{sub 3}/SrRuO{sub 3} heterostructure have been investigated using an embedded Green-function approach. A strong dependence of the (magneto electric) transport properties on the polarization is observed.

  4. Magnetic dipole moment of the doubly closed-shell plus one proton nucleus $^{49}$Sc

    CERN Multimedia

    Gaulard, C V; Walters, W; Nishimura, K; Muto, S; Bingham, C R

    It is proposed to measure the magnetic moment of $^{49}$Sc by the Nuclear Magnetic Resonance on Oriented Nuclei (NMR-ON) method using the NICOLE on-line nuclear orientation facility. $^{49}$Sc is the neutron rich, doubly closed-shell, nucleus $^{48}$Ca plus one proton. Results will be used to deduce the effective g-factors in the $^{48}$Ca region with reference to nuclear structure and meson exchange current effects.

  5. Electrical and piezoelectric properties of BiFeO3 thin films grown on SrxCa1−xRuO3-buffered SrTiO3 substrates

    KAUST Repository

    Yao, Yingbang

    2012-06-01

    (001)-oriented BiFeO 3 (BFO) thin films were grown on Sr xCa 1-xRuO 3- (SCRO; x = 1, 0.67, 0.33, 0) buffered SrTiO 3 (001) substrates using pulsed laser deposition. The microstructural, electrical, ferroelectric, and piezoelectric properties of the thin films were considerably affected by the buffer layers. The interface between the BFO films and the SCRO-buffer layer was found to play a dominant role in determining the electrical and piezoelectric behaviors of the films. We found that films grown on SrRuO 3-buffer layers exhibited minimal electrical leakage while films grown on Sr 0.33Ca 0.67RuO 3-buffer layers had the largest piezoelectric response. The origin of this difference is discussed. © 2012 American Institute of Physics.

  6. Monitor of SC beam profiles

    CERN Document Server

    CERN PhotoLab

    1977-01-01

    A high-resolution secondary emission grid for the measurement of SC beam profiles. Modern techniques of metal-ceramic bonding, developed for micro-electronics, have been used in its construction. (See Annual Report 1977 p. 105 Fig. 12.)

  7. First coil for the SC

    CERN Multimedia

    CERN PhotoLab

    1955-01-01

    The coils for the SC magnet were stored in the large hangar of the Cointrin Airport (to make sure that they would be available before snow and ice would block the roads and canals from Belgium, where they were built).

  8. Effect of yttrium doping on the dielectric properties of CaCu{sub 3}Ti{sub 4}O{sub 12} thin film produced by chemical solution deposition

    Energy Technology Data Exchange (ETDEWEB)

    Saji, Viswanathan S., E-mail: vssaji@chosun.ac.k [Chosun University, College of Dentistry and 2nd Stage of Brain Korea 21 for College of Dentistry, Gwangju-501-759 (Korea, Republic of); Choe, Han Cheol [Chosun University, College of Dentistry and 2nd Stage of Brain Korea 21 for College of Dentistry, Gwangju-501-759 (Korea, Republic of)

    2009-05-29

    Pure and yttrium substituted CaCu{sub 3}Ti{sub 4-x}Y{sub x}O{sub 12-x/} {sub 2} (x = 0, 0.02, 0.1) thin films were prepared on boron doped silica substrate employing chemical solution deposition, spin coating and rapid thermal annealing. The phase and microstructure of the sintered films were examined using X-ray diffraction and scanning electron microscopy. Dielectric properties of the films were measured at room temperature using electrochemical impedance spectroscopy. Highly ordered polycrystalline CCTO thin film with bimodal grain size distribution was achieved at a sintering temperature of 800 {sup o}C. Yttrium doping was found to have beneficial effects on the dielectric properties of CCTO thin film. Dielectric parameters obtained for a CaCu{sub 3}Ti{sub 4-x}Y{sub x}O{sub 12-x} {sub /2} (x = 0.02) film at 1 KHz were k {approx} 2700 and tan {delta} {approx} 0.07.

  9. Structure and Dielectric Properties of (Sr0.2Ca0.488Nd0.208) TiO3-Li3NbO4 Ceramic Composites

    Science.gov (United States)

    Xia, C. C.; Chen, G. H.

    2017-12-01

    The new ceramic composites of (1-x) Li3NbO4-x (Sr0.2Ca0.488Nd0.208)TiO3 were prepared by the conventional solid state reaction method. The sintering behavior, phase composition, microstructure and microwave dielectric properties of the ceramics were investigated specially. The SEM and XRD results show that (1-x) Li3NbO4-x (Sr0.2Ca0.488Nd0.208) TiO3 (0.35≤x≤0.5) composites were composed of two phase, i.e. perovskite and Li3NbO4. With the increase of x, the ɛr increases from 27.1 to 38.7, Q×f decreases from 55000 GHz to 16770 GHz, and the τ f increases from -49 ppm/°C to 226.7 ppm/°C. The optimized dielectric properties with ɛr∼31.4, Q×f~16770GHz and τf~-8.1ppm/°C could be obtained as x=0.4 sintered at 1100°C for 4h. The as-prepared ceramic is expected to be used in resonators, filters, and other microwave devices.

  10. Effect of doping of trivalent cations Ga{sup 3+}, Sc{sup 3+}, Y{sup 3+} in Li{sub 1.3}Al{sub 0.3}Ti{sub 1.7} (PO{sub 4}){sub 3} (LATP) system on Li{sup +} ion conductivity

    Energy Technology Data Exchange (ETDEWEB)

    Kothari, Dharmesh H.; Kanchan, D.K., E-mail: dkkanchan.ssi@gmail.com

    2016-11-15

    We report the effect of trivalent cations dopants in the Li{sub 1.3}Al{sub 0.3−x}R{sub x}Ti{sub 1.7}(PO{sub 4}){sub 3} (R=Ga{sup 3+}, Sc{sup 3+}, Y{sup 3+}) NASICON ceramic system in the concentration range x=0.01,0.03,0.05,0.07, on the Li{sup +} ion conducting properties using impedance spectroscopy. The samples were prepared by solid state reaction method and characterized by X-Ray Diffraction and density measurements. The electrical properties were studied using impedance spectroscopy in frequency range 10 Hz to 20 MHz and temperature range 303 K to 423 K. Although the porosity of the material decreased with doping, the overall Li{sup +} ion conductivity of the system did not improve with doping. Ionic radii of the dopant cations was found to be an important factor in formation of impurity phases and low Li{sup +} ion conductivity. Gallium doped samples exhibited a higher Li{sup +} ion conductivity compared to its scandium and yttrium doped counterparts.

  11. Bioactivity studies on TiO2-bearing Na2O–CaO–SiO2–B2O3 glasses

    International Nuclear Information System (INIS)

    Jagan Mohini, G.; Sahaya Baskaran, G.; Ravi Kumar, V.; Piasecki, M.; Veeraiah, N.

    2015-01-01

    Soda lime silica borate glasses mixed with different concentrations of TiO 2 are synthesized by the melt-quenching technique. As a part of study on bioactivity of these glasses, the samples were immersed in simulated body fluid (SBF) solution for prolonged times (~ 21 days) during which weight loss along with pH measurements is carried out at specific intervals of time. The XRD and SEM analyses of post-immersed samples confirm the formation of crystalline hydroxyapatite layer (HA) on the surface of the samples. To assess the role of TiO 2 on the formation of HA layer and degradability of the samples the spectroscopic studies viz. optical absorption and IR spectral studies on post- and pre-immersed samples have been carried out. The analysis of the results of degradability together with spectroscopic studies as a function of TiO 2 concentration indicated that about 6.0 mol% of TiO 2 is the optimal concentration for achieving better bioactivity of these glasses. The presence of the maximal concentration octahedral titanium ions in this glass that facilitates the formation of HA layer is found to be the reason for such a higher bioactivity. - Highlights: • Soda lime silica borate glasses mixed with TiO 2 are synthesized. • Bioactivity of the glasses is studied by immersing them in SBF solution. • XRD and SEM studies indicated the formation of hydroxyapatite layer on the surface. • Quantum of degradability is the highest in the glasses mixed with 6.0 mol% of TiO 2. • The results are analyzed using IR and optical absorption studies

  12. On the possibility to measure 0νββ-decay nuclear matrix element for 48Ca

    International Nuclear Information System (INIS)

    Rodin, Vadim

    2011-01-01

    As shown in Ref. [2], the Fermi part M F 0ν of the total 0νββ-decay nuclear matrix element M 0ν can be related to the single Fermi transition matrix element between the isobaric analog state (IAS) of the ground state of the initial nucleus and the ground state of the final nucleus. The latter matrix element could be measured in charge-exchange reactions. Here we discuss a possibility of such a measurement for 48 Ca and estimate the cross-section of the reaction 48 Ti(n,p) 48 Sc(IAS).

  13. Correlative characterization of primary Al{sub 3}(Sc,Zr) phase in an Al–Zn–Mg based alloy

    Energy Technology Data Exchange (ETDEWEB)

    Li, J.H., E-mail: jie-hua.li@hotmail.com [Institute of Casting Research, Montanuniversität Leoben, A-8700 Leoben (Austria); Wiessner, M. [Materials Center Leoben Forschung GmbH, A-8700 Leoben (Austria); Albu, M. [Institute for Electron Microscopy and Nanoanalysis, Graz University of Technology, Center for Electron Microscopy (Austria); Wurster, S. [Department of Materials Physics, Montanuniversität Leoben, Erich Schmid Institute of Materials Science of the Austrian Academy of Sciences, A-8700 Leoben (Austria); Sartory, B. [Materials Center Leoben Forschung GmbH, A-8700 Leoben (Austria); Hofer, F. [Institute for Electron Microscopy and Nanoanalysis, Graz University of Technology, Center for Electron Microscopy (Austria); Schumacher, P. [Institute of Casting Research, Montanuniversität Leoben, A-8700 Leoben (Austria); Austrian Foundry Research Institute, A-8700 Leoben (Austria)

    2015-04-15

    Three-dimensional electron backscatter diffraction, focused ion beam, transmission electron microscopy and energy filtered transmission electron microscopy were employed to investigate the structural information of primary Al{sub 3}(Sc,Zr) phase, i.e. size, shape, element distribution and orientation relationship with the α-Al matrix. It was found that (i) most primary Al{sub 3}(Sc,Zr) phases have a cubic three-dimensional morphology, with a size of about 6–10 μm, (ii) most primary Al{sub 3}(Sc,Zr) phases are located within the α-Al matrix, and exhibit a cube to cube orientation relationship with the α-Al matrix, and (iii) a layer by layer growth was observed within primary Al{sub 3}(Sc,Zr) phases. Al, Cu, Si and Fe are enriched in the α-Al matrix between the layers of cellular eutectic Al{sub 3}(Sc,Zr) phase, while Sc, Ti and Zr are enriched in small Al{sub 3}(Sc,Zr) phases. A peritectic reaction and subsequent eutectic reaction between Al{sub 3}Sc and Al was proposed to interpret the observed layer by layer growth. This paper demonstrates that the presence of impurities (Fe, Si, Cu, Ti) in the diffusion field surrounding the growing Al{sub 3}(Sc,Zr) particle enhances the heterogeneous nucleation of Al{sub 3}(Sc,Zr) phases. - Highlights: • Most fine cubic primary Al{sub 3}(Sc,Zr) phases were observed within the α-Al matrix. • A layer by layer growth within primary Al{sub 3}(Sc,Zr) phase was observed. • A peritectic and subsequent eutectic reaction between Al{sub 3}Sc and Al was proposed. • Impurities in diffusion fields enhance heterogeneous nucleation of Al{sub 3}(Sc,Zr)

  14. The growth of hydroxyapatite on alkaline treated Ti-6Al-4V soaking in higher temperature with concentrated Ca2+/HPO42- simulated body fluid

    International Nuclear Information System (INIS)

    Lin, F.-H.; Hsu, Y.-S.; Lin, S.-H.; Chen, T.-M.

    2004-01-01

    In this study, calcium and phosphorous ions in the simulated body fluid (SBF) was be increased to increase the rate of precipitation of hydroxyapatite (HA). The soaking temperature in concentrated calcium and phosphorous ion-SBF (CP-SBF) was increased to reduce the nucleation energy of the HA, which lead to an early precipitation to shorten the treatment process. When the metallic substrates treated with 10 M NaOH aqueous solution and subsequently heated at 600 deg. C, a thin sodium titanium oxide layer was formed on the surfaces as the linking layer for HA and Ti-6Al-4V alloys. After Ti-6Al-4V alloys treated with alkali solution, it would soak into a simulated body fluid with higher concentration of calcium and phosphorous ions (CP-SBF) to increase the possibility of nucleation of HA. When Ti-6Al-4V alloys treated with alkali solution, subsequently heated at 600 deg. C, and then soaked into CP-SBF at a temperature of 80 deg. C, it could form a dense and thick (50 μm) bone-like hydroxyapatite layer on the surface. The HA layer was appeared on the surface of the Ti-alloy at the first week soaking, which was greatly shorten the coating process. In the research, the characteristics of the coating layer will be analyzed by the results of X-ray diffractometer (XRD), scanning electron microscope (SEM), and Fourier transformation infrared (FT-IR)

  15. Ca isotopes in refractory inclusions

    International Nuclear Information System (INIS)

    Niederer, F.R.; Papanastassiou, D.A.

    1984-01-01

    We report measurements of the absolute isotope abundance of Ca in Ca-Al-rich inclusions from the Allende and Leoville meteorites. Improved high precision measurements are reported also for 46 Ca. We find that nonlinear isotope effects in Ca are extremely rare in these inclusions. The absence of nonlinear effects in Ca, except for the effects in FUN inclusions, is in sharp contrast to the endemic effects in Ti. One fine-grained inclusion shows an excess of 46 Ca of (7 +- 1) per mille, which is consistent with addition of only 46 Ca or of an exotic (*) component with 46 Ca* approx. 48 Ca*. FUN inclusion EK-1-4-1 shows a small 46 Ca excess of (3.3 +- 1.0) per mille; this confirms that the exotic Ca components in EK-1-4-1 were even more deficient in 46 Ca relative to 48 Ca than is the case for normal Ca. The Ca in the Ca-Al-rich inclusions shows mass dependent isotope fractionation effects which have a range from -3.8 to +6.7 per mille per mass unit difference. This range is a factor of 20 wider than the range previously established for bulk meteorites and for terrestrial and lunar samples. Ca and Mg isotope fractionation effects in the Ca-Al-rich inclusions are common and attributed to kinetic isotope effects. (author)

  16. Development of standardized radioactive 46Sc solution

    International Nuclear Information System (INIS)

    Du Hongshan; Jia Zhang; Yu Yiguang; Sun Naiyao

    1988-01-01

    A method of preparation of standardized radioactive 46 Sc solution is developed. The separation of 46 Sc, the composition of 46 Sc solution and its stability, and radioactivity measurement of 46 Sc are systematically studied. The results obtained in the study and in the applications in many laboratories have shown that our method is effective and reliable

  17. High-resolution clean-sc

    NARCIS (Netherlands)

    Sijtsma, P.; Snellen, M.

    2016-01-01

    In this paper a high-resolution extension of CLEAN-SC is proposed: HR-CLEAN-SC. Where CLEAN-SC uses peak sources in “dirty maps” to define so-called source components, HR-CLEAN-SC takes advantage of the fact that source components can likewise be derived from points at some distance from the peak,

  18. 45Ti extraction using hydroxamate resin

    DEFF Research Database (Denmark)

    Gagnon, K.; Severin, Gregory; Barnhart, T. E.

    2012-01-01

    As an attractive radionuclide for positron emission tomography, this study explores the extraction and reactivity of 45Ti produced via the 45Sc(p,n)45Ti reaction on a GE PETtrace. Using a small hydroxamate column, we have demonstrated an overall recovery of >50% of 45Ti in ~1 mL of 1M oxalic acid...

  19. Laachite, (Ca,Mn){sub 2}Zr{sub 2}Nb{sub 2}TiFeO{sub 14}, a new zirconolite-related mineral from the Eifel volcanic region, Germany

    Energy Technology Data Exchange (ETDEWEB)

    Chukanov, Nikita V. [Institute of Problems of Chemical Physics, Chernogolovka (Russian Federation); Krivovichev, Sergey V.; Pakhomova, Anna S. [St. Petersburg State Univ. (Russian Federation). Faculty of Crystallography; Pekov, Igor V.; Vigasina, Marina F. [Moscow State Univ. (Russian Federation). Faculty of Geology; Schaefer, Christof [Suedwestdeutsche Salzwerke AG, Heilbronn (Germany); Van, Konstantin V. [Russian Academy of Sciences, Chernogolovka (Russian Federation). Inst. of Experimental Mineralogy

    2014-02-15

    The new mineral laachite was discovered in a sanidinite specimen from the Laach Lake (Laacher See) volcano, Eifel region, Rheinland-Pfalz, Germany. Associated minerals are sanidine, allanite-(Ce), baddeleyite, hau¨yne, hedenbergite, intermediate members of the jacobsite-magnetite series, phlogopite, rhodonite, spessartine, tephroite, thorite, zircon, and a pyrochlore-group mineral. Laachite is deep brownish-red, has an adamantine lustre, and is translucent; the streak is brownish red. It forms longprismatic crystals up to 0.02 x 0.04 x 0.5 mm, which are present as random intergrowths and twins in cavities within sanidinite. The density calculated from the empirical formula is 5.417 g/cm{sup 3}. The mean refractive index calculated from the Gladstone-Dale relationship is 2.26. The Raman spectrum shows the absence of hydrogen-bearing groups. The chemical composition is (electron microprobe, mean of 5 analyses, wt. %): CaO 4.29, MnO 9.42, FeO 5.73, Y{sub 2}O{sub 3} 2.56, La{sub 2}O{sub 3} 2.00, Ce{sub 2}O{sub 3} 6.37, Nd{sub 2}O{sub 3} 2.22, Al{sub 2}O{sub 3} 0.99, ThO{sub 2} 7.75, TiO{sub 2} 10.98, ZrO{sub 2} 19.39, Nb{sub 2}O{sub 5} 27.82, total 99.52. The empirical formula based on 14 O atoms is: (Ca{sub 0.66}Mn{sub 0.37}Th{sub 0.25}Y{sub 0.20}La{sub 0.11}Ce{sub 0.34}Nd{sub 0.11})(Zr{sub 1.3} {sub 6}Mn{sub 0.64})(Nb{sub 1.81}Ti{sub 1.19})(Fe{sub 0.69}Al{sub 0.17}Mn{sub 0.14})O{sub 14.00}. The simplified formula, taking into account the structural data, is: (Ca,Mn){sub 2}(Zr,Mn){sub 2}Nb{sub 2}TiFeO{sub 14}. Laachite is monoclinic, space group C2/c, a = 7.3119(5), b = 14.1790(10), c = 10.1700(7)Aa, β = 90.072(2), V = 1054.38(1) Aa{sup 3}, Z = 4. The crystal structure was solved using single-crystal X-ray diffraction data. Laachite is a monoclinic analogue of zirconolite-3O, CaZrTi{sub 2}O{sub 7}, with Nb dominant over Ti in the octahedral sites Nb1 and Nb2 and Fe dominant in a site with four-fold coordination. The strongest lines of the powder X-ray diffraction

  20. Sc-45 nuclear magnetic resonance analysis of precipitation in dilute Al-Sc alloys

    NARCIS (Netherlands)

    Celotto, S; Bastow, TJ

    Nuclear magnetic resonance (NMR) with Sc-45 is used to determine the solid solubility of scandium in aluminium and to follow the precipitation of Al3Sc during the ageing of an Al-0.06 at.% Sc alloy via the two fully resolved peaks, corresponding to Sc in the solid solution Al matrix and to Sc in the

  1. Crystal structure and luminescence properties of (Ca{sub 2.94-x}Lu{sub x}Ce{sub 0.06})(Sc{sub 2-y}Mg{sub y})Si{sub 3}O{sub 12} phosphors for white LEDs with excellent colour rendering and high luminous efficiency

    Energy Technology Data Exchange (ETDEWEB)

    Liu Yongfu; Zhang Xia; Hao Zhendong; Lu Wei; Liu Xingyuan; Zhang Jiahua [Key Laboratory of Excited State Processes, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 3888 Eastern South Lake Road, Changchun 130033 (China); Wang Xiaojun, E-mail: zhangjh@ciomp.ac.cn [Department of Physics, Georgia Southern University, Statesboro, GA 30460 (United States)

    2011-02-23

    Lu-modified (Ca{sub 2.94-x}Lu{sub x}Ce{sub 0.06})(Sc{sub 2-y}Mg{sub y})Si{sub 3}O{sub 12} (CLSMS : Ce{sup 3+}) yellow emitting phosphors are prepared by a solid-state reaction. Controllable luminescent intensity and emitting colour are studied as a function of Lu and Mg contents. Fixing the Mg content to be 1, the effect of Lu content on crystal phase formation, luminescence properties and temperature characteristics is studied. It is revealed that the Lu-induced luminescent enhancement is the result of an increase in absorbance of Ce{sup 3+} rather than the internal quantum efficiency. Intense and broadband emission is realized by controlling the Lu content to obtain a pure CLSMS crystal phase. The maximum luminescence intensity is obtained at x = 0.54, which is as high as 156% of the Lu-free phosphor. The Lu-containing phosphor also exhibits better temperature characteristics for its big activation energy (0.20 eV) than the Lu-free one (0.18 eV). Combining the present phosphor with a blue light-emitting diode (LED) chip, a white LED with an excellent colour rendering index R{sub a} of 86 and a high luminous efficiency of 86 lm W{sup -1} is obtained. The results of the present study demonstrate that the CLSMS : Ce{sup 3+} phosphors show a good performance and are attractive candidates for commercial applications when used in white LEDs.

  2. [Roberts-SC phocomelia syndrome].

    Science.gov (United States)

    Musfeld, D A; Bühler, E M; Heinzl, S

    2001-01-01

    The Roberts-SC phocomelia syndrome is a rare autosomal recessive inherited disorder clinically manifested by tetraphocomelia, pre- and postnatal growth retardation, and craniofacial abnormalities (skull, eyes, lip, and palate), accompanied at times by centromer puffing and splitting, renal abnormalities, heart defect, clitoral or penile enlargement, and bilateral corneal opacities. Mental retardation is common in surviving patients.

  3. Rotary condenser for SC2

    CERN Multimedia

    1975-01-01

    During 1975 the SC2 performance was improved among other things by redesigning some of the elements of the ROTCO (Annual Report 1975, p. 55). The photo shows an interior wiew of the housing of the rotary condenser and of the sixteen sets of shaped stator blades.

  4. Magnetodielectric effect in (1 - x)(Ba0.88Ca0.12)(Ti0.88Zr0.12)O3 - xCoFe2O4

    Science.gov (United States)

    Pan, Pengfei; Tao, Jin; Ma, Fusheng; Zhang, Ning

    2018-05-01

    Magnetodielectric (MD) materials have attracted considerable attention due to their intriguing physics and potential future applications. In this work, polycrystalline (1 - x)(Ba0.88Ca0.12)(Ti0.88Zr0.12)O3 - xCoFe2O4 (x = 0.10, 0.20, 0.30, 0.40) ceramic have been prepared via sol-gel method. The room temperature magnetic and ferroelectric behaviors of the synthesized composites were investigated. For the composite with x = 0.40, a MD ratio of 5.37% was achieved under a magnetic field of 1.5 T at f = 1 kHz. The measured "butterfly hysteresis" MD curves exhibit an obvious dielectric anomaly. Theoretical analysis suggests that the observed magnetodielectric effect is attributed to the magnetoresistance effect and magnetoelectric coupling.

  5. Large Electrocaloric Effect in Lead-Free (Ba0.85Ca0.15)(Zr0.1Ti0.9)O3 Ceramics Prepared via Citrate Route

    Science.gov (United States)

    Shi, Jing; Zhu, Rongfeng; Liu, Xing; Yuan, Ningyi; Ding, Jianning; Luo, Haosu

    2017-01-01

    The 1 wt % Li-doped (Ba0.85Ca0.15)(Zr0.1Ti0.9)O3 (BCZT-Li) ceramics prepared by the citrate method exhibit improved phase purity, densification and electrical properties, which provide prospective possibility to develop high-performance electrocaloric materials. The electrocaloric effect was evaluated by phenomenological method, and the BCZT-Li ceramics present large electrocaloric temperature change ∆T, especially large electrocaloric responsibility ξ = ∆Tmax/∆Emax, which can be comparable to the largest values reported in the lead-free piezoelectric ceramics. The excellent electrocaloric effect is considered as correlating with the coexistence of polymorphic ferroelectric phases, which are detected by the Raman spectroscopy. The large ξ value accompanied by decreased Curie temperature (around 73 °C) of the BCZT-Li ceramics prepared by the citrate method presents potential applications as the next-generation solid-state cooling devices. PMID:28927004

  6. Large Electrocaloric Effect in Lead-Free (Ba0.85Ca0.15(Zr0.1Ti0.9O3 Ceramics Prepared via Citrate Route

    Directory of Open Access Journals (Sweden)

    Jing Shi

    2017-09-01

    Full Text Available The 1 wt % Li-doped (Ba0.85Ca0.15(Zr0.1Ti0.9O3 (BCZT-Li ceramics prepared by the citrate method exhibit improved phase purity, densification and electrical properties, which provide prospective possibility to develop high-performance electrocaloric materials. The electrocaloric effect was evaluated by phenomenological method, and the BCZT-Li ceramics present large electrocaloric temperature change ∆T, especially large electrocaloric responsibility ξ = ∆Tmax/∆Emax, which can be comparable to the largest values reported in the lead-free piezoelectric ceramics. The excellent electrocaloric effect is considered as correlating with the coexistence of polymorphic ferroelectric phases, which are detected by the Raman spectroscopy. The large ξ value accompanied by decreased Curie temperature (around 73 °C of the BCZT-Li ceramics prepared by the citrate method presents potential applications as the next-generation solid-state cooling devices.

  7. Microstrain engineered magnetic properties in Bi1-x Ca x Fe1-y Ti y O3-δ nanoparticles: deviation from Néel’s 1/d size-dependent magnetization behaviour

    Science.gov (United States)

    Mocherla, Pavana S. V.; Sahana, M. B.; Gopalan, R.; Ramachandra Rao, M. S.; Nanda, B. R. K.; Sudakar, C.

    2017-10-01

    Magnetization of antiferromagnetic nanoparticles is known to generally scale up inversely to their diameter (d) according to Néel’s model. Here we report a deviation from this conventional linear 1/d dependence, altered significantly by the microstrain, in Ca and Ti substituted BiFeO3 nanoparticles. Magnetic properties of microstrain-controlled Bi1-x Ca x Fe1-y Ti y O3-δ (y  =  0 and x  =  y) nanoparticles are analyzed as a function of their size ranging from 18 nm to 200 nm. A complex interdependence of doping concentration (x or y), annealing temperature (T), microstrain (ɛ) and particle size (d) is established. X-ray diffraction studies reveal a linear variation of microstrain with inverse particle size, 1/d nm-1 (i.e. ɛ · d  =  16.5 nm·%). A rapid increase in the saturation magnetization below a critical size d c ~ 35 nm, exhibiting a (1/d) α (α  ≈  2.6) dependence, is attributed to the influence of microstrain. We propose an empirical formula M \\propto (1/d)ɛ β (β  ≈  1.6) to highlight the contributions from both the size and microstrain towards the total magnetization in the doped systems. The magnetization observed in nanoparticles is thus, a result of the competing magnetic contribution from the terminated spin cycloid on the surface and counteracting microstrain present at a given size.

  8. A-site substitution effect of strontium on bismuth layered CaBi{sub 4}Ti{sub 4}O{sub 15} ceramics on electrical and piezoelectric properties

    Energy Technology Data Exchange (ETDEWEB)

    Tanwar, Amit, E-mail: amit07tanwar@gmail.com [Department of Physics and Astrophysics, University of Delhi, Delhi 110007 (India); Verma, Maya; Gupta, Vinay; Sreenivas, K. [Department of Physics and Astrophysics, University of Delhi, Delhi 110007 (India)

    2011-10-17

    Strontium substituted CaBi{sub 4}Ti{sub 4}O{sub 15} ceramics with the chemical formula Ca{sub 1-x}Sr{sub x}Bi{sub 4}Ti{sub 4}O{sub 15} (CSBT) (x = 0.0-1.0) have been prepared through conventional solid state route. The formation of single phase material with orthorhombic structure was verified from X-ray diffraction with incorporation of Sr substitution. Decrease in a-axis displacement of Bi ion in the perovskite structure in the CSBT ceramics were observed from the relative changes in soft mode (20 cm{sup -1}) in the Raman spectra, and increase in Sr incorporation shows the shift in ferroelectric to paraelectric phase transition temperature. The dielectric properties for all the CSBT ceramic compositions are studied as a function of temperature over the frequency range of 100 Hz-1 MHz. Curie's temperature was found to be function of Sr substitution and with increase in the Sr concentration the phase transition becomes sharper and phase transition temperature gets shifted towards lower temperature (790-545 deg. C). The behavior of ac conductivity as a function of frequency (100 Hz-1 MHz) at low temperature (<500 deg. C) follows the power law and attributed to hopping conduction mechanism. Sr substitution results in the increase in piezoelectric coefficients (d{sub 33}) whereas piezoelectric charge coefficient values were found comparable to that of PZT at room temperature. Relative changes in soft modes due to Sr incorporation results in high piezoelectricity in the CSBT ceramics.

  9. Correlation between atomic structure and magnetic properties of La0.7Ca0.3MnO3 thin films grown on SrTiO3 (1 0 0)

    International Nuclear Information System (INIS)

    Rubio-Zuazo, J.; Andres, A. de; Taboada, S.; Prieto, C.; Martinez, J.L.; Castro, G.R.

    2005-01-01

    The crystallographic structure of La 0.7 Ca 0.3 MnO 3 (LCMO) ultra-thin films grown on SrTiO 3 (0 0 1) has been investigated by surface X-ray diffraction (SXD) and the correlation between their transport and magnetic properties and crystallographic structure is discussed. LCMO thin films in a thickness range between 2.4 and 27 nm were grown by DC-sputtering on SrTiO 3 (0 0 1). We distinguish two different crystallographic structures associated to the 2.4 and 27 nm thin films, respectively. The 27 nm film structure corresponds to a tetragonal perovskite (space group Pbnm), as has been reported for bulk LCMO. For the 2.4 nm film the La/Ca ions are located at the regular position of an ideal perovskite and the MnO 6 octahedrons are aligned along the c-axis. The MnO 2 stacking layer (basal plane) is distorted and coplanar to the a-b crystallographic axis with an anti-correlation between octahedron layers. This observed distortion is not compatible with the Pbnm space group. The new phase, which cannot be excluded to coexist at the interface of thicker films, can be described, as an example, through an I4/mcm or Pbcn space group. Based on the observed structure, plausible models to explain their transport and magnetic behaviour are proposed. For the 2.4 nm film, an octahedron in-plane (basal plane) distortion induced by the substrate is observed. Thicker films behave structurally and magnetically as bulk-like materials

  10. Determination of 46Sc in water

    International Nuclear Information System (INIS)

    Huo Bijun; Ji Zhaogang; Wang Juying

    1985-01-01

    Analytical procedures for the determination of 46 Sc in water is presented. 46 Sc in water is concentrated with Fe(OH) 3 ; Then 46 Sc is extracted with TBP and purified by precipitating it with Amygdalic Acid. Finally the precipitate is ignited into Sc 2 O 3 under 800 deg C and β-activity is counted. In this method chemical reeovery for Sc was (90.8 +- 2.8)% and radiochemical recovery for 46 Sc was (89.8 +- 3.8)%. Purification factors for some of the relevant Radionuclides ranged from 10 3 to 10 5

  11. Elastic and inelastic {alpha}-scattering cross-sections obtained with the 44 MeV fixed energy Saclay cyclotron on separated targets of {sup 24}Mg, {sup 25}Mg, {sup 26}Mg, {sup 40}Ca, {sup 46}Ti, {sup 48}Ti, {sup 50}Ti, {sup 52}Cr, {sup 54}Fe, {sup 56}Fe, {sup 58}Fe, {sup 58}Ni, {sup 60}Ni, {sup 62}Ni, {sup 64}Ni, {sup 63}Cu, {sup 65}Cu, {sup 64}Zn, {sup 112}Sn, {sup 114}Sn, {sup 116}Sn, {sup 118}Sn, {sup 120}Sn, {sup 122}Sn, {sup 124}Sn and {sup 208}Pb using the Saclay fixed-energy cyclotron; Sections efficaces differentielles elastiques et inelastiques obtenues par diffusion de particules {alpha} de 44 MeV sur des cibles de {sup 24}Mg, {sup 25}Mg, {sup 26}Mg, {sup 40}Ca, {sup 46}Ti, {sup 48}Ti, {sup 50}Ti, {sup 52}Cr, {sup 54}Fe, {sup 56}Fe, {sup 58}Fe, {sup 58}Ni, {sup 60}Ni, {sup 62}Ni, {sup 64}Ni, {sup 63}Cu, {sup 65}Cu, {sup 64}Zn, {sup 112}Sn, {sup 114}Sn, {sup 116}Sn, {sup 118}Sn, {sup 120}Sn, {sup 122}Sn, {sup 124}Sn et {sup 208}Pb au cyclotron a energie fixe de saclay

    Energy Technology Data Exchange (ETDEWEB)

    Bruge, G [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires. Departement de physique nucleaire, service de physique nucleaire a moyenne energie

    1967-01-01

    This report contains elastic and inelastic {alpha}-scattering cross-sections obtained with the 44 MeV fixed energy Saclay cyclotron on Mg, Ca, Ti, Cr, Fe, Ni, Co, Zn, Sn and Pb enriched targets. (author) [French] Ce rapport contient les tableaux des sections efficaces differentielles obtenues par diffusion elastique et inelastique des particules {alpha} de 44 MeV, fournies par le cyclotron a energie fixe de Saclay, sur des cibles d'isotopes separes de Mg, Ca, Ti, Cr, Fe, Ni, Co, Zn, Sn et Pb. (auteur)

  12. Effect of surface chemistries and characteristics of Ti6Al4V on the Ca and P adsorption and ion dissolution in Hank's ethylene diamine tetra-acetic acid solution.

    Science.gov (United States)

    Chang, E; Lee, T M

    2002-07-01

    This study examined the influence of chemistries and surface characteristics of Ti6Al4V on the adsorption of Ca and P species and ion dissolution behavior of the material exposed in Hank's solution with 8.0 mM ethylene diamine tetra-acetic acid at 37 degrees C. The variation of chemistries of the alloy and nano-surface characteristics (chemistries of nano-surface oxides, amphoteric OH group adsorbed on oxides, and oxide thickness) was effected by surface modification and three passivation methods (34% nitric acid passivation. 400 degrees C heated in air, and aged in 100 degrees C water). X-ray photoelectron spectroscopy and Auger electron spectroscopy were used for surface analyses. The chemistries of nano-surface oxides in a range studied should not change the capability of Ca and P adsorption. Nor is the capability affected significantly by amphoteric OH group and oxide thickness. However, passivations influence the surface oxide thickness and the early stage ion dissolution rate of the alloy. The rate-limiting step of the rate can be best explained by metal-ion transport through the oxide film, rather than hydrolysis of the film. Variation of the chemistries of titanium alloy alters the electromotive force potential of the metal, thereby affecting the corrosion and ion dissolution rate.

  13. Magnetic moment of {sup 48}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Ohtsubo, T., E-mail: tohtsubo@np.gs.niigata-u.ac.jp; Kawamura, Y.; Ohya, S. [Niigata University, Department of Physics (Japan); Izumikawa, T. [Niigata University, Radioisotope Center (Japan); Nishimura, K. [Toyama University, Faculty of Engineering (Japan); Muto, S. [Neutron Science Laboratory, KEK (Japan); Shinozuka, T. [Tohoku University, Cyclotron and Radioisotope Center (Japan)

    2007-11-15

    Nuclear magnetic resonances were measured for {sup 48}Sc and {sup 44m}Sc oriented at 8 mK in an Fe host metal. The magnetic hyperfine splitting frequencies at an external magnetic field of 0.2 T were determined to be 63.22(11) MHz and 64.81(1) MHz for {sup 48}Sc and {sup 44m}Sc, respectively. With the known magnetic moment of {mu}({sup 44m}Sc)=+3.88 (1) {mu}{sub N}, the magnetic moment of {sup 48}Sc is deduced as {mu}({sup 44}Sc)=+3.785(12) {mu}{sub N}. The measured magnetic moment of {sup 48}Sc is discussed in terms of the shell model using the effective interactions.

  14. Improved ferroelectric/piezoelectric properties and bright green/UC red emission in (Li,Ho)-doped CaBi4Ti4O15 multifunctional ceramics with excellent temperature stability and superior water-resistance performance.

    Science.gov (United States)

    Xiao, Ping; Guo, Yongquan; Tian, Mijie; Zheng, Qiaoji; Jiang, Na; Wu, Xiaochun; Xia, Zhiguo; Lin, Dunmin

    2015-10-21

    Multifunctional materials based on rare earth ion doped ferro/piezoelectrics have attracted considerable attention in recent years. In this work, new lead-free multifunctional ceramics of Ca1-x(LiHo)x/2Bi4Ti4O15 were prepared by a conventional solid-state reaction method. The great multi-improvement in ferroelectricity/piezoelectricity, down/up-conversion luminescence and temperature stability of the multifunctional properties is induced by the partial substitution of (Li0.5Ho0.5)(2+) for Ca(2+) ions in CaBi4Ti4O15. All the ceramics possess a bismuth-layer structure, and the crystal structure of the ceramics is changed from a four layered bismuth-layer structure to a three-layered structure with the level of (Li0.5Ho0.5)(2+) increasing. The ceramic with x = 0.1 exhibits simultaneously, high resistivity (R = 4.51 × 10(11)Ω cm), good piezoelectricity (d33 = 10.2 pC N(-1)), high Curie temperature (TC = 814 °C), strong ferroelectricity (Pr = 9.03 μC cm(-2)) and enhanced luminescence. These behaviours are greatly associated with the contribution of (Li0.5Ho0.5)(2+) in the ceramics. Under the excitation of 451 nm light, the ceramic with x = 0.1 exhibits a strong green emission peak centered at 545 nm, corresponding to the transition of the (5)S2→(5)I8 level in Ho(3+) ions, while a strong red up-conversion emission band located at 660 nm is observed under the near-infrared excitation of 980 nm at room temperature, arising from the transition of (5)F5→(5)I8 levels in Ho(3+) ions. Surprisingly, the excellent temperature stability of ferroelectricity/piezoelectricity/luminescence and superior water-resistance behaviors of piezoelectricity/luminescence are also obtained in the ceramic with x = 0.1. Our study suggests that the present ceramics may have potential applications in advanced multifunctional devices at high temperature.

  15. SHMUTZ & PROTON-DIAMANT H + Irradiated/Written-Hyper/Super-conductivity(HC/SC) Precognizance/Early Experiments Connections: Wet-Graphite Room-Tc & Actualized MgB2 High-Tc: Connection to Mechanical Bulk-Moduli/Hardness: Diamond Hydrocarbon-Filaments, Disorder, Nano-Powders:C,Bi,TiB2,TiC

    Science.gov (United States)

    Wunderman, Irwin; Siegel, Edward Carl-Ludwig; Lewis, Thomas; Young, Frederic; Smith, Adolph; Dresschhoff-Zeller, Gieselle

    2013-03-01

    SHMUTZ: ``wet-graphite''Scheike-....[Adv.Mtls.(7/16/12)]hyper/super-SCHMUTZ-conductor(S!!!) = ``wet''(?)-``graphite''(?) = ``graphene''(?) = water(?) = hydrogen(?) =ultra-heavy proton-bands(???) = ...(???) claimed room/high-Tc/high-Jc superconductOR ``p''-``wave''/ BAND(!!!) superconductIVITY and actualized/ instantiated MgB2 high-Tc superconductors and their BCS- superconductivity: Tc Siegel[ICMAO(77);JMMM 7,190(78)] connection to SiegelJ.Nonxline-Sol.40,453(80)] disorder/amorphous-superconductivity in nano-powders mechanical bulk/shear(?)-moduli/hardness: proton-irradiated diamond, powders TiB2, TiC,{Siegel[Semis. & Insuls.5:39,47, 62 (79)])-...``VS''/concommitance with Siegel[Phys.Stat.Sol.(a)11,45(72)]-Dempsey [Phil.Mag. 8,86,285(63)]-Overhauser-(Little!!!)-Seitz-Smith-Zeller-Dreschoff-Antonoff-Young-...proton-``irradiated''/ implanted/ thermalized-in-(optimal: BOTH heat-capacity/heat-sink & insulator/maximal dielectric-constant) diamond: ``VS'' ``hambergite-borate-mineral transformable to Overhauser optimal-high-Tc-LiBD2 in Overhauser-(NW-periodic-table)-Land: CO2/CH4-ETERNAL-sequestration by-product: WATER!!!: physics lessons from

  16. Electrical and mechanical properties of 0.5Ba (Zr0.2Ti0.8)O3-0.5 (Ba0.7Ca0.3)TiO3 (BZT-BCT) lead free ferroelectric ceramics reinforced with Al2O3 nano-oxide

    International Nuclear Information System (INIS)

    Adhikari, Prativa; Mazumder, R.

    2014-01-01

    Piezoelectric ceramics are widely used as actuator, resonator, and spark igniter. Recently, much attention has been paid to prepare 0.5Ba (Zr 0.2 Ti 0.8 )O 3 -0.5 (Ba 0.7 Ca 0.3 )TiO 3 (BZT-BCT) piezoelectric ceramics because of its good dielectric, piezoelectric properties and environment friendly nature. However, piezoelectric ceramics based on BaTiO 3 suffer from low reliability and poor mechanical properties such as strength and toughness. For practical application improvement of the mechanical properties of BaTiO 3 -based ceramics is strongly required. A novel method has been used to improve the mechanical properties of structural ceramics by reinforcement of oxide (Al 2 O 3 , MgO, ZrO 2 and Stabilized-ZrO 2 ) or non-oxide (SiC) particles. It is well known that electrical properties of ferroelectric ceramics generally degrade with non-ferroelectric additives and decrease in sinterability usually encountered with refractory oxide additives. Use of nano-oxide additives may drastically reduce the amount of additive and electrical property may not degrade much. In this report we would show the electrical and mechanical properties of BZT-BCT with Al 2 O 3 nano oxide additive. Modified BZT-BCT nanocomposites were prepared by mixing and sintering of solid state synthesized Zr, Ca modified barium titanate powder and small amount (0.1-2.0 vol %) of nano-oxides, i.e. Al 2 O 3 . Effect of sintering temperature, time, particle size of the nano-oxide additives on electrical (dielectric constant, loss factor, Curie temperature, d 33 ) and mechanical (flexural strength, fracture toughness, hardness) properties were studied. We obtained ∼ 94% dense BZT-BCT reinforced with Al 2 O 3 nano-oxide at 1300℃ without degrading electrical properties (dielectric constant (4850), low dissipation factor (0.0242)) and superior mechanical properties (flexural strength - 60.3 MPa, Vickers hardness-750-800 MPa). (author)

  17. Evaluation of the thermoluminescent detector answers of CaSO4:Dy, LiF:Mg,Ti and micro LiF:Mg,Ti in photon clinical beams dosimetry using water simulator

    International Nuclear Information System (INIS)

    Matsushima, Luciana C.; Veneziani, Glauco R.; Campos, Leticia L.

    2011-01-01

    This paper perform the comparative study of thermoluminescent answer of calcium sulfate dosemeter doped with dysprosium (DaSO 4 :Dy) produced by the IPEN, Sao Paulo, with answer of lithium fluoride dosemeters doped with magnesium and titanium (LiF:Mg, Ti) in the dosimetry of clinical beams of photons (6 and 15 MV) by using water simulator object. Dose-answer curves were obtained for gamma radiation of cobalt-60 in the air and in conditions of electronic equilibrium (plate of PMMA), and clinical photons of CLINAC model 2100C accelerators of the two evaluated hospitals: Hospital das Clinicas of the Faculty of Medicine of Sao Paulo university and Hospital Albert Einstein. It was also evaluated the sensitivity and reproduction of the three dosemeters

  18. Evaluation of the thermoluminescent detector answers of CaSO{sub 4}:Dy, LiF:Mg,Ti and micro LiF:Mg,Ti in photon clinical beams dosimetry using water simulator; Avaliacao da resposta de detectores termoluminescentes de CaSO4:Dy, LiF:Mg,Ti e microLiF:Mg,Ti na dosimetria de feixes clinicos de fotons utilizando simulador de agua

    Energy Technology Data Exchange (ETDEWEB)

    Matsushima, Luciana C.; Veneziani, Glauco R.; Campos, Leticia L., E-mail: lmatsushima@usp.b, E-mail: veneziani@ipen.b, E-mail: lcrodri@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (GMR/IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Gerencia de Metrologia das Radiacoes; Sakuraba, Roberto K.; Cruz, Jose C. da, E-mail: rsakuraba@einstein.b, E-mail: jccruz@einstein.b [Sociedade Beneficente Israelita Brasileira, Sao Paulo, SP (Brazil). Hospital Albert Einstein (HAE)

    2011-10-26

    This paper perform the comparative study of thermoluminescent answer of calcium sulfate dosemeter doped with dysprosium (DaSO{sub 4}:Dy) produced by the IPEN, Sao Paulo, with answer of lithium fluoride dosemeters doped with magnesium and titanium (LiF:Mg, Ti) in the dosimetry of clinical beams of photons (6 and 15 MV) by using water simulator object. Dose-answer curves were obtained for gamma radiation of cobalt-60 in the air and in conditions of electronic equilibrium (plate of PMMA), and clinical photons of CLINAC model 2100C accelerators of the two evaluated hospitals: Hospital das Clinicas of the Faculty of Medicine of Sao Paulo university and Hospital Albert Einstein. It was also evaluated the sensitivity and reproduction of the three dosemeters

  19. Structure and transport properties of coherently strained La{sub 2/3}Ca{sub 1/3}MnO{sub 3}/SrTiO{sub 3} superlattices

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Yafeng [Walther-Meissner-Institut, Bayerische Akademie der Wissenschaften, Walther-Meissner Str. 8, 85748 Garching (Germany); Northwest Institute for Nonferrous Metal Research, P.O. Box 51, Xi' an, Shaanxi 710016 (China); Klein, J.; Herbstritt, F.; Philipp, J.B.; Marx, A.; Alff, L.; Gross, R. [Walther-Meissner-Institut, Bayerische Akademie der Wissenschaften, Walther-Meissner Str. 8, 85748 Garching (Germany); Zhang, H. [Engineering Center of Electronic Information Materials and Devices, University of Electronic Science and Technology of China, Chengdu, Sichuan 610054 (China)

    2005-07-01

    We have prepared high quality, coherently strained La{sub 2/3}Ca{sub 1/3}MnO{sub 3}/SrTiO{sub 3} superlattices with different modulation periods by laser molecular beam epitaxy on (001) SrTiO{sub 3} and NdGaO{sub 3} substrates. A detailed structural characterization was performed by high-angle X-ray diffraction (HAXRD) and low-angle X-ray reflectivity (LAXRR). All superlattices are very flat, show excellent structural coherence and very small mosaic spread (0.02 ). The in-plane coherency strain was varied by changing the thickness ratio of the constituent layers allowing for a systematic variation of the resulting tetragonal distortion of LCMO. The c-axis lattice parameter of LCMO could be continuously changed from 3.87 Aa to 3.79 Aa. The interface roughness was analyzed by offset low-angle X-ray reflectivity and low-angle rocking curve measurements. It was found to be of the order of one unit cell with a significant part of the roughness being vertically correlated. The strain induced tetragonal distortion of LCMO was found to cause strong reduction of the paramagnetic to ferromagnetic transition temperature from about 260 to 120 K and an increase of resistivity. The transport properties in the paramagnetic regime could be well described by a small polaron hopping model. The lattice distortions were found to result in a significant increase of the polaron trapping energy. Our results show that coherently strain superlattices are an interesting model system for the systematic study of the effect of lattice distortions on the magnetic and electronic properties of the doped manganites. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  20. Roberts-SC phocomelia syndrome.

    Science.gov (United States)

    Maheshwari, A; Kumar, P; Dutta, S; Narang, A

    2001-06-01

    A severely growth retarded baby was born at 38 weeks gestation. He had multiple craniofacial anomalies, microbrachycephaly, phocomelia in the upper limbs and renal cysts visible on ultrasound. He died of recurrent apneas. The autopsy showed left sided multicystic dysplastic kidney and absence of one testis. Cytogenetic studies did not reveal any abnormality. The phenotypic features match those described in the Roberts-SC phocomelia syndrome. A literature review revealed that 50% of these patients have chromosomal defects and antenatal detection is possible on ultrasound and by chromosome analysis of the amniocytes.

  1. Mechanisms Responsible for the Large Piezoelectricity at the Tetragonal-Orthorhombic Phase Boundary of (1-x)BaZr0.2Ti0.8O3-xBa0.7Ca0.3TiO3 System.

    Science.gov (United States)

    Yang, Tao; Ke, Xiaoqin; Wang, Yunzhi

    2016-09-16

    Recently it was found that in the lead-free (1-x)BaZr0.2Ti0.8O3-xBa0.7Ca0.3TiO3 (BZT-xBCT) system, the highest piezoelectric d33 coefficient appears at the tetragonal (T) - orthorhombic (O) phase boundary rather than the O - rhombohedral (R) phase boundary, but the physical origin of it is still unclear. In this work we construct the phase diagram of the BZT-xBCT system using a generic sixth-order Landau free energy polynomial and calculate the energy barrier (EB) for direct domain switching between two variants of the stable low-symmetry ferroelectric phase. We find that the EB at the T-O phase boundary is lower than that at the O-R phase boundary and EB may serve as a rigorous quantitative measure of the degree of polarization anisotropy through Landau potential. The calculations may shed some light on the physical origin of the highest piezoelectric coefficients as well as the softest elastic compliance at the T-O phase boundary observed in experiments.

  2. Symmetry determination on Pb-free piezoceramic 0.5Ba(Zr0.2Ti0.8)O3-0.5(Ba0.7Ca0.3)TiO3 using convergent beam electron diffraction method

    International Nuclear Information System (INIS)

    Gao, Jinghui; Zhong, Lisheng; Zhang, Lixue; Xue, Dezhen; Kimoto, Takayoshi; Song, Minghui; Ren, Xiaobing

    2014-01-01

    (1−x)(Ba(Zr 0.2 Ti 0.8 )O 3 -x(Ba 0.7 Ca 0.3 )TiO 3 (BZT-xBCT) Pb-free piezoceramic has been reported showing ultrahigh piezoelectric performance in its morphotropic phase boundary (MPB) region. However, the crystal structure characteristic for the MPB composition of BZT-xBCT is still under debate—between single orthorhombic phase and tetragonal + rhombohedral two phase mixture. In the present study, we perform the local symmetry determination on the MPB composition x = 0.5 using convergent beam electron diffraction analysis (CBED). Our CBED results from multiple zone axes suggest that there are two coexisting phases with the point group symmetries of 4 mm (tetragonal) and 3 m (rhombohedral) respectively, which agree with two phase mixture model. The strong piezoelectricity can thus be understood by considering the polarization rotation between tetragonal and rhombohedral phases by external field

  3. In situ transmission electron microscopy studies of microstructure evolution in Ba(Zr{sub 0.2}Ti{sub 0.8})O{sub 3}-x(Ba{sub 0.7}Ca{sub 0.3})TiO{sub 3} piezoceramic

    Energy Technology Data Exchange (ETDEWEB)

    Zakhozheva, Marina

    2016-10-21

    The purpose of this work is to understand the microstructural features which contribute to the strong electromechanical properties of the lead-free Ba (Zr{sub 0.2}Ti{sub 0.8})O{sub 3}-x(Ba{sub 0.7}Ca{sub 0.3})TiO{sub 3} (BZT-xBCT) piezoelectric ceramic. Detailed conventional transmission electron microscopy (TEM) studies on a broad variety of BZT - xBCT were performed in order to demonstrate the composition dependent structural changes. Moreover, several in situ TEM techniques, including in situ hot- and cold-stage, in situ electric field and in situ electric field with simultaneous cooling, were successfully applied in order to monitor the domain morphology evolution in real time. By means of in situ temperature dependent TEM experiments it was shown that during rhombohedral → orthorhombic → tetragonal phase transition the domain morphology changed according to the crystal structure present. During in situ electric field investigations the displacement of the domain walls and changes in the domain configuration during electrical poling were observed, which indicates a high extrinsic contribution to the piezoelectric response in all BZT - xBCT compositions studied. From the results of in situ electric field TEM experiments with simultaneous cooling, we obtained experimental evidence that the further the composition deviates from the polymorphic phase boundary, the higher the electric field required to fully pole the material.

  4. Electric-field control of electronic transport properties and enhanced magnetoresistance in La0.7Sr0.3MnO3/0.5BaZr0.2Ti0.8O3-0.5Ba0.7Ca0.3TiO3 lead-free multiferroic structures

    Science.gov (United States)

    Yan, Jian-Min; Gao, Guan-Yin; Liu, Yu-Kuai; Wang, Fei-Fei; Zheng, Ren-Kui

    2017-10-01

    We report the fabrication of lead-free multiferroic structures by depositing ferromagnetic La0.7Sr0.3MnO3 (LSMO) polycrystalline films on polished 0.5BaZr0.2Ti0.8O3-0.5Ba0.7Ca0.3TiO3 (BZT-BCT) piezoelectric ceramic substrates. By applying electric fields to the BZT-BCT along the thickness direction, the resistivity of LSMO films can be effectively manipulated via the piezoelectric strain of the BZT-BCT. Moreover, the LSMO polycrystalline films exhibit almost temperature independent and significantly enhanced magnetoresistance (MR) below TC. At T = 2 K and H = 8 T, the MR of polycrystalline films is approximately two orders of magnitude higher than that of LSMO epitaxial films grown on (LaAlO3)0.3(SrAl1/2Ta1/2O3)0.7 single-crystal substrates. The enhanced MR mainly results from the spin-polarized tunneling of charge carriers across grain boundaries. The LSMO/BZT-BCT structures with electric-field controllable modulation of resistivity and enhanced MR effect may have potential applications in low-energy consumption and environmentally friendly electronic devices.

  5. MODELS FOR METAL-POOR STARS WITH ENHANCED ABUNDANCES OF C, N, O, Ne, Na, Mg, Si, S, Ca, AND Ti, IN TURN, AT CONSTANT HELIUM AND IRON ABUNDANCES

    Energy Technology Data Exchange (ETDEWEB)

    VandenBerg, Don A.; Dotter, Aaron [Department of Physics and Astronomy, University of Victoria, P.O. Box 3055, Victoria, B.C. V8W 3P6 (Canada); Bergbusch, Peter A. [Department of Physics, University of Regina, Regina, Saskatchewan S4S 0A2 (Canada); Ferguson, Jason W. [Department of Physics, Wichita State University, Wichita, KS 67260-0032 (United States); Michaud, Georges; Richer, Jacques [Departement de Physique, Universite de Montreal, Montreal, Quebec H3C 3J7 (Canada); Proffitt, Charles R., E-mail: vandenbe@uvic.ca, E-mail: Aaron.Dotter@gmail.com, E-mail: pbergbusch@accesscomm.ca, E-mail: proffitt@stsci.edu, E-mail: Jason.Ferguson@wichita.edu, E-mail: michaudg@astro.umontreal.ca, E-mail: jacques.richer@umontreal.ca [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

    2012-08-10

    Recent work has shown that most globular clusters have at least two chemically distinct components, as well as cluster-to-cluster differences in the mean [O/Fe], [Mg/Fe], and [Si/Fe] ratios at similar [Fe/H] values. In order to investigate the implications of variations in the abundances of these and other metals for H-R diagrams and predicted ages, grids of evolutionary sequences have been computed for scaled solar and enhanced {alpha}-element metal abundances, and for mixtures in which the assumed [m/Fe] value for each of the metals C, N, O, Ne, Na, Mg, Si, S, Ca, and Ti has been increased, in turn, by 0.4 dex at constant [Fe/H]. These tracks, together with isochrones for ages from Almost-Equal-To 5 to 14 Gyr, have been computed for -3.0 {<=} [Fe/H] {<=}-0.6, with helium abundances Y = 0.25, 0.29, and 0.33 at each [Fe/H] value, using upgraded versions of the Victoria stellar structure program and the Regina interpolation code, respectively. Turnoff luminosity versus age relations from isochrones are found to depend almost entirely on the importance of the CNO cycle, and thereby mainly on the abundance of oxygen. Since C, N, and O, as well as Ne and S, do not contribute significantly to the opacities at low temperatures and densities, variations in their abundances do not impact the predicted T{sub eff} scale of red giants. The latter is a strong function of the abundances of only Mg and Si (and Fe, possibly to a lesser extent) because they are so abundant and because they are strong sources of opacity at low temperatures. For these reasons, Mg and Si also have important effects on the temperatures of main-sequence stars. Due to their low abundances, Na, Ca, and Ti are of little consequence for stellar models. The effects of varying the adopted solar metals mixture and the helium abundance at a fixed [Fe/H] are also briefly discussed.

  6. Polymorphic phase transition and morphotropic phase boundary in Ba{sub 1-x}Ca{sub x}Ti{sub 1-y}Zr{sub y}O{sub 3} ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Abdessalem, M. Ben; Aydi, S.; Aydi, A.; Abdelmoula, N.; Khemakhem, H. [Universite de Sfax, Faculte des Sciences de Sfax (FSS), Laboratoire des Materiaux Multifonctionnels et Applications (LaMMA) LR16ES18, B.P.1171, Sfax (Tunisia); Sassi, Z. [Laboratoire de Genie Electrique et Ferroelectricite (LGEF) de L' INSA de Lyon, Lyon (France)

    2017-09-15

    This paper deals with Ca and Zr co-doped BaTiO{sub 3} (BCTZ{sub (x,} {sub y)}) (x = 0.1, 0.13, 0.2 and y = 0.05, 0.1, 0.15). These ceramics were prepared using the conventional solid state method. The symmetry, dielectric properties, Raman spectroscopy, ferroelectric behavior and piezoelectric effect were examined. X-ray diffraction (XRD) results display that morphotropic boundary occurs from tetragonal to orthorhombic region of BCZT{sub (x=0.1,} {sub 0.2,} {sub y=0.05,} {sub 0.1)} and polymorphic phase transitions from tetragonal to orthorhombic, orthorhombic to rhombohedral regions of BCZT{sub (x=0.13,} {sub y=0.1)}. The evolution of the Raman spectra was investigated as a function of compositions at room temperature, in correlation with XRD analysis and dielectric measurements. We note that the substitution of Ca in Ba site and Zr ions in Ti site slightly decreased the cubic-tetragonal temperature transition (T{sub C}) and increased the orthorhombic-tetragonal (T{sub 1}) and rhombohedral-orthorhombic (T{sub 2}) temperatures transitions. The ferroelectric properties were examined by a P-E hysteresis loop. The two parameters ΔT{sub 1} and ΔT{sub 2} are defined as ΔT{sub 1} = T{sub C} - T{sub 1} and ΔT{sub 2} = T{sub C} - T{sub 2}, they come close to T{sub C} for x = 0.13, y = 0.1, which reveals that this composition is around the polymorphic phase. The excellent piezoelectric coefficient of d{sub 33} = 288 pC N{sup -1}, the electromechanical coupling factor k{sub p} = 40%, high constant dielectric 9105, coercive field E{sub c} = 0.32 (KV mm{sup -1}) and remanent polarization P{sub r} = 0.1 (μc mm{sup -2}) were obtained for composition x = 0.13, y = 0.1. (orig.)

  7. Glass-ceramic nuclear waste forms obtained by crystallization of SiO 2-Al 2O 3-CaO-ZrO 2-TiO 2 glasses containing lanthanides (Ce, Nd, Eu, Gd, Yb) and actinides (Th): Study of the crystallization from the surface

    Science.gov (United States)

    Loiseau, P.; Caurant, D.

    2010-07-01

    Glass-ceramic materials containing zirconolite (nominally CaZrTi 2O 7) crystals in their bulk can be envisaged as potential waste forms for minor actinides (Np, Am, Cm) and Pu immobilization. In this study such matrices are synthesized by crystallization of SiO 2-Al 2O 3-CaO-ZrO 2-TiO 2 glasses containing lanthanides (Ce, Nd, Eu, Gd, Yb) and actinides (Th) as surrogates. A thin partially crystallized layer containing titanite and anorthite (nominally CaTiSiO 5 and CaAl 2Si 2O 8, respectively) growing from glass surface is also observed. The effect of the nature and concentration of surrogates on the structure, the microstructure and the composition of the crystals formed in the surface layer is presented in this paper. Titanite is the only crystalline phase able to significantly incorporate trivalent lanthanides whereas ThO 2 precipitates in the layer. The crystal growth thermal treatment duration (2-300 h) at high temperature (1050-1200 °C) is shown to strongly affect glass-ceramics microstructure. For the system studied in this paper, it appears that zirconolite is not thermodynamically stable in comparison with titanite growing form glass surface. Nevertheless, for kinetic reasons, such transformation (i.e. zirconolite disappearance to the benefit of titanite) is not expected to occur during interim storage and disposal of the glass-ceramic waste forms because their temperature will never exceed a few hundred degrees.

  8. Investigation of the structural, optical and dielectric properties of highly (1 0 0)-oriented (Pb{sub 0.60}Ca{sub 0.20}Sr{sub 0.20})TiO{sub 3} thin films on LaNiO{sub 3} bottom electrode

    Energy Technology Data Exchange (ETDEWEB)

    Pontes, D.S.L. [Laboratorio Interdisciplinar de Eletroquimica e Cerâmica, Department of Chemistry, Universidade Federal de São Carlos, Via Washington Luiz, Km 235, P.O. Box 676, 13565-905 São Carlos, São Paulo (Brazil); Pontes, F.M., E-mail: fenelon@fc.unesp.br [Department of Chemistry, Universidade Estadual Paulista, P.O. Box 473, 17033-360 Bauru, São Paulo (Brazil); Chiquito, A.J. [NanO LaB, Transporte Eletrônico em Nanoestruturas, Department of Physics, Universidade Federal de São Carlos, Via Washington Luiz, Km 235, P.O. Box 676, 13565-905 São Carlos, São Paulo (Brazil); Longo, E. [Laboratorio Interdisciplinar de Eletroquimica e Cerâmica, Department of Chemistry, Universidade Federal de São Carlos, Via Washington Luiz, Km 235, P.O. Box 676, 13565-905 São Carlos, São Paulo (Brazil); Institute of Chemistry, Universidade Estadual Paulista, Araraquara, São Paulo (Brazil)

    2014-07-01

    Highlights: • Highly (h 0 0) oriented LNO and PCST thin films were grown on LAO(1 0 0) substrate. • PCST/LNO/LAO structure shown classic ferroelectric–paraelectric phase transition. • PCST/LNO/LAO structure shows superior dielectric properties. • PCST/LAO films showed a direct allowed optical transition. - Abstract: Highly (1 0 0)-oriented Pb{sub 0.60}Ca{sub 0.20}Sr{sub 0.20}TiO{sub 3}/LNO/LAO structure was fabricated using a chemical deposition process via spin-coating technique. XRD revealed that both LNO and Pb{sub 0.60}Ca{sub 0.20}Sr{sub 0.20}TiO{sub 3} films grown on LAO(1 0 0) substrate and LNO/LAO(1 0 0) structure were crystallized to be highly (h 0 0)-oriented, respectively. AFM images revealed smooth surfaces, spherical-shaped grains and a crack-free surface with a roughness of about 3–7 nm. The tetragonal perovskite phase was confirmed by Raman spectroscopy for Pb{sub 0.60}Ca{sub 0.20}Sr{sub 0.20}TiO{sub 3}/LNO/LAO and Pb{sub 0.60}Ca{sub 0.20}Sr{sub 0.20}TiO{sub 3}/LAO structures. The optical transmittance of 340 nm thick Pb{sub 0.60}Ca{sub 0.20}Sr{sub 0.20}TiO{sub 3} films on a LAO(1 0 0) substrate exhibited an average transmittance above 80% in the wavelength range of 500–1000 nm and an optical band gap E{sub g} of 3.56 and 2.87 eV for the direct and indirect transition processes, respectively. The Au/Pb{sub 0.60}Ca{sub 0.20}Sr{sub 0.20}TiO{sub 3}/LNO/LAO structure has a hysteresis loop with remnant polarization, P{sub r}, of 12 μC/cm{sup 2}, and a coercive field, E{sub c}, of 46 kV/cm for an electric field at 370 kV/cm along with a dielectric constant over 1200.

  9. Theranostic pretargeted radioimmunotherapy of colorectal cancer xenografts in mice using picomolar affinity Y-86- or Lu-177-DOTA-Bn binding scFv C825/GPA33 IgG bispecific immunoconjugates

    Science.gov (United States)

    Cheal, Sarah M.; Xu, Hong; Guo, Hong-fen; Lee, Sang-gyu; Punzalan, Blesida; Chalasani, Sandhya; Fung, Edward K.; Jungbluth, Achim; Zanzonico, Pat B.; Carrasquillo, Jorge A.; O’Donoghue, Joseph; Smith-Jones, Peter M.; Wittrup, K. Dane; Cheung, Nai-Kong V.; Larson, Steven M.

    2015-01-01

    Purpose GPA33 is a colorectal cancer (CRC) antigen with unique retention properties after huA33-mediated tumor targeting. We tested a pre-targeted radioimmunotherapy (PRIT) approach for CRC using a tetravalent bispecific antibody with dual specificity for GPA33 tumor antigen and DOTA-Bn (radiolanthanide metal) complex. Methods PRIT was optimized in vivo by titrating sequential intravenous doses of huA33-C825, the dextran-based clearing agent (CA), and the C825-haptens 177Lu-or 86Y-DOTA-Bn in mice bearing the SW1222 subcutaneous (s.c.) CRC xenograft model. Results Using optimized PRIT, therapeutic indices (TIs) for tumor radiation absorbed dose of 73 (tumor/blood) and 12 (tumor/kidney) were achieved. Estimated absorbed doses (cGy/MBq) to tumor, blood, liver, spleen, and kidney for single-cycle PRIT were 65.8, 0.9 (TI: 73), 6.3 (TI: 10), 6.6 (TI: 10), and 5.3 (TI: 12), respectively. Two cycles of PRIT treatment (66.6 or 111 MBq 177Lu-DOTA-Bn) were safe and effective, with 9/9 complete responses of established s.c. tumors (100–700 mm3) and 2/9 alive without recurrence >140 d. Tumor log kill in this model was estimated to be 2.1–3.0 based time to 500-mm3 tumor recurrence. In addition, PRIT dosimetry/diagnosis was performed by PET imaging of the positron-emitting DOTA-hapten 86Y-DOTA-Bn. Conclusions We have developed anti-GPA33 PRIT, as a triple-step theranostic strategy for pre-clinical detection, dosimetry and safe targeted radiotherapy of established human colorectal mouse xenografts. PMID:26596724

  10. Correlation of irreversibility and vortex solid melting for Ti nBa 2Ca 2Cu 3O x (n = 1, 2) thin films

    Science.gov (United States)

    Hyun, O. B.; Suhara, H.; Nabatame, T.; Koike, S.; Hirabayashi, I.

    1995-08-01

    The transport measurements were performed for the Tl nBa 2Ca 2Cu 3O x (n = 1, 2) thin films in magnetic fields. The resistive state could be approximately described by the thermally activated form, ϱ ˜ exp[- {U(H,T)}/{k BT }] , where U(H,T) ∝ (const. + T)H -α with α ≈ 0.5 ˜ 0.6. This form, however, appreciably deviates from the data for low dissipation and high fields. As for the viscosity of the supercooled liquid, the divergence of U well described the behavior, particularly, of the low dissipation state for all fields, implying the presence of the vortex solid. The log(V) - log(I) characteristics revealed the curvature change, which defines the vortex solid (glass) - liquid melting temperature T m. Both the irreversibility line and the melting line showed approximately the same T dependence, H α ˜ T -1, which is from the thermally activated form. This correlation suggests that the irreversibility line appropriately figures the vortex solid (glass) - liquid melting line.

  11. Investigating the effect of SiO2-TiO 2-CaO-Na 2O-ZnO bioactive glass doped hydroxyapatite: characterisation and structural evaluation.

    Science.gov (United States)

    Yatongchai, Chokchai; Wren, Anthony W; Curran, Declan J; Hampshire, Stuart; Towler, Mark R

    2014-07-01

    The effects of increasing bioactive glass additions, SiO2-TiO2-CaO-Na2O-ZnO up to 25 wt% in increments of 5 wt%, on the physical and mechanical properties of hydroxyapatite (HA) sintered at 900, 1000, 1100 and 1200 °C for 2 h was investigated. Increasing both the glass content and the temperature resulted in increased HA decomposition. This resulted in the formation of a number of bioactive phases. However the presence of the liquidus glass phase did not result in increased densification levels. At 1000 and 1100 °C the additions of 5 wt% glass resulted in a decrease in density which never recovered with increasing glass content. At 1200 °C a cyclic pattern resulted from increasing glass content. There was no direct relationship between strength and density with all samples experiencing no change or a decrease in strength with increasing glass content. Weibull statistics displayed no pattern with increasing glass content.

  12. Tunability, dielectric, and piezoelectric properties of Ba{sub (1−x)}Ca{sub x}Ti{sub (1−y)}Zr{sub y}O{sub 3} ferroelectric thin films

    Energy Technology Data Exchange (ETDEWEB)

    Daumont, C. J. M., E-mail: christophe.daumont@univ-tours.fr; Le Mouellic, E.; Negulescu, B.; Wolfman, J. [Laboratoire GREMAN, UMR7347 CNRS, Faculté de Sciences et Techniques, Université François Rabelais, 37200 Tours (France); Simon, Q.; Payan, S.; Maglione, M. [Institute of Condensed Matter Chemistry of Bordeaux, ICMCB-CNRS, Université de Bordeaux, 33608 Pessac Cedex (France); Gardes, P.; Poveda, P. [STMicroelectronics, 10 rue Thalès de Milet, 37071 Tours Cedex (France)

    2016-03-07

    Tunable ferroelectric capacitors, which exhibit a decrease of the dielectric permittivity (ϵ) under electric field, are widely used in electronics for RF tunable applications (e.g., antenna impedance matching). Current devices use barium strontium titanate as the tunable dielectric, and the need for performance enhancement of the tunable element is the key for device improvement. We report here on libraries of Ba{sub 0.97}Ca{sub 0.03}Ti{sub 1−x}Zr{sub x}O{sub 3} thin films (0 ≤ x ≤ 27%) with a thickness of about 130 nm deposited on IrO{sub 2}/SiO{sub 2}/Si substrates using combinatorial pulsed laser deposition allowing for gradients of composition on one sample. A total of 600 capacitors on a single sample were characterized in order to statistically investigate the dielectric properties. We show that the tunabilty is maximum at intermediate compositions, reaching values up to 60% for an electric field of about 400 kV cm{sup −1}. We attribute the high tunability in the intermediate compositions to the paraelectric-ferroelectric phase transition, which is brought down to room temperature by the addition of Zr. In addition, the piezoelectric coefficient is found to be decreasing with increasing Zr content.

  13. Contributions of intrinsic and extrinsic polarization species to energy storage properties of Ba0.95Ca0.05Zr0.2Ti0.8O3 ceramics

    Science.gov (United States)

    Zhan, Di; Xu, Qing; Huang, Duan-Ping; Liu, Han-Xing; Chen, Wen; Zhang, Feng

    2018-03-01

    Ba0.95Ca0.05Zr0.2Ti0.8O3 ceramics were prepared at different sintering temperatures by citrate precursor and solid-state reaction methods, respectively. The crystal structure and microstructure of the specimens were characterized. In view of energy storage capacitor utilizations, the dielectric properties of the specimens were investigated at room temperature as a function of frequency and applied electric field. Moreover, the nature of mobile charge carriers in the specimens was diagnosed by complex impedance spectroscopy at elevated temperatures. While the dielectric constants of the specimens prepared by different methods are quite different (4.4 × 103-2.2 × 104 at 10 kHz) at zero electric field, the energy storage densities at an identical strong electric field are similar (e.g. 0.32-0.41 J/cm3 at 120 kV/cm). The dielectric constants under bias electric field were fitted to a multipolarization mechanism model to resolve the contributions of intrinsic and extrinsic polarization mechanisms. It turned out that the extrinsic contributions fade out within low electric field range (dielectric responses at higher fields. Based on the fitting result, the energy storage properties of the specimens were interpreted.

  14. Investigating the influence of Na+ and Sr2+ on the structure and solubility of SiO2-TiO2-CaO-Na2O/SrO bioactive glass.

    Science.gov (United States)

    Li, Y; Placek, L M; Coughlan, A; Laffir, F R; Pradhan, D; Mellott, N P; Wren, A W

    2015-02-01

    This study was conducted to determine the influence that network modifiers, sodium (Na+) and strontium (Sr2+), have on the solubility of a SiO2-TiO2-CaO-Na2O/SrO bioactive glass. Glass characterization determined each composition had a similar structure, i.e. bridging to non-bridging oxygen ratio determined by X-ray photoelectron spectroscopy. Magic angle spinning nuclear magnetic resonance (MAS-NMR) confirmed structural similarities as each glass presented spectral shifts between -84 and -85 ppm. Differential thermal analysis and hardness testing revealed higher glass transition temperatures (Tg 591-760 °C) and hardness values (2.4-6.1 GPa) for the Sr2+ containing glasses. Additionally the Sr2+ (~250 mg/L) containing glasses displayed much lower ion release rates than the Na+ (~1,200 mg/L) containing glass analogues. With the reduction in ion release there was an associated reduction in solution pH. Cytotoxicity and cell adhesion studies were conducted using MC3T3 Osteoblasts. Each glass did not significantly reduce cell numbers and osteoblasts were found to adhere to each glass surface.

  15. Effect of grain boundary layer strain on the magnetic and transport properties of (100-x) La0.7Ca0.3MnO3/(x) BaTiO3 composites showing enhanced magnetoresistance

    International Nuclear Information System (INIS)

    Bose, Esa; Taran, S.; Karmakar, S.; Chaudhuri, B.K.; Pal, S.; Sun, C.P.; Yang, H.D.

    2007-01-01

    A ferromagnetic/ferroelectric composite system, viz. (100-x)La 0.7 Ca 0.3 MnO 3 [LCMO]/(x) BaTiO 3 [BTO] (with x=0.0%, 1.0%, 5.0%, 7.5%, 10.0% and 15.0%, in wt%) has been synthesized and the temperature-dependent DC magnetization M(T), resistivity ρ(T), magnetoresistance (MR), and thermoelectric power S(T) have been studied. Both metal-insulator transition temperature (T MI ) and the corresponding Curie temperature (T C ) decrease whereas peak resistivity at T MI increases as x is enhanced from 0.0% to 10.0%. For x>10.0%, this trend of variation is reversed. A maximum three-fold increase of magnetoresistance (MR) is observed (for sample with x=10.0%) due to the addition of ferroelectric (non-magnetic) perovskite BTO (compared to the mother compound LCMO). Interestingly, thermoelectric power S(T) shows a pronounced depression (dip) near the magnetic transition region for the composite samples. The above results have been analyzed considering strain induced by the LCMO/BTO grain boundary layer (BL)

  16. Coupling of electric charge and magnetic field via electronic phase separation in (La,Pr,Ca)MnO3/Pb(Mg1/3Nb2/3)O3-PbTiO3 multiferroic heterostructures

    Science.gov (United States)

    Zheng, Ming; Wang, Wei

    2016-04-01

    The electric-field-tunable non-volatile resistivity and ferromagnetism switching in the (La0.5Pr0.5)0.67Ca0.33MnO3 films grown on (111)-oriented 0.7Pb(Mg1/3Nb2/3)O3-0.3PbTiO3 ferroelectric single-crystal substrates have been investigated. By combining the 180° ferroelectric domain switching and in situ X-ray diffraction and resistivity measurements, we identify that this voltage control of order parameters stems from the domain switching-induced accumulation/depletion of charge carriers at the interface rather than induced lattice strain effect. In particular, the polarization-induced charge effect (i.e., ferroelectric field effect) is strongly dependent on the magnetic field. This, together with the charge-modulated magnetoresistance and magnetization, reveals the strong correlation between the electric charge and the magnetic field. Further, we found that this coupling is essentially driven by the electronic phase separation, the relative strength of which could be determined by recording charge-tunability of resistivity [ (Δρ/ρ)c h arg e ] under various magnetic fields. These findings present a potential strategy for elucidating essential physics of perovskite manganites and delivering prototype electronic devices for non-volatile information storage.

  17. Structural analysis, optical and dielectric function of [Ba{sub 0.9}Ca{sub 0.1}](Ti{sub 0.9}Zr{sub 0.1})O{sub 3} nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Herrera-Pérez, G., E-mail: guillermo.herrera@cimav.edu.mx, E-mail: damasio.morales@cimav.edu.mx [Centro de Investigación en Materiales Avanzados (CIMAV), S. C. Miguel de Cervantes 120, Chihuahua 31136, Chihuahua (Mexico); Physics of Materials Department, Centro de Investigación en Materiales Avanzados (CIMAV), S. C. Miguel de Cervantes 120, Chihuahua 31136, Chihuahua (Mexico); Morales, D., E-mail: guillermo.herrera@cimav.edu.mx, E-mail: damasio.morales@cimav.edu.mx; Paraguay-Delgado, F.; Reyes-Rojas, A.; Fuentes-Cobas, L. E. [Physics of Materials Department, Centro de Investigación en Materiales Avanzados (CIMAV), S. C. Miguel de Cervantes 120, Chihuahua 31136, Chihuahua (Mexico); Borja-Urby, R. [Centro de Nanociencias Micro y Nanotecnologías, Instituto Politécnico Nacional, 07300 México City (Mexico)

    2016-09-07

    This work presents the identification of inter-band transitions in the imaginary part of the dielectric function (ε{sub 2}) derived from the Kramers–Kronig analysis for [Ba{sub 0.9}Ca{sub 0.1}](Ti{sub 0.9}Zr{sub 0.1})O{sub 3} (BCZT) nanocrystals synthesized by the modified Pechini method. The analysis started with the chemical identification of the atoms that conform BCZT in the valence loss energy region of a high energy-resolution of electron energy loss spectroscopy. The indirect band energy (E{sub g}) was determined in the dielectric response function. This result is in agreement with the UV-Vis technique, and it obtained an optical band gap of 3.16 eV. The surface and volume plasmon peaks were observed at 13.1 eV and 26.2 eV, respectively. The X-ray diffraction pattern and the Rietveld refinement data of powders heat treated at 700 °C for 1 h suggest a tetragonal structure with a space group (P4 mm) with the average crystal size of 35 nm. The average particle size was determined by transmission electron microscopy.

  18. The colours of Hubble Sc galaxy nuclei

    International Nuclear Information System (INIS)

    Iskudaryan, S.G.

    1975-01-01

    The colorimetric data on the nuclei of the Sc galaxies are given. Comparison of the following parameters: color of a nucleus, integral color of a galaxy, Byurakan class, and spectral type of normal spirals gives the possibility to conclude: (1) The colors of the nuclei of the Sc galaxies have a high dispersion in its values. In all Byurakan classes the galaxies with intensely red and blue nuclei occur; (2) Some Sc galaxies exhibit a discrepancy between the spectral and morphological types. The results of colorimetry of nuclei indicate that almost all such Sc galaxies have intensely red nuclei which, naturally, provide for these late spectral types. It can be assumed that the intensely red color of the nuclei of such Sc galaxies is a result of a new type of activity of these nuclei; and (3) some Sc galaxies show the characteristics of the Markarian objects

  19. Academic Training - Pulsed SC Magnets

    CERN Multimedia

    Françoise Benz

    2006-01-01

    2005-2006 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 2, 3, June 29, 30, 31 May, 1, 2 June 11:00-12:00 - Auditorium, bldg 500 Pulsed SC Magnets by M. Wilson Lecture 1. Introduction to Superconducting Materials Type 1,2 and high temperature superconductors; their critical temperature, field & current density. Persistent screening currents and the critical state model. Lecture 2. Magnetization and AC Loss How screening currents cause irreversible magnetization and hysteresis loops. Field errors caused by screening currents. Flux jumping. The general formulation of ac loss in terms of magnetization. AC losses caused by screening currents. Lecture 3. Twisted Wires and Cables Filamentary composite wires and the losses caused by coupling currents between filaments, the need for twisting. Why we need cables and how the coupling currents in cables contribute more ac loss. Field errors caused by coupling currents. Lecture 4. AC Losses in Magnets, Cooling and Measurement Summary of all loss mech...

  20. Structural properties of CaTi{sub 1-x}(Nb{sub 2/3}Li{sub 2/3}){sub x}O{sub 3-d}elta (CNLTO) and CaTi{sub 1-x}(Nb{sub 1/2}Ln{sub 1/2}){sub x}O{sub 3} (Ln=Fe (CNFTO), Bi (CNBTO)), modified dielectric ceramics for microwave applications

    Energy Technology Data Exchange (ETDEWEB)

    Costa, R.C.S. [Laboratorio de Telecomunicacoes e Ciencia e Engenharia dos Materiais (LOCEM), Departamento de Fisica, Universidade Federal do Ceara, Caixa Postal 6030, CEP 60455-760, Fortaleza, Ceara (Brazil); Departamento de Engenharia de Teleinformatica, CP 6007, Universidade Federal do Ceara, CEP 60455-760, Fortaleza, Ceara (Brazil); Bruno Costa, A.D.S. [Departamento de Engenharia de Teleinformatica, CP 6007, Universidade Federal do Ceara, CEP 60455-760, Fortaleza, Ceara (Brazil); Freire, F.N.A.; Santos, M.R.P.; Almeida, J.S.; Sohn, R.S.T.M. [Laboratorio de Telecomunicacoes e Ciencia e Engenharia dos Materiais (LOCEM), Departamento de Fisica, Universidade Federal do Ceara, Caixa Postal 6030, CEP 60455-760, Fortaleza, Ceara (Brazil); Sasaki, J.M. [Laboratorio de Raios-X, Departamento de Fisica, Universidade Federal do Ceara, Caixa Postal 6030, CEP 60455-760, Fortaleza, Ceara (Brazil); Sombra, A.S.B., E-mail: sombra@fisica.ufc.b [Laboratorio de Telecomunicacoes e Ciencia e Engenharia dos Materiais (LOCEM), Departamento de Fisica, Universidade Federal do Ceara, Caixa Postal 6030, CEP 60455-760, Fortaleza, Ceara (Brazil)

    2009-05-01

    This paper presents an investigation of the structural characteristics of Nb{sub 1/2}Bi{sub 1/2} (CNBTO), Nb{sub 1/2}Fe{sub 1/2} (CNFTO) and Nb{sub 2/3}Li{sub 1/3} (CNLTO) substitution into the B-site of calcium titanate ceramics. The modified CaTiO{sub 3} (CTO) ceramics were prepared by the conventional solid-state method. The compounds were investigated, by X-ray diffraction (XRD), energy-dispersive X-ray spectroscopy (EDXS). The X-ray analysis shows that all samples have an orthorhombic structure. The refinement analysis of all samples were also performed and discussed in this paper. For all studied samples, a Raman mode at 805 cm{sup -1} was detected and its intensity increases as the substitution increases. The dielectric permittivity and loss at microwave frequencies (MW) were investigated. The CNLTO phase, present the highest dielectric constant (k=35.8) at 3.9 GHz with loss (tg alpha=7x10{sup -3}). The lowest value of k=25.7 (f=4.8 GHz) and tg alpha=3x10{sup -3}, was obtained for the CNFTO phase. These measurements confirm the possible use of such material for microwave devices like dielectric resonator antennas.

  1. 46 CFR 7.70 - Folly Island, SC to Hilton Head Island, SC.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Folly Island, SC to Hilton Head Island, SC. 7.70 Section... BOUNDARY LINES Atlantic Coast § 7.70 Folly Island, SC to Hilton Head Island, SC. (a) A line drawn from the...′ W. (Port Royal Sound Lighted Whistle Buoy “2PR”); thence to the easternmost extremity of Hilton Head...

  2. Absolute isotopic abundances of Ti in meteorites

    International Nuclear Information System (INIS)

    Niederer, F.R.; Papanastassiou, D.A.; Wasserburg, G.J.

    1985-01-01

    The absolute isotope abundance of Ti has been determined in Ca-Al-rich inclusions from the Allende and Leoville meteorites and in samples of whole meteorites. The absolute Ti isotope abundances differ by a significant mass dependent isotope fractionation transformation from the previously reported abundances, which were normalized for fractionation using 46 Ti/ 48 Ti. Therefore, the absolute compositions define distinct nucleosynthetic components from those previously identified or reflect the existence of significant mass dependent isotope fractionation in nature. We provide a general formalism for determining the possible isotope compositions of the exotic Ti from the measured composition, for different values of isotope fractionation in nature and for different mixing ratios of the exotic and normal components. The absolute Ti and Ca isotopic compositions still support the correlation of 50 Ti and 48 Ca effects in the FUN inclusions and imply contributions from neutron-rich equilibrium or quasi-equilibrium nucleosynthesis. The present identification of endemic effects at 46 Ti, for the absolute composition, implies a shortfall of an explosive-oxygen component or reflects significant isotope fractionation. Additional nucleosynthetic components are required by 47 Ti and 49 Ti effects. Components are also defined in which 48 Ti is enhanced. Results are given and discussed. (author)

  3. Radiation Protection Section (SC/SL/RP)

    CERN Document Server

    2006-01-01

    We should like to inform you that the Radiation Protection Section (SC/SL/RP) located on the Prévessin site has moved from Building 865 (ground floor) to new premises in Wing A of Building 892 (second floor). Telephone numbers remain the same. SC/SL/RP section

  4. Quaternary equilibrium diagrams ZrO{sub 2}-Al{sub 2}O{sub 3}-SiO{sub 2}-(CaO, MgO, TiO{sub 2}). A powerful tool for the development of new materials by reaction sintering; Diagramas de equilibrio cuaternarios ZrO{sub 2}-Al{sub 2}O{sub 3}-SiO{sub 2}- (CaO, MgO, TiO{sub 2}). Una poderosa herramienta para el desarrollo de nuevos materiales por sinterizacion reactiva

    Energy Technology Data Exchange (ETDEWEB)

    Moya, J. S.; Bartolome, J. F.; Pena, P.

    2011-07-01

    In this paper we set out, discuss and evaluate the work on Mullite-zirconia composites obtained by reaction sintering led and inspired by Salvador de Aza on the basis of ZrO{sub 2}-Al{sub 2}O{sub 3}-SiO{sub 2}-(CaO, MgO, TiO{sub 2}) multicomponent phase equilibrium diagrams. We analyze their impact on different areas of ceramic science and technology such as refractory grogs, aluminum industry, etc. The possible fields of future applications such as dental prosthesis replacing partially stabilized zirconia materials with rare earths are also reported. (Author) 42 refs.

  5. Sc-W-Si and Sc-W-Ge ternary systems

    International Nuclear Information System (INIS)

    Kotur, B.Ya.; Voznyak, O.M.; Bodak, O.I.

    1989-01-01

    Phase equilibria in Sc-W-Si and Sc-W-Ge ternary systems are investigated at 1070 K. Sc 2+x W 3-x Si 4 ternary compound (0≤x≤1) is determined, its crystal structure (Ce 2 Sc 3 Si 4 structural type), as well as, change of elementary cell parameters and microhardness within homogeneity range are determined. Regularities of component interaction within Sc-M-Si(Ge) (M-Cr, Mo, W) ternary system are determined. Ternary systems with Mo and W are more closer to each other according to the phase equilibria character, than to ternary systems with Cr

  6. Enhanced piezoelectric properties and excellent thermal stabilities of cobalt-modified Aurivillius-type calcium bismuth titanate (CaBi{sub 4}Ti{sub 4}O{sub 15})

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Tian-Long [School of Physics, State Key Laboratory of Crystal Materials, Shandong University, Jinan 250100 (China); Wang, Chun-Ming, E-mail: wangcm@sdu.edu.cn [School of Physics, State Key Laboratory of Crystal Materials, Shandong University, Jinan 250100 (China); Wang, Chun-Lei; Wang, Yi-Ming [School of Physics, State Key Laboratory of Crystal Materials, Shandong University, Jinan 250100 (China); Dong, Shuxiang [Department of Materials Science and Engineering, College of Engineering, Peking University, Beijing 100871 (China)

    2015-11-15

    Highlights: • Cobalt oxide modified CBT-based ceramics were prepared and investigated in detail. • XRPD analysis revealed Co ions enter into B-site of CBT-based ceramics. • CBT-Co4 ceramics show the enhanced d{sub 33} of 14 pC/N and T{sub c} of 782 °C. • CBT-Co4 ceramics present the improved high-temperature resistivity. • Thermal depoling behavior indicates CBT-Co4 ceramics exhibit good thermal stability. - Abstract: Bismuth layer-structured ferroelectric (BLSF) calcium bismuth titanate (CaBi{sub 4}Ti{sub 4}O{sub 15}, CBT) piezoelectric ceramics with 0.0–1.0 wt.% cobalt oxide (Co{sub 2}O{sub 3}) have been prepared via a conventional solid-state reaction method. Microstructural morphology and electrical properties of cobalt oxide-modified CBT ceramics were investigated in detail. X-ray powder diffraction (XRPD) analysis revealed that the cobalt oxide-modified CBT ceramics have a pure four-layer Aurivillius-type structure. The piezoelectric properties of CBT ceramics were significantly enhanced by cobalt oxide modifications. The piezoelectric coefficient d{sub 33} and Curie temperature T{sub c} of 0.2 wt.% cobalt oxide-modified CBT ceramics (CBT-Co4) are 14 pC/N and 782 °C, respectively. The DC resistivity and thermal depoling behavior at elevated temperature indicated that the CBT-Co4 ceramics exhibit good thermal stability, demonstrating that the CBT-Co4 ceramics are potential materials for high temperature piezoelectric applications.

  7. Dual-band LTCC antenna based on 0.95Zn2SiO4-0.05CaTiO3 ceramics for GPS/UMTS applications

    Science.gov (United States)

    Dou, Gang; Li, Yu-Xia; Guo, Mei

    2015-10-01

    In this paper, we present a compact low-temperature co-fired ceramic (LTCC) dual-band antenna by using the electromagnetic coupling effect concept for global positioning system (GPS) and universal mobile telecommunication system (UMTS) applications. The overall dimension of the antenna is 8.6 mm × 13.0 mm × 1.1 mm. It consists of double meander lines and a via hole line. The top meander line operates at the upper band, and the bottom radiating patch is designed for the lower band. The via-hole line is employed to connect the double meander lines. Because of the effect of the coupled line, total dimension of the proposed antenna is greatly reduced. With the 2.5: voltage standing wave ratio (VSWR) impedance bandwidth definition, the lower and upper bands have the bandwidths of 110 MHz and 150 MHz, respectively. The proposed antenna is successfully designed, simulated, and analyzed by a high frequency structure simulator (HFSS). And the antenna is manufactured by using the 0.95Zn2SiO4-0.05CaTiO3 ceramics (εr = 7.1, tanδ = 0.00038) that is prepared by ourselves. The results show that the antenna is compact, efficient, and of near omnidirectional radiation pattern. Project supported by the Specialized Research Fund for the Doctoral Program of Higher Education of China (Grant No. 20133718120009), the Natural Science Foundation of Shandong Provence, China (Grant Nos. ZR2013FQ002 and ZR2014FQ006), the China Postdoctoral Science Foundation (Grant No. 2014M551935), the Qingdao Municipality Postdoctoral Science Foundation, China, and the Scientific Research Foundation of Shandong University of Science and Technology for Recruited Talents, China (Grant Nos. 2013RCJJ042 and 2014RCJJ052).

  8. Structural, multiferroic, dielectric and magnetoelectric properties of (1-x)Ba0.85Ca0.15Ti0.90Zr0.10O3-(x)CoFe2O4 lead-free composites

    Science.gov (United States)

    Negi, N. S.; Kumar, Rakesh; Sharma, Hakikat; Shah, J.; Kotnala, R. K.

    2018-06-01

    High performance lead-free multiferroic composites with strong magnetoelectric coupling effect are desired to replace lead-based ceramics in multifunctional device applications due to increasing environmental issues. We report crystal structure, ferroelectric, magnetic, dielectric and magnetoelectric properties of (1-x)Ba0.85Ca0.15Ti0.90Zr0.10O3-(x)CoFe2O4 (BCTZ-CFO) lead-free composites with x = 0.1, 0.3, 0.5, 0.7 and 0.9 synthesized by chemical solution method. BCTZ power was synthesized by sol-gel method while CFO was prepared by metallo-organic decomposition (MOD) method. The XRD results confirm successful formation of the BCTZ-CFO composites without presence of any impurity phase. At room temperature, the BCTZ-CFO composites show multiferroic behavior characterized by ferroelectric and ferromagnetic hysteresis curves. The composite having 10 wt% of CFO exhibited maximum polarization, remnant polarization and coercive field of Ps ∼ 5.1 μC/cm2, Pr ∼ 1.4 μC/cm2 and Ec ∼ 11.6 kV/cm respectively. The BCTZ-CFO composite with 90 wt% of CFO incorporation exhibits improved ferromagnetic properties with Ms ∼ 32 emu/g, Mr ∼ 11.7 emu/g and Hc ∼ 504 Oe. Mӧssbauer spectra analysis show two sets of six-line hyperfine patterns for BCTZ-CFO composites, indicating the presence of Fe3+ ions in both A and B sites. Increasing BCTZ content was found to decrease the hyperfine field strength at both sites and is consistent with the decreasing magnetic moment observed for the samples. The maximum dielectric constant value ε‧ ∼ 678 is obtained at 1 MHz for composite with 10 wt% of CFO phase. The results indicate that the BCTZ-CFO composites are potential lead-free room temperature multiferroic systems.

  9. CaMn0.875Ti0.125O3 as oxygen carrier for chemical-looping combustion with oxygen uncoupling (CLOU)—Experiments in a continuously operating fluidized-bed reactor system

    KAUST Repository

    Rydén, Magnus

    2011-03-01

    Particles of the perovskite material CaMn0.875Ti0.125O3 has been examined as oxygen carrier for chemical-looping with oxygen uncoupling, and for chemical-looping combustion of natural gas, by 70h of experiments in a circulating fluidized-bed reactor system. For the oxygen uncoupling experiments, it was found that the particles released O2 in gas phase at temperatures above 720°C when the fuel reactor was fluidized with CO2. The effect increased with increased temperature, and with the O2 partial pressure in the air reactor. At 950°C, the O2 concentration in the outlet from the fuel reactor was in the order of 4.0vol%, if the particles were oxidized in air. For the chemical-looping combustion experiments the combustion efficiency with standard process parameters was in the order of 95% at 950°C, using 1000kg oxygen carrier per MW natural gas, of which about 30% was located in the fuel reactor. Reducing the fuel flow so that 1900kg oxygen carrier per MW natural gas was used improved the combustion efficiency to roughly 99.8%. The particles retained their physical properties, reactivity with CH4 and ability to release gas-phase O2 reasonably well throughout the testing period and there were no problems with the fluidization or formation of solid carbon in the reactor. X-ray diffraction showed that the particles underwent changes in their phase composition though. © 2010 Elsevier Ltd.

  10. Dielectric, Piezoelectric, and Vibration Properties of the LiF-Doped (Ba0.95Ca0.05(Ti0.93Sn0.07O3 Lead-Free Piezoceramic Sheets

    Directory of Open Access Journals (Sweden)

    Chien-Min Cheng

    2018-01-01

    Full Text Available By the conventional solid state reaction method, a small amount of lithium fluoride (LiF was used as the sintering promoter to improve the sintering and piezoelectric characteristics of (Ba0.95Ca0.05(Ti0.93Sn0.07O3 (BCTS lead-free piezoceramic sheets. Using X-ray diffraction (XRD and a scanning electron microscope (SEM, the inferences of the crystalline and surface microstructures were obtained and analyzed. Then, the impedance analyzer and d33-meter were used to measure the dielectric and piezoelectric characteristics. In this study, the optimum sintering temperature of the BCTS sheets decreased from 1450 °C to 1390 °C due to LiF doping. For the 0.07 wt % LiF-doped BCTS sheets sintered at 1390 °C, the piezoelectric constant (d33 is 413 pC/N, the electric–mechanical coupling coefficient (kp is 47.5%, the dielectric loss (tan δ is 3.9%, and the dielectric constant (εr is 8100, which are all close to or even better than that of the pure undoped BCTS ceramics. The Curie temperature also improved, from 85 °C for pure BCTS to 140 °C for BCTS–0.07 LiF sheets. Furthermore, by using the vibration system and fixing 1.5 g tip mass at the end of the sheets, as the vibration frequency is 20 Hz, the proposed piezoelectric ceramic sheets also reveal a good energy harvesting performance at the maximum output peak voltage of 4.6 V, which is large enough and can be applied in modern low-power electronic products.

  11. New procedure of quantitative mapping of Ti and Al released from dental implant and Mg, Ca, Fe, Zn, Cu, Mn as physiological elements in oral mucosa by LA-ICP-MS.

    Science.gov (United States)

    Sajnóg, Adam; Hanć, Anetta; Koczorowski, Ryszard; Barałkiewicz, Danuta

    2017-12-01

    A new procedure for determination of elements derived from titanium implants and physiological elements in soft tissues by laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) is presented. The analytical procedure was developed which involved preparation of in-house matrix matched solid standards with analyte addition based on certified reference material (CRM) MODAS-4 Cormorant Tissue. Addition of gelatin, serving as a binding agent, essentially improved physical properties of standards. Performance of the analytical method was assayed and validated by calculating parameters like precision, detection limits, trueness and recovery of analyte addition using additional CRM - ERM-BB184 Bovine Muscle. Analyte addition was additionally confirmed by microwave digestion of solid standards and analysis by solution nebulization ICP-MS. The detection limits are in range 1.8μgg -1 to 450μgg -1 for Mn and Ca respectively. The precision values range from 7.3% to 42% for Al and Zn respectively. The estimated recoveries of analyte addition line within scope of 83%-153% for Mn and Cu respectively. Oral mucosa samples taken from patients treated with titanium dental implants were examined using developed analytical method. Standards and tissue samples were cryocut into 30µm thin sections. LA-ICP-MS allowed to obtain two-dimensional maps of distribution of elements in tested samples which revealed high content of Ti and Al derived from implants. Photographs from optical microscope displayed numerous particles with µm size in oral mucosa samples which suggests that they are residues from implantation procedure. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. Location of the major 2Psub(1/2) strength in 49Sc by forward angle heavy-ion j dependence

    International Nuclear Information System (INIS)

    Kemper, K.W.; Zeller, A.F.; Ophel, T.R.

    1977-12-01

    Foward angle 48 Ca( 7 Li, 6 He) data show the 4.49 MeV state in 49 Sc to be 2Psub(1/2) and not 2Psub(3/2) as reported in an earlier 48 Ca( 15 N, 14 C) work. The ( 3 He,d) spectroscopic factor of 0.55 indicates that this state has the major components of the 2psub(1/2) strength in 49 Sc. (Author)

  13. SC-FDMA for mobile communications

    CERN Document Server

    Abd El-Samie, Fathi E

    2013-01-01

    SC-FDMA for Mobile Communications examines Single-Carrier Frequency Division Multiple Access (SC-FDMA). Explaining this rapidly evolving system for mobile communications, it describes its advantages and limitations and outlines possible solutions for addressing its current limitations. The book explores the emerging trend of cooperative communication with SC-FDMA and how it can improve the physical layer security. It considers the design of distributed coding schemes and protocols for wireless relay networks where users cooperate to send their data to the destination. Supplying you with the re

  14. Investigating the large degeneracy Kondo lattice metamagnet CeTiGe: Crystal growth and doping studies

    Energy Technology Data Exchange (ETDEWEB)

    Gruner, T.; Caroca-Canales, N.; Deppe, M.; Geibel, C. [MPI fuer Chemische Physik fester Stoffe, 01187, Dresden (Germany); Sereni, J. [Centro Atomico Bariloche, 8400, S. C. de Bariloche (Argentina)

    2011-07-01

    CeTiGe is a paramagnetic Kondo lattice system with a large orbital degeneracy involved in the formation of the heavy Fermion ground state. Recently we discovered that this compound presents a huge metamagnetic transition at B{sub MMT} {approx} 13 T, with much larger anomalies in magnetization, magnetoresistance and magnetostriction than in the archetypical Kondo lattice metamagnet CeRu{sub 2}Si{sub 2}. Since CeTiGe forms in a pronounced peritectic reaction the growth of single crystals is difficult. We therefore studied the Ce-Ti-Ge ternary metallographic phase diagram to get a sound basis for future crystal growth attempts. Preliminary results of growth experiments based on these studies are promising and shall be discussed. Furthermore, Ti-rich CeTiGe was recently reported to present a high temperature phase crystallizing in the closely related CeScSi structure type. In order to study this structural instability and the effect on the physical properties, we studied the effect of substituting Sc for Ti, since pure CeScGe crystallizes in the CeScSi structure type. In well annealed samples we observed a two phase region in the range 10% - 25%-Sc-substitution. Preliminary investigations of the CeSc{sub x}Ti{sub 1-x}Ge alloy suggest it is a promising candidate for the observation of a ferromagnetic quantum critical point in a large degeneracy Kondo lattice system.

  15. Low modulus and bioactive Ti/α-TCP/Ti-mesh composite prepared by spark plasma sintering.

    Science.gov (United States)

    Guo, Yu; Tan, Yanni; Liu, Yong; Liu, Shifeng; Zhou, Rui; Tang, Hanchun

    2017-11-01

    A titanium mesh scaffold composite filled with Ti/α-TCP particles was prepared by spark plasma sintering (SPS). The microstructures and interfacial reactions of the composites were investigated by scanning electron microscopy (SEM), Energy Dispersive Spectroscopy (EDS) and X-ray diffraction (XRD) analyses. The compressive strength and elastic modulus were also measured. In vitro bioactivity and biocompatibility was evaluated by using simulated body fluid and cells culture, respectively. After high temperature sintering, Ti oxides, Ti x P y and CaTiO 3 were formed. The formation of Ti oxides and Ti x P y were resulted from the diffusion of O and P elements from α-TCP to Ti. CaTiO 3 was the reaction product of Ti and α-TCP. The composite of 70Ti/α-TCP incorporated with Ti mesh showed a high compressive strength of 589MPa and a low compressive modulus of 30GPa. The bioactivity test showed the formation of a thick apatite layer on the composite and well-spread cells attachment. A good combination of mechanical properties and bioactivity indicated a high potential application of Ti/α-TCP/Ti-mesh composite for orthopedic implants. Copyright © 2017. Published by Elsevier B.V.

  16. 47,49Ti NMR: hyperfine interactions in oxides and metals.

    Science.gov (United States)

    Bastow, T J; Gibson, M A; Forwood, C T

    1998-10-01

    A 47,49Ti NMR characterisation is given of various polymorphs of TiO2 (anatase, rutile and brookite), Ti2O3, perovskites CaTiO3 and BaTiO3, FeTiO3, TiB2, titanium metal, the titanium aluminides Ti3Al, TiAl, TiAl2, TiAl3, and TiAg. Values of chemical or Knight shift, nuclear quadrupole coupling constant and asymmetry parameter were derived from the (1/2, -1/2) powder lineshapes. For TiB2, titanium metal, TiAl, and TiAl3, where +/- (1/2, 3/2), and higher satellite transitions were observed, a value for the axial component of the Knight shift was obtained.

  17. Electrolytic Production of Ti5Si3/TiC Composites by Solid Oxide Membrane Technology

    Science.gov (United States)

    Zheng, Kai; Zou, Xingli; Xie, Xueliang; Lu, Changyuan; Chen, Chaoyi; Xu, Qian; Lu, Xionggang

    2018-02-01

    This paper investigated the electrolytic production of Ti5Si3/TiC composites from TiO2/SiO2/C in molten CaCl2. The solid-oxide oxygen-ion-conducting membrane tube filled with carbon-saturated liquid tin was served as the anode, and the pressed spherical TiO2/SiO2/C pellet was used as the cathode. The electrochemical reduction process was carried out at 1273 K and 3.8 V. The characteristics of the obtained cathode products and the reaction mechanism of the electroreduction process were studied by a series of time-dependent electroreduction experiments. It was found that the electroreduction process generally proceeds through the following steps: TiO2/SiO2/C → Ti2O3, CaTiO3, Ca2SiO4, SiC → Ti5Si3, TiC. The morphology observation and the elemental distribution analysis indicate that the reaction routes for Ti5Si3 and TiC products are independent during the electroreduction process.

  18. Properties of the low-lying negative parity states in 45Sc

    International Nuclear Information System (INIS)

    Chevallier, J.; Haas, B.; Schulz, N.; Toulemonde, M.

    1975-01-01

    The electromagnetic decay of negative parity states in 45 Sc up to an excitation energy of 2107keV have been investigated via the 42 Ca(α,pγ) 45 Sc reaction at a bombarding energy of 10.5MeV. Spin and lifetime of the levels as well as branching and mixing ratios of their decay γ-rays have been obtained from proton-gamma angular correlation measurements. Calculations based on the strong coupling model have been performed. The results are compared with experiment [fr

  19. Physical conditions in CaFe interstellar clouds

    OpenAIRE

    Gnacinski, P.; Krogulec, M.

    2007-01-01

    Interstellar clouds that exhibit strong Ca I and Fe I lines were called CaFe clouds. The ionisation equilibrium equations were used to model the column densities of Ca II, Ca I, K I, Na I, Fe I and Ti II in CaFe clouds. The chemical composition of CaFe clouds is that of the Solar System and no depletion of elements onto dust grains is seen. The CaFe clouds have high electron densities n=1 cm^-3 that leads to high column densities of neutral Ca and Fe.

  20. Domain wall motion and electromechanical strain in lead-free piezoelectrics: Insight from the model system (1 − x)Ba(Zr{sub 0.2}Ti{sub 0.8})O{sub 3}–x(Ba{sub 0.7}Ca{sub 0.3})TiO{sub 3} using in situ high-energy X-ray diffraction during application of electric fields

    Energy Technology Data Exchange (ETDEWEB)

    Tutuncu, Goknur [Department of Materials Science and Engineering, University of Florida, Gainesville, Florida 32611 (United States); Li, Binzhi [Department of Chemical Engineering and Materials Science, University of California, Davis, Davis, California 95616 (United States); Bowman, Keith [Illinois Institute of Technology, Armour College of Engineering, Chicago, Illinois 60616 (United States); School of Materials Engineering, Purdue University, West Lafayette, Indiana 47907 (United States); Jones, Jacob L., E-mail: JacobJones@ncsu.edu [Department of Materials Science and Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States)

    2014-04-14

    The piezoelectric compositions (1 − x)Ba(Zr{sub 0.2}Ti{sub 0.8})O{sub 3}–x(Ba{sub 0.7}Ca{sub 0.3})TiO{sub 3} (BZT-xBCT) span a model lead-free morphotropic phase boundary (MPB) between room temperature rhombohedral and tetragonal phases at approximately x = 0.5. In the present work, in situ X-ray diffraction measurements during electric field application are used to elucidate the origin of electromechanical strain in several compositions spanning the tetragonal compositional range 0.6 ≤ x ≤ 0.9. As BCT concentration decreases towards the MPB, the tetragonal distortion (given by c/a-1) decreases concomitantly with an increase in 90° domain wall motion. The increase in observed macroscopic strain is predominantly attributed to the increased contribution from 90° domain wall motion. The results demonstrate that domain wall motion is a significant factor in achieving high strain and piezoelectric coefficients in lead-free polycrystalline piezoelectrics.

  1. 33 CFR 80.712 - Morris Island, SC to Hilton Head Island, SC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Morris Island, SC to Hilton Head..., SC to Hilton Head Island, SC. (a) A line drawn from the easternmost tip of Folley Island to the... easternmost extremity of Hilton Head at latitude 32°13.0′ N. longitude 80°40.1′ W. [CGD 77-118a, 42 FR 35784...

  2. Unraveling the resistive switching effect in ZnO/0.5Ba(Zr{sub 0.2}Ti{sub 0.8})O{sub 3}-0.5(Ba{sub 0.7}Ca{sub 0.3})TiO{sub 3} heterostructures

    Energy Technology Data Exchange (ETDEWEB)

    Silva, J.P.B., E-mail: josesilva@fisica.uminho.pt [Centre of Physics, University of Minho, Campus de Gualtar, 4710-057 Braga (Portugal); IFIMUP and IN-Institute of Nanoscience and Nanotechnology, Departamento de Física e Astronomia, Faculdade de Ciências da Universidade do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal); Vorokhta, M.; Dvořák, F. [Department of Surface and Plasma Science, Faculty of Mathematics and Physics, Charles University, V Holešovičkách 2, 18000 Prague 8 (Czech Republic); Sekhar, K.C. [Centre of Physics, University of Minho, Campus de Gualtar, 4710-057 Braga (Portugal); Department of Physics, School of Basic and Applied Science, Central University of Tamil Nadu, Thiruvarur 610 101 (India); Matolín, V. [Department of Surface and Plasma Science, Faculty of Mathematics and Physics, Charles University, V Holešovičkách 2, 18000 Prague 8 (Czech Republic); Moreira, J. Agostinho [IFIMUP and IN-Institute of Nanoscience and Nanotechnology, Departamento de Física e Astronomia, Faculdade de Ciências da Universidade do Porto, Rua do Campo Alegre 687, 4169-007 Porto (Portugal); Pereira, M.; Gomes, M.J.M. [Centre of Physics, University of Minho, Campus de Gualtar, 4710-057 Braga (Portugal)

    2017-04-01

    Highlights: • ZnO/0.5BZT-0.5BCT heterostructures exhibited resistive switching (RS) ratio ≥ 10 4. • Effect of oxygen pressure used in the deposition of ZnO on RS ratio is highlighted. • Determination of the Band alignment in ZnO/0.5BZT-0.5BCT heterojunctions from XPS. • Resistive Switching is explained based on charge coupling effect. - Abstract: This work reports the effect of partial oxygen pressure, used in the deposition of the ZnO layer, on the band alignment at ZnO – 0.5Ba(Zr{sub 0.2}Ti{sub 0.8})O{sub 3}-0.5(Ba{sub 0.7}Ca{sub 0.3})TiO{sub 3} (0.5BZT-0.5BCT) interface and on the resistive switching (RS) behavior of pulsed laser deposited ZnO/0.5BZT-0.5BCT heterostructures. X-ray photoelectron spectroscopy (XPS) has been employed to measure the valence band offset and the conduction band offset of the ZnO/0.5BZT-0.5BCT heterojunctions. The valence and conduction band offsets of the ZnO/0.5BZT-0.5BCT heterostucture with ZnO deposited at 10{sup −2} mbar of partial oxygen pressure were found to be 0.27 and 0.80 eV, respectively. The RS effect in heterostructures is explained on the base of the charge coupling between the switchable polarization of ferroelectric layer and the non-switchable polarization of semiconductor layer. The heterostructure with ZnO deposited at 10{sup −2} mbar of partial oxygen pressure displays optimum RS characteristics, with a switching ratio ≥ 10{sup 4} and excellent retention and endurance characteristics. The optimum RS characteristics are attributed to a good interface quality with enough carrier concentration in ZnO, as evidenced by XPS.

  3. Ca-Embedded C2N: an efficient adsorbent for CO2 capture.

    Science.gov (United States)

    Liu, Yuzhen; Meng, Zhaoshun; Guo, Xiaojian; Xu, Genjian; Rao, Dewei; Wang, Yuhui; Deng, Kaiming; Lu, Ruifeng

    2017-10-25

    Carbon dioxide as a greenhouse gas causes severe impacts on the environment, whereas it is also a necessary chemical feedstock that can be converted into carbon-based fuels via electrochemical reduction. To efficiently and reversibly capture CO 2 , it is important to find novel materials for a good balance between adsorption and desorption. In this study, we performed first-principles calculations and grand canonical Monte Carlo (GCMC) simulations, to systematically study metal-embedded carbon nitride (C 2 N) nanosheets for CO 2 capture. Our first-principles results indicated that Ca atoms can be uniformly trapped in the cavity center of C 2 N structure, while the transition metals (Sc, Ti, V, Cr, Mn, Fe, Co) are favorably embedded in the sites off the center of the cavity. The determined maximum number of CO 2 molecules with strong physisorption showed that Ca-embedded C 2 N monolayer is the most promising CO 2 adsorbent among all considered metal-embedded materials. Moreover, GCMC simulations revealed that at room temperature the gravimetric density for CO 2 adsorbed on Ca-embedded C 2 N reached 50 wt% at 30 bar and 23 wt% at 1 bar, higher than other layered materials, thus providing a satisfactory system for the CO 2 capture and utilization.

  4. Preparation and characterization of segmented p-type Ti0.3Zr0.35Hf0.35CoSb0.8Sn0.2/Ca3Co4O9

    DEFF Research Database (Denmark)

    Le, Thanh Hung; Han, Li; Stamate, Eugen

    with HH using an electrically conductive adhesive and brazing joining technique. The thermoelectric properties of the component materials as well as the interfacial resistance at high temperatures were characterized as a function of temperature up to 1100 K, and the results are discussed in details.......Misfit-layered cobaltite Ca3Co4O9+δ is considered as good p-type thermoelectric material in high temperature region (950 - 1100 K), while half-Heusler (HH) Ti0.3Zr0.35Hf0.35CoSb0.8Sn0.2 is high performance p-type material at temperatures below 950 K. In this work, oxide Ca3Co4O9+δ is segmented...

  5. Structure and bonding of ScCN and ScNC: Ground and low-lying states

    International Nuclear Information System (INIS)

    Kalemos, Apostolos; Metropoulos, Aristophanes; Mavridis, Aristides

    2012-01-01

    Graphical abstract: The experimentally unknown systems ScCN and ScNC have been studied through single reference CISD and CCSD(T) methods. A total of 20 = 10 (ScCN) + 10 (ScNC) states were examined. All states are quite ionic whereas ScNC(X ∼3 Δ) is stabler than ScCN(X ∼3 Δ) by ∼5 kcal/mol. Display Omitted Highlights: ► We have studied through ab initio methods the polytopic system Sc[CN]. ► A series of low lying states for both isomeric forms have been examined. ► Around equilibrium the system displays a pronounced Sc + [CN] − ionic character. - Abstract: We have studied the experimentally unknown Sc[CN] molecular system in both its isomeric forms, scandium cyanide (ScCN) and isocyanide (ScNC), through ab initio computations. We report energetics, geometries, harmonic frequencies, and dipole moments for the first 20 Sc[CN] states correlating diabatically to Sc + ( 3 D, 1 D, 3 F) + CN − (X 1 Σ + ). Both isomers have a pronounced ionic character around equilibrium due to the high electron affinity of the CN group and the low ionization energy of the Sc atom. According to our calculations the ScNC isomer (X ∼3 Δ) is stabler than the ScCN(X ∼3 Δ) by ∼5 kcal/mol.

  6. Platinum determination by instrumental neutron activation analysis with special reference to the spectral interference of Sc-47 on the platinum indicator nuclide Au-199

    DEFF Research Database (Denmark)

    Alfassi, Z.B.; Probst, T.U.; Rietz, B.

    1998-01-01

    A method of instrumental neutron activation analysis (INAA) is developed for the determination of platinum by the Au-199 daughter of Pt-199 in the presence of the spectral interference from the Sc-47 daughter of Ca-47. The contributions of the Pt and Ca signals to the integral 157-161 keV peak we...... separated by calculating the number of disintegrations due to the Sc-47 from the signal of her parent Ca-47 at 1297.1 keV gamma-ray. The method was used to calculate the trace concentrations of Pt in air samples, collected on filters, (C) 1998 Elsevier Science B.V....

  7. Ti, Al

    Indian Academy of Sciences (India)

    In the present study, authors report on the effect that substrate bias voltage has on the microstructure and mechanical properties of (Ti, Al)N hard coatings deposited with cathodic arc evaporation (CAE) technique. The coatings were deposited from a Ti0.5Al0.5 powder metallurgical target in a reactive nitrogen atmosphere at ...

  8. Fermilab's SC Accelerator Magnet Program for Future U.S. HEP Facilities

    International Nuclear Information System (INIS)

    Lamm, Michael; Zlobin, Alexander

    2010-01-01

    The invention of SC accelerator magnets in the 1970s opened wide the possibilities for advancing the energy frontier of particle accelerators, while limiting the machine circumference and reducing their energy consumption. The successful development of SC accelerator magnets based on NbTi superconductor have made possible a proton-antiproton collider (Tevatron) at Fermilab, an electron-proton collider (HERA) at DESY, a relativistic heavy ion collider (RHIC) at BNL and recently a proton-proton collider (LHC) at CERN. Further technological innovations and inventions are required as the US HEP looks forward towards the post-LHC energy or/and intensity frontiers. A strong, goal oriented national SC accelerator magnet program must take on this challenge to provide a strong base for the future of HEP in the U.S. The results and experience obtained by Fermilab during the past 30 years will allow us to play a leadership role in the SC accelerator magnet development in the U.S., in particular, focusing on magnets for a Muon Collider/Neutrino Factory (1)-(2). In this paper, we summarize the required Muon Collider magnet needs and challenges, summarize the technology advances in the Fermilab accelerator magnet development over the past few years, and present and discuss our vision and long-term plans for these Fermilab-supported accelerator initiatives.

  9. Laser photoelectron spectrometry of Sc- and Y-

    International Nuclear Information System (INIS)

    Feigerle, C.S.; Herman, Z.; Lineberger, W.C.

    1981-01-01

    The photoelectron spectra of Sc - and Y - have been obtained in a crossed ion- and laser-beam experiment. Analysis of the Sc - spectrum yields two bound terms of 3d4s 2 4p configuration ( 1 D 0 and 3 D 0 ), with EA(Sc) = 0.189 +- 0.020 eV and an excited-state binding energy of 0.042 +- 0.020 eV. Similarly, the (4d5s 2 5p) 1 D 0 ground state of Y - is bound by 0.308 +- 0.012 eV and a (4d5s 2 5p) 3 D 0 excited term is bound by 0.165 +- 0.025 eV. With the determination of the bound electronic configuration of Sc - as 3d4s 2 4p, the order of filling of electron shells of the first transition series negative ions is found to be 4s 2 ep, 3d4s 2 4p, the order of filling of electron shells of the first transition series negative ions is found to be 4s 2 4p, 3d4s 2 4p, followed by 3dsup(k) 4s 2 (k = 3, 4, ..., 10). (orig.)

  10. Final Scientific Report: DE-SC0008580

    Energy Technology Data Exchange (ETDEWEB)

    Seidler, Gerald T. [Univ. of Washington, Seattle, WA (United States)

    2017-03-16

    We report scientific, technical, and organizational accomplishments under DE-SC0008580. This includes 10 publications, 5 patent or provisional patent applications, beamtime with important results at both LCLS and APS, and new progress in understanding target design for x-ray heating experiments at x-ray heating facilities.

  11. The Synchrocyclotron (SC) in building 300

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    The red magnet of CERN's first accelerator, the Synchrocyclotron (SC), has occupied a large part of Hall 300 since it was installed in the late 1950s. The remaining part of the 300-square-metre building has been used as a storage room since the accelerator was shut down in 1990. Now a public exhibition will breathe new life into the hall.

  12. Magnet measuring equipment of SC2

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator.

  13. Magnet measuring equipment of SC2

    CERN Multimedia

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator. On the left, Marinus van Gulik. (See Photo Archive 7402005 and Annual Report 1974, p. 44.)

  14. Knowledge insufficient: the management of haemoglobin SC disease.

    Science.gov (United States)

    Pecker, Lydia H; Schaefer, Beverly A; Luchtman-Jones, Lori

    2017-02-01

    Although haemoglobin SC (HbSC) accounts for 30% of sickle cell disease (SCD) in the United States and United Kingdom, evidence-based guidelines for genotype specific management are lacking. The unique pathology of HbSC disease is complex, characterized by erythrocyte dehydration, intracellular sickling and increased blood viscosity. The evaluation and treatment of patients with HbSC is largely inferred from studies of SCD consisting mostly of haemoglobin SS (HbSS) patients. These studies are underpowered to allow definitive conclusions about HbSC. We review the pathophysiology of HbSC disease, including known and potential differences between HbSS and HbSC, and highlight knowledge gaps in HbSC disease management. Clinical and translational research is needed to develop targeted treatments and to validate management recommendations for efficacy, safety and impact on quality of life for people with HbSC. © 2016 John Wiley & Sons Ltd.

  15. Bioactivity studies on TiO{sub 2}-bearing Na{sub 2}O–CaO–SiO{sub 2}–B{sub 2}O{sub 3} glasses

    Energy Technology Data Exchange (ETDEWEB)

    Jagan Mohini, G. [Department of Physics, Andhra Loyola College, Vijayawada 520 008, Andhra Pradesh (India); Department of Physics, Acharya Nagarjuna University, Nagarjuna Nagar 522 510, A.P. (India); Sahaya Baskaran, G. [Department of Physics, Andhra Loyola College, Vijayawada 520 008, Andhra Pradesh (India); Ravi Kumar, V. [Department of Physics, Acharya Nagarjuna University, Nagarjuna Nagar 522 510, A.P. (India); Piasecki, M. [Institute of Physics, J. Dlugosz University, Al. Armii Krajowej 13/15, Czestochowa (Poland); Veeraiah, N., E-mail: nvr8@rediffmail.com [Department of Physics, Acharya Nagarjuna University, Nagarjuna Nagar 522 510, A.P. (India)

    2015-12-01

    Soda lime silica borate glasses mixed with different concentrations of TiO{sub 2} are synthesized by the melt-quenching technique. As a part of study on bioactivity of these glasses, the samples were immersed in simulated body fluid (SBF) solution for prolonged times (~ 21 days) during which weight loss along with pH measurements is carried out at specific intervals of time. The XRD and SEM analyses of post-immersed samples confirm the formation of crystalline hydroxyapatite layer (HA) on the surface of the samples. To assess the role of TiO{sub 2} on the formation of HA layer and degradability of the samples the spectroscopic studies viz. optical absorption and IR spectral studies on post- and pre-immersed samples have been carried out. The analysis of the results of degradability together with spectroscopic studies as a function of TiO{sub 2} concentration indicated that about 6.0 mol% of TiO{sub 2} is the optimal concentration for achieving better bioactivity of these glasses. The presence of the maximal concentration octahedral titanium ions in this glass that facilitates the formation of HA layer is found to be the reason for such a higher bioactivity. - Highlights: • Soda lime silica borate glasses mixed with TiO{sub 2} are synthesized. • Bioactivity of the glasses is studied by immersing them in SBF solution. • XRD and SEM studies indicated the formation of hydroxyapatite layer on the surface. • Quantum of degradability is the highest in the glasses mixed with 6.0 mol% of TiO{sub 2.} • The results are analyzed using IR and optical absorption studies.

  16. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available n CaO19.6989 [Candida albicans SC5314] ... Length = 94 ... Query: 11 ... VKNLPYNTSNSSLYEFFGKYGYINQIRINSSQPG...TCFIIYHNIKNAQRAAQDLNGVNFNG 70 ... VKNLPYNTSNSSLYEFFGKYGYINQIRINSSQPGTCFIIY...HNIKNAQRAAQDLNGVNFNG Sbjct: 1 ... VKNLPYNTSNSSLYEFFGKYGYINQIRINSSQPGTCFIIYHNIKNAQRAAQDLNGVNFNG 60 ...

  17. Photon stimulated desorption investigations of positive ions of MgO, TiO2, Yb2O3, Nd2O3, H2O/Si(100), CaF2/Si and of H2O, CO and NO on Yb and Nd in the energy range 14 eV up to 800 eV

    International Nuclear Information System (INIS)

    Senf, F.

    1987-01-01

    Photon-stimulated desorption of positive ions from surfaces has been studied with synchrotron radiation in the photon energy range 14 -800 eV of the 'FLIPPER'-monochromator using a time-of-flight mass spectrometer. TiO 2 , as a prototype of a maximal valency ionic compound, shows a strong desorption of O +- in the photon energy range of the Ti 3 p → 3d- and Ti 2p → 3d-resonance as well as at the 0 1s-excitation due to intraatomic respectively intraatomic Auger decays, which is in agreement with the Knotek-Feibelman model. The desorption of F + from CaF 2 -covered silicon is found to follow the respective excitation and decay processes in Ca and F. In addition, the very large cross section for the F + desorption causes a radiation damage by photons of more than about 30 eV. The adsorbate system H 2 O/Si (100) needs a multiple electron excitation to show a significant desorption setting in only 30 eV above the 0 1s threshold. The rare earth metals Yb and Nd covered with O 2 , H 2 O, CO or NO exhibit a competitive desorption of O + partly due to intraatomic Auger decays caused by single electron excitations and partly due to multiple electron excitations. The variation of the 0 + yield with regard to the different adsorbates on Yb and Nd is unexpectedly low. A detailed investigation was concerned with thin oxidized Mg-films and differently prepared MgO-single-crystals. Here we found a very efficient desorption of O + and H + resulting from the excitation of O 1s-surface-excitons. In addition, the strong hole-hole-interaction energy of crystalline MgO appears to be responsible for a suppressed O + -signal in the energy range of the Mg 2p-excitation. (orig./BHO)

  18. The temporoammonic input to the hippocampal CA1 region displays distinctly different synaptic plasticity compared to the Schaffer collateral input in vivo: significance for synaptic information processing

    Directory of Open Access Journals (Sweden)

    Ayla eAksoy Aksel

    2013-08-01

    Full Text Available In terms of its sub-regional differentiation, the hippocampal CA1 region receives cortical information directly via the perforant (temporoammonic path (pp-CA1 synapse and indirectly via the tri-synaptic pathway where the last relay station is the Schaffer collateral-CA1 synapse (Sc-CA1 synapse. Research to date on pp-CA1 synapses has been conducted predominantly in vitro and never in awake animals, but these studies hint that information processing at this synapse might be distinct to processing at the Sc-CA1 synapse. Here, we characterized synaptic properties and synaptic plasticity at the pp-CA1 synapse of freely behaving adult rats. We established that field excitatory postsynaptic potentials at the pp-CA1 have longer onset latencies and a shorter time-to-peak compared to the Sc-CA1 synapse. LTP (> 24h was successfully evoked by tetanic afferent stimulation of pp-CA1 synapses. Low frequency stimulation evoked synaptic depression at Sc-CA1 synapses, but did not elicit LTD at pp-CA1 synapses unless the Schaffer collateral afferents to the CA1 region had been severed. Paired-pulse responses also showed significant differences. Our data suggest that synaptic plasticity at the pp-CA1 synapse is distinct from the Sc-CA1 synapse and that this may reflect its specific role in hippocampal information processing.

  19. Influence of the sintering temperature on the Sr content in a Ca{sub (1−x−y)}Ce{sub x}Sr{sub y}Al{sub z}Ti{sub (1−z)}O{sub 3} perovskite (x = 0.04–0.16) co-doped with Ce

    Energy Technology Data Exchange (ETDEWEB)

    Kamel, Nour-el-hayet; Mouheb, Yasmina, E-mail: mouhebyascrna@hotmail.com; Kamel, Ziane; Moudir, Dalila; Aouchiche, Fairouz; Arabi, Azeddine

    2016-08-15

    A Sr-Ce co-doped perovskite, with the chemical formula: Ca{sub (1−x−y)}Ce{sub x}Sr{sub y}Al{sub z}Ti{sub (1−z)}O{sub 3} (y = 0.04, 0.08, 0.12 and 0.16, x = 0.05) is synthesized by sol–gel process. The influence of the sintering temperature, Ts, on the rate of inserted Sr was investigated at 1223, 1373 and 1473 K. The Sr amount sequestered in the perovskite reaches 85% (y = 0.16, 9.50 wt%) for Ts = 1373 K, giving sintering densities between 3.520 and 4.400. XRD analysis reveals an orthorhombic CaTiO{sub 3} structure. The lattice parameters obey to Vegard’s law for Ts = 1373 and 1473 K. SEM analysis shows orthorhombic grains of 0.514 μm × 1 μm mean dimensions. MCC1 and MCC2 tests, performed on minerals sintered at 1373 K, indicate that the most durable one is that containing 9.50 wt% Sr. MCC1 test gave 6.998·10{sup −6} g/cm{sup 2} d of Sr, and MCC2 2.143·10{sup −4} g/cm{sup 2} d of Ce. The temperature favors the Sr dissolution to the detriment of Ce. The Ca dissolution rate reaches 1.002·10{sup −6} to 2.005·10{sup −6} g/cm{sup 2} d. - Highlights: • Ca{sub (1−x−y)}Ce{sub x}Sr{sub y}Al{sub z}Ti{sub (1−z)}O{sub 3} perovskite is synthesized by sol–gel. • The influence of the sintering temperature, Ts, on the rate of inserted Sr was investigated at 1223, 1373 and 1473 K. • 85% of total Sr was sequestered in the perovskite for Ts = 1373 K. • MCC1 and MCC2 leach tests indicate that the most durable mineral is that containing 9.50 wt.% Sr. • MCC1 test gave 8.10 10{sup −10} kg/m{sup 2}.d Sr. The lower is the leaching temperature the higher is the mineral durability.

  20. Influence of the sintering temperature on the Sr content in a Ca_(_1_−_x_−_y_)Ce_xSr_yAl_zTi_(_1_−_z_)O_3 perovskite (x = 0.04–0.16) co-doped with Ce

    International Nuclear Information System (INIS)

    Kamel, Nour-el-hayet; Mouheb, Yasmina; Kamel, Ziane; Moudir, Dalila; Aouchiche, Fairouz; Arabi, Azeddine

    2016-01-01

    A Sr-Ce co-doped perovskite, with the chemical formula: Ca_(_1_−_x_−_y_)Ce_xSr_yAl_zTi_(_1_−_z_)O_3 (y = 0.04, 0.08, 0.12 and 0.16, x = 0.05) is synthesized by sol–gel process. The influence of the sintering temperature, Ts, on the rate of inserted Sr was investigated at 1223, 1373 and 1473 K. The Sr amount sequestered in the perovskite reaches 85% (y = 0.16, 9.50 wt%) for Ts = 1373 K, giving sintering densities between 3.520 and 4.400. XRD analysis reveals an orthorhombic CaTiO_3 structure. The lattice parameters obey to Vegard’s law for Ts = 1373 and 1473 K. SEM analysis shows orthorhombic grains of 0.514 μm × 1 μm mean dimensions. MCC1 and MCC2 tests, performed on minerals sintered at 1373 K, indicate that the most durable one is that containing 9.50 wt% Sr. MCC1 test gave 6.998·10"−"6 g/cm"2 d of Sr, and MCC2 2.143·10"−"4 g/cm"2 d of Ce. The temperature favors the Sr dissolution to the detriment of Ce. The Ca dissolution rate reaches 1.002·10"−"6 to 2.005·10"−"6 g/cm"2 d. - Highlights: • Ca_(_1_−_x_−_y_)Ce_xSr_yAl_zTi_(_1_−_z_)O_3 perovskite is synthesized by sol–gel. • The influence of the sintering temperature, Ts, on the rate of inserted Sr was investigated at 1223, 1373 and 1473 K. • 85% of total Sr was sequestered in the perovskite for Ts = 1373 K. • MCC1 and MCC2 leach tests indicate that the most durable mineral is that containing 9.50 wt.% Sr. • MCC1 test gave 8.10 10"−"1"0 kg/m"2.d Sr. The lower is the leaching temperature the higher is the mineral durability.

  1. Soft spin-dipole resonances in 40Ca

    International Nuclear Information System (INIS)

    Stuhl, L; Krasznahorkay, A; Csatlós, M; Gulyás, J; Marketin, T; Litvinova, E; Adachi, T; Fujita, H; Hatanaka, K; Hirota, K; Ong, H J; Ishikawa, D; Matsubara, H; Algora, A; Estevez, E; Molina, F; Daeven, J; Guess, C; Meharchand, R; Fujita, Y

    2012-01-01

    High resolution experimental data has been obtained for the 40,42,44,48 Ca( 3 He,t)Sc charge exchange reaction at 420 MeV beam energy, which favors the spin-isospin excitations. The measured angular distributions were analyzed for each state separately, and the relative spin dipole strength has been extracted for the first time. The low-lying spin-dipole strength distribution in 40 Sc shows some interesting periodic gross feature. It resembles to a soft, damped multi-phonon vibrational band with hω= 1.8 MeV, which might be associated to pairing vibrations around 40 Ca.

  2. Synthesis, microstructural characterization and optical properties of undoped, V and Sc doped ZnO thin films

    International Nuclear Information System (INIS)

    Amezaga-Madrid, P.; Antunez-Flores, W.; Ledezma-Sillas, J.E.; Murillo-Ramirez, J.G.; Solis-Canto, O.; Vega-Becerra, O.E.; Martinez-Sanchez, R.; Miki-Yoshida, M.

    2011-01-01

    Research highlights: → Undoped, V and Sc doped ZnO thin films by Aerosol Assisted Chemical Vapour Deposition. → Optimum substrate temperatures of 673 K and 623 K for Sc and V doped films. → Around one third of the dopants in solution were deposited into the films. → Crystallite and grain size decreased with the increase of dopant concentration. → Optical band gap increased from 3.29 to 3.32 eV for undoped to 7 Sc/Zn at. %. - Abstract: Many semiconductor oxides (ZnO, TiO 2 , SnO 2 ) when doped with a low percentage of non-magnetic (V, Sc) or magnetic 3d (Co, Mn, Ni, Fe) cation behave ferromagnetically. They have attracted a great deal of interest due to the integration of semiconducting and magnetic properties in a material. ZnO is one of the most promising materials to carry out these tasks in view of the fact that it is optically transparent and has n or p type conductivity. Here, we report the synthesis, microstructural characterization and optical properties of undoped, V and Sc doped zinc oxide thin films. ZnO based thin films with additions of V and Sc were deposited by the Aerosol Assisted Chemical Vapour Deposition method. V and Sc were incorporated separately in the precursor solution. The films were uniform, transparent and non-light scattering. The microstructure of the films was characterized by Grazing Incidence X-ray Diffraction, Scanning Electron Microscopy, and Scanning Probe Microscopy. Average grain size and surface rms roughness were estimated by the measurement of Atomic Force Microscopy. The microstructure of doped ZnO thin films depended on the type and amount of dopant material incorporated. The optical properties were determined from specular reflectance and transmittance spectra. Results were analyzed to determine the optical constant and band gap of the films. An increase in the optical band gap with the content of Sc dopant was obtained.

  3. The effect of Sc additions on the microstructure and age hardening behaviour of as cast Al–Sc alloys

    International Nuclear Information System (INIS)

    Costa, S.; Puga, H.; Barbosa, J.; Pinto, A.M.P.

    2012-01-01

    Highlights: ► The Sc effect on the microstructure and ageing behaviour of Al–Sc alloys is studied. ► Cast into copper mould allows the elimination of solution heat treatment. ► Directly aged as cast alloys exhibits higher hardness and precipitation kinetics. ► Sc addition and optimised ageing result in an increase in Al–Sc mechanical properties. -- Abstract: The grain refinement effect and the ageing behaviour of Al–0.5 wt.% Sc, Al–0.7 wt.% Sc, and Al–1 wt.% Sc alloys are studied on the basis of optic microscopy (OM), scanning electron microscopy (SEM), X-ray diffraction (XRD) observations and hardness measurements. In Al–Sc alloys the higher grain refinement is observed for Sc contents greater than 0.5 wt.% accompanied by a notorious morphology modification, from coarse columnar grains to a fine perfect equiaxed structure. The as cast structures are characterised by a rich supersaturated solid solution in Sc, that promotes a great age hardening response at 250 °C and 300 °C. The age hardening curves also demonstrate a low overageing kinetics for all the alloys. Although the higher Sc content in solid solution for the alloys with 0.7 and 1 wt.% Sc, the age hardening response of all the Al–Sc alloys remains similar. The direct age hardening response of the as cast Al–0.5 wt.% Sc is shown to be greater than the solutionised and age hardened alloy.

  4. 44gSc production using a water target on a 13 MeV cyclotron

    International Nuclear Information System (INIS)

    Hoehr, Cornelia; Oehlke, Elisabeth; Benard, Francois; Lee, Chris Jaeil; Hou, Xinchi; Badesso, Brian; Ferguson, Simon; Miao, Qing; Yang, Hua; Buckley, Ken; Hanemaayer, Victoire; Zeisler, Stefan; Ruth, Thomas; Celler, Anna; Schaffer, Paul

    2014-01-01

    Introduction: Access to promising radiometals as isotopes for novel molecular imaging agents requires that they are routinely available and inexpensive to obtain. Proximity to a cyclotron center outfitted with solid target hardware, or to an isotope generator for the metal of interest is necessary, both of which can introduce significant hurdles in development of less common isotopes. Herein, we describe the production of 44 Sc (t 1/2 = 3.97 h, E avg,β + = 1.47 MeV, branching ratio = 94.27%) in a solution target and an automated loading system which allows a quick turn-around between different radiometallic isotopes and therefore greatly improves their availability for tracer development. Experimental yields are compared to theoretical calculations. Methods: Solutions containing a high concentration (1.44–1.55 g/mL) of natural-abundance calcium nitrate tetrahydrate (Ca(NO 3 ) 2 · 4 H 2 O) were irradiated on a 13 MeV proton-beam cyclotron using a standard liquid target. 44g Sc was produced via the 44 Ca(p,n) 44g Sc reaction. Results: 44g Sc was produced for the first time in a solution target with yields sufficient for early radiochemical studies. Saturation yields of up to 4.6 ± 0.3 MBq/μA were achieved using 7.6 ± 0.3 μA proton beams for 60.0 ± 0.2 minutes (number of runs n = 3). Experimental data and calculation results are in fair agreement. Scandium was isolated from the target mixture via solid-phase extraction with 88 ± 6% (n = 5) efficiency and successfully used for radiolabelling experiments. The demonstration of the production of 44 Sc in a liquid target greatly improves its availability for tracer development

  5. Incipient ferroelectric to a possible ferroelectric transition in Te4+ doped calcium copper titanate (CaCu3Ti4O12 ceramics at low temperature as evidenced by Raman and dielectric spectroscopy

    Directory of Open Access Journals (Sweden)

    Nabadyuti Barman

    2017-03-01

    Full Text Available Partial replacement of Ti4+ by Te4+ ions in calcium copper titanate lattice improved its dielectric behaviour mostly due to cubic-to-tetragonal structural transformation and associated distortion in TiO6 octahedra. The relative permittivity values (23–30 x 103 of Te4+ doped ceramics is more than thrice that of un-doped ceramics (8 x 103 at 1 kHz. A decreasing trend in relative permittivity with increasing temperature (50–300 K is observed for all the samples. Barrett’s formula, as a signature of incipient ferroelectricity, is invoked to rationalize the relative permittivity variation as a function of temperature. A systematic investigation supported by temperature dependent Raman studies reveal a possible ferroelectric transition in Te4+ doped ceramic samples below 120 K. The possible ferroelectric transition is attributed to the interactions between quasi-local vibrations associated with the micro-clusters comprising TiO6 and TeO6 structural units and indirect dipole-dipole interactions of off-center B–cations (Ti4+ and Te4+ in double perovskite lattice.

  6. CORRELATION BETWEEN SEED TESTS AND FIELD EMERGENCE OF TWO MAIZE HYBRIDS (SC704 AND SC500)

    OpenAIRE

    A.A. ALILOO; B. SHOKATI

    2011-01-01

    Early emergence and stand establishment of maize (Zea mays L.) are considered to be the most important yield-contributing factors. The influence of seed vigor on these factors is vital. Therefore, five laboratory tests and field experiment were conducted on basis of a randomized complete block design (RCBD) with five replications in 2011, to evaluate the correlation among the seed vigor tests and field emergence of two maize hybrids (SC704 and SC500). In laboratory tests, differences between ...

  7. Crystal structure and phase stability of AlSc in the near-equiatomic Al–Sc alloy

    Energy Technology Data Exchange (ETDEWEB)

    Li, Juan; Huang, Li; Liang, Yongfeng [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, 30 Xueyuan Road, Beijing 100083 (China); Ye, Feng, E-mail: yefeng@skl.ustb.edu.cn [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, 30 Xueyuan Road, Beijing 100083 (China); Lin, Junpin [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, 30 Xueyuan Road, Beijing 100083 (China); Shang, Shunli; Liu, Zikui [Department of Materials Science and Engineering, The Pennsylvania State University, University Park, PA 16802 (United States)

    2015-01-05

    Highlights: • Two lattice structures of equiatomic Al–Sc compounds are confirmed. • Al–Sc phase at Sc 50 at.% has a space group of Pbam. • Al–Sc phase at Sc 55 at.% has a space group of B2. • B2 AlSc is a metastable phase with Sc 50 at.%. • Lattice transition between two compounds is proposed under local thermal stress. - Abstract: Intermetallic compound AlSc is found in the equiatomic Al–Sc binary alloy. The present work indicates that the orthorhombic AlSc with the Au{sub 2}CuZn-type structure can be formed at 50 at.% Sc, while the CsCl-type (B2) AlSc will be formed at 55 at.% Sc. After annealing at 1100 °C, some orthorhombic AlSc grains transit to the B2 structure, and the annealing at lower temperatures leads to the disappearance of B2 phase, indicating that the B2 AlSc is also a metastable phase in the alloy at lower Sc content (<50 at.%). First-principle calculations at 0 K reveal that the orthorhombic AlSc is more stable than the B2 AlSc with the energy difference between them being 5.4 meV/atom. The fast transition between these two phases, which cannot be interpreted by the mechanism of atomic diffusion, was tentatively analyzed by the volume change based on the calculated atomic positions of these two phases.

  8. First-in-Human PET/CT Imaging of Metastatic Neuroendocrine Neoplasms with Cyclotron-Produced 44Sc-DOTATOC: A Proof-of-Concept Study.

    Science.gov (United States)

    Singh, Aviral; van der Meulen, Nicholas P; Müller, Cristina; Klette, Ingo; Kulkarni, Harshad R; Türler, Andreas; Schibli, Roger; Baum, Richard P

    2017-05-01

    44 Sc is a promising positron emission tomography (PET) radionuclide (T 1/2  = 4.04 hours, E β+average  = 632 keV) and can be made available, using a cyclotron production route, in substantial quantities as a highly pure product. Herein, the authors report on a first-in-human PET/CT study using 44 Sc-DOTATOC prepared with cyclotron-produced 44 Sc. The production of 44 Sc was carried out through the 44 Ca(p,n) 44 Sc nuclear reaction at Paul Scherrer Institut, Switzerland. After separation, 44 Sc was shipped to Zentralklinik Bad Berka, Germany, where radiolabeling was performed, yielding radiochemically pure 44 Sc-DOTATOC. Two patients, currently followed up after peptide receptor radionuclide therapy of metastatic neuroendocrine neoplasms, participated in this proof-of-concept study. Blood sampling was performed before and after application of 44 Sc-DOTATOC. PET/CT acquisitions, performed at different time points after injection of 44 Sc-DOTATOC, allowed detection of even very small lesions on delayed scans. No clinical adverse effects were observed and the laboratory hematological, renal, and hepatic profiles remained unchanged. In this study, cyclotron-produced 44 Sc was used in the clinic for the first time. It is attractive for theranostic application with 177 Lu, 90 Y, or 47 Sc as therapeutic counterparts. 44 Sc-based radiopharmaceuticals will be of particular value for PET facilities without radiopharmacy, to which they can be shipped from a centralized production site.

  9. Hemoglobin C, S-C, and E Diseases

    Science.gov (United States)

    ... quickly than others, resulting in chronic anemia. Hemoglobin C disease Hemoglobin C disease occurs mostly in blacks. ... a common complication of hemoglobin C disease. Hemoglobin S-C disease Hemoglobin S-C disease occurs in people who ...

  10. Design of SC solenoid with high homogeneity

    International Nuclear Information System (INIS)

    Yang Xiaoliang; Liu Zhong; Luo Min; Luo Guangyao; Kang Qiang; Tan Jie; Wu Wei

    2014-01-01

    A novel kind of SC (superconducting) solenoid coil is designed to satisfy the homogeneity requirement of the magnetic field. In this paper, we first calculate the current density distribution of the solenoid coil section through the linear programming method. Then a traditional solenoid and a nonrectangular section solenoid are designed to produce a central field up to 7 T with a homogeneity to the greatest extent. After comparison of the two solenoid coils designed in magnet field quality, fabrication cost and other aspects, the new design of the nonrectangular section of a solenoid coil can be realized through improving the techniques of framework fabrication and winding. Finally, the outlook and error analysis of this kind of SC magnet coil are also discussed briefly. (authors)

  11. LHCb Data Replication During SC3

    CERN Multimedia

    Smith, A

    2006-01-01

    LHCb's participation in LCG's Service Challenge 3 involves testing the bulk data transfer infrastructure developed to allow high bandwidth distribution of data across the grid in accordance with the computing model. To enable reliable bulk replication of data, LHCb's DIRAC system has been integrated with gLite's File Transfer Service middleware component to make use of dedicated network links between LHCb computing centres. DIRAC's Data Management tools previously allowed the replication, registration and deletion of files on the grid. For SC3 supplementary functionality has been added to allow bulk replication of data (using FTS) and efficient mass registration to the LFC replica catalog.Provisional performance results have shown that the system developed can meet the expected data replication rate required by the computing model in 2007. This paper details the experience and results of integration and utilisation of DIRAC with the SC3 transfer machinery.

  12. Development of bonding techniques for cryogenic components (2). HIP bonding between Cu Alloys and Ti, cryogenic stainless steels

    Energy Technology Data Exchange (ETDEWEB)

    Saito, Shigeru; Ouchi, Nobuo [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Fukaya, Kiyoshi [Nihon Advanced Technology Ltd., Tokai, Ibaraki (Japan); Ishiyama, Shintaro [Japan Atomic Energy Research Inst., Oarai, Ibaraki (Japan). Oarai Research Establishment; Tsuchiya, Yoshinori; Nakajima, Hideo [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    2003-03-01

    Several joints between dissimilar materials are required in the superconducting (SC) magnet system of SC linear accelerator or fusion reactor, Pure titanium (Ti) is one of candidate materials for a jacket of SC coil of fusion reactor because Ti is non-magnetic material and has a feature that its thermal expansion is similar to SC material in addition to good corrosion resistance and workability. Also, Ti does not require strict control of environment during reaction heat treatment of SC material. Copper (Cu) or Cu-alloy is used in electrical joints and cryogenic stainless steel (SS) is used in cryogenic pipes. Therefore, it is necessary to develop new bonding techniques for joints between Ti, Cu, and SS because jacket, electrical joint and cryogenic pipe have to be bonded each other to cool SC coils. Japan Atomic Energy Research Institute (JAERI) has started to develop dissimilar material joints bonded by hot isostatic pressing (HIP), which can bring a high strength joint with good tolerance and can applied to a large or complex geometry device. HIP conditions for Cu-Ti, Cu alloy-Ti, Cu alloy-SS were investigated in this study and most stable HIP condition were evaluated by microscopic observation, tensile and bending tests at room temperature. (author)

  13. SC*994C>T causes the Sc(null) phenotype in Pacific Islanders and successful transfusion of Sc3+ blood to a patient with anti-Sc3.

    Science.gov (United States)

    Reid, Marion E; Hue-Roye, Kim; Velliquette, Randall W; Larimore, Kathleen; Moscarelli, Sue; Ohswaldt, Nicolas; Lomas-Francis, Christine

    2013-01-01

    Antigens in the SC blood group system are expressed by the human erythrocyte membrane-associated protein (ERMAP).Two molecular bases have been reported for the Sc,un phenotype:SC*307del2 and SC*994C>T. We report our investigation of the molecular background of five Sc,n1 individuals from the Pacific Islands and describe the successful transfusion of Sc3+ blood to a patient with anti-Sc3 in her plasma. SC (ERMAP) exons 2,3, and 12 and their flanking intronic regions were analyzed. TheSC*994C>T change introduces a restriction enzyme cleavage site for Tsp45I, and polymerase chain reaction (PCR) products from exon 12 were subjected to this PCR-restriction fragment length polymorphism (RFLP) assay. The five samples had the variant SC*994T/T. One sample, from a first cousin of one Marshallese proband, was heterozygous for SC*1514C/T (in the 3' untranslated region); the other four samples were SC*1514C/C(consensus sequence). Samples from white donors (n = 100) and African American donors (n = 99) were tested using the Tsp45IPCR-RFLP assay; all gave a banding pattern that was consistent with the SC*994C/C consensus sequence. In all five samples,our analyses showed homozygosity for the nonsense nucleotide change SC*994C>Tin an allele carrying the nucleotide associated with SLd. Further investigation determined that one of the probands reported previously with the SC*994C>T change was from the Marshall Islands (which form part of the Micronesian Pacific Islands) and the other was from an unspecified location within the large collection of Pacific Islands. Taken together, the five known probands with the SC*994C>T silencing nucleotide change were from the Pacific Islands.

  14. The SC gets ready for visitors

    CERN Multimedia

    Antonella Del Rosso

    2012-01-01

    Hall 300, which houses the Synchrocyclotron (SC), CERN’s first accelerator, is getting ready to host a brand-new exhibition. The site will be one of the stops on the new visit itineraries that will be inaugurated for the 2013 CERN Open Day.   The Synchrocyclotron through the years. Just as it did in the late 1950s, when the accelerator was first installed, the gigantic red structure of the Synchrocyclotron's magnet occupies a large part of the 300-square-metre hall. “We have completed the first phase of the project that will give the SC a new lease of life,” says Marco Silari, the project leader and a member of CERN’s Radiation Protection Group. “We have removed all the equipment that was not an integral part of the accelerator. The hall is now ready for the civil-engineering work that will precede the installation of the exhibition.” The SC was witness to a big part of the history of CERN. The accelerator produced ...

  15. Spectroscopic study of the elusive globular cluster ESO452-SC11 and its surroundings

    Science.gov (United States)

    Koch, Andreas; Hansen, Camilla Juul; Kunder, Andrea

    2017-08-01

    Globular clusters (GCs) have long been recognized as being amongst the oldest objects in the Galaxy. As such, they have the potential of playing a pivotal role in deciphering the Milky Way's early history. Here we present the first spectroscopic study of the low-mass system ESO452-SC11 using the AAOmega multifibre spectrograph at medium resolution. Given the stellar sparsity of this object and the high degree of foreground contamination due to its location toward the Galactic bulge, very few details are known for this cluster - there is no consensus, for instance, about its age, metallicity, or its association with the disk or bulge. We identify five member candidates based on common radial velocity, calcium-triplet metallicity, and position within the GC. Using spectral synthesis, the measurement of accurate Fe-abundances from Fe-lines, and abundances of several α-, Fe-peak, and neutron-capture elements (Si, Ca, Ti,Cr, Co, Ni, Sr, and Eu) is carried out, albeit with large uncertainties. We find that two of the five cluster candidates are likely non-members, as they have deviating iron abundances and [α/Fe] ratios. The cluster mean heliocentric velocity is 19 ± 2 km s-1 with a velocity dispersion of 2.8 ± 3.4 km s-1, a low value in line with its sparse nature and low mass. The mean Fe-abundance from spectral fitting is -0.88 ± 0.03 dex, where the spread is driven by observational errors. Furthermore, the α-elements of the GC candidates are marginally lower than expected for the bulge at similar metallicities. As spectra of hundreds of stars were collected in a 2-degree field centered on ESO452-SC11, a detailed abundance study of the surrounding field was also enabled. The majority of the non-members have slightly higher [α/Fe] ratios, in line with the typical nearby bulge population. A subset of the spectra with measured Fe-peak abundance ratios shows a large scatter around solar values, albeit with large uncertainties. Furthermore, our study provides the

  16. Determination of Sc and Th in ScI3-NaI-ThI4 sample

    International Nuclear Information System (INIS)

    Yuan Hui; Yang Zhihong

    1999-01-01

    Determination of Sc and Th in ScI 3 -NaI-ThI 4 sample is studied by X-ray fluorescence and complexometry. The effect of working condition of Sc on X-ray fluorescence spectrometer and different sample-making method on the determination of Sc and Th are studied experimentally. The X-ray fluorescence analysis of determination of Sc and Th is developed by polyester film sample-making technique, the measuring precision of Sc and Th is better than 4%. The effect of acidity and temperature on the determining end point of titration is obvious. The results of different complexometric methods are compared. The precision of Sc and Th is less than 2% by comlexometry, it is fit for the routine analysis of ScI 3 -NaI-ThI 4 sample

  17. Electronic structure and physical properties of ScN in pressure: density-functional theory calculations

    International Nuclear Information System (INIS)

    Guan Pengfei; Wang Chongyu; Yu Tao

    2008-01-01

    Local density functional is investigated by using the full-potential linearized augmented plane wave (FP-LAPW) method for ScN in the hexagonal structure and the rocksalt structure and for hexagonal structures linking a layered hexagonal phase with wurtzite structure along a homogeneous strain transition path. It is found that the wurtzite ScN is unstable and the layered hexagonal phase, labelled as h o , in which atoms are approximately fivefold coordinated, is metastable, and the rocksalt ScN is stable. The electronic structure, the physical properties of the intermediate structures and the energy band structure along the transition are presented. It is found that the band gaps change from 4.0 to 1.0 eV continuously when c/a value varies from 1.68 to 1.26. It is noticeable that the study of ScN provides an opportunity to apply this kind of material (in wurtzite[h]-derived phase). (condensed matter: electronic structure, electrical, magnetic, and optical properties)

  18. Measurement for commercial exposives with SC-DSC test. Sangyoyo bakuhayaku no SC-DSC sokutei

    Energy Technology Data Exchange (ETDEWEB)

    Yabashi, H.; Wada, Y.; Hwang, D.; Akutsu, Y.; Tamura, M.; Yoshida, T. (The University of Tokyo, Tokyo (Japan). Faculty of Engineering); Matsuzawa, T. (Nippon Kayaku Co. Ltd., Tokyo (Japan))

    1991-08-30

    The sealed cell differential scanning calorimetry (SC-DSC) was sintroduced of commercial blasting explosives. As a series of testing the commercial blasting explosives in performance, an SC-DSC test was made to compare the critical detonability line with that resulting therefrom. From the result of SC-DSC measurement, the critical dilution rate was estimated of commercial blasting explosives to become without detonating propagation. As a result, all the explosives with exception of ANFO one were assumed to have a possibility of detonating propagation so that the ANFO explosive was known to be material, unable to exactly evaluate the detonability by the SC-DSC test. The explosion heat, then calculated by the REITP2 in order to assume how the reaction proceeded in the DSC cell, was compared with the reaction heat measured by the SC-DSC test. As a result, the calculated value was known to be almost equal to or slightly larger than the measured one. 15 refs., 4 figs., 2 tabs.

  19. Crystal structure and phase transition studies in perovskite-type oxides using powder-diffraction techniques and symmetry-mode analysis : SrLnMRuO6 (Ln=La,Pr,Nd; M=Zn,Co,Mg,Ni,Fe) and ALn2CuTi2O9 (A=Ca,Ba; Ln=La,Pr,Nd,Sm)

    OpenAIRE

    Iturbe Zabalo, Edurne

    2013-01-01

    La tesis se ha centrado en la síntesis y caracterización estructural de materiales tipo perovskita: SrLnMRuO6 (Ln=La,Pr,Nd; M=Zn,Co,Mg,Ni,Fe) y ALn2CuTi2O9 (A=Ca,Ba; Ln=La,Pr,Nd,Sm). El estudio de las estructuras de los materiales se ha realizado mediante el análisis de los patrones de difracción en polvo de rayos-X, sincrotrón y/o neutrones. En el refinamiento por el método de Rietveld de las estructuras se han sustituido las coordenadas atómicas (el método más común), por coordenadas colect...

  20. Enhanced temperature stability and quality factor with Hf substitution for Sn and MnO2 doping of (Ba0.97Ca0.03(Ti0.96Sn0.04O3 lead-free piezoelectric ceramics with high Curie temperature

    Directory of Open Access Journals (Sweden)

    Cheng-Che Tsai

    2016-12-01

    Full Text Available In this work, the process of two-stage modifications for (Ba0.97Ca0.03(Ti0.96Sn0.04-xHfxO3 (BCTS4-100xH100x ceramics was studied. The trade-off composition was obtained by Hf substitution for Sn and MnO2 doping (two-stage modification which improves the temperature stability and piezoelectric properties. The phase structure ratio, microstructure, and dielectric, piezoelectric, ferroelectric, and temperature stability properties were systematically investigated. Results showed that BCTS4-100xH100x piezoelectric ceramics with x=0.035 had a relatively high Curie temperature (TC of about 112 °C, a piezoelectric charge constant (d33 of 313 pC/N, an electromechanical coupling factor (kp of 0.49, a mechanical quality factor (Qm of 122, and a remnant polarization (Pr of 19μC/cm2. In addition, the temperature stability of the resonant frequency (fr, kp, and aging d33 could be tuned via Hf content. Good piezoelectric temperature stability (up to 110 °C was found with x =0.035. BCTS0.5H3.5 + a mol% Mn (BCTSH + a Mn piezoelectric ceramics with a = 2 had a high TC of about 123 °C, kp ∼ 0.39, d33 ∼ 230 pC/N, Qm ∼ 341, and high temperature stability due to the produced oxygen vacancies. This mechanism can be depicted using the complex impedance analysis associated with a valence compensation model on electric properties. Two-stage modification for lead-free (Ba0.97Ca0.03(Ti0.96Sn0.04O3 ceramics suitably adjusts the compositions for applications in piezoelectric motors and actuators.

  1. Effect of Sb{sub 2}O{sub 3} on the electrical properties of Ba{sub 0.9}Ca{sub 0.1}Zr{sub 0.1}Ti{sub 0.9}O{sub 3} ceramics fabricated using nanocrystals seed

    Energy Technology Data Exchange (ETDEWEB)

    Parjansri, P. [Rajamangala University of Technology Krungthep, Physics Division, Faculty of Science and Technology, Bangkok (Thailand); Intatha, U. [Mae Fah Luang University, School of Science, Chiang Rai (Thailand); Guo, R.; Bhalla, A.S. [University of Texas at San Antonio, Department of Electrical and Computer Engineering, Faculty of Engineering, San Antonio, TX (United States); Eitssayeam, S. [Chiang Mai University, Department of Physics and Materials Science, Faculty of Science, Chiang Mai (Thailand); Chiang Mai University, Materials Science Research Center, Faculty of Science, Chiang Mai (Thailand)

    2016-09-15

    This work was to investigate the effects of antimony oxide (Sb{sub 2}O{sub 3}) on the electrical properties of Ba{sub 0.9}Ca{sub 0.1}Zr{sub 0.1}Ti{sub 0.9}O{sub 3} (BCZT) ceramics and was prepared by adding 1 mol% of BCZT nanocrystals. The seed is nanocrystals of BCZT which was synthesized by the molten salt method. The ceramics powders were prepared by the mixed oxide method using BaCO{sub 3}, CaCO{sub 3}, ZrO{sub 2}, TiO{sub 2} as starting materials, and the BCZT seed was added as nanocrystal for induce phase transition. They were doped with x mol% Sb{sub 2}O{sub 3} (x = 0.0-0.5). Results indicated that all samples show pure perovskite phase. The Sb{sub 2}O{sub 3} enhanced the electrical properties of the ceramic systems. Excellent values of a dielectric constant (ε {sub r}) at room temperature (T{sub r}) were 4086 with sample of x = 0.5, and at Curie temperature (T{sub c}) was 15,485 for samples with x = 0.1. The highest remnant polarization (P{sub r}), piezoelectric charge coefficient (d{sub 33}), piezoelectric voltage coefficient (g{sub 33}), electromechanical coefficient for planar mode (k{sub p}) and thickness mode (k{sub t}) values were 6.3 μC/cm{sup 2}, 346 pC/N, 15.6 x 10{sup -3} Vm/N, 42 and 41 %, respectively, which were obtained for the sample of x = 0.2 mol% Sb. (orig.)

  2. Room-Temperature Multiferroics and Thermal Conductivity of 0.85BiFe1-2xTixMgxO3-0.15CaTiO3 Epitaxial Thin Films (x = 0.1 and 0.2).

    Science.gov (United States)

    Zhang, Ji; Sun, Wei; Zhao, Jiangtao; Sun, Lei; Li, Lei; Yan, Xue-Jun; Wang, Ke; Gu, Zheng-Bin; Luo, Zhen-Lin; Chen, Yanbin; Yuan, Guo-Liang; Lu, Ming-Hui; Zhang, Shan-Tao

    2017-08-02

    Thin films of 0.85BiFe 1-2x Ti x Mg x O 3 -0.15CaTiO 3 (x = 0.1 and 0.2, abbreviated to C-1 and C-2, respectively) have been fabricated on (001) SrTiO 3 substrate with and without a conductive La 0.7 Sr 0.3 MnO 3 buffer layer. The X-ray θ-2θ and ϕ scans, atomic force microscopy, and cross-sectional transmission electron microscopy confirm the (001) epitaxial nature of the thin films with very high growth quality. Both the C-1 and C-2 thin films show well-shaped magnetization-magnetic field hysteresis at room temperature, with enhanced switchable magnetization values of 145.3 and 42.5 emu/cm 3 , respectively. The polarization-electric loops and piezoresponse force microscopy measurements confirm the room-temperature ferroelectric nature of both films. However, the C-1 films illustrate a relatively weak ferroelectric behavior and the poled states are easy to relax, whereas the C-2 films show a relatively better ferroelectric behavior with stable poled states. More interestingly, the room-temperature thermal conductivity of C-1 and C-2 films are measured to be 1.10 and 0.77 W/(m·K), respectively. These self-consistent multiferroic properties and thermal conductivities are discussed by considering the composition-dependent content and migration of Fe-induced electrons and/or charged point defects. This study not only provides multifunctional materials with excellent room-temperature magnetic, ferroelectric, and thermal conductivity properties but may also stimulate further work to develop BiFeO 3 -based materials with unusual multifunctional properties.

  3. Electrical and piezoelectric properties of BiFeO3 thin films grown on SrxCa1−xRuO3-buffered SrTiO3 substrates

    KAUST Repository

    Yao, Yingbang; Chen, Long; Wang, Zhihong; Alshareef, Husam N.; Zhang, Xixiang

    2012-01-01

    on SrRuO 3-buffer layers exhibited minimal electrical leakage while films grown on Sr 0.33Ca 0.67RuO 3-buffer layers had the largest piezoelectric response. The origin of this difference is discussed. © 2012 American Institute of Physics.

  4. Martensitic Transformation in a β-Type Mg-Sc Alloy

    Science.gov (United States)

    Ogawa, Yukiko; Ando, Daisuke; Sutou, Yuji; Somekawa, Hidetoshi; Koike, Junichi

    2018-03-01

    Recently, we found that a Mg-Sc alloy with a bcc (β) phase exhibits superelasticity and a shape memory effect at low temperature. In this work, we examined the stress-induced and thermally induced martensitic transformation of the β-type Mg-Sc alloy and investigated the crystal structure of the thermally induced martensite phase based on in situ X-ray diffraction (XRD) measurements. The lattice constants of the martensite phase were calculated to be a = 0.3285 nm, b = 0.5544 nm, and c = 0.5223 nm when we assumed that the martensite phase has an orthorhombic structure (Cmcm). Based on the lattice correspondence between a bcc and an orthorhombic structures such as that in the case of β-Ti shape memory alloys, we estimated the transformation strain of the β Mg-Sc alloy. As a result, the transformation strains along the 001, 011, and 111 directions in the β phase were calculated to be + 5.7, + 8.8, and + 3.3%, respectively.

  5. Martensitic Transformation in a β-Type Mg-Sc Alloy

    Science.gov (United States)

    Ogawa, Yukiko; Ando, Daisuke; Sutou, Yuji; Somekawa, Hidetoshi; Koike, Junichi

    2017-12-01

    Recently, we found that a Mg-Sc alloy with a bcc (β) phase exhibits superelasticity and a shape memory effect at low temperature. In this work, we examined the stress-induced and thermally induced martensitic transformation of the β-type Mg-Sc alloy and investigated the crystal structure of the thermally induced martensite phase based on in situ X-ray diffraction (XRD) measurements. The lattice constants of the martensite phase were calculated to be a = 0.3285 nm, b = 0.5544 nm, and c = 0.5223 nm when we assumed that the martensite phase has an orthorhombic structure (Cmcm). Based on the lattice correspondence between a bcc and an orthorhombic structures such as that in the case of β-Ti shape memory alloys, we estimated the transformation strain of the β Mg-Sc alloy. As a result, the transformation strains along the 001, 011, and 111 directions in the β phase were calculated to be + 5.7, + 8.8, and + 3.3%, respectively.

  6. Atom probe tomographic studies of precipitation in Al-0.1Zr-0.1Ti (at.%) alloys.

    Science.gov (United States)

    Knipling, Keith E; Dunand, David C; Seidman, David N

    2007-12-01

    Atom probe tomography was utilized to measure directly the chemical compositions of Al(3)(Zr(1)-(x)Ti(x)) precipitates with a metastable L1(2) structure formed in Al-0.1Zr-0.1Ti (at.%) alloys upon aging at 375 degrees C or 425 degrees C. The alloys exhibit an inhomogeneous distribution of Al(3)(Zr(1)-(x)Ti(x)) precipitates, as a result of a nonuniform dendritic distribution of solute atoms after casting. At these aging temperatures, the Zr:Ti atomic ratio in the precipitates is about 10 and 5, respectively, indicating that Ti remains mainly in solid solution rather than partitioning to the Al(3)(Zr(1)-(x)Ti(x)) precipitates. This is interpreted as being due to the very small diffusivity of Ti in alpha-Al, consistent with prior studies on Al-Sc-Ti and Al-Sc-Zr alloys, where the slower diffusing Zr and Ti atoms make up a small fraction of the Al(3)(Zr(1)-(x)Ti(x)) precipitates. Unlike those alloys, however, the present Al-Zr-Ti alloys exhibit no interfacial segregation of Ti at the matrix/precipitate heterophase interface, a result that may be affected by a significant disparity in the evaporation fields of the alpha-Al matrix and Al(3)(Zr(1)-(x)Ti(x)) precipitates and/or a lack of local thermodynamic equilibrium at the interface.

  7. Exploration of R2XM2 (R=Sc, Y, Ti, Zr, Hf, rare earth; X=main group element; M=transition metal, Si, Ge): Structural Motifs, the novel Compound Gd2AlGe2 and Analysis of the U3Si2 and Zr3Al2 Structure Types