WorldWideScience

Sample records for ca ii triplet

  1. Study of the Sextans dwarf spheroidal galaxy from the DART Ca II triplet survey

    NARCIS (Netherlands)

    Battaglia, G.; Tolstoy, E.; Helmi, A.; Irwin, M.; Parisi, P.; Hill, V.; Jablonka, P.

    We use Very Large Telescope (VLT)/Fibre Large Array Multi Element Spectrograph (FLAMES) intermediate-resolution (R˜ 6500) spectra of individual red giant branch stars in the near-infrared Ca II triplet (CaT) region to investigate the wide-area metallicity properties and internal kinematics of the

  2. Observations of the Ca II IR Triplet in High Luminosity Quasars ...

    Indian Academy of Sciences (India)

    Abstract. We present a new spectroscopic sample of 11 quasars at intermediate redshift observed with the Infrared Spectrometer and Array. Camera (ISAAC) on the ESO Very Large Telescope (VLT), covering O I λ8446 and the Ca II triplet 8498, 8542, 8662. The new observations – that supplement the sample presented by ...

  3. Analysis and calibration of CaII triplet spectroscopy of red giant branch stars from VLT/FLAMES observations

    NARCIS (Netherlands)

    Battaglia, G.; Irwin, M.; Tolstoy, E.; Hill, V.; Helmi, A.; Letarte, B.; Jablonka, P.

    2008-01-01

    We demonstrate that low-resolution Ca II triplet (CaT) spectroscopic estimates of the overall metallicity ([Fe/H]) of individual red giant branch (RGB) stars in two nearby dwarf spheroidal galaxies (dSphs) agree to +/- 0.1-0.2 dex with detailed high-resolution spectroscopic determinations for the

  4. Observations of the Ca ${\\rm\\tiny II} $ IR Triplet in High Luminosity ...

    Indian Academy of Sciences (India)

    Abstract. We present a new spectroscopic sample of 11 quasars at intermediate redshift observed with the Infrared Spectrometer and Array Camera (ISAAC) on the ESO Very Large Telescope (VLT), covering O I 8446 and the Ca I I triplet 8498, 8542, 8662. The new observations – that supplement the sample presented by ...

  5. The near-infrared Ca II triplet as a metallicity indicator - II. Extension to extremely metal-poor metallicity regimes

    Science.gov (United States)

    Carrera, R.; Pancino, E.; Gallart, C.; del Pino, A.

    2013-09-01

    We extend our previous calibration of the infrared Ca II triplet (CaT) as a metallicity indicator to the metal-poor regime by including observations of 55 field stars with [Fe/H] down to -4.0 dex. While we previously solved the saturation at high metallicity using a combination of a Lorentzian and a Gaussian to reproduce the line profiles, in this paper we address the non-linearity at low metallicity following the suggestion of Starkenburg et al. of adding two non-linear terms to the relation among the [Fe/H], luminosity and strength of the calcium triplet lines. Our calibration thus extends from -4.0 to +0.5 in metallicity and is presented using four different luminosity indicators: V - VHB, MV, MI and MK. The calibration obtained in this paper results in a tight correlation between [Fe/H] abundances measured from high-resolution spectra and [Fe/H] values derived from the CaT, over the whole metallicity range covered.

  6. CA II TRIPLET SPECTROSCOPY OF SMALL MAGELLANIC CLOUD RED GIANTS. III. ABUNDANCES AND VELOCITIES FOR A SAMPLE OF 14 CLUSTERS

    Energy Technology Data Exchange (ETDEWEB)

    Parisi, M. C.; Clariá, J. J.; Marcionni, N. [Observatorio Astronómico, Universidad Nacional de Córdoba, Laprida 854, Córdoba, CP 5000 (Argentina); Geisler, D.; Villanova, S. [Departamento de Astronomía, Universidad de Concepción Casilla 160-C, Concepción (Chile); Sarajedini, A. [Department of Astronomy, University of Florida P.O. Box 112055, Gainesville, FL 32611 (United States); Grocholski, A. J., E-mail: celeste@oac.uncor.edu, E-mail: claria@oac.uncor.edu, E-mail: nmarcionni@oac.uncor.edu, E-mail: dgeisler@astro-udec.cl, E-mail: svillanova@astro-udec.cl, E-mail: ata@astro.ufl.edu, E-mail: grocholski@phys.lsu.edu [Department of Physics and Astronomy, Louisiana State University 202 Nicholson Hall, Tower Drive, Baton Rouge, LA 70803-4001 (United States)

    2015-05-15

    We obtained spectra of red giants in 15 Small Magellanic Cloud (SMC) clusters in the region of the Ca ii lines with FORS2 on the Very Large Telescope. We determined the mean metallicity and radial velocity with mean errors of 0.05 dex and 2.6 km s{sup −1}, respectively, from a mean of 6.5 members per cluster. One cluster (B113) was too young for a reliable metallicity determination and was excluded from the sample. We combined the sample studied here with 15 clusters previously studied by us using the same technique, and with 7 clusters whose metallicities determined by other authors are on a scale similar to ours. This compilation of 36 clusters is the largest SMC cluster sample currently available with accurate and homogeneously determined metallicities. We found a high probability that the metallicity distribution is bimodal, with potential peaks at −1.1 and −0.8 dex. Our data show no strong evidence of a metallicity gradient in the SMC clusters, somewhat at odds with recent evidence from Ca ii triplet spectra of a large sample of field stars. This may be revealing possible differences in the chemical history of clusters and field stars. Our clusters show a significant dispersion of metallicities, whatever age is considered, which could be reflecting the lack of a unique age–metallicity relation in this galaxy. None of the chemical evolution models currently available in the literature satisfactorily represents the global chemical enrichment processes of SMC clusters.

  7. Radial velocities and metallicities from infrared Ca ii triplet spectroscopy of open clusters. II. Berkeley 23, King 1, NGC 559, NGC 6603, and NGC 7245

    Science.gov (United States)

    Carrera, R.; Casamiquela, L.; Ospina, N.; Balaguer-Núñez, L.; Jordi, C.; Monteagudo, L.

    2015-06-01

    Context. Open clusters are key to studying the formation and evolution of the Galactic disc. However, there is a deficiency of radial velocity and chemical abundance determinations for open clusters in the literature. Aims: We intend to increase the number of determinations of radial velocities and metallicities from spectroscopy for open clusters. Methods: We acquired medium-resolution spectra (R ~ 8000) in the infrared region Ca ii triplet lines (~8500 Å) for several stars in five open clusters with the long-slit IDS spectrograph on the 2.5 m Isaac Newton Telescope (Roque de los Muchachos Observatory, Spain). Radial velocities were obtained by cross-correlation fitting techniques. The relationships available in the literature between the strength of infrared Ca ii lines and metallicity were also used to derive the metallicity for each cluster. Results: We obtain ⟨Vr⟩ = 48.6 ± 3.4, -58.4 ± 6.8, 26.0 ± 4.3, and -65.3 ± 3.2 km s-1 for Berkeley 23, NGC 559, NGC 6603, and NGC 7245, respectively. We found [ Fe/H ] = -0.25 ± 0.14 and -0.15 ± 0.18 for NGC 559 and NGC 7245, respectively. Berkeley 23 has low metallicity, [ Fe/H ] = -0.42 ± 0.13, which is similar to other open clusters in the outskirts of the Galactic disc. In contrast, we derived high metallicity ([ Fe/H ] = +0.43 ± 0.15) for NGC 6603, which places this system among the most metal-rich known open clusters. To our knowledge, this is the first determination of radial velocities and metallicities from spectroscopy for these clusters, except NGC 6603, for which radial velocities had been previously determined. We have also analysed ten stars in the line of sight to King 1. Because of the large dispersion obtained in both radial velocity and metallicity, we cannot be sure that we have sampled true cluster members. Based on observations made with the 2.5 m Isaac Newton Telescope operated on the island of La Palma by the Isaac Newton Group in the Spanish Observatorio del Roque de los Muchachos of the

  8. Stellar rotation periods determined from simultaneously measured Ca II H&K and Ca II IRT lines

    Science.gov (United States)

    Mittag, M.; Hempelmann, A.; Schmitt, J. H. M. M.; Fuhrmeister, B.; González-Pérez, J. N.; Schröder, K.-P.

    2017-11-01

    Aims: Previous studies have shown that, for late-type stars, activity indicators derived from the Ca II infrared-triplet (IRT) lines are correlated with the indicators derived from the Ca II H&K lines. Therefore, the Ca II IRT lines are in principle usable for activity studies, but they may be less sensitive when measuring the rotation period. Our goal is to determine whether the Ca II IRT lines are sufficiently sensitive to measure rotation periods and how any Ca II IRT derived rotation periods compare with periods derived from the "classical" Mount Wilson S-index. Methods: To analyse the Ca II IRT lines' sensitivity and to measure rotation periods, we define an activity index for each of the Ca II IRT lines similar to the Mount Wilson S-index and perform a period analysis for the lines separately and jointly. Results: For eleven late-type stars we can measure the rotation periods using the Ca II IRT indices similar to those found in the Mount Wilson S-index time series and find that a period derived from all four indices gives the most probable rotation period; we find good agreement for stars with already existing literature values. In a few cases the computed periodograms show a complicated structure with multiple peaks, meaning that formally different periods are derived in different indices. We show that in one case, this is due to data sampling effects and argue that denser cadence sampling is necessary to provide credible evidence for differential rotation. However, our TIGRE data for HD 101501 shows good evidence for the presence of differential rotation.

  9. A fluorescence detected magnetic resonance investigation of the carotenoid triplet states associated with Photosystem II of isolated spinach thylakoid membranes

    CERN Document Server

    Santabarbara, S; Carbonera, D; Heathcote, P

    2005-01-01

    The carotenoid triplet populations associated with the fluorescence emission chlorophyll forms of Photosystem II have been investigated in isolated spinach thylakoid membranes by means of fluorescence detected magnetic resonance in zero field (FDMR). The spectra collected in the 680-690 nm emission range, have been fitted by a global analysis procedure. At least five different carotenoid triplet states coupled to the terminal emitting chlorophyll forms of PS II, peaking at 682 nm, 687 nm and 692 nm, have been characterised. The triplets associated with the outer antenna emission forms, at 682 nm, have zero field splitting parameters D = 0.0385 cm/sup -1/, E = 0.00367 cm/sup -1/; D = 0.0404 cm/sup -1/, E = 0.00379 cm/sup -1/ and D = 0.0386 cm/sup -1/, E = 0.00406 cm/sup -1/ which are very similar to those previously reported for the xanthophylls of the isolated LHC II complex. Therefore the FDMR spectra recorded in this work provide insights into the organisation of the LHC II complex in the unperturbed enviro...

  10. CaII Κ Imaging to Understand UV Irradiance Variability

    Indian Academy of Sciences (India)

    tribpo

    CaII Κ Imaging to Understand UV Irradiance Variability. R. Kariyappa, Indian Institute of ... Introduction. The CaII Η and Κ resonance lines have been recognized as useful indicators for identifying regions of ... magnetic features, we have calculated histograms over the complete full disc image. (Paper I). We have applied the ...

  11. Cadmium activates CaMK-II and initiates CaMK-II-dependent apoptosis in mesangial cells.

    Science.gov (United States)

    Liu, Ying; Templeton, Douglas M

    2007-04-03

    Cadmium is a toxic metal that initiates both mitogenic responses and cell death. We show that Cd(2+) increases phosphorylation and activity of Ca(2+)/calmodulin-dependent protein kinase II (CaMK-II) in mesangial cells, in a concentration-dependent manner. Activation is biphasic with peaks at 1-5 min and 4-6 h. Cadmium also activates Erk, but this appears to be independent of CaMK-II. At 10-20 microM, Cd(2+) initiates apoptosis in 25-55% of mesangial cells by 6h. Inhibition of CaMK-II, but not of Erk, suppresses Cd(2+)-induced apoptosis. We conclude that activation of CaMK-II by Cd(2+) contributes to apoptotic cell death, independent of Erk activation.

  12. Neutrosophic triplet normed space

    Science.gov (United States)

    Şahin, Mehmet; Kargın, Abdullah

    2017-11-01

    In this paper; new properties for neutrosophic triplet groups are introduced. A notion of neutrosophic triplet metric space is given and properties of neutrosophic triplet metric spaces are studied. Neutrosophic triplet vector space and neutrosophic triplet normed space are also studied and some of their properties are given. Furthermore, we also show that these neutrosophic triplet notionsare different from the classical notions.

  13. Kainic acid (KA)-induced Ca2+/calmodulin-dependent protein kinase II (CaMK II) expression in the neurons, astrocytes and microglia of the mouse hippocampal CA3 region, and the phosphorylated CaMK II only in the hippocampal neurons.

    Science.gov (United States)

    Suh, Hong-Won; Lee, Han-Kyu; Seo, Young-Jun; Kwon, Min-Soo; Shim, Eon-Jeong; Lee, Jin-Young; Choi, Seong-Soo; Lee, Jong-Ho

    2005-06-24

    In the present study, we investigated the role of Ca2+/calmodulin-dependent protein kinase II (CaMK II) and which types of neuronal cells contain CaMK II and phosphorylated CaMK II (p-CaMK II) in the CA3 hippocampal region of mice using confocal immunofluorescence study. KA increased the CaMK II, p-CaMK II, glial fibrillary acidic protein (GFAP) and complement receptor type 3 (OX-42) immunoreactivities (IR) at 30 min after KA treatment in mouse hippocampal area. In studies, nevertheless KA-induced CaMK II is expressed in neurons or astrocytes or microglia, p-CaMK II is expressed only in neurons. Thus, our results suggest that the activated CaMK II in early time may be performed important roles only in neurons but not in the astrocytes and microglia.

  14. Definition and determination of the triplet-triplet energy transfer reaction coordinate

    Energy Technology Data Exchange (ETDEWEB)

    Zapata, Felipe; Marazzi, Marco; Castaño, Obis; Frutos, Luis Manuel, E-mail: luisma.frutos@uah.es [Departamento de Química Física, Universidad de Alcalá, 28871 Alcalá de Henares, Madrid (Spain); Acuña, A. Ulises [Instituto de Química Física “Rocasolano”, C.S.I.C., Serrano 119, 28006 Madrid (Spain)

    2014-01-21

    A definition of the triplet-triplet energy transfer reaction coordinate within the very weak electronic coupling limit is proposed, and a novel theoretical formalism is developed for its quantitative determination in terms of internal coordinates The present formalism permits (i) the separation of donor and acceptor contributions to the reaction coordinate, (ii) the identification of the intrinsic role of donor and acceptor in the triplet energy transfer process, and (iii) the quantification of the effect of every internal coordinate on the transfer process. This formalism is general and can be applied to classical as well as to nonvertical triplet energy transfer processes. The utility of the novel formalism is demonstrated here by its application to the paradigm of nonvertical triplet-triplet energy transfer involving cis-stilbene as acceptor molecule. In this way the effect of each internal molecular coordinate in promoting the transfer rate, from triplet donors in the low and high-energy limit, could be analyzed in detail.

  15. Definition and determination of the triplet-triplet energy transfer reaction coordinate

    Science.gov (United States)

    Zapata, Felipe; Marazzi, Marco; Castaño, Obis; Acuña, A. Ulises; Frutos, Luis Manuel

    2014-01-01

    A definition of the triplet-triplet energy transfer reaction coordinate within the very weak electronic coupling limit is proposed, and a novel theoretical formalism is developed for its quantitative determination in terms of internal coordinates The present formalism permits (i) the separation of donor and acceptor contributions to the reaction coordinate, (ii) the identification of the intrinsic role of donor and acceptor in the triplet energy transfer process, and (iii) the quantification of the effect of every internal coordinate on the transfer process. This formalism is general and can be applied to classical as well as to nonvertical triplet energy transfer processes. The utility of the novel formalism is demonstrated here by its application to the paradigm of nonvertical triplet-triplet energy transfer involving cis-stilbene as acceptor molecule. In this way the effect of each internal molecular coordinate in promoting the transfer rate, from triplet donors in the low and high-energy limit, could be analyzed in detail.

  16. Assembly and properties of heterobimetallic Co(II/III)/Ca(II) complexes with aquo and hydroxo ligands.

    Science.gov (United States)

    Lacy, David C; Park, Young Jun; Ziller, Joseph W; Yano, Junko; Borovik, A S

    2012-10-24

    The use of water as a reagent in redox-driven reactions is advantageous because it is abundant and environmentally compatible. The conversion of water to dioxygen in photosynthesis illustrates one example, in which a redox-inactive Ca(II) ion and four manganese ions are required for function. In this report we describe the stepwise formation of two new heterobimetallic complexes containing Co(II/III) and Ca(II) ions and either hydroxo or aquo ligands. The preparation of a four-coordinate Co(II) synthon was achieved with the tripodal ligand, N,N',N"-[2,2',2"-nitrilotris(ethane-2,1-diyl)]tris(2,4,6-trimethylbenzenesulfonamido, [MST](3-). Water binds to [Co(II)MST](-) to form the five-coordinate [Co(II)MST(OH(2))](-) complex that was used to prepare the Co(II)/Ca(II) complex [Co(II)MST(μ-OH(2))Ca(II)⊂15-crown-5(OH(2))](+) ([Co(II)(μ-OH(2))Ca(II)OH(2)](+)). [Co(II)(μ-OH(2))CaOH(2)](+) contained two aquo ligands, one bonded to the Ca(II) ion and one bridging between the two metal ions, and thus represents an unusual example of a heterobimetallic complex containing two aquo ligands spanning different metal ions. Both aquo ligands formed intramolecular hydrogen bonds with the [MST](3-) ligand. [Co(II)MST(OH(2))](-) was oxidized to form [Co(III)MST(OH(2))] that was further converted to [Co(III)MST(μ-OH)Ca(II)⊂15-crown-5](+) ([Co(III)(μ-OH)Ca(II)](+)) in the presence of base and Ca(II)OTf(2)/15-crown-5. [Co(III)(μ-OH)Ca(II)](+) was also synthesized from the oxidation of [Co(II)MST](-) with iodosylbenzene (PhIO) in the presence of Ca(II)OTf(2)/15-crown-5. Allowing [Co(III)(μ-OH)Ca(II)](+) to react with diphenylhydrazine afforded [Co(II)(μ-OH(2))Ca(II)OH(2)](+) and azobenzene. Additionally, the characterization of [Co(III)(μ-OH)Ca(II)](+) provides another formulation for the previously reported Co(IV)-oxo complex, [(TMG(3)tren)Co(IV)(μ-O)Sc(III)(OTf)(3)](2+) to one that instead could contain a Co(III)-OH unit.

  17. Cloning and quantitative determination of the human Ca2+/calmodulin-dependent protein kinase II (CaMK II) isoforms in human beta cells.

    Science.gov (United States)

    Rochlitz, H; Voigt, A; Lankat-Buttgereit, B; Göke, B; Heimberg, H; Nauck, M A; Schiemann, U; Schatz, H; Pfeiffer, A F

    2000-04-01

    The Ca2+/calmodulin-dependent protein kinase II (CaMK II) is highly expressed in pancreatic islets and associated with insulin secretion vesicles. The suppression of CaMK II disturbs insulin secretion and insulin gene expression. There are four isoforms of CaMK II, alpha to delta, that are expressed from different genes in mammals. Our aim was to identify the isoforms of CaMK II expressed in human beta cells by molecular cloning from a human insulinoma cDNA library and to assess its distribution in humans. The previously unknown complete coding sequences of human CaMK IIbeta and the kinase domain of CaMK IIdelta were cloned from a human insulinoma cDNA library. Quantitative determination of CaMK II isoform mRNA was carried out in several tissues and beta cells purified by fluorescence activated cell sorting and compared to the housekeeping enzyme pyruvate dehydrogenase. We found CaMK IIbeta occurred in three splice variants and was highly expressed in endocrine tissues such as adrenals, pituitary and beta cells. Liver showed moderate expression but adipose tissue or lymphocytes had very low levels of CaMK IIbeta-mRNA. In human beta cells CaMK IIbeta and delta were expressed equally with pyruvate dehydrogenase whereas tenfold lower expression of CaMK IIgamma and no expression of CaMK IIalpha were found. Although CaMK IIdelta is ubiquitously expressed, CaMK IIbeta shows preferential expression in neuroendocrine tissues. In comparison with the expression of a key regulatory enzyme in glucose oxidation, pyruvate dehydrogenase, two of the four CaM kinases investigated are expressed at equally high levels, which supports an important role in beta-cell physiology. These results provide the basis for exploring the pathophysiological relevance of CaMK IIbeta in human diabetes.

  18. [Effect of curcumin on the learning, memory and hippocampal Ca+/CaMK II level in senescence-accelerated mice].

    Science.gov (United States)

    Sun, Chen-you; Qi, Shuang-shuang; Sun, Shu-hong

    2011-03-01

    To explore effect of curcumin in different concentrations on learning and memory of senescence-accelerated mice (SAM) and their possible mechanisms. Mice were randomly divided into six groups: the SAMR1 normal control group, the SAMP8 model control group, the SAMP8 + solvent (the peanut oil) control group, SAMP8 + low, middle and high dose curcumin groups. Mice were gastrogavage for 25 successive days. On the next day of ending the experiment, changes of learning and memory in mice of each group were observed by Morris water maze. The hippocampal [Ca2+] was determined. Expressions of hippocampal calmodulin-dependent protein kinase II (CaMK II) and Calmodulin (CaM) mRNA were detected using Western blot and reverse transcription polymerase chain reaction (RT-PCR) respectively. The latency to find the hidden platform was remarkably prolonged, the hippocampal [Ca2+]i was markedly increased, the expression of CaMK II in the hippocampal membrane and the level of hippocampal CaM mRNA were significantly reduced in the SAMP8-model control group (P CaMK II in the hippocampal membrane and the level of hippocampal CaM mRNA obviously increased in the SAMP8 + low, middle and high dose curcumin groups (P CaMK II expression in the hippocampal dose-dependently.

  19. Flavonoid Myricetin Modulates GABA(A) Receptor Activity through Activation of Ca(2+) Channels and CaMK-II Pathway.

    Science.gov (United States)

    Zhang, Xiao Hu; Ma, Ze Gang; Rowlands, Dewi Kenneth; Gou, Yu Lin; Fok, Kin Lam; Wong, Hau Yan; Yu, Mei Kuen; Tsang, Lai Ling; Mu, Li; Chen, Lei; Yung, Wing Ho; Chung, Yiu Wa; Zhang, Bei Lin; Zhao, Hua; Chan, Hsiao Chang

    2012-01-01

    The flavonoid myricetin is found in several sedative herbs, for example, the St. John's Wort, but its influence on sedation and its possible mechanism of action are unknown. Using patch-clamp technique on a brain slice preparation, the present study found that myricetin promoted GABAergic activity in the neurons of hypothalamic paraventricular nucleus (PVN) by increasing the decay time and frequency of the inhibitory currents mediated by GABA(A) receptor. This effect of myricetin was not blocked by the GABA(A) receptor benzodiazepine- (BZ-) binding site antagonist flumazenil, but by KN-62, a specific inhibitor of the Ca(2+)/calmodulin-stimulated protein kinase II (CaMK-II). Patch clamp and live Ca(2+) imaging studies found that myricetin could increase Ca(2+) current and intracellular Ca(2+) concentration, respectively, via T- and L-type Ca(2+) channels in rat PVN neurons and hypothalamic primary culture neurons. Immunofluorescence staining showed increased phosphorylation of CaMK-II after myricetin incubation in primary culture of rat hypothalamic neurons, and the myricetin-induced CaMK-II phosphorylation was further confirmed by Western blotting in PC-12 cells. The present results suggest that myricetin enhances GABA(A) receptor activity via calcium channel/CaMK-II dependent mechanism, which is distinctively different from that of most existing BZ-binding site agonists of GABA(A) receptor.

  20. Flavonoid Myricetin Modulates GABAA Receptor Activity through Activation of Ca2+ Channels and CaMK-II Pathway

    Directory of Open Access Journals (Sweden)

    Xiao Hu Zhang

    2012-01-01

    Full Text Available The flavonoid myricetin is found in several sedative herbs, for example, the St. John's Wort, but its influence on sedation and its possible mechanism of action are unknown. Using patch-clamp technique on a brain slice preparation, the present study found that myricetin promoted GABAergic activity in the neurons of hypothalamic paraventricular nucleus (PVN by increasing the decay time and frequency of the inhibitory currents mediated by GABAA receptor. This effect of myricetin was not blocked by the GABAA receptor benzodiazepine- (BZ- binding site antagonist flumazenil, but by KN-62, a specific inhibitor of the Ca2+/calmodulin-stimulated protein kinase II (CaMK-II. Patch clamp and live Ca2+ imaging studies found that myricetin could increase Ca2+ current and intracellular Ca2+ concentration, respectively, via T- and L-type Ca2+ channels in rat PVN neurons and hypothalamic primary culture neurons. Immunofluorescence staining showed increased phosphorylation of CaMK-II after myricetin incubation in primary culture of rat hypothalamic neurons, and the myricetin-induced CaMK-II phosphorylation was further confirmed by Western blotting in PC-12 cells. The present results suggest that myricetin enhances GABAA receptor activity via calcium channel/CaMK-II dependent mechanism, which is distinctively different from that of most existing BZ-binding site agonists of GABAA receptor.

  1. Constitutive activity of inwardly rectifying K+ channel at physiological [Ca]i is mediated by Ca2+/CaMK II pathway in opossum kidney proximal tubule cells.

    Science.gov (United States)

    Mori, Yoshiaki; Yoshida, Hideyo; Miyamoto, Manabu; Sohma, Yoshiro; Kubota, Takahiro

    2008-06-01

    Using patch-clamp technique, we studied the role of the Ca2+/calmodulin kinase II (CaMK II)-mediated phosphorylation process on the K+ channel with an inward conductance of 90 pS in opossum kidney proximal tubule cells (OKPCs). The intracellular Ca2+ concentration ([Ca]i) was measured by use of the fluorescent dye fura 2. The following results were obtained: (i) In cell-attached patches, the channel activity was inhibited by a decrease in [Ca]i induced by perfusion with low Ca2+ (10(-8) M), La3+ (100 microM), or EGTA/AM (100 microM) contained in the bath solution. The application of KN-62 (10 microM) or KN-93 (5 microM), inhibitors of CaMK II, also inhibited the channel activity. (ii) The membrane potential measured with nystatin-perforated patches was significantly decreased by the fall in [Ca]i induced by the perfusion with EGTA- or La(3+)-containing solution. Also, the application of KN-62 (10 microM) or KN-93 (5 microM) to the bath significantly decreased the membrane potential. (iii) In inside-out patches, the channel activity was significantly stimulated by the application of CaMK II (300 pM) at 10(-7) M Ca2+ in the bath. Furthermore, the application of KN-62 (10 microM) to the bath significantly decreased the channel activity. Our findings show that the constitutive activity of inwardly rectifying K+ channel at physiological [Ca]i is mediated by the Ca2+/CaMK II pathway in OKPCs.

  2. Laminin activates CaMK-II to stabilize nascent embryonic axons.

    Science.gov (United States)

    Easley, Charles A; Faison, Milton O; Kirsch, Therese L; Lee, Jocelyn A; Seward, Matthew E; Tombes, Robert M

    2006-05-30

    In neurons, the interaction of laminin with its receptor, beta1 integrin, is accompanied by an increase in cytosolic Ca2+. Neuronal behavior is influenced by CaMK-II, the type II Ca2+/calmodulin-dependent protein kinase, which is enriched in axons of mouse embryonic neurons. In this study, we sought to determine whether CaMK-II is activated by laminin, and if so, how CaMK-II influences axonal growth and stability. Axons grew up to 200 microm within 1 day of plating P19 embryoid bodies on laminin-1 (EHS laminin). Activated CaMK-II was found enriched along the axon and in the growth cone as detected using a phospho-Thr(287) specific CaMK-II antibody. beta1 integrin was found in a similar pattern along the axon and in the growth cone. Direct inhibition of CaMK-II in 1-day-old neurons immediately froze growth cone dynamics, disorganized F-actin and ultimately led to axon retraction. Collapsed axonal remnants exhibited diminished phospho-CaMK-II levels. Treatment of 1-day neurons with a beta1 integrin-blocking antibody (CD29) also reduced axon length and phospho-CaMK-II levels and, like CaMK-II inhibitors, decreased CaMK-II activation. Among several CaMK-II variants detected in these cultures, the 52-kDa delta variant preferentially associated with actin and beta 3 tubulin as determined by reciprocal immunoprecipitation. Our findings indicate that persistent activation of delta CaMK-II by laminin stabilizes nascent embryonic axons through its influence on the actin cytoskeleton.

  3. Ca2+/calmodulin-dependent protein kinase II-dependent remodeling of Ca2+ current in pressure overload heart failure.

    Science.gov (United States)

    Wang, Yanggan; Tandan, Samvit; Cheng, Jun; Yang, Chunmei; Nguyen, Lan; Sugianto, Jessica; Johnstone, Janet L; Sun, Yuyang; Hill, Joseph A

    2008-09-12

    Ca(2+)/calmodulin-dependent protein kinase II (CaMKII) activity is increased in heart failure (HF), a syndrome characterized by markedly increased risk of arrhythmia. Activation of CaMKII increases peak L-type Ca(2+) current (I(Ca)) and slows I(Ca) inactivation. Whether these events are linked mechanistically is unknown. I(Ca) was recorded in acutely dissociated subepicardial and subendocardial murine left ventricular (LV) myocytes using the whole cell patch clamp method. Pressure overload heart failure was induced by surgical constriction of the thoracic aorta. I(Ca) density was significantly larger in subepicardial myocytes than in subendocardial/myocytes. Similar patterns were observed in the cell surface expression of alpha1c, the channel pore-forming subunit. In failing LV, I(Ca) density was increased proportionately in both cell types, and the time course of I(Ca) inactivation was slowed. This typical pattern of changes suggested a role of CaMKII. Consistent with this, measurements of CaMKII activity revealed a 2-3-fold increase (p process could not be induced, suggesting already maximal activation. Internal application of active CaMKII in failing myocytes did not elicit changes in I(Ca). Finally, CaMKII inhibition by internal diffusion of a specific peptide inhibitor reduced I(Ca) density and inactivation time course to similar levels in control and HF myocytes. I(Ca) density manifests a significant transmural gradient, and this gradient is preserved in heart failure. Activation of CaMKII, a known pro-arrhythmic molecule, is a major contributor to I(Ca) remodeling in load-induced heart failure.

  4. Mg(II) binding by bovine prothrombin fragment 1 via equilibrium dialysis and the relative roles of Mg(II) and Ca(II) in blood coagulation

    Energy Technology Data Exchange (ETDEWEB)

    Deerfield, D.W. 2d.; Olson, D.L.; Berkowitz, P.; Byrd, P.A.; Koehler, K.A.; Pedersen, L.G.; Hiskey, R.G.

    1987-03-25

    The first direct equilibrium dialysis titration of the blood coagulation protein bovine prothrombin fragment 1 with Mg(II) is presented. Fragment 1 has fewer thermodynamic binding sites for Mg(II) than Ca(II), less overall binding affinity, and significantly less cooperativity. Several nonlinear curve fitting models were tested for describing the binding of fragment 1 with Mg(II), Ca(II), and mixed metal binding data. The Mg(II) data is represented by essentially five equivalent, noninteracting sites; for Ca(II), a model with three tight, cooperative sites and four ''loose'', equal affinity, noninteracting sites provides the best model. Based on the reported equilibrium dialysis data and in conjunction with other experimental data, a model for the binding of Ca(II) and Mg(II) to bovine prothrombin fragment 1 is proposed. The key difference between the binding of these divalent ions is that Ca(II) apparently causes a specific conformational change reflected by the cooperativity observed in the Ca(II) titration. The binding of Ca(II) ions to the three tight, cooperative sites establishes a conformation that is essential for phospholipid X Ca(II) X protein binding. The filling of the loose sites with Ca(II) ions leads to charge reduction and subsequent phospholipid X Ca(II) X protein complex interaction. Binding of Mg(II) to bovine prothrombin fragment 1 does not yield a complex with the necessary phospholipid-binding conformation. However, Mg(II) is apparently capable of stabilizing the Ca(II) conformation as is observed in the mixed metal ion binding data and the synergism in thrombin formation.

  5. Assembly and Properties of Heterobimetallic CoII/III/CaII Complexes with Aquo and Hydroxo Ligands

    Science.gov (United States)

    Lacy, David C.; Park, Young Jun; Ziller, Joseph W.; Yano, Junko; Borovik, A. S.

    2012-01-01

    The use of water as a reagent in redox-driven reactions is advantageous because it is abundant and environmentally compatible. The conversion of water to dioxygen in photosynthesis illustrates one example, in which a redox-inactive CaII ion and four manganese ions are required for function. In this report we describe the stepwise formation of two new heterobimetallic complexes containing CoII/III and CaII ions, and either hydroxo or aquo ligands. The preparation of a 4-coordinate CoII synthon was achieved with the tripodal ligand, N,N′,N″-[2,2′,2″-nitrilotris(ethane-2,1-diyl)]tris(2,4,6-trimethylbenzenesulfonamido, [MST]3−. Water binds to [CoIIMST]− to form the 5-coordinate [CoIIMST(OH2)]− complex that was used to prepare the CoII/CaII complex [CoIIMST(μ-OH2)CaII⊂15-crown-5(OH2)]+ ([CoII(μ-OH2)CaIIOH2]+). [CoII(μ-OH2)CaOH2]+ contained two aquo ligands, one bonded to the CaII ion and one bridging between the two metal ions and thus represents an unusual example of a heterobimetallic complex containing 2 aquo ligands spanning different metal ions. Both aquo ligands formed intramolecular hydrogen bonds with the [MST]3− ligand. [CoIIMST(OH2)]− was oxidized to form [CoIIIMST(OH2)] that was further converted to [CoIIIMST(μ-OH)CaII⊂15-crown-5]+ ([CoIII(μ-OH)CaII]+) in the presence of base and CaIIOTf2/15-crown-5. [CoIII(μ-OH)CaII]+ was also synthesized from the oxidation of [CoIIMST]− with PhIO in the presence of CaIIOTf2/15-crown-5. Allowing [CoIII(μ-OH)CaII]+ to react with diphenylhydrazine afforded [CoII(μ-OH2)CaIIOH2]+ and azobenzene. Additionally, the characterization of [CoIII(μ-OH)CaII]+ provides another formulation for the previously reported CoIV–oxo complex, [(TMG3tren)CoIV(μ-O)ScIII(OTf)3]2+ to one that instead could contain a CoIII–OH unit. PMID:22998407

  6. Involvement of Ca2+, CaMK II and PKA in EGb 761-induced insulin secretion in INS-1 cells.

    Science.gov (United States)

    Choi, Sung-E; Shin, Ha-Chul; Kim, Hyo-Eun; Lee, Soo-Jin; Jang, Hyun-Ju; Lee, Kwan-Woo; Kang, Yup

    2007-03-01

    EGb 761, a standardized form of Ginkgo biloba L. (Ginkgoaceae) leaf extract, was recently reported to increase pancreatic beta-cell function. To determine whether EGb 761 elicits insulin secretion directly, we treated INS-1 rat beta cells with EGb 761 and then measured insulin release. Treatment of EGb 761 (50 microg/ml) significantly stimulated insulin secretion in INS-1 cells, compared with untreated control (pCaMK) II and protein kinase A (PKA) inhibitor, respectively, significantly reduced EGb 761-induced insulin secretion. Immunoblotting studies showed an increase in the phosphorylated-forms of CaMK II and of PKA substrates after EGb 761 treatment. Our data suggest that EGb 761-induced insulin secretion is mediated by [Ca(2+)](i) elevation and subsequent activation of CaMK II and PKA.

  7. Using the CaII triplet to trace abundance variations in individual red giant branch stars in three nearby galaxies

    NARCIS (Netherlands)

    Tolstoy, E; Irwin, MJ; Cole, AA; Pasquini, L; Gilmozzi, R; Gallagher, JS

    2001-01-01

    Spectroscopic abundance determinations for stars spanning a Hubble time in age are necessary in order to determine unambiguously the evolutionary histories of galaxies. Using FORS I in multi-object spectroscopy mode on ANTU (UT1) at the ESO VLT on Paranal, we have obtained near-infrared spectra from

  8. The effects of age on red giant metallicities derived from the near-infrared CaII triplet

    NARCIS (Netherlands)

    Cole, AA; Smecker-Hane, TA; Tolstoy, E; Bosler, TL; Gallagher, JS

    2004-01-01

    We have obtained spectra with a resolution of similar to2.5 Angstrom in the region of approximate to7500-9500 Angstrom for 116 red giants in five galactic globular clusters and six old open clusters (five with published metallicities and one previously unmeasured). The signal-to-noise (S/N) ratio

  9. CaMK-II oligomerization potential determined using CFP/YFP FRET.

    Science.gov (United States)

    Lantsman, Konstantin; Tombes, Robert M

    2005-10-30

    Members of the Ca(2+)/calmodulin-dependent protein kinase II (CaMK-II) family are encoded throughout the animal kingdom by up to four genes (alpha, beta, gamma, and delta). Over three dozen known CaMK-II splice variants assemble into approximately 12-subunit oligomers with catalytic domains facing out from a central core. In this study, the catalytic domain of alpha, beta, and delta CaMK-IIs was replaced with cyan (CFP) or yellow fluorescent protein (YFP) for fluorescence resonance energy transfer (FRET) studies. FRET, when normalized to total CFP and YFP, reproducibly yielded values which reflected oligomerization preference, inter-subunit spacing, and localization. FRET occurred when individual CFP and YFP-linked CaMK-IIs were co-expressed, but not when they were expressed separately and then mixed. All hetero-oligomers exhibited FRET values that were averages of their homo-oligomeric parents, indicating no oligomeric preference or restriction. FRET for CaMK-II homo-oligomers was inversely proportional to the variable region length. FPs were monomerized (Leu221 to Lys221) for this study, thus eliminating any potential artifact caused by FP-CaMK-II aggregates. Our results indicate that alpha, beta, and delta CaMK-IIs can freely hetero-oligomerize and that increased variable region lengths place amino termini further apart, potentially influencing the rate of inter-subunit autophosphorylation.

  10. Involvement of Ca2+/calmodulin kinase II (CaMK II) in genistein-induced potentiation of leucine/glutamine-stimulated insulin secretion.

    Science.gov (United States)

    Lee, Soo-Jin; Kim, Hyo-Eun; Choi, Sung-E; Shin, Ha-Chul; Kwag, Won-Jae; Lee, Byung-Kyu; Cho, Ki-Woong; Kang, Yup

    2009-09-01

    Genistein has been reported to potentiate glucose-stimulated insulin secretion (GSIS). Inhibitory activity on tyrosine kinase or activation of protein kinase A (PKA) was shown to play a role in the genistein-induced potentiation effect on GSIS. The aim of the present study was to elucidate the mechanism of genistein-induced potentiation of insulin secretion. Genistein augmented insulin secretion in INS-1 cells stimulated by various energy-generating nutrients such as glucose, pyruvate, or leucine/glutamine (Leu/Gln), but not the secretion stimulated by depolarizing agents such as KCl and tolbutamide, or Ca(2+) channel opener Bay K8644. Genistein at a concentration of 50 μM showed a maximum potentiation effect on Leu/Gln-stimulated insulin secretion, but this was not sufficient to inhibit the activity of tyrosine kinase. Inhibitor studies as well as immunoblotting analysis demonstrated that activation of PKA was little involved in genistein-induced potentiation of Leu/Gln-stimulated insulin secretion. On the other hand, all the inhibitors of Ca(2+)/calmodulin kinase II tested, significantly diminished genistein-induced potentiation. Genistein also elevated the levels of [Ca(2+)]i and phospho-CaMK II. Furthermore, genistein augmented Leu/Gln-stimulated insulin secretion in CaMK II-overexpressing INS-1 cells. These data suggest that the activation of CaMK II played a role in genistein-induced potentiation of insulin secretion.

  11. Characterization of competitive binding of Eu(III)/Cu(II) and Eu(III)/Ca(II) to Gorleben humic acid

    Energy Technology Data Exchange (ETDEWEB)

    Marang, L.; Reiller, P.E. [CEA Saclay, Lab Speciat Radionucledies and Mol, DEN, DANS, DPC, SECR, 91 - Gif sur Yvette (France); Marang, L.; Benedetti, M.F. [Univ Paris Diderot, Lab Geochim Eaux, IPGP, F-75251 Paris 05 (France); Marang, L.; Benedetti, M.F. [CNRS, UMR 71574, F-75251 Paris 05 (France); Eidner, S.; Kumke, M. [Univ Potsdam, Inst Chem, D-14476 Potsdam (Germany)

    2009-06-15

    Complete text of publication follows: In an area that contains high concentrations of natural organic matter, it is expected to play an important role on the speciation of trivalent radionuclides. Competitive interactions with H{sup +} and major cations, e.g. Ca{sup 2+} or Mg{sup 2+}, could influence these metals transport and bioavailability. Competitive experiments between Eu{sup 3+} and cations which can bind differently to humic substances, would bring an improved understanding of the competitive mechanisms. The aim of this study is to acquire data for Eu(III)/Cu(II) and Eu(III)/Ca(II) competitive binding to a sedimentary-originated humic acid (Gorleben, Germany). The NICA-Donnan parameters [1] for Ca(II), Cu(II), and Eu(III) obtained from competitive binding experiments using Ca{sup 2+} or Cu{sup 2+} ion selective electrodes (ISE), were used to model time-resolved luminescence spectroscopy (TRLS) measurements. Then the TRL spectra and decay times were interpreted to check the consistency of the modelling. From ISE data, Eu(III) and Cu(II) are in direct competition for the same type of sites, whereas Ca(II) has an indirect influence through electrostatic binding. The spectroscopic interpretation of the competition experiments showed two strikingly different environments for the Eu(III)/Cu(II) and Eu(III)/Ca(II) systems. Cu(II) seems to expel more effectively Eu(III) into an aqueous like environment within the humic acid structure, i.e., the Donnan phase, and to the aqueous phase as free Eu{sup 3+}. This is evidenced both from the spectra as well as from the decrease in the luminescence decay times. Moreover, Ca(II) causes a slighter modification of the chemical environment of the humic-complexed Eu(III). [1] Kinniburgh et al. (1999) Colloids Surf. A 151, 147-166

  12. Assembly and Properties of Heterobimetallic CoII/III/CaII Complexes with Aquo and Hydroxo Ligands

    OpenAIRE

    Lacy, David C.; Park, Young Jun; Ziller, Joseph W.; Yano, Junko; Borovik, A. S.

    2012-01-01

    The use of water as a reagent in redox-driven reactions is advantageous because it is abundant and environmentally compatible. The conversion of water to dioxygen in photosynthesis illustrates one example, in which a redox-inactive CaII ion and four manganese ions are required for function. In this report we describe the stepwise formation of two new heterobimetallic complexes containing CoII/III and CaII ions, and either hydroxo or aquo ligands. The preparation of a 4-coordinate CoII synthon...

  13. The Influence of Mg(II and Ca(II Ions on Rutin Autoxidation in Weakly Alkaline Aqueous Solutions

    Directory of Open Access Journals (Sweden)

    Živanović Slavoljub C.

    2016-09-01

    Full Text Available Rutin (quercetin-3-O-rutinoside is one of the most abundant bioflavonoids with various biological and pharmacological activities. Considering the ubiquitous presence of Mg(II and Ca(II ions in biological systems we decided to investigate their influence on the autoxidation of rutin in weakly alkaline aqueous solutions. Changes in UV-Vis spectra recorded during the rutin autoxidation in aqueous solution at pH 8.4 revealed that this process was very slow in the absence of metal ions. The presence of Mg(II and, especially Ca(II ion, increased the transformation rate of rutin. UV-Vis spectra recorded after prolonged autoxidation indicated the formation of humic acidlike products in the presence of Mg(II and Ca(II ions. Four new compounds formed during the initial stage of rutin autoxidation in the presence of Mg(II and Ca(II ions were detected by HPLCDAD. Based on the analysis of their DAD UV-Vis spectra and comparison of their retention times with the retention time value for rutin, we concluded that the initial rutin transformation products were formed by the water addition on double bond in ring C and hydroxylation of ring B. A very small decrease of the initial rutin concentration (4% was observed by HPLC-DAD in the absence of metal ions for the period of 90 minutes. However, rutin concentration decrease was much larger in the presence of Mg(II and Ca(II ions (14% and 24%, respectively. The more pronounced effect of Ca(II ion on the rutin autoxidation may be explained by the stronger binding of Mg(II ion to rutin and thus greater stabilizing effect on reaction intermediates caused by its higher ionic potential (charge/ionic radius ratio in comparison to Ca(II ion. The results of this study may contribute to the better understanding of interactions of Mg(II and Ca(II ions with natural phenolic antioxidants which are important for their various biological activities.

  14. Adsorption of Ca(II, Mg(II, Zn(II, and Cd(II on Chitosan Membrane Blended with Rice Hull Ash Silica and Polyethylene Glycol

    Directory of Open Access Journals (Sweden)

    F. Widhi Mahatmanti

    2016-03-01

    Full Text Available In this research, chitosan based membrane blended with rice hull ash (RHA silica and polyethylene glycol (PEG has been applied as adsorbent of Ca(II, Mg(II, Zn(II and Cd(II in an aqueous solution. Membrane was synthesized by blending RHA silica and polyethylene glycol into chitosan. Silica and polyethylene glycol blended into the chitosan to improve the mechanical properties and the membrane porous. The membrane was characterized using Fourier Transform infrared (FTIR spectroscopy, X-Ray Diffraction (XRD, Scanning Electron Microscopy (SEM, and swelling degree analyzer. Adsorption of metal ions investigated was conducted in a batch system with variation of pH, initial ion concentration and contact time. Thermodynamics and kinetics of adsorption were evaluated based on the adsorption data at initial metal ion concentration and contact time variations, respectively. Results showed that the optimum condition of adsorption was at pH 9.0 for Ca(II, 6.0 for both Mg(II and Zn(II and 5.5 for Cd(II, and contact time of 24 h for all ions investigated. Kinetics of all investigated metal ion adsorption followed a kinetic model of pseudo-second-order. Adsorption of Ca(II and Mg(II on the membrane fitted to Freundlich model with the affinity of 1.266 and 1.099, respectively; and Zn(II and Cd(II fitted to Langmuir one with the capacity of 182 and 106 µmol/g, respectively.

  15. [Expression of CaMK II delta in cerebral cortex following traumatic brain injury].

    Science.gov (United States)

    Pan, Hong; Zhang, Jing-Jing; Xu, Dong-Dong; Gu, Zhen-Yong; Tao, Lu-Yang; Zhang, Ming-Yang

    2014-06-01

    To observe the time-course expression of calcium-calmodulin dependent protein kinase II delta (CaMK II delta) in cerebral cortex after traumatic brain injury (TBI). The TBI rat model was established. The expression of CaMK II delta in cerebral cortex around injured area was tested by Western blotting and immunohistochemical staining. Western blotting revealed expression of CaMK II delta in normal rat brain cortex. It gradually increased after TBI, peaked after 3 days, and then returned to normal level. The result of immunohistochemical staining was consistent with that of Western blotting. The expression of CaMK II delta around injured area after TBI increased initially and then decreased. It could be used as a new indicator for wound age determination following TBI.

  16. Inhibitions of PKC and CaMK-II synergistically rescue ischemia-induced astrocytic dysfunction.

    Science.gov (United States)

    Liu, Zhan; Huang, Ying; Liu, Lina; Zhang, Li

    2017-09-14

    Ischemic neuronal death is presumably caused by glutamate-induced excitotoxicity, in which the increased glutamate release and impaired glutamate reuptake lead to glutamate accumulation. Mechanisms underlying the ischemic deficiency of astrocytic glutamate reuptake remain unclear, which we have studied by analyzing the effect of calmodulin-dependent protein kinase II (CaMK-II) and protein kinase C (PKC) inhibitions on astrocytic glutamate transporter during ischemia. Glutamate transporter current was recorded on the astrocytes in cortical slices. KN-62 (CaMK-II inhibitor) or chelerythrine (PKC inhibitor) partially reverses the ischemic deficiency of astrocytic glutamate transporter. A combined use of PKC and CaMK-II inhibitors synergistically reverses this deficiency. Thus, one of potential therapeutic strategies is to secure the ischemia-induced deficiency of astrocytic glutamate reuptake by inhibiting PKC and CaMK-II. Copyright © 2017. Published by Elsevier B.V.

  17. Identification of the sites for CaMK-II-dependent phosphorylation of GABA(A) receptors.

    Science.gov (United States)

    Houston, Catriona M; Lee, Henry H C; Hosie, Alastair M; Moss, Stephen J; Smart, Trevor G

    2007-06-15

    Phosphorylation can affect both the function and trafficking of GABA(A) receptors with significant consequences for neuronal excitability. Serine/threonine kinases can phosphorylate the intracellular loops between M3-4 of GABA(A) receptor beta and gamma subunits thereby modulating receptor function in heterologous expression systems and in neurons (1, 2). Specifically, CaMK-II has been demonstrated to phosphorylate the M3-4 loop of GABA(A) receptor subunits expressed as GST fusion proteins (3, 4). It also increases the amplitude of GABA(A) receptor-mediated currents in a number of neuronal cell types (5-7). To identify which substrate sites CaMK-II might phosphorylate and the consequent functional effects, we expressed recombinant GABA(A) receptors in NG108-15 cells, which have previously been shown to support CaMK-II modulation of GABA(A) receptors containing the beta3 subunit (8). We now demonstrate that CaMK-II mediates its effects on alpha1beta3 receptors via phosphorylation of Ser(383) within the M3-4 domain of the beta subunit. Ablation of beta3 subunit phosphorylation sites for CaMK-II revealed that for alphabetagamma receptors, CaMK-II has a residual effect on GABA currents that is not mediated by previously identified sites of CaMK-II phosphorylation. This residual effect is abolished by mutation of tyrosine phosphorylation sites, Tyr(365) and Tyr(367), on the gamma2S subunit, and by the tyrosine kinase inhibitor genistein. These results suggested that CaMK-II is capable of directly phosphorylating GABA(A) receptors and activating endogenous tyrosine kinases to phosphorylate the gamma2 subunit in NG108-15 cells. These findings were confirmed in a neuronal environment by expressing recombinant GABA(A) receptors in cerebellar granule neurons.

  18. [Study on interference effect of Sijunzi decoction on brain-gut CaM/CaMK II of spleen Qi deficiency syndrome rats].

    Science.gov (United States)

    Tian, Rong; Gong, Zi-han; Yang, Xiao-yi; Zhu, Li-ming; Duan, Yong-qiang; Cheng, Ying-xia; Du, Juan; Wang, Yan

    2015-10-01

    To observe the dynamic time-phase expressions of key genes of brain-gut CaM signal pathway of spleen Qi deficiency rats and the intervention effect of Sijunzi decoction. Male Wistar rats were randomly divided into the normal control group, model 14 d, 21 d, 28 d groups, and Sijunzi decoction 14 d, 21 d, 28 d groups. Except for the normal control group, the remaining groups were included into the spleen Qi deficiency model with the bitter cold breaking Qi method (ig 7.5 g · kg⁻¹ · d⁻¹ of Rheum officinale, Fructus aurantii immaturus, Magnolia officinalis preparation) and the exhaustive swimming method. On the 7th day after the modeling, the Sijunzi decoction groups were orally administered with Sijunzi decoction 20 g · kg⁻¹ · d⁻¹. The expressions of key genes CaM/CaMK II of CaM signaling pathway in hippocampus and intestine at different time points by immunohistochemical method and Western blot. At the same time, the intervention effect of Sijunzi decoction on spleen Qi deficiency rats and its mechanism were analyzed. Spleen Qi deficiency rats showed higher intestinal CaM/CaMK II expression and lower hippocampus CaM/CaMK II expression than normal rats (P CaMK II expression and increase in hippocampus CaM/CaMK II expression (P CaMK II in small intestine tissues and its low expression in hippocampus tissues. Sijunzi decoction may achieve the therapeutic effect in spleen Qi deficiency syndrome by reducing the CaM/CaMK II expression in intestinal tissues and increasing it in hippocampus tissues.

  19. The effects of prenatal stress on expression of CaMK-II and L-Ca2+ channel in offspring hippocampus.

    Science.gov (United States)

    Cai, Qing; Zhang, Boli; Huang, Shuyun; Wang, Tao; Zhou, Tao

    2011-08-01

    The purpose of the present study was to characterize the expressions of phosphorylated Ca(2+)/calmodulin-dependent protein kinase II (p-CaMK-II), total CaMK-II, and L-type Ca(2+) channel in offspring hippocampus that was induced by prenatal restraint stress. Pregnant rats were divided into two groups: the control group and the prenatal stress (PNS) group. Pregnant rats in the PNS group were exposed to restraint stress on day 14-20 of pregnancy three times daily for 45 min. Adult offspring rats were used in this study. The results demonstrated that prenatal restraint stress induced a significant increase in the expression of p-CaMK-II, total CaMK-II, and L-Ca(2+) channel by western blot analysis in offspring hippocampus. The immunohistochemistry results revealed that PNS increased the expressions of CaMK-II and L-Ca(2+) channel in the hippocampal CA3 of offspring rats. These data suggest that PNS can have long-term neuronal effects within hippocampal structure involved in the feedback mechanisms of the hypothalamo-pituitary-adrenal axis.

  20. PKC and CaMK-II inhibitions coordinately rescue ischemia-induced GABAergic neuron dysfunction.

    Science.gov (United States)

    Huang, Li; Wang, Chun; Zhao, Shidi; Ge, Rongjing; Guan, Sudong; Wang, Jin-Hui

    2017-06-13

    Cerebral ischemia leads to neuronal death for stroke, in which the imbalance between glutamatergic neurons and GABAergic neurons toward neural excitotoxicity is presumably involved. GABAergic neurons are vulnerable to pathological factors and impaired in an early stage of ischemia. The rescue of GABAergic neurons is expected to be the strategy to reserve ischemic neuronal impairment. As protein kinase C (PKC) and calmodulin-dependent protein kinase II (CaMK-II) are activated during ischemia, we have investigated whether the inhibitions of these kinases rescue the ischemic impairment of cortical GABAergic neurons. The functions of GABAergic neurons were analyzed by whole-cell recording in the cortical slices during ischemia and in presence of 1-[N,O-bis(5-isoquinolinesulfonyl)-N-methyl-L-tyrosyl]-4-phenylpiperazine (CaMK-II inhibitor) and chelerythrine chloride (PKC inhibitor). Our results indicate that PKC inhibitor or CaMK-II inhibitor partially prevents ischemia-induced functional deficits of cortical GABAergic neurons. Moreover, the combination of PKC and CaMK-II inhibitors synergistically reverses this ischemia-induced deficit of GABAergic neurons. One of potential therapeutic strategies for ischemic stroke may be to rescue the ischemia-induced deficit of cortical GABAergic neurons by inhibiting PKC and CaMK-II.

  1. Differential calreticulin expression affects focal contacts via the calmodulin/CaMK II pathway.

    Science.gov (United States)

    Szabo, Eva; Papp, Sylvia; Opas, Michal

    2007-10-01

    Calreticulin is an ER calcium-storage protein, which influences gene expression and cell adhesion. In this study, we analysed the differences in adhesive properties of calreticulin under- and overexpressing fibroblasts in relation to the calmodulin- and calcium/calmodulin-dependent kinase II (CaMK II)-dependent signalling pathways. Cells stably underexpressing calreticulin had elevated expression of calmodulin, activated CaMK II, activated ERK and activated c-src. Inhibition of calmodulin by W7, and CaMK II by KN-62, caused the otherwise weekly adhesive calreticulin underexpressing cells to behave like the overexpressing cells, via induction of increased cell spreading. Increased vinculin, activated paxillin, activated focal adhesion kinase and fibronectin levels were observed upon inhibition of either the calmodulin or the CaMK II signalling pathways, which was accompanied by an increase in cell spreading and focal contact formation. Both KN-62 and W7 treatment increased cell motility in underexpressing cells, but W7 treatment led to loss of directionality. Thus, both the calmodulin and CaMK II signalling pathways influence cellular spreading and motility, but subtle differences exist in their distal effects on motility effectors. (c) 2007 Wiley-Liss, Inc.

  2. Flightless-I, a gelsolin family member and transcriptional regulator, preferentially binds directly to activated cytosolic CaMK-II.

    Science.gov (United States)

    Seward, Matthew E; Easley, Charles A; McLeod, Jamie J; Myers, Alexandra L; Tombes, Robert M

    2008-07-23

    In order to evaluate links between Ca2+/calmodulin (CaM)-dependent protein kinase type II (CaMK-II) and cell cycle progression, CaMK-II binding partners were sought in proliferating cells by epitope-tag tandem mass spectrometry. One protein identified was the gelsolin family member, flightless-I (Fli-I). Fli-I is not a CaMK-II substrate, but binds directly and preferentially to constitutively active (T287D) CaMK-II over inactive CaMK-II. Fli-I gradually enters the nucleus upon CaMK-II inhibition and is retained in the cytosol by T287D CaMK-II. CaMK-II inhibition and Fli-I overexpression suppress transcription of beta-catenin dependent transcriptional reporters, whereas Fli-I suppression enhances their transcription. These findings support a novel mechanism whereby cytosolic CaMK-II influences beta-catenin dependent gene expression through Fli-I.

  3. Dynamics of the Solar Chromosphere. II. Ca II H2V and K2V Grains versus Internetwork Fields

    NARCIS (Netherlands)

    Lites, B.W.; Rutten, R.J.; Berger, T.E.

    1998-01-01

    We use the Advanced Stokes Polarimeter at the NSO/Sacramento Peak Vacuum Tower Telescope to search for spatio- temporal correlations between enhanced magnetic fields in the quiet solar internetwork photosphere and the occurrence of Ca II H2v grains in the overlying chromosphere.We address the

  4. CaMK-II is a PKD2 target that promotes pronephric kidney development and stabilizes cilia.

    Science.gov (United States)

    Rothschild, Sarah C; Francescatto, Ludmila; Drummond, Iain A; Tombes, Robert M

    2011-08-01

    Intracellular Ca²⁺ signals influence gastrulation, neurogenesis and organogenesis through pathways that are still being defined. One potential Ca²⁺ mediator of many of these morphogenic processes is CaMK-II, a conserved calmodulin-dependent protein kinase. Prolonged Ca²⁺ stimulation converts CaMK-II into an activated state that, in the zebrafish, is detected in the forebrain, ear and kidney. Autosomal dominant polycystic kidney disease has been linked to mutations in the Ca²⁺-conducting TRP family member PKD2, the suppression of which in vertebrate model organisms results in kidney cysts. Both PKD2-deficient and CaMK-II-deficient zebrafish embryos fail to form pronephric ducts properly, and exhibit anterior cysts and destabilized cloacal cilia. PKD2 suppression inactivates CaMK-II in pronephric cells and cilia, whereas constitutively active CaMK-II restores pronephric duct formation in pkd2 morphants. PKD2 and CaMK-II deficiencies are synergistic, supporting their existence in the same genetic pathway. We conclude that CaMK-II is a crucial effector of PKD2 Ca²⁺ that both promotes morphogenesis of the pronephric kidney and stabilizes primary cloacal cilia.

  5. Flavonoid Myricetin Modulates G A B A A Receptor Activity through Activation of Ca 2+ Channels and CaMK-II Pathway

    Science.gov (United States)

    Zhang, Xiao Hu; Ma, Ze Gang; Rowlands, Dewi Kenneth; Gou, Yu Lin; Fok, Kin Lam; Wong, Hau Yan; Yu, Mei Kuen; Tsang, Lai Ling; Mu, Li; Chen, Lei; Yung, Wing Ho; Chung, Yiu Wa; Zhang, Bei Lin; Zhao, Hua; Chan, Hsiao Chang

    2012-01-01

    The flavonoid myricetin is found in several sedative herbs, for example, the St. John's Wort, but its influence on sedation and its possible mechanism of action are unknown. Using patch-clamp technique on a brain slice preparation, the present study found that myricetin promoted GABAergic activity in the neurons of hypothalamic paraventricular nucleus (PVN) by increasing the decay time and frequency of the inhibitory currents mediated by GABAA receptor. This effect of myricetin was not blocked by the GABAA receptor benzodiazepine- (BZ-) binding site antagonist flumazenil, but by KN-62, a specific inhibitor of the Ca2+/calmodulin-stimulated protein kinase II (CaMK-II). Patch clamp and live Ca2+ imaging studies found that myricetin could increase Ca2+ current and intracellular Ca2+ concentration, respectively, via T- and L-type Ca2+ channels in rat PVN neurons and hypothalamic primary culture neurons. Immunofluorescence staining showed increased phosphorylation of CaMK-II after myricetin incubation in primary culture of rat hypothalamic neurons, and the myricetin-induced CaMK-II phosphorylation was further confirmed by Western blotting in PC-12 cells. The present results suggest that myricetin enhances GABAA receptor activity via calcium channel/CaMK-II dependent mechanism, which is distinctively different from that of most existing BZ-binding site agonists of GABAA receptor. PMID:23258999

  6. Ca(2+ permeable AMPA receptor induced long-term potentiation requires PI3/MAP kinases but not Ca/CaM-dependent kinase II.

    Directory of Open Access Journals (Sweden)

    Suhail Asrar

    Full Text Available Ca(2+ influx via GluR2-lacking Ca(2+-permeable AMPA glutamate receptors (CP-AMPARs can trigger changes in synaptic efficacy in both interneurons and principle neurons, but the underlying mechanisms remain unknown. We took advantage of genetically altered mice with no or reduced GluR2, thus allowing the expression of synaptic CP-AMPARs, to investigate the molecular signaling process during CP-AMPAR-induced synaptic plasticity at CA1 synapses in the hippocampus. Utilizing electrophysiological techniques, we demonstrated that these receptors were capable of inducing numerous forms of long-term potentiation (referred to as CP-AMPAR dependent LTP through a number of different induction protocols, including high-frequency stimulation (HFS and theta-burst stimulation (TBS. This included a previously undemonstrated form of protein-synthesis dependent late-LTP (L-LTP at CA1 synapses that is NMDA-receptor independent. This form of plasticity was completely blocked by the selective CP-AMPAR inhibitor IEM-1460, and found to be dependent on postsynaptic Ca(2+ ions through calcium chelator (BAPTA studies. Surprisingly, Ca/CaM-dependent kinase II (CaMKII, the key protein kinase that is indispensable for NMDA-receptor dependent LTP at CA1 synapses appeared to be not required for the induction of CP-AMPAR dependent LTP due to the lack of effect of two separate pharmacological inhibitors (KN-62 and staurosporine on this form of potentiation. Both KN-62 and staurosporine strongly inhibited NMDA-receptor dependent LTP in control studies. In contrast, inhibitors for PI3-kinase (LY294002 and wortmannin or the MAPK cascade (PD98059 and U0126 significantly attenuated this CP-AMPAR-dependent LTP. Similarly, postsynaptic infusion of tetanus toxin (TeTx light chain, an inhibitor of exocytosis, also had a significant inhibitory effect on this form of LTP. These results suggest that distinct synaptic signaling underlies GluR2-lacking CP-AMPAR-dependent LTP, and reinforces

  7. Ca2+/Calmodulin-Dependent Protein Kinase II in Vascular Smooth Muscle.

    Science.gov (United States)

    Saddouk, F Z; Ginnan, R; Singer, H A

    2017-01-01

    Ca2+-dependent signaling pathways are central regulators of differentiated vascular smooth muscle (VSM) contractile function. In addition, Ca2+ signals regulate VSM gene transcription, proliferation, and migration of dedifferentiated or "synthetic" phenotype VSM cells. Synthetic phenotype VSM growth and hyperplasia are hallmarks of pervasive vascular diseases including hypertension, atherosclerosis, postangioplasty/in-stent restenosis, and vein graft failure. The serine/threonine protein kinase Ca2+/calmodulin-dependent protein kinase II (CaMKII) is a ubiquitous mediator of intracellular Ca2+ signals. Its multifunctional nature, structural complexity, diversity of isoforms, and splice variants all characterize this protein kinase and make study of its activity and function challenging. The kinase has unique autoregulatory mechanisms, and emerging studies suggest that it can function to integrate Ca2+ and reactive oxygen/nitrogen species signaling. Differentiated VSM expresses primarily CaMKIIγ and -δ isoforms. CaMKIIγ isoform expression correlates closely with the differentiated phenotype, and some studies link its function to regulation of contractile activity and Ca2+ homeostasis. Conversely, synthetic phenotype VSM cells primarily express CaMKIIδ and substantial evidence links it to regulation of gene transcription, proliferation, and migration of VSM in vitro, and vascular hypertrophic and hyperplastic remodeling in vivo. CaMKIIδ and -γ isoforms have opposing functions at the level of cell cycle regulation, proliferation, and VSM hyperplasia in vivo. Isoform switching following vascular injury is a key step in promoting vascular remodeling. Recent availability of genetically engineered mice with smooth muscle deletion of specific isoforms and transgenics expressing an endogenous inhibitor protein (CAMK2N) has enabled a better understanding of CaMKII function in VSM and should facilitate future studies. © 2017 Elsevier Inc. All rights reserved.

  8. Class II HDACs mediate CaMK-dependent signaling to NRSF in ventricular myocytes.

    Science.gov (United States)

    Nakagawa, Yasuaki; Kuwahara, Koichiro; Harada, Masaki; Takahashi, Nobuki; Yasuno, Shinji; Adachi, Yuichiro; Kawakami, Rika; Nakanishi, Michio; Tanimoto, Keiji; Usami, Satoru; Kinoshita, Hideyuki; Saito, Yoshihiko; Nakao, Kazuwa

    2006-12-01

    We recently reported that a transcriptional repressor, neuron-restrictive silencer factor (NRSF), represses expression of fetal cardiac genes, including atrial and brain natriuretic peptide (ANP and BNP), by recruiting class I histone deacetylase (HDAC) and that attenuation of NRSF-mediated repression contributes to the reactivation of fetal gene expression during cardiac hypertrophy. The molecular mechanism by which the activity of the NRSF-HDAC complex is inhibited in cardiac hypertrophy remains unresolved, however. In the present study, we show that class II HDACs (HDAC4 and 5), which are Ca/calmodulin-dependent kinase (CaMK)-responsive repressors of hypertrophic signaling, associate with NRSF and participate in NRSF-mediated repression. Blockade of the CaMK-class II HDAC signaling pathway using a CaMK-resistant HDAC5 mutant, a CaMK inhibitor (KN62) or a dominant-negative CaMK mutant inhibited ET-1-inducible ANP and BNP promoter activity, but that inhibitory effect was abolished by mutation of the neuron-restrictive silencer element (NRSE) within the ANP and BNP promoter. In addition, adenovirus-mediated expression of a dominant-negative NRSF mutant abolished the inhibitory effect of KN62 on ET-1-inducible endogenous ANP gene expression in ventricular myocytes. Finally, the interaction between NRSF and class II HDACs was decreased in both in vitro and in vivo models of cardiac hypertrophy. These findings show that ET-1-induced CaMK signaling disrupts class II HDAC-NRSF repressor complexes, thereby enabling activation of ANP and BNP gene transcription in ventricular myocytes, and shed light on a novel mechanism by which the fetal cardiac gene program is reactivated.

  9. Ca(2+-dependent regulation of the Ca(2+ concentration in the myometrium mitochondria. II. Ca(2+ effects on mitochondria membranes polarization and [Ca(2+](m

    Directory of Open Access Journals (Sweden)

    L. G. Babich

    2017-06-01

    Full Text Available It is known that Ca2+ accumulation in the mitochondria undergoes complex regulation by Ca2+ itself. But the mechanisms of such regulation are still discussed. In this paper we have shown that Ca ions directly or indirectly regulate the level of myometrium mitochondria membranes polarization. The additions of 100 µM Ca2+ were accompanied by depolarization of the mitochondria membranes. The following experiments were designed to study the impact of Ca2+ on the myometrium mitochondria [Ca2+]m. Isolated myometrium mitochondria were preincubated without or with 10 μM Са2+ followed by 100 μM Са2+ addition. Experiments were conducted in three mediums: without ATP and Mg2+ (0-medium, in the presence of 3 mM Mg2+ (Mg-medium and 3 mM Mg2+ + 3 mM ATP (Mg,ATP-medium. It was shown that the effects of 10 μM Са2+ addition were different in different mediums, namely in 0- and Mg-medium the [Ca2+]m values increased, whereas in Mg,ATP-medium statistically reliable changes were not registered. Preincubation of mitochondria with 10 μM Са2+ did not affect the [Ca2+]m value after the addition of 100 μM Са2+. The [Ca2+]m values after 100 μM Са2+ addition were the same in 0- and Mg,ATP-mediums and somewhat lower in Mg-medium. Preliminary incubation of mitochondria with 10 μM Са2+ in 0- and Mg-mediums reduced changes of Fluo 4 normalized fluorescence values that were induced by 100 μM Са2+ additions, but in Mg,ATP-medium such differences were not recorded. It is concluded that Са2+ exchange in myometrium mitochondria is regulated by the concentration of Ca ions as in the external medium, so in the matrix of mitochondria. The medium composition had a significant impact on the [Са2+]m values in the absence of exogenous cation. It is suggested that light increase of [Са2+]m before the addition of 100 μM Са2+ may have a positive effect on the functional activity of the mitochondria.

  10. Differential expression of CaMK-II genes during early zebrafish embryogenesis.

    Science.gov (United States)

    Rothschild, Sarah C; Lister, James A; Tombes, Robert M

    2007-01-01

    CaMK-II is a highly conserved Ca(2+)/calmodulin-dependent protein kinase expressed throughout the lifespan of all vertebrates. During early development, CaMK-II regulates cell cycle progression and "non-canonical" Wnt-dependent convergent extension. In the zebrafish, Danio rerio, CaMK-II activity rises within 2 hr after fertilization. At the time of somite formation, zygotic expression from six genes (camk2a1, camk2b1, camk2g1, camk2g2, camk2d1, camk2d2) results in a second phase of increased activity. Zebrafish CaMK-II genes are 92-95% identical to their human counterparts in the non-variable regions. During the first three days of development, alternative splicing yields at least 20 splice variants, many of which are unique. Whole-mount in situ hybridization reveals that camk2g1 comprises the majority of maternal expression. All six genes are expressed strongly in ventral regions at the 18-somite stage. Later, camk2a1 is expressed in anterior somites, heart, and then forebrain. Camk2b1 is expressed in somites, mid- and forebrain, gut, retina, and pectoral fins. Camk2g1 appears strongly along the midline and then in brain, gut, and pectoral fins. Camk2g2 is expressed early in the midbrain and trunk and exhibits the earliest retinal expression. Camk2d1 is elevated early at somite boundaries, then epidermal tissue, while camk2d2 is expressed in discrete anterior locations, steadily increasing along either side of the dorsal midline and then throughout the brain, including the retina. These findings reveal a complex pattern of CaMK-II gene expression consistent with pleiotropic roles during development.

  11. Structural Properties of Human CaMKII Ca2+ /Calmodulin-Dependent Protein Kinase II using X-ray Crystallography

    Science.gov (United States)

    Cao, Yumeng Melody; McSpadden, Ethan; Kuriyan, John; Department of Molecular; Cell Biology; Department of Chemistry Team

    To this day, human memory storage remains a mystery as we can at most describe the process vaguely on a cellular level. Switch-like properties of Calcium/Calmodulin-Dependent Protein Kinase II make it a leading candidate in understanding the molecular basis of human memory. The protein crystal was placed in the beam of a synchrotron source and the x-ray crystallography data was collected as reflections on a diffraction pattern that undergo Fourier transform to obtain the electron density. We observed two drastic differences from our solved structure at 2.75Å to a similar construct of the mouse CaMKII association domain. Firstly, our structure is a 6-fold symmetric dodecamer, whereas the previously published construct was a 7-fold symmetric tetradecamer. This suggests the association domain of human CaMKII is a dynamic structure that is triggered subunit exchange process. Secondly, in our structure the N-terminal tag is docked as an additional beta-strand on an uncapped beta-sheet present in each association domain protomer. This is concrete evidence of the involvement of the polypeptide docking site in the molecular mechanism underlining subunit exchange. In the future, we would like to selectively inhibit the exchange process while not disrupting the other functionalities of CaMKII.

  12. Time-resolved photoelectron spectroscopy of a dinuclear Pt(II) complex: Tunneling autodetachment from both singlet and triplet excited states of a molecular dianion

    Energy Technology Data Exchange (ETDEWEB)

    Winghart, Marc-Oliver, E-mail: marc-oliver.winghart@kit.edu; Unterreiner, Andreas-Neil [Institute of Physical Chemistry, Karlsruhe Institute of Technology, P.O. Box 6980, 76049 Karlsruhe (Germany); Yang, Ji-Ping [Institute of Physical Chemistry, Karlsruhe Institute of Technology, P.O. Box 6980, 76049 Karlsruhe (Germany); School of Sciences, Hefei University of Technology, Hefei 230009 (China); Vonderach, Matthias [Centre for Proteome Research, Institute of Integrative Biology, University of Liverpool, Liverpool L69 7ZB (United Kingdom); Huang, Dao-Ling; Wang, Lai-Sheng [Department of Chemistry, Brown University, Providence, Rhode Island 02912 (United States); Kruppa, Sebastian; Riehn, Christoph [Fachbereich Chemie und Landesforschungszentrum OPTIMAS, Technische Universität Kaiserslautern, Erwin-Schrödinger-Str. 52–54, 67663 Kaiserslautern (Germany); Kappes, Manfred M., E-mail: manfred.kappes@kit.edu [Institute of Physical Chemistry, Karlsruhe Institute of Technology, P.O. Box 6980, 76049 Karlsruhe (Germany); Institute of Nanotechnology, Karlsruhe Institute of Technology, P.O. Box 3640, 76021 Karlsruhe (Germany)

    2016-02-07

    Time-resolved pump-probe photoelectron spectroscopy has been used to study the relaxation dynamics of gaseous [Pt{sub 2}(μ-P{sub 2}O{sub 5}H{sub 2}){sub 4} + 2H]{sup 2−} after population of its first singlet excited state by 388 nm femtosecond laser irradiation. In contrast to the fluorescence and phosphorescence observed in condensed phase, a significant fraction of the photoexcited isolated dianions decays by electron loss to form the corresponding monoanions. Our transient photoelectron data reveal an ultrafast decay of the initially excited singlet {sup 1}A{sub 2u} state and concomitant rise in population of the triplet {sup 3}A{sub 2u} state, via sub-picosecond intersystem crossing (ISC). We find that both of the electronically excited states are metastably bound behind a repulsive Coulomb barrier and can decay via delayed autodetachment to yield electrons with characteristic kinetic energies. While excited state tunneling detachment (ESETD) from the singlet {sup 1}A{sub 2u} state takes only a few picoseconds, ESETD from the triplet {sup 3}A{sub 2u} state is much slower and proceeds on a time scale of hundreds of nanoseconds. The ISC rate in the gas phase is significantly higher than in solution, which can be rationalized in terms of changes to the energy dissipation mechanism in the absence of solvent molecules. [Pt{sub 2}(μ-P{sub 2}O{sub 5}H{sub 2}){sub 4} + 2H]{sup 2−} is the first example of a photoexcited multianion for which ESETD has been observed following ISC.

  13. CaMK-II promotes focal adhesion turnover and cell motility by inducing tyrosine dephosphorylation of FAK and paxillin.

    Science.gov (United States)

    Easley, Charles A; Brown, Claire M; Horwitz, Alan F; Tombes, Robert M

    2008-08-01

    Transient elevations in Ca2+ have previously been shown to promote focal adhesion disassembly and cell motility through an unknown mechanism. In this study, evidence is provided to show that CaMK-II, a Ca2+/calmodulin dependent protein kinase, influences fibroblast adhesion and motility. TIRF microscopy reveals a dynamic population of CaMK-II at the cell surface in migrating cells. Inhibition of CaMK-II with two mechanistically distinct, membrane permeant inhibitors (KN-93 and myr-AIP) freezes lamellipodial dynamics, accelerates spreading on fibronectin, enlarges paxillin-containing focal adhesions and blocks cell motility. In contrast, constitutively active CaMK-II is not found at the cell surface, reduces cell attachment, eliminates paxillin from focal adhesions and decreases the phospho-tyrosine levels of both FAK and paxillin; all of these events can be reversed with myr-AIP. Thus, both CaMK-II inhibition and constitutive activation block cell motility through over-stabilization or destabilization of focal adhesions, respectively. Coupled with the existence of transient Ca2+ elevations and a dynamic CaMK-II population, these findings provide the first direct evidence that CaMK-II enables cell motility by transiently and locally stimulating tyrosine dephosphorylation of focal adhesion proteins to promote focal adhesion turnover. (c) 2008 Wiley-Liss, Inc.

  14. Biophysical analysis of the dynamics of calmodulin interactions with neurogranin and Ca(2+) /calmodulin-dependent kinase II.

    Science.gov (United States)

    Seeger, Christian; Talibov, Vladimir O; Danielson, U Helena

    2017-08-01

    Calmodulin (CaM) functions depend on interactions with CaM-binding proteins, regulated by Ca2+. Induced structural changes influence the affinity, kinetics, and specificities of the interactions. The dynamics of CaM interactions with neurogranin (Ng) and the CaM-binding region of Ca2+/calmodulin-dependent kinase II (CaMKII290-309 ) have been studied using biophysical methods. These proteins have opposite Ca2+ dependencies for CaM binding. Surface plasmon resonance biosensor analysis confirmed that Ca2+ and CaM interact very rapidly, and with moderate affinity ( KDSPR=3μM). Calmodulin-CaMKII290-309 interactions were only detected in the presence of Ca2+, exhibiting fast kinetics and nanomolar affinity ( KDSPR=7.1nM). The CaM-Ng interaction had higher affinity under Ca2+-depleted ( KDSPR=480nM,k1=3.4×105M-1s-1 and k-1 = 1.6 × 10(-1) s(-1) ) than Ca2+-saturated conditions ( KDSPR=19μM). The IQ motif of Ng (Ng27-50 ) had similar affinity for CaM as Ng under Ca2+-saturated conditions ( KDSPR=14μM), but no interaction was seen under Ca2+-depleted conditions. Microscale thermophoresis using fluorescently labeled CaM confirmed the surface plasmon resonance results qualitatively, but estimated lower affinities for the Ng ( KDMST=890nM) and CaMKII290-309 ( KDMST=190nM) interactions. Although CaMKII290-309 showed expected interaction characteristics, they may be different for full-length CaMKII. The data for full-length Ng, but not Ng27-50 , agree with the current model on Ng regulation of Ca2+/CaM signaling. © 2017 The Authors Journal of Molecular Recognition Published by John Wiley & Sons Ltd.

  15. Die Rolle der Ca2+/calmodulinabhängigen Proteinkinase II δ2 in β-Zellen

    OpenAIRE

    Osterhoff, Martin

    2001-01-01

    In der vorliegenden Arbeit ist die Funktion der Ca2+/calmodulinabhängigen Kinase II δ2(CaMK II δ2) in INS- 1 Ratteninsulinomzellen untersucht worden. Zu diesem Zweck wurden durch einen retroviralen Ansatz sowohl Zellen erzeugt, die die CaMK IIδ2überexprimieren, als auch Zellen, in denen die Expression der CaMK IIδ2 durch einen RNA-Gegenstrang Ansatz supprimiert ist. Während eine Überxpression der CaMK IIδ2 zu einer verstärkten Insulinsekretion führt, verringert eine Suppression de...

  16. Conditioned taste aversion and Ca/calmodulin-dependent kinase II in the parabrachial nucleus of rats.

    Science.gov (United States)

    Krivanek, J

    2001-07-01

    Bielavska and colleagues (Bielavska, Sacchetti, Baldi, & Tassoni, 1999) have recently shown that KN-62, an inhibitor of calcium/calmodulin-dependent kinase II (CaCMK), induces conditioned taste aversion (CTA) when introduced into the parabrachial nucleus (PBN) of rats. The aim of the present report was to assess whether activity of CaCMK in the PBN is changed during CTA. We induced CTA in one group of rats by pairing saccharin consumption with an ip injection of lithium chloride. Another group of rats received lithium alone (without being paired with saccharin consumption) to test whether lithium has an effect on CaCMK in the PBN, independent of those effects due to training. In animals receiving CTA training, CaCMK activity in extracts of PBN was reduced by approximately 30% at the postacquisition intervals of 12, 24, and 48 h, compared to control animals receiving saccharin with saline injection. By 120 h after CTA training, no effect on CaCMK was present. At those postacquisition intervals showing CaCMK activity effects due to CTA, there were no effects attributable to lithium alone. Lithium alone produced only a short-lasting reduction in CaCMK activity (at 20 min a 30% decrease, at 60 min a 23% decrease; and at 6, 12, and 24 h no decrease). The time course of lithium-induced effects differed markedly from that of CTA training. All changes were Ca2+/- -dependent; we did not observe any changes in Ca-independent activity. CTA effects on CaCMK were selective for PBN, insofar as we did not observe any CTA effects on CaCMK in the visual cortex, a brain region unrelated to taste pathways. Since CTA produces a relatively long-lasting reduction in CaCMK activity (lasting 2 days or more) specifically in the PBN, which is critical a relay for taste information, the reduction of CaCMK activity may enable the consolidation of taste memory in an aversive situation.

  17. Tracers of Chromospheric Structure. I. Observations of Ca II K and Hα in M Dwarfs

    Science.gov (United States)

    Walkowicz, Lucianne M.; Hawley, Suzanne L.

    2009-02-01

    We report on our observing program4This paper is based on observations obtained with the Apache Point Observatory 3.5 m telescope, which is owned and operated by the Astrophysical Research Consortium. Some of the data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation. to capture simultaneous spectra of Ca II and Balmer lines in a sample of nearby M3 dwarfs. Our goal is to investigate the chromospheric temperature structure required to produce these lines at the observed levels. We find a strong positive correlation between instantaneous measurements of Ca II K and the Balmer lines in active stars, although these lines may not be positively correlated in time-resolved measurements. The relationship between Hα and Ca II K remains ambiguous for weak and intermediate activity stars, with Hα absorption corresponding to a range of Ca II K emission. A similar relationship is also observed between Ca II K and the higher-order Balmer lines. As our sample consists of a single spectral type, correlations between these important chromospheric tracers cannot be ascribed to continuum effects, as suggested by other authors. These data confirm prior nonsimultaneous observations of the Hα line behavior with increasing activity, showing an initial increase in the Hα absorption with increasing Ca II K emission, prior to Hα filling in and eventually becoming a pure emission line in the most active stars. We also compare our optical measurements with archival UV and X-ray measurements, finding a positive correlation between the chromospheric and coronal emission for both high and intermediate activity stars. We compare our results with previous determinations of the active fraction of low-mass stars

  18. Evaluating the triplet hypothesis during rhythmic mastication in primates.

    Science.gov (United States)

    Ram, Yashesvini; Ross, Callum F

    2017-11-13

    Mammalian mastication involves precise jaw movements including transverse movement of the mandible during the power stroke. Jaw elevation and transverse movement are driven by asymmetrical jaw elevator muscle activity which is thought to include a phylogenetically primitive and conserved triplet motor pattern consisting of: triplet I-balancing side superficial masseter and medial pterygoid, working side posterior temporalis- which reaches onset, peak, and offset first; and triplet II-working side superficial masseter and medial pterygoid, balancing side posterior temporalis-which is active second. Although the presence of a triplet motor pattern has been confirmed in several primate species, the prevalence of this motor pattern-the proportion of cycles that display this pattern-has not been evaluated in primates. The present study quantifies the presence and prevalence of the triplet motor pattern in five different primate species, Eulemur fulvus, Propithecus verreauxi, Papio anubis, Macaca fascicularis, and Pan troglodytes, using mean onset, peak, and offset time relative to working superficial masseter. In all five of the species studied, the mean triplet motor pattern is observed at peak muscle activation, and in four out of the five species the triplet motor pattern occurs more frequently than expected at random at peak muscle activation and offset. Non-triplet motor patterns were observed in varying proportions at different time points in the cycle, suggesting that presence or absence of the triplet motor pattern is not a binomial trait. Instead, the primate masticatory motor pattern is malleable within individual cycles, within individual animals, and therefore within species. © 2017. Published by The Company of Biologists Ltd.

  19. Ca2+/calmodulin-dependent protein kinase II-γ (CaMKIIγ) negatively regulates vascular smooth muscle cell proliferation and vascular remodeling

    Science.gov (United States)

    Saddouk, Fatima Z.; Sun, Li-Yan; Liu, Yong Feng; Jiang, Miao; Singer, Diane V.; Backs, Johannes; Van Riper, Dee; Ginnan, Roman; Schwarz, John J.; Singer, Harold A.

    2016-01-01

    Vascular smooth muscle (VSM) expresses calcium/calmodulin-dependent protein kinase II (CaMKII)-δ and -γ isoforms. CaMKIIδ promotes VSM proliferation and vascular remodeling. We tested CaMKIIγ function in vascular remodeling after injury. CaMKIIγ protein decreased 90% 14 d after balloon injury in rat carotid artery. Intraluminal transduction of adenovirus encoding CaMKIIγC rescued expression to 35% of uninjured controls, inhibited neointima formation (>70%), inhibited VSM proliferation (>60%), and increased expression of the cell-cycle inhibitor p21 (>2-fold). Comparable doses of CaMKIIδ2 adenovirus had no effect. Similar dynamics in CaMKIIγ mRNA and protein expression were observed in ligated mouse carotid arteries, correlating closely with expression of VSM differentiation markers. Targeted deletion of CaMKIIγ in smooth muscle resulted in a 20-fold increase in neointimal area, with a 3-fold increase in the cell proliferation index, no change in apoptosis, and a 60% decrease in p21 expression. In cultured VSM, CaMKIIγ overexpression induced p53 mRNA (1.7 fold) and protein (1.8-fold) expression; induced the p53 target gene p21 (3-fold); decreased VSM cell proliferation (>50%); and had no effect on expression of apoptosis markers. We conclude that regulated CaMKII isoform composition is an important determinant of the injury-induced vasculoproliferative response and that CaMKIIγ and -δ isoforms have nonequivalent, opposing functions.—Saddouk, F. Z., Sun, L.-Y., Liu, Y. F., Jiang, M., Singer, D. V., Backs, J., Van Riper, D., Ginnan, R., Schwarz, J. J., Singer, H. A. Ca2+/calmodulin-dependent protein kinase II-γ (CaMKIIγ) negatively regulates vascular smooth muscle cell proliferation and vascular remodeling. PMID:26567004

  20. Leptin facilitates learning and memory performance and enhances hippocampal CA1 long-term potentiation and CaMK II phosphorylation in rats.

    Science.gov (United States)

    Oomura, Y; Hori, N; Shiraishi, T; Fukunaga, K; Takeda, H; Tsuji, M; Matsumiya, T; Ishibashi, M; Aou, S; Li, X L; Kohno, D; Uramura, K; Sougawa, H; Yada, T; Wayner, M J; Sasaki, K

    2006-11-01

    Leptin, an adipocytokine encoded by an obesity gene and expressed in adipose tissue, affects feeding behavior, thermogenesis, and neuroendocrine status via leptin receptors distributed in the brain, especially in the hypothalamus. Leptin may also modulate the synaptic plasticity and behavioral performance related to learning and memory since: leptin receptors are found in the hippocampus, and both leptin and its receptor share structural and functional similarities with the interleukin-6 family of cytokines that modulate long-term potentiation (LTP) in the hippocampus. We therefore examined the effect of leptin on (1) behavioral performance in emotional and spatial learning tasks, (2) LTP at Schaffer collateral-CA1 synapses, (3) presynaptic and postsynaptic activities in hippocampal CA1 neurons, (4) the intracellular Ca(2+) concentration ([Ca(2+)](i)) in CA1 neurons, and (5) the activity of Ca(2+)/calmodulin protein kinase II (CaMK II) in the hippocampal CA1 tissue that exhibits LTP. Intravenous injection of 5 and/or 50mug/kg, but not of 500mug/kg leptin, facilitated behavioral performance in passive avoidance and Morris water-maze tasks. Bath application of 10(-12)M leptin in slice experiments enhanced LTP and increased the presynaptic transmitter release, whereas 10(-10)M leptin suppressed LTP and reduced the postsynaptic receptor sensitivity to N-methyl-d-aspartic acid. The increase in the [Ca(2+)](i) induced by 10(-10)M leptin was two times greater than that induced by 10(-12)M leptin. In addition, the facilitation (10(-12)M) and suppression (10(-10)M) of LTP by leptin was closely associated with an increase and decrease in Ca(2+)-independent activity of CaMK II. Our results show that leptin not only affects hypothalamic functions (such as feeding, thermogenesis, and neuroendocrine status), but also modulates higher nervous functions, such as the behavioral performance related to learning and memory and hippocampal synaptic plasticity.

  1. Molecular determinants for cardiovascular TRPC6 channel regulation by Ca2+/calmodulin-dependent kinase II

    DEFF Research Database (Denmark)

    Shi, Juan; Geshi, Naomi; Takahashi, Shinichi

    2013-01-01

    and distribution of TRPC6 channels did not significantly change with these mutations. Electrophysiological and immunocytochemical data with the Myc-tagged TRPC6 channel indicated that Thr487 is most likely located at the intracellular side of the cell membrane. Overexpression of T487A caused significant reduction......The molecular mechanism underlying Ca2+/calmodulin (CaM)-dependent kinase II (CaMKII)-mediated regulation of the mouse transient receptor potential channel TRPC6 was explored by chimera, deletion and site-directed mutagenesis approaches. Induction of currents (ICCh) in TRPC6-expressing HEK293 cells...... of the TRPC6 channel by receptor stimulation. The abrogating effect of the alanine mutation of Thr487 (T487A) was reproduced with other non-polar amino acids, namely glutamine or asparagine, while being partially rescued by phosphomimetic mutations with glutamate or aspartate. The cellular expression...

  2. Slender Ca ii H Fibrils Mapping Magnetic Fields in the Low Solar Chromosphere

    Energy Technology Data Exchange (ETDEWEB)

    Jafarzadeh, S.; Rutten, R. J.; Szydlarski, M. [Institute of Theoretical Astrophysics, University of Oslo, P.O. Box 1029 Blindern, NO-0315 Oslo (Norway); Solanki, S. K.; Wiegelmann, T.; Riethmüller, T. L.; Noort, M. van; Barthol, P.; Gandorfer, A.; Gizon, L.; Hirzberger, J. [Max Planck Institute for Solar System Research, Justus-von-Liebig-Weg 3, D-37077 Göttingen (Germany); Rodríguez, J. Blanco [Grupo de Astronomía y Ciencias del Espacio, Universidad de Valencia, E-46980 Paterna, Valencia (Spain); Iniesta, J. C. del Toro; Suárez, D. Orozco [Instituto de Astrofísica de Andalucía (CSIC), Apartado de Correos 3004, E-18080 Granada (Spain); Knölker, M. [High Altitude Observatory, National Center for Atmospheric Research, P.O. Box 3000, Boulder, CO 80307-3000 (United States); Pillet, V. Martínez [National Solar Observatory, 3665 Discovery Drive, Boulder, CO 80303 (United States); Schmidt, W., E-mail: shahin.jafarzadeh@astro.uio.no [Kiepenheuer-Institut für Sonnenphysik, Schöneckstr. 6, D-79104 Freiburg (Germany)

    2017-04-01

    A dense forest of slender bright fibrils near a small solar active region is seen in high-quality narrowband Ca ii H images from the SuFI instrument onboard the Sunrise balloon-borne solar observatory. The orientation of these slender Ca ii H fibrils (SCF) overlaps with the magnetic field configuration in the low solar chromosphere derived by magnetostatic extrapolation of the photospheric field observed with Sunrise/IMaX and SDO/HMI. In addition, many observed SCFs are qualitatively aligned with small-scale loops computed from a novel inversion approach based on best-fit numerical MHD simulation. Such loops are organized in canopy-like arches over quiet areas that differ in height depending on the field strength near their roots.

  3. Encapsulation of lactase in Ca(II)-alginate beads: Effect of stabilizers and drying methods.

    Science.gov (United States)

    Traffano-Schiffo, Maria Victoria; Castro-Giraldez, Marta; Fito, Pedro J; Santagapita, Patricio R

    2017-10-01

    The purpose of the present work was to analyze the effect of trehalose, arabic and guar gums on the preservation of β-galactosidase activity in freeze-dried and vacuum dried Ca(II)-alginate beads. Freezing process was also studied as a first step of freeze-drying. Trehalose was critical for β-galactosidase conservation, and guar gum as a second excipient showed the highest conservation effect (close to 95%). Systems with Tg values ~40°C which were stables at ambient temperature were obtained, being trehalose the main responsible of the formation of an amorphous matrix. Vacuum dried beads showed smaller size (with Feret's diameter below 1.08±0.09mm), higher circularity (reaching 0.78±0.06) and large cracks in their surface than freeze-dried beads, which were more spongy and voluminous. Ice crystallization of the beads revealed that the crystallization of Ca(II)-alginate system follows the Avrami kinetics of nucleation and growth. Particularly, Ca(II)-alginate showed an Avrami index of 2.03±0.07, which means that crystal growing is bidimensional. Neither the addition of trehalose nor gums affected the dimension of the ice growing or its rate. These results open an opportunity in the development of new lactic products able to be consumed by lactose intolerance people. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. The origin of split EPR signals in the Ca2+-depleted photosystem II.

    Science.gov (United States)

    Mino, Hiroyuki; Itoh, Shigeru

    2005-06-01

    A light-driven reaction model for the Ca2+-depleted Photosystem (PS) II is proposed to explain the split signal observed in electron paramagnetic resonance (EPR) spectra based on a comparison of EPR assignments with recent x-ray structural data. The split signal has a splitting linewidth of 160 G at around g = 2 and is seen upon illumination of the Ca2+-depleted PS II in the S2 state associated with complete or partial disappearance of the S2 state multiline signal. Another g=2 broad ESR signal with a 110 G linewidth was produced by 245 K illumination for a short period in the Ca2+-depleted PS II in S1 state. At the same time a normal YZ . radical signal was also efficiently trapped. The g=2 broad signal is attributed to an intermediate S1X. state in equilibrium with the trapped YZ . radical. Comparison with x-ray structural data suggests that one of the split signals (doublet signal) is attributable to interaction between His 190 and the YZ . radical, and other signals is attributable to interaction between His 337 and the manganese cluster, providing further clues as to the mechanism of water oxidation in photosynthetic oxygen evolution.

  5. Spectroscopic Inversions of the Ca ii 8542 Å Line in a C-class Solar Flare

    Science.gov (United States)

    Kuridze, D.; Henriques, V.; Mathioudakis, M.; Koza, J.; Zaqarashvili, T. V.; Rybák, J.; Hanslmeier, A.; Keenan, F. P.

    2017-09-01

    We study the C8.4-class solar flare SOL2016-05-14T11:34 UT using high-resolution spectral imaging in the Ca ii 8542 Å line obtained with the CRISP imaging spectropolarimeter on the Swedish 1 m Solar Telescope. Spectroscopic inversions of the Ca ii 8542 Å line using the non-LTE code NICOLE are used to investigate the evolution of the temperature and velocity structure in the flaring chromosphere. A comparison of the temperature stratification in flaring and non-flaring areas reveals strong footpoint heating during the flare peak in the lower atmosphere. The temperature of the flaring footpoints between {log} {τ }500 ≈ -2.5 {and} -3.5, where τ 500 is the continuum optical depth at 500 nm, is ˜ 5{--}6.5 {kK} close to the flare peak, reducing gradually to ˜ 5 {kK}. The temperature in the middle and upper chromosphere, between {log} {τ }500≈ -3.5 and -5.5, is estimated to be ˜6.5-20 kK, decreasing to preflare temperatures, ˜5-10 kK, after approximately 15 minutes. However, the temperature stratification of the non-flaring areas is unchanged. The inverted velocity fields show that the flaring chromosphere is dominated by weak downflowing condensations at the formation height of Ca ii 8542 Å.

  6. CaMK-II activation is essential for zebrafish inner ear development and acts through Delta-Notch signaling.

    Science.gov (United States)

    Rothschild, Sarah C; Lahvic, Jamie; Francescatto, Ludmila; McLeod, Jamie J A; Burgess, Shawn M; Tombes, Robert M

    2013-09-01

    Zebrafish inner ear development is characterized by the crystallization of otoliths onto immotile kinocilia that protrude from sensory "hair" cells. The stereotypical formation of these sensory structures is dependent on the expression of key patterning genes and on Ca2+ signals. One potential target of Ca2+ signaling in the inner ear is the type II Ca2+/calmodulin-dependent protein kinase (CaMK-II), which is preferentially activated in hair cells, with intense activation at the base of kinocilia. In zebrafish, CaMK-II is encoded by seven genes; the expression of one of these genes (camk2g1) is enriched in hair cells. The suppression of camk2g1 expression by antisense morpholino oligonucleotides or inhibition of CaMK-II activation by the pharmacological antagonist, KN-93, results in aberrant otolith formation without preventing cilia formation. In fact, CaMK-II suppression results in additional ciliated hair cells and altered levels of Delta-Notch signaling members. DeltaA and deltaD transcripts are increased and DeltaD protein accumulates in hair cells of CaMK-II morphants, indicative of defective recycling and/or exocytosis. Our findings indicate that CaMK-II plays a critical role in the developing ear, influencing cell differentiation through extranuclear effects on Delta-Notch signaling. Continued expression and activation of CaMK-II in maculae and cristae in older embryos suggests continued roles in auditory sensory maturation and transduction. Copyright © 2013 Elsevier Inc. All rights reserved.

  7. Ca2+ entry is essential for cell strain-induced lamellar body fusion in isolated rat type II pneumocytes

    NARCIS (Netherlands)

    Frick, Manfred; Bertocchi, Cristina; Jennings, Paul; Haller, Thomas; Mair, Norbert; Singer, Wolfgang; Pfaller, Walter; Ritsch-Marte, Monika; Dietl, Paul

    Using a new equibiaxial strain device, we investigated strain-induced Ca2+ signals and their relation to lamellar body (LB) exocytosis in single rat alveolar type II (AT II) cells. The strain device allows observation of single cells while inducing strain to the entire substratum. AT II cells

  8. Removal of Ca(II) and Mg(II) from potassium chromate solution on Amberlite IRC 748 synthetic resin by ion exchange.

    Science.gov (United States)

    Yu, Zhihui; Qi, Tao; Qu, Jingkui; Wang, Lina; Chu, Jinglong

    2009-08-15

    Experimental measurements have been made on the batch ion exchange of Ca(II) and Mg(II) from potassium chromate solution using cation exchanger of Amberlite IRC 748 as K+ form. The ion exchange behavior of two alkaline-earth metals on the resin, depending on contact time, pH, temperature and resin dosage was studied. The adsorption isotherms were described by means of the Langmuir and Freundlich isotherms. For Ca(II) ion, the Langmuir model represented the adsorption process better than the Freundlich model. The maximum ion exchange capacity was found to be 47.21 mg g(-1) for Ca(II) and 27.70 mg g(-1) for Mg(II). The kinetic data were tested using Lagergren-first-order and pseudo-second-order kinetic models. Kinetic data correlated well with the pseudo-second-order kinetic model, indicating that the chemical adsorption was the rate-limiting step. Various thermodynamic parameters such as Gibbs free energy (DeltaG degrees ), enthalpy (DeltaH degrees ) and entropy (DeltaS degrees ) were also calculated. These parameters showed that the ion exchange of Ca(II) and Mg(II) from potassium chromate solution was feasible, spontaneous and endothermic process in nature. The activation energy of ion-exchange (E(a)) was determined as 12.34 kJ mol(-1) for Ca(II) and 9.865 kJ mol(-1) for Mg(II) according to the Arrhenius equation.

  9. The activation of membrane targeted CaMK-II in the zebrafish Kupffer's vesicle is required for left-right asymmetry.

    Science.gov (United States)

    Francescatto, Ludmila; Rothschild, Sarah C; Myers, Alexandra L; Tombes, Robert M

    2010-08-01

    Intracellular calcium ion (Ca(2+)) elevation on the left side of the mouse embryonic node or zebrafish Kupffer's vesicle (KV) is the earliest asymmetric molecular event that is functionally linked to lateral organ placement in these species. In this study, Ca(2+)/CaM-dependent protein kinase (CaMK-II) is identified as a necessary target of this Ca(2+) elevation in zebrafish embryos. CaMK-II is transiently activated in approximately four interconnected cells along the anterior left wall of the KV between the six- and 12-somite stages, which is coincident with known left-sided Ca(2+) elevations. Within these cells, activated CaMK-II is observed at the surface and in clusters, which appear at the base of some KV cilia. Although seven genes encode catalytically active CaMK-II in early zebrafish embryos, one of these genes also encodes a truncated inactive variant (alphaKAP) that can hetero-oligomerize with and target active enzyme to membranes. alphaKAP, beta2 CaMK-II and gamma1 CaMK-II antisense morpholino oligonucleotides, as well as KV-targeted dominant negative CaMK-II, randomize organ laterality and southpaw (spaw) expression in lateral plate mesoderm (LPM). Left-sided CaMK-II activation was most dependent on an intact KV, the PKD2 Ca(2+) channel and gamma1 CaMK-II; however, alphaKAP, beta2 CaMK-II and the RyR3 ryanodine receptor were also necessary for full CaMK-II activation. This is the first report to identify a direct Ca(2+)-sensitive target in left-right asymmetry and supports a model in which membrane targeted CaMK-II hetero-oligomers in nodal cells transduce the left-sided PKD2-dependent Ca(2+) signals to the LPM.

  10. Experiments TGV I (double-beta decay of 48Ca) and TGV II (double-beta decay of 106Cd and 48Ca)

    Science.gov (United States)

    Štekl, I.; Čermák, P.; Beneš, P.; Brudanin, V. B.; Rukhadze, N. I.; Egorov, V. G.; Kovalenko, V. E.; Kovalík, A.; Salamatin, A. V.; Tsoupko-Sitnikov, V. V.; Vylov, Ts.; Briancon, Ch.; Šimkovic, F.

    2000-04-01

    Present status of experiments TGV I and TGV II is given. The TGV I collaboration has studied the double-beta decay of 48Ca with a low-background and high sensitivity Ge multi-detector spectrometer TGV (Telescope Germanium Vertical). The preliminary results of years and years (90% CL) for double-beta decay of 48 Ca has been found after the processing of experimental data obtained after 8700 hours of measuring time using approximately 1 gramme of 48Ca. The aim of the experiment TGV II is the development of the experimental methods, construction of spectrometers and measurement of the decay (++, β+/EC, EC/EC) of 106Cd particularly the 2νEC/EC mode. The theoretical description and performance of the TGV II spectrometer are also given.

  11. Fusion-activated Ca(2+ entry: an "active zone" of elevated Ca(2+ during the postfusion stage of lamellar body exocytosis in rat type II pneumocytes.

    Directory of Open Access Journals (Sweden)

    Pika Miklavc

    2010-06-01

    Full Text Available Ca(2+ is essential for vesicle fusion with the plasma membrane in virtually all types of regulated exocytoses. However, in contrast to the well-known effects of a high cytoplasmic Ca(2+ concentration ([Ca(2+](c in the prefusion phase, the occurrence and significance of Ca(2+ signals in the postfusion phase have not been described before.We studied isolated rat alveolar type II cells using previously developed imaging techniques. These cells release pulmonary surfactant, a complex of lipids and proteins, from secretory vesicles (lamellar bodies in an exceptionally slow, Ca(2+- and actin-dependent process. Measurements of fusion pore formation by darkfield scattered light intensity decrease or FM 1-43 fluorescence intensity increase were combined with analysis of [Ca(2+](c by ratiometric Fura-2 or Fluo-4 fluorescence measurements. We found that the majority of single lamellar body fusion events were followed by a transient (t(1/2 of decay = 3.2 s rise of localized [Ca(2+](c originating at the site of lamellar body fusion. [Ca(2+](c increase followed with a delay of approximately 0.2-0.5 s (method-dependent and in the majority of cases this signal propagated throughout the cell (at approximately 10 microm/s. Removal of Ca(2+ from, or addition of Ni(2+ to the extracellular solution, strongly inhibited these [Ca(2+](c transients, whereas Ca(2+ store depletion with thapsigargin had no effect. Actin-GFP fluorescence around fused LBs increased several seconds after the rise of [Ca(2+](c. Both effects were reduced by the non-specific Ca(2+ channel blocker SKF96365.Fusion-activated Ca(2+entry (FACE is a new mechanism that leads to [Ca(2+](c transients at the site of vesicle fusion. Substantial evidence from this and previous studies indicates that fusion-activated Ca(2+ entry enhances localized surfactant release from type II cells, but it may also play a role for compensatory endocytosis and other cellular functions.

  12. The γ isoform of CaM kinase II controls mouse egg activation by regulating cell cycle resumption

    Science.gov (United States)

    Backs, Johannes; Stein, Paula; Backs, Thea; Duncan, Francesca E.; Grueter, Chad E.; McAnally, John; Qi, Xiaoxia; Schultz, Richard M.; Olson, Eric N.

    2009-01-01

    Fertilization triggers a rise in intracellular Ca2+ concentration ([Ca2+]i) in the egg that initiates a series of events known as egg activation. These events include cortical granule exocytosis that establishes a block to polyspermy, resumption of meiosis, and recruitment of maternal mRNAs into polysomes for translation. Several calcium-dependent proteins, including calcium/calmodulin-dependent protein kinase II (CaMKII), have been implicated in egg activation. However, the precise role of CaMKII in mediating specific events of egg activation and the identity of the isoform(s) present in mouse eggs have not been unequivocally established. Through targeted deletion of the γ isoform of CaMKII, we find that CaMKIIγ is the predominant CaMKII isoform in mouse eggs and that it is essential for egg activation. Although CaMKIIγ−/− eggs exhibit a normal pattern of Ca2+ oscillations after insemination and undergo cortical granule exocytosis, they fail to resume meiosis or to recruit maternal mRNAs. Surprisingly, we find that the recruitment of maternal mRNAs does not directly depend on CaMKII, but requires elevated [Ca2+]i and metaphase II exit. We conclude that CaMKIIγ specifically controls mouse egg activation by regulating cell cycle resumption. PMID:19966304

  13. Hypothyroidism following developmental iodine deficiency reduces hippocampal neurogranin, CaMK II and calmodulin and elevates calcineurin in lactational rats.

    Science.gov (United States)

    Dong, Jing; Liu, Wanyang; Wang, Yi; Xi, Qi; Chen, Jie

    2010-11-01

    Developmental iodine deficiency (ID) leads to inadequate thyroid hormone that impairs learning and memory with an unclear mechanism. Here, we show that hippocampal neurogranin, calcium/calmodulin dependent protein kinase II (CaMKII), calmodulin (CaM) and calcineurin (CaN) are implicated in the brain impairment in lactational rat hippocampus following developmental ID and hypothyroidism. Three developmental rat models were created by administrating dam rats with either iodine-deficient diet or propylthiouracil (PTU, 5 ppm or 15 ppm)-added drinking water from gestational day (GD) 6 till postnatal day (PN) 21. Then, the neurogranin, CaMKII, CaM and CaN in the hippocampus were detected with immunohistochemistry and western blotting on PN14 and PN21. The iodine-deficient and hypothyroid pups showed significantly lower level of neurogranin, CaMKII and CaM and significantly increased CaN in hippocampal CA1 and CA3 regions than the controls on PN14 and PN21 (P<0.05, respectively). Data indicate that, in lactational rats, hippocampal neurogranin, CaMKII, CaM and CaN are involved in the brain impairment by developmental ID and hypothyroidism. Copyright © 2010 ISDN. Published by Elsevier Ltd. All rights reserved.

  14. A dynamic model of interactions of Ca2+, calmodulin, and catalytic subunits of Ca2+/calmodulin-dependent protein kinase II.

    Directory of Open Access Journals (Sweden)

    Shirley Pepke

    2010-02-01

    Full Text Available During the acquisition of memories, influx of Ca2+ into the postsynaptic spine through the pores of activated N-methyl-D-aspartate-type glutamate receptors triggers processes that change the strength of excitatory synapses. The pattern of Ca2+influx during the first few seconds of activity is interpreted within the Ca2+-dependent signaling network such that synaptic strength is eventually either potentiated or depressed. Many of the critical signaling enzymes that control synaptic plasticity,including Ca2+/calmodulin-dependent protein kinase II (CaMKII, are regulated by calmodulin, a small protein that can bindup to 4 Ca2+ ions. As a first step toward clarifying how the Ca2+-signaling network decides between potentiation or depression, we have created a kinetic model of the interactions of Ca2+, calmodulin, and CaMKII that represents our best understanding of the dynamics of these interactions under conditions that resemble those in a postsynaptic spine. We constrained parameters of the model from data in the literature, or from our own measurements, and then predicted time courses of activation and autophosphorylation of CaMKII under a variety of conditions. Simulations showed that species of calmodulin with fewer than four bound Ca2+ play a significant role in activation of CaMKII in the physiological regime,supporting the notion that processing of Ca2+ signals in a spine involves competition among target enzymes for binding to unsaturated species of CaM in an environment in which the concentration of Ca2+ is fluctuating rapidly. Indeed, we showed that dependence of activation on the frequency of Ca2+ transients arises from the kinetics of interaction of fluctuating Ca2+with calmodulin/CaMKII complexes. We used parameter sensitivity analysis to identify which parameters will be most beneficial to measure more carefully to improve the accuracy of predictions. This model provides a quantitative base from which to build more complex dynamic

  15. A Single Protein Kinase A or Calmodulin Kinase II Site Does Not Control the Cardiac Pacemaker Ca2+ Clock

    Science.gov (United States)

    Wu, Yuejin; Valdivia, Héctor H.; Wehrens, Xander H.T.; Anderson, Mark E.

    2016-01-01

    Background Fight or flight heart rate (HR) increases depend on protein kinase A (PKA) and calmodulin kinase II (CaMKII) mediated enhancement of Ca2+ uptake and release from sarcoplasmic reticulum (SR) in sinoatrial nodal cells (SANC). However, the impact of specific PKA and CaMKII phosphorylation sites on HR is unknown. Methods and Results We systematically evaluated validated PKA and CaMKII target sites on phospholamban (PLN) and the ryanodine receptor (RyR2) using genetically modified mice. We found that knockin alanine replacement of RyR2 PKA (S2808) or CaMKII (S2814) target sites failed to affect HR responses to isoproterenol or spontaneous activity in vivo or in SANC. Similarly, selective mutation of PLN amino acids critical for enhancing SR Ca2+ uptake by PKA (S16) or CaMKII (T17) to alanines did not affect HR in vivo or in SANC. In contrast, CaMKII inhibition by expression of AC3-I has been shown to slow SANC rate responses to isoproterenol and decrease SR Ca2+ content. PLN deficiency rescued SR Ca2+ content and SANC rate responses to isoproterenol in mice with AC3-I expression, suggesting CaMKII affects HR by modulation of SR Ca2+ content. Consistent with this, mice expressing a superinhibitory PLN mutant had low SR Ca2+ content and slow HR in vivo and in SANC. Conclusions SR Ca2+ depletion reduces HR and SR Ca2+ repletion restores physiological SANC rate responses despite CaMKII inhibition. PKA and CaMKII do not affect HR by a unique target site governing SR Ca2+ uptake or release. HR acceleration may require an SR Ca2+ content threshold. PMID:26857906

  16. Triplet State Resonance Raman Spectroscopy

    DEFF Research Database (Denmark)

    Wilbrandt, Robert Walter; Jensen, N. H.; Pagsberg, Palle Bjørn

    1978-01-01

    Makes the first report on the resonance Raman spectrum of a molecule in its triplet state generated by pulse radiolysis. A solution of 0.01 mol dm-3 of p-terphenyl in benzene was studied......Makes the first report on the resonance Raman spectrum of a molecule in its triplet state generated by pulse radiolysis. A solution of 0.01 mol dm-3 of p-terphenyl in benzene was studied...

  17. Triplets pass their pressure test

    CERN Multimedia

    2007-01-01

    All the LHC inner triplets have now been repaired and are in position. The first ones have passed their pressure tests with flying colours. The repaired inner triplet at LHC Point 1, right side (1R). Ranko Ostojic (on the right), who headed the team responsible for repairing the triplets, shows the magnet to Robert Zimmer, President of the University of Chicago and of Fermi Research Alliance, who visited CERN on 20th August.Three cheers for the triplets! All the LHC inner triplets have now been repaired and are in position in the tunnel. Thanks to the mobilisation of a multidisciplinary team from CERN and Fermilab, assisted by the KEK Laboratory and the Lawrence Berkeley National Laboratory (LBNL), a solution has been found, tested, validated and applied. At the end of March this year, one of the inner triplets at Point 5 failed to withstand a pressure test. A fault was identified in the supports of two out of the three quadruple magne...

  18. Related bifunctional restriction endonuclease-methyltransferase triplets: TspDTI, Tth111II/TthHB27I and TsoI with distinct specificities.

    Science.gov (United States)

    Zylicz-Stachula, Agnieszka; Zolnierkiewicz, Olga; Lubys, Arvydas; Ramanauskaite, Danute; Mitkaite, Goda; Bujnicki, Janusz M; Skowron, Piotr M

    2012-04-10

    We previously defined a family of restriction endonucleases (REases) from Thermus sp., which share common biochemical and biophysical features, such as the fusion of both the nuclease and methyltransferase (MTase) activities in a single polypeptide, cleavage at a distance from the recognition site, large molecular size, modulation of activity by S-adenosylmethionine (SAM), and incomplete cleavage of the substrate DNA. Members include related thermophilic REases with five distinct specificities: TspGWI, TaqII, Tth111II/TthHB27I, TspDTI and TsoI. TspDTI, TsoI and isoschizomers Tth111II/TthHB27I recognize different, but related sequences: 5'-ATGAA-3', 5'-TARCCA-3' and 5'-CAARCA-3' respectively. Their amino acid sequences are similar, which is unusual among REases of different specificity. To gain insight into this group of REases, TspDTI, the prototype member of the Thermus sp. enzyme family, was cloned and characterized using a recently developed method for partially cleaving REases. TspDTI, TsoI and isoschizomers Tth111II/TthHB27I are closely related bifunctional enzymes. They comprise a tandem arrangement of Type I-like domains, like other Type IIC enzymes (those with a fusion of a REase and MTase domains), e.g. TspGWI, TaqII and MmeI, but their sequences are only remotely similar to these previously characterized enzymes. The characterization of TspDTI, a prototype member of this group, extends our understanding of sequence-function relationships among multifunctional restriction-modification enzymes.

  19. Developmental distribution of CaM kinase II in the antennal lobe of the sphinx moth Manduca sexta.

    Science.gov (United States)

    Lohr, Christian; Bergstein, Sandra; Hirnet, Daniela

    2007-01-01

    The antennal lobe (primary olfactory center of insects) is completely reorganized during metamorphosis. This reorganization is accompanied by changing patterns of calcium signaling in neurons and glial cells. In the present study, we investigated the developmental distribution of a major calcium-dependent protein, viz., calcium/calmodulin-dependent protein kinase II (CaM kinase II), in the antennal lobe of the sphinx moth Manduca sexta by using a monoclonal antibody. During synaptogenesis (developmental stages 6-10), we found a redistribution of CaM kinase II immunoreactivity, from a homogeneous distribution in the immature neuropil to an accumulation in the neuropil of the glomeruli. CaM kinase II immunoreactivity was less intense in olfactory receptor axons of the antennal nerve and antennal lobe glial cells. Western blot analysis revealed a growing content of CaM kinase II in antennal lobe tissue throughout metamorphosis. Injection of the CaM kinase inhibitor KN-93 into pupae resulted in a reduced number of antennal lobe glial cells migrating into the neuropil to form borders around glomeruli. The results suggest that CaM kinase II is involved in glial cell migration.

  20. Comparison Among Ca II K Spectroheliogram Time Series with an Application to Solar Activity Studies

    Science.gov (United States)

    Ermolli, I.; Solanki, S. K.; Tlatov, A. G.; Krivova, N. A.; Ulrich, R. K.; Singh, J.

    2009-06-01

    Various observatories around the globe started regular full-disk imaging of the solar atmosphere in the Ca II K line in the early decades of the 20th century. The archives made by these observations have the potential of providing far more detailed information on solar magnetism than just the sunspot number and area records to which most studies of solar activity and irradiance changes are restricted. We evaluate the image quality and contents of three Ca II K spectroheliogram time series, specifically those obtained by the digitization of the Arcetri, Kodaikanal, and Mt Wilson photographic archives, in order to estimate their value for studies focusing on timescales longer than the solar cycle. We analyze the quality of these data and compare the results obtained with those achieved for similar present-day observations taken with the Meudon spectroheliograph and with the Rome-PSPT. We also investigate whether image-segmentation techniques, such as those developed for identification of plage regions on present-day Ca II K observations, can be used to process historic series. We show that historic data suffer from stronger geometrical distortions and photometric uncertainties than similar present-day observations. The latter uncertainties mostly originate from the photographic calibration of the original data and from stray-light effects. We also show that the image contents of the three analyzed series vary in time. These variations are probably due to instrument changes and aging of the spectrographs used, as well as changes of the observing programs. The segmentation technique tested in this study gives reasonably consistent results for the three analyzed series after application of a simple photographic calibration. Although the plage areas measured from the three analyzed series differ somewhat, the difference to previously published results is larger.

  1. Recovering the line-of-sight magnetic field in the chromosphere from Ca II IR spectra

    Science.gov (United States)

    Wöger, F.; Wedemeyer-Böhm, S.; Uitenbroek, H.; Rimmele, T.

    We propose a method to derive the line-of-sight magnetic flux density from measurements in the chromospheric Ca II IR line at 854.2 nm. The method combines two well-understood techniques, the center-of-gravity and bisector method, in a single hybrid technique. The technique is tested with magneto-static simulations of a flux tube. We apply the method to observations with the Interferometric Bidimensional Spectrometer (IBIS) installed at the Dunn Solar Telescope of the NSO/SP to investigate the morphology of the lower chromosphere, with focus on the chromospheric counterparts to the underlying photospheric magnetic flux elements.

  2. Rat vas deferens SERCA2 is modulated by Ca{sup 2+}/calmodulin protein kinase II-mediated phosphorylation

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, J.B.R.; Muzi-Filho, H. [Programa de Farmacologia e Inflamação, Instituto de Ciências Biomédicas, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil); Valverde, R.H.F. [Instituto de Biofísica Carlos Chagas Filho, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil); Quintas, L.E.M. [Programa de Farmacologia e Inflamação, Instituto de Ciências Biomédicas, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil); Noel, F. [Programa de Desenvolvimento de Fármacos, Instituto de Ciências Biomédicas, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil); Einicker-Lamas, M. [Instituto de Biofísica Carlos Chagas Filho, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil); Instituto Nacional de Ciência e Tecnologia em Biologia Estrutural e Bioimagem, Rio de Janeiro, RJ (Brazil); Cunha, V.M.N. [Programa de Farmacologia e Inflamação, Instituto de Ciências Biomédicas, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil)

    2013-03-19

    Ca{sup 2+} pumps are important players in smooth muscle contraction. Nevertheless, little information is available about these pumps in the vas deferens. We have determined which subtype of sarco(endo)plasmic reticulum Ca{sup 2+}-ATPase isoform (SERCA) is expressed in rat vas deferens (RVD) and its modulation by calmodulin (CaM)-dependent mechanisms. The thapsigargin-sensitive Ca{sup 2+}-ATPase from a membrane fraction containing the highest SERCA levels in the RVD homogenate has the same molecular mass (∼115 kDa) as that of SERCA2 from the rat cerebellum. It has a very high affinity for Ca{sup 2+} (Ca{sub 0.5} = 780 nM) and a low sensitivity to vanadate (IC{sub 50} = 41 µM). These facts indicate that SERCA2 is present in the RVD. Immunoblotting for CaM and Ca{sup 2+}/calmodulin-dependent protein kinase II (CaMKII) showed the expression of these two regulatory proteins. Ca{sup 2+} and CaM increased serine-phosphorylated residues of the 115-kDa protein, indicating the involvement of CaMKII in the regulatory phosphorylation of SERCA2. Phosphorylation is accompanied by an 8-fold increase of thapsigargin-sensitive Ca{sup 2+} accumulation in the lumen of vesicles derived from these membranes. These data establish that SERCA2 in the RVD is modulated by Ca{sup 2+} and CaM, possibly via CaMKII, in a process that results in stimulation of Ca{sup 2+} pumping activity.

  3. Regulation of Ca2+/Calmodulin-Dependent Protein Kinase II Signaling within Hippocampal Glutamatergic Postsynapses during Flurazepam Withdrawal

    Directory of Open Access Journals (Sweden)

    Damien E. Earl

    2012-01-01

    Full Text Available Cessation of one-week oral administration of the benzodiazepine flurazepam (FZP to rats results in withdrawal anxiety after 1 day of withdrawal. FZP withdrawal is correlated with synaptic incorporation of homomeric GluA1-containing α-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptors (AMPARs in the proximal stratum radiatum of CA1 neurons. After 2 days of withdrawal, Ca2+/calmodulin-dependent protein kinase II (CaMKII phosphorylates GluA1 subunits at Ser831, increasing channel conductance. Secondary to AMPAR potentiation, GluN2B-containing N-methyl-D-aspartate receptors (NMDARs, known binding partners of CaMKII, are selectively removed from the postsynaptic density (PSD. While activation of synaptic CaMKII is known to involve translocation to the PSD, CaMKII bound to NMDARs may be removed from the PSD. To distinguish these possibilities, the current studies used postembedding immunogold electron microscopy to investigate alterations in CaMKII signaling at CA1 stratum radiatum synapses after 2 days of FZP withdrawal. These studies revealed decreased total, but not autophosphorylated (Thr286 CaMKIIα expression in CA1 PSDs. The removal of CaMKII-GluN2B complexes from the PSD during drug withdrawal may serve as a homeostatic mechanism to limit AMPAR-mediated CA1 neuron hyperexcitability and benzodiazepine withdrawal anxiety.

  4. Investigation in vitro Effects of Rivastigmine and Galantamine Used to Treatment of Alzheimer's Disease on CA Isozymes I and II

    OpenAIRE

    DİLEK, Esra; ÇANKAYA, Murat; EZMECİ, Talat; SUNAR, Mukadder; ÇOBAN, T. Abdulkadir

    2017-01-01

    The carbonicanhydrases (CA, EC. 4.2.1.1) are an expanding family of zinc-containing enzymescatalyzing the reversible hydration of CO2 in a two-step reaction toyield HCO3-and H+. These enzymes playimportant roles in several physiological/pathological processes. The aim ofthis study is to evaluate in vitrothe effects of these drug active substances which use which use for treatmentof Alzheimer disease on CA I and II isoenzyme. CA I and II isoenzymes fromhuman blood have been purified using Seph...

  5. [Intervention of Qi-activating and Spleen-strengthening Herbs on Ca2+/CaMK II Signaling Pathways Key Factors in Skeletal Muscle Tissue of Rats with Spleen-qi Deficiency].

    Science.gov (United States)

    Duan, Yong-qiang; Cheng, Ying-xia; Liang, Yu-jie; Cheng, Wei-dong; Du, Juan; Yang, Xiao-yi; Wang, Yan

    2015-03-01

    To observe changes of [Ca2+]i concentration and CaM, CaMK II and p-CaMK II of Ca2+/CaMK II signaling pathways in skeletal muscle tissue of rats with spleen-qi deficiency and intervention of Sijunzi decoction and extract of Hedysarum polybotrys. Rats were randomized into four groups: normal control group, spleen-qi deficient model group, extract from Hedysarum polybotrys group and Sijunzi decoction group, ten rats in each group. After the spleen-qi deficient models were built by comprehensive application of rhubarb, exhaustive and hungry methods, and treatment groups were treated with extract from Hedysarum polybotrys at 6 g/(kg . d) or Sijunzi decoction at 20 g/(kg . d) for 21 d. Then, general existence,gastrointestinal hormones GAS and MOT levels, and activities of Na+-K+-ATPase and Ca2+-Mg2+-ATPase of skeletal muscle were evaluated. Also, confocal laser technology was used to test cellular[Ca2+]i concentrations in skeletal muscle and Western blotting technique was used to test CaM, CaMK II and p-CaMK 11 expression in intestinal tissue of spleen-qi deficient model rats. Compared with normal group, general condition was poor, levels of GAS and MOT decreased (P CaMK II and p-CaMK II in skeletal muscle decreased significantly (P CaMK II in skeletal muscle tissue increased (P CaMK II in skeletal muscle tissue increased in the rats of Sijunzi decoction group (P < 0. 05). Sijunzi decoction and extract of Hedysarum polybotrys can be applied to treat spleen-qi deficiency syndrome through the mechanism of regulating GAS and MOT secretion and raising expression of Ca2+ /CaM signaling pathways key factors in skeletal muscle tissue. Sijunzi decoction has the better effect

  6. Mechanochemical synthesis and intercalation of Ca(II)Fe(III)-layered double hydroxides

    Energy Technology Data Exchange (ETDEWEB)

    Ferencz, Zs.; Szabados, M.; Varga, G.; Csendes, Z. [Department of Organic Chemistry, University of Szeged, Dóm tér 8, Szeged H-6720 (Hungary); Materials and Solution Structure Research Group, Institute of Chemistry, University of Szeged, Aradi Vértanúk tere 1, Szeged H-6720 (Hungary); Kukovecz, Á. [Department of Applied and Environmental Chemistry, University of Szeged, Rerrich Béla tér 1, Szeged H-6720 (Hungary); MTA-SZTE “Lendület” Porous Nanocomposites Research Group, Rerrich Béla tér 1, Szeged H-6720 (Hungary); Kónya, Z. [Department of Applied and Environmental Chemistry, University of Szeged, Rerrich Béla tér 1, Szeged H-6720 (Hungary); MTA-SZTE Reaction Kinetics and Surface Chemistry Research Group, Rerrich Béla tér 1, Szeged H-6720 (Hungary); Carlson, S. [MAX IV Laboratory, Ole Römers väg 1, Lund SE-223 63 (Sweden); Sipos, P. [Materials and Solution Structure Research Group, Institute of Chemistry, University of Szeged, Aradi Vértanúk tere 1, Szeged H-6720 (Hungary); Department of Inorganic and Analytical Chemistry, University of Szeged, Dóm tér 7, Szeged H-6720 (Hungary); and others

    2016-01-15

    A mechanochemical method (grinding the components without added water – dry grinding, followed by further grinding in the presence of minute amount of water or NaOH solution – wet grinding) was used in this work for the preparation and intercalation of CaFe-layered double hydroxides (LDHs). Both the pristine LDHs and the amino acid anion (cystinate and tyrosinate) intercalated varieties were prepared by the two-step grinding procedure in a mixer mill. By systematically changing the conditions of the preparation method, a set of parameters could be determined, which led to the formation of close to phase-pure LDH. The optimisation procedure was also applied for the intercalation processes of the amino acid anions. The resulting materials were structurally characterised by a range of methods (X-ray diffractometry, scanning electron microscopy, energy dispersive analysis, thermogravimetry, X-ray absorption and infra-red spectroscopies). It was proven that this simple mechanochemical procedure was able to produce complex organic–inorganic nanocomposites: LDHs intercalated with amino acid anions. - Graphical abstract: Amino acid anion-Ca(II)Fe(III)-LDHs were successfully prepared by a two-step milling procedure. - Highlights: • Synthesis of pristine and amino acid intercalated CaFe-LDHs by two-step milling. • Identifying the optimum synthesis and intercalation parameters. • Characterisation of the samples with a range of instrumental methods.

  7. [Effect of iodine deficiency and hypothyroidism on the protein expressions of CaMK II in the hippocampus of pups].

    Science.gov (United States)

    Wei, Wei; Dong, Jing; Liu, Wanyang; Wang, Yi; Chen, Jie

    2010-03-01

    To observe the effect of iodine deficiency and hypothyroidism on the protein expressions of CaMK II in the hippocampus of pups. Female Wistar rats (n=28) after pregnancy were randomly divided into control group, hypothyroid group and iodine deficient group. According to the dose of PTU in fed water, hypothyroid group was divided into 5 mg/L group and 15 mg/L group (7 in each). 5 pups from each group were sacrificed and perfused intracardially in PN7, PN14 and PN21. Brains were removed, fixed and sectioned coronally. All sections were observed and analyzed the protein exression of CaMK II by immunohistochemistry in the hippocampus CA1, CA3 and DG regions. Control group in CA1, CA3 and DG regions of the hippocampus had strong positive staining and the cytoplasm of neurons were filled with CaMK II. The distribution of the immune reaction product in hippocampus of 5 mg/L, 15 mg/L and iodine groups were in line with the control group, but the staining intensity as compared with the control group gradually decreased. In PN21 and PN14, integrated optical density average of CaMK II in CA1, CA3 and DG regions of the hippocampus in iodine deficient group [PN21: (26.05 +/- 4.98), (30.79 +/- 3.22), (26.40 +/- 2.63); PN14:(25.48 +/- 4.87), (44.17 +/- 5.91), (26.41 +/- 3.01)] and 15 mg/L groups [PN21: (17.02 +/- 2.68), (24.57 +/- 6.62), (20.18 +/- 4.05); PN14:(20.66 +/- 3.51), (34.94 +/- 5.09), (27.32 +/- 4.97)] were significantly lower than those of controls [PN21: (57.75 +/- 13.22), (65.03 +/- 6.20), (49.39 +/- 8.41), P CaMK II in CA1 region of the hippocampus in iodine deficient group (25.74 +/- 3.33) and 15 mg/L groups (26.89 +/- 5.25) were significantly lower than those of controls(40.53 +/- 3.65), P CaMK II.

  8. A novel fluorescent nano-scale sensor for detection of trace amounts of Ca (II) ions

    Energy Technology Data Exchange (ETDEWEB)

    Kacmaz, Sibel [Department of Food Engineering, Faculty of Engineering, University of Giresun, Güre, 28200 Giresun (Turkey); Ertekin, Kadriye, E-mail: kadriye.ertekin@deu.edu.tr [Department of Chemistry, Faculty of Science, Dokuz Eylul University, Kaynaklar Campus, 35160 Buca-Izmir (Turkey); Oter, Ozlem [Department of Chemistry, Faculty of Science, Dokuz Eylul University, Kaynaklar Campus, 35160 Buca-Izmir (Turkey); Mercan, Deniz; Cetinkaya, Engin [Department of Chemistry, Faculty of Science, University of Ege, Bornova, Izmir (Turkey); Celik, Erdal [University of Dokuz Eylul, Faculty Engineering, Department of Metallurgical and Materials Engineering, 35160, Izmir (Turkey); Center for Fabrication and Application of Electronic Materials (EMUM), University of Dokuz Eylul, 35160 Buca, Izmir (Turkey)

    2014-03-15

    A photo-induced electron transfer (PET) based sensing approach for the direct determination of trace amounts of calcium ions is presented. The Ca{sup 2+} selective fluoroionophore Bis, 2,2'-{1,2 phenylenebis [nitrilomethylylidene]} diphenol (DMK) was encapsulated in polymeric ethyl cellulose. The sensing membranes were fabricated in form of nanofibers, exploiting the prepared polymer. When embedded in nanomaterials, the DMK dye yielded strong absorbance, large Stoke's shift, high fluorescence quantum yield, and excellent short and long-term photostability. The sensing ability of the nanofibers was tested by steady state and time resolved fluorescence spectroscopy. To our knowledge, this is the first attempt using the DMK-doped electrospun nanofibrous materials for calcium sensing. The offered nanosensor displays a sensitive response with a detection limit of 0.016 nM for Ca{sup 2+} ions over a wide concentration range, 1.0×10{sup −10}–1.0×10{sup −4} M, and exhibits high selectivity over Mg {sup 2+} and other cations. Accuracy of the sensing system was proven by recovery tests. -- Highlights: • The DMK dye was used for the first time as a fluoroionophore in the sensing of calcium. • Nano-scale materials were utilized as sensor matrix materials. • We offered a very sensitive and selective fluorescent probe for Ca (II) ions. • The offered design exhibits a LOD value of 1.60×10{sup −11} M Ca{sup 2+}. • The nanofibers can be used at pH 4.0 in the concentration range of 10{sup –10}–10{sup –4} M.

  9. Perinatal death of triplet pregnancies by chorionicity.

    Science.gov (United States)

    Kawaguchi, Haruna; Ishii, Keisuke; Yamamoto, Ryo; Hayashi, Shusaku; Mitsuda, Nobuaki

    2013-07-01

    The purpose of this study was to evaluate the perinatal risk of death by chorionicity at >22 weeks of gestation of triplet pregnancies. In a retrospective cohort study, the perinatal data were collected from triplet pregnancies in Japanese perinatal care centers between 1999 and 2009. We included maternal characteristics and examined the following factors: prenatal interventions, pregnancy outcome, and neonatal outcome. The association between fetal or neonatal death of triplets and chorionicity was evaluated by logistic regression analysis. After the exclusion of 253 cases, the study group comprised 701 cases: 507 trichorionic triamniotic (TT) triplet pregnancies, 144 diamniotic triamniotic (DT) triplet pregnancies, and 50 monochorionic triamniotic (MT) triplet pregnancies. The mortality rate (fetal death at >22 weeks of gestation; neonatal death) in triplets was 2.6% and included 2.1% of TT triplet pregnancies, 3.2% of DT triplet pregnancies, and 5.3% of MT triplet pregnancies. No significant risk of death was identified in DT triplet pregnancies; however, MT triplet pregnancies had a 2.6-fold greater risk (adjusted odds ratio, 2.60; 95% confidence interval, 1.17-5.76; P = .019) compared with TT triplet pregnancies. Prophylactic cervical cerclage did not reduce the perinatal mortality rate at >22 weeks of gestation in triplets. The risk of death for MT triplet pregnancies is significantly higher than that of TT triplet pregnancies; however, the risk of death for DT triplet pregnancies is not. Copyright © 2013 Mosby, Inc. All rights reserved.

  10. Removal of Ca(II) and Mg(II) from potassium chromate solution on Amberlite IRC 748 synthetic resin by ion exchange

    Energy Technology Data Exchange (ETDEWEB)

    Yu Zhihui [Key Laboratory of Green Process and Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Graduate University of Chinese Academy of Sciences, Beijing 100049 (China); Qi Tao, E-mail: tqgreen@home.ipe.ac.cn [Key Laboratory of Green Process and Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Qu Jingkui; Wang Lina; Chu Jinglong [Key Laboratory of Green Process and Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing 100190 (China)

    2009-08-15

    Experimental measurements have been made on the batch ion exchange of Ca(II) and Mg(II) from potassium chromate solution using cation exchanger of Amberlite IRC 748 as K{sup +} form. The ion exchange behavior of two alkaline-earth metals on the resin, depending on contact time, pH, temperature and resin dosage was studied. The adsorption isotherms were described by means of the Langmuir and Freundlich isotherms. For Ca(II) ion, the Langmuir model represented the adsorption process better than the Freundlich model. The maximum ion exchange capacity was found to be 47.21 mg g{sup -1} for Ca(II) and 27.70 mg g{sup -1} for Mg(II). The kinetic data were tested using Lagergren-first-order and pseudo-second-order kinetic models. Kinetic data correlated well with the pseudo-second-order kinetic model, indicating that the chemical adsorption was the rate-limiting step. Various thermodynamic parameters such as Gibbs free energy ({Delta}G{sup o}), enthalpy ({Delta}H{sup o}) and entropy ({Delta}S{sup o}) were also calculated. These parameters showed that the ion exchange of Ca(II) and Mg(II) from potassium chromate solution was feasible, spontaneous and endothermic process in nature. The activation energy of ion-exchange (E{sub a}) was determined as 12.34 kJ mol{sup -1} for Ca(II) and 9.865 kJ mol{sup -1} for Mg(II) according to the Arrhenius equation.

  11. Calcium EXAFS establishes the Mn-Ca cluster in the oxygen-evolving complex of Photosystem II

    Energy Technology Data Exchange (ETDEWEB)

    Cinco, Roehl M.; McFarlane Holman, Karen L.; Robblee, John H.; Yano, Junko; Pizarro, Shelly A.; Bellacchio, Emanuele; Sauer, Kenneth; Yachandra, Vittal K.

    2002-08-02

    The proximity of Ca to the Mn cluster of the photosynthetic water-oxidation complex is demonstrated by X-ray absorption spectroscopy. We have collected EXAFS data at the Ca K-edge using active PS II membrane samples that contain approximately 2 Ca per 4 Mn. These samples are much less perturbed than previously investigated Sr-substituted samples, which were prepared subsequent to Ca depletion. The new Ca EXAFS clearly shows backscattering from Mn at 3.4 angstroms, a distance that agrees with that surmised from previously recorded Mn EXAFS. This result is also consistent with earlier related experiments at the Sr K-edge, using samples that contained functional Sr, that show Mn is {approx}; 3.5 angstroms distant from Sr. The totality of the evidence clearly advances the notion that the catalytic center of oxygen evolution is a Mn-Ca heteronuclear cluster.

  12. Cadmium affects focal adhesion kinase (FAK) in mesangial cells: involvement of CaMK-II and the actin cytoskeleton.

    Science.gov (United States)

    Choong, Grace; Liu, Ying; Templeton, Douglas M

    2013-08-01

    The toxic metal ion cadmium (Cd(2+)) induces pleiotropic effects on cell death and survival, in part through effects on cell signaling mechanisms and cytoskeletal dynamics. Linking these phenomena appears to be calmodulin-dependent activation of the Ca(2+)/calmodulin-dependent protein kinase II (CaMK-II). Here we show that interference with the dynamics of the filamentous actin cytoskeleton, either by stabilization or destabilization, results in disruption of focal adhesions at the ends of organized actin structures, and in particular the loss of vinculin and focal adhesion kinase (FAK) from the contacts is a result. Low-level exposure of renal mesangial cells to CdCl2 disrupts the actin cytoskeleton and recapitulates the effects of manipulation of cytoskeletal dynamics with biological agents. Specifically, Cd(2+) treatment causes loss of vinculin and FAK from focal contacts, concomitant with cytoskeletal disruption, and preservation of cytoskeletal integrity with either a calmodulin antagonist or a CaMK-II inhibitor abrogates these effects of Cd(2+). Notably, inhibition of CaMK-II decreases the migration of FAK-phosphoTyr925 to a membrane-associated compartment where it is otherwise sequestered from focal adhesions in a Cd(2+)-dependent manner. These results add further insight into the mechanism of the CaMK-II-dependent effects of Cd(2+) on cellular function. Copyright © 2013 Wiley Periodicals, Inc.

  13. Proton Matrix ENDOR Studies on Ca2+-depleted and Sr2+-substituted Manganese Cluster in Photosystem II.

    Science.gov (United States)

    Nagashima, Hiroki; Nakajima, Yoshiki; Shen, Jian-Ren; Mino, Hiroyuki

    2015-11-20

    Proton matrix ENDOR spectra were measured for Ca(2+)-depleted and Sr(2+)-substituted photosystem II (PSII) membrane samples from spinach and core complexes from Thermosynechococcus vulcanus in the S2 state. The ENDOR spectra obtained were similar for untreated PSII from T. vulcanus and spinach, as well as for Ca(2+)-containing and Sr(2+)-substituted PSII, indicating that the proton arrangements around the manganese cluster in cyanobacterial and higher plant PSII and Ca(2+)-containing and Sr(2+)-substituted PSII are similar in the S2 state, in agreement with the similarity of the crystal structure of both Ca(2+)-containing and Sr(2+)-substituted PSII in the S1 state. Nevertheless, slightly different hyperfine separations were found between Ca(2+)-containing and Sr(2+)-substituted PSII because of modifications of the water protons ligating to the Sr(2+) ion. Importantly, Ca(2+) depletion caused the loss of ENDOR signals with a 1.36-MHz separation because of the loss of the water proton W4 connecting Ca(2+) and YZ directly. With respect to the crystal structure and the functions of Ca(2+) in oxygen evolution, it was concluded that the roles of Ca(2+) and Sr(2+) involve the maintenance of the hydrogen bond network near the Ca(2+) site and electron transfer pathway to the manganese cluster. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  14. Proton Matrix ENDOR Studies on Ca2+-depleted and Sr2+-substituted Manganese Cluster in Photosystem II*

    Science.gov (United States)

    Nagashima, Hiroki; Nakajima, Yoshiki; Shen, Jian-Ren; Mino, Hiroyuki

    2015-01-01

    Proton matrix ENDOR spectra were measured for Ca2+-depleted and Sr2+-substituted photosystem II (PSII) membrane samples from spinach and core complexes from Thermosynechococcus vulcanus in the S2 state. The ENDOR spectra obtained were similar for untreated PSII from T. vulcanus and spinach, as well as for Ca2+-containing and Sr2+-substituted PSII, indicating that the proton arrangements around the manganese cluster in cyanobacterial and higher plant PSII and Ca2+-containing and Sr2+-substituted PSII are similar in the S2 state, in agreement with the similarity of the crystal structure of both Ca2+-containing and Sr2+-substituted PSII in the S1 state. Nevertheless, slightly different hyperfine separations were found between Ca2+-containing and Sr2+-substituted PSII because of modifications of the water protons ligating to the Sr2+ ion. Importantly, Ca2+ depletion caused the loss of ENDOR signals with a 1.36-MHz separation because of the loss of the water proton W4 connecting Ca2+ and YZ directly. With respect to the crystal structure and the functions of Ca2+ in oxygen evolution, it was concluded that the roles of Ca2+ and Sr2+ involve the maintenance of the hydrogen bond network near the Ca2+ site and electron transfer pathway to the manganese cluster. PMID:26438823

  15. Mixed ligand complexes of alkaline earth metals: Part XII. Mg(II, Ca(II, Sr(II and Ba(II complexes with 5-chlorosalicylaldehyde and salicylaldehyde or hydroxyaromatic ketones

    Directory of Open Access Journals (Sweden)

    MITHLESH AGRAWAL

    2002-04-01

    Full Text Available The reactions of alkaline earth metal chlorides with 5-chlorosalicylaldehyde and salicylaldehyde, 2-hydroxyacetophenone or 2-hydroxypropiophenone have been carried out in 1 : 1 : 1 mole ratio and the mixed ligand complexes of the type MLL’(H2O2 (where M = Mg(II, Ca(II, Sr(II and Ba(II, HL = 5-chlorosalicylaldehyde and HL’ = salicylaldehyde, 2-hydroxyacetophenone or 2-hydroxypropiophenone have been isolated. These complexes were characterized by TLC, conductance measurements, IR and 1H-NMR spectra.

  16. Ca II H and K measurements made at Mount Wilson Observatory, 1966-1983

    Science.gov (United States)

    Duncan, Douglas K.; Wilson, Olin C.; Preston, George W.; Frazer, James; Vaughan, Arthur H.

    1991-01-01

    Summaries are presented of the photoelectric measurements of stellar Ca II H and K line intensity made at Mount Wilson Observatory during the years 1966-1983. These results are derived from 65,263 individual observations of 1296 stars. For each star, for each observing season, the maximum, minimum, mean, and variation of the instrumental H and K index 'S' are given, as well as a measurement of the accuracy of observation. A total of 3110 seasonal summaries are reported. Factors which affect the ability to detect stellar activity variations and accurately measure their amplitudes, such as the accuracy of the H and K measurements and scattered light contamination, are discussed. Relations are given which facilitate intercomparison of 'S' values with residual intensities derived from ordinary spectrophotometry, and for converting measurements to absolute fluxes.

  17. Transverse Oscillations in Slender Ca ii H Fibrils Observed with Sunrise/SuFI

    Energy Technology Data Exchange (ETDEWEB)

    Jafarzadeh, S. [Institute of Theoretical Astrophysics, University of Oslo, P.O. Box 1029 Blindern, NO-0315 Oslo (Norway); Solanki, S. K.; Gafeira, R.; Noort, M. van; Barthol, P.; Gandorfer, A.; Gizon, L.; Hirzberger, J.; Riethmüller, T. L. [Max Planck Institute for Solar System Research, Justus-von-Liebig-Weg 3, D-37077 Göttingen (Germany); Rodríguez, J. Blanco [Grupo de Astronomía y Ciencias del Espacio, Universidad de Valencia, E-46980 Paterna, Valencia (Spain); Iniesta, J. C. del Toro; Suárez, D. Orozco [Instituto de Astrofísica de Andalucía (CSIC), Apartado de Correos 3004, E-18080 Granada (Spain); Knölker, M. [High Altitude Observatory, National Center for Atmospheric Research, P.O. Box 3000, Boulder, CO 80307-3000 (United States); Schmidt, W., E-mail: shahin.jafarzadeh@astro.uio.no [Kiepenheuer-Institut für Sonnenphysik, Schöneckstr. 6, D-79104 Freiburg (Germany)

    2017-03-01

    We present observations of transverse oscillations in slender Ca ii H fibrils (SCFs) in the lower solar chromosphere. We use a 1 hr long time series of high- (spatial and temporal-) resolution seeing-free observations in a 1.1 Å wide passband covering the line core of Ca ii H 3969 Å from the second flight of the Sunrise balloon-borne solar observatory. The entire field of view, spanning the polarity inversion line of an active region close to the solar disk center, is covered with bright, thin, and very dynamic fine structures. Our analysis reveals the prevalence of transverse waves in SCFs with median amplitudes and periods on the order of 2.4 ± 0.8 km s{sup −1} and 83 ± 29 s, respectively (with standard deviations given as uncertainties). We find that the transverse waves often propagate along (parts of) the SCFs with median phase speeds of 9 ± 14 km s{sup −1}. While the propagation is only in one direction along the axis in some of the SCFs, propagating waves in both directions, as well as standing waves are also observed. The transverse oscillations are likely Alfvénic and are thought to be representative of magnetohydrodynamic kink waves. The wave propagation suggests that the rapid high-frequency transverse waves, often produced in the lower photosphere, can penetrate into the chromosphere with an estimated energy flux of ≈15 kW m{sup −2}. Characteristics of these waves differ from those reported for other fibrillar structures, which, however, were observed mainly in the upper solar chromosphere.

  18. THE HANLE AND ZEEMAN POLARIZATION SIGNALS OF THE SOLAR Ca II 8542 Å LINE

    Energy Technology Data Exchange (ETDEWEB)

    Štěpán, Jiri [Astronomical Institute ASCR, Fričova 298, 251 65 Ondřejov (Czech Republic); Bueno, Javier Trujillo [Instituto de Astrofísica de Canarias, E-38205 La Laguna, Tenerife (Spain)

    2016-07-20

    We highlight the main results of a three-dimensional (3D) multilevel radiative transfer investigation about the solar disk-center polarization of the Ca ii 8542 Å line. First, through the use of a 3D model of the solar atmosphere, we investigate the linear polarization that occurs due to the atomic level polarization produced by the absorption and scattering of anisotropic radiation, taking into account the symmetry-breaking effects caused by its thermal, dynamic, and magnetic structure. Second, we study the contribution of the Zeeman effect to the linear and circular polarization. Finally, we show examples of the Stokes profiles produced by the joint action of the atomic level polarization and the Hanle and Zeeman effects. We find that the Zeeman effect tends to dominate the linear polarization signals only in the localized patches of opposite magnetic polarity, where the magnetic field is relatively strong and slightly inclined; outside such very localized patches, the linear polarization is often dominated by the contribution of atomic level polarization. We demonstrate that a correct modeling of this last contribution requires taking into account the symmetry-breaking effects caused by the thermal, dynamic, and magnetic structure of the solar atmosphere, and that in the 3D model used the Hanle effect in forward-scattering geometry (disk-center observation) mainly reduces the polarization corresponding to the zero-field case. We emphasize that, in general, a reliable modeling of the linear polarization in the Ca ii 8542 Å line requires taking into account the joint action of atomic level polarization and the Hanle and Zeeman effects.

  19. SYNTHESIS, CHARACTERIZATION AND ANTITUMOR ACTIVITY OF A Ca (II COORDINATION POLYMER BASED ON 3-AMINO-2-PYRAZINECARBOXYLIC ACID

    Directory of Open Access Journals (Sweden)

    XI-SHI TAI

    2015-10-01

    Full Text Available A new Ca(II coordination polymer has been obtained by reaction of Ca(ClO42·H2O with 3-amino-2-pyrazinecarboxylic acid in CH3CH2OH/H2O. It was characterized by IR, 1HNMR, thermal analysis and X-ray single crystal diffraction analysis. X-ray analysis reveals that each Ca(II center is seven-coordination with a N2O5 distorted pentagonal bipyramidal coordination environment. The Ca(II ions are linked through the O atoms of 3-amino-2-pyrazinecarboxylic acid ligands to form 1D chain structure. And then a 3D network structure is constructed by hydrogen bonds and π-π stacking. The antitumor activity of 3-amino-2-pyrazinecarboxylic acid ligand and its Ca(II coordination polymer against human intestinal adenocarcinoma HCT-8 cells, lung adenocarcinoma HCT-116 cells and human lung adenocarcinoma A549 cells line have been investigated.

  20. Spectroscopic characterization of the competitive binding of Eu(III), Ca(II), and Cu(II) to a sedimentary originated humic acid

    Energy Technology Data Exchange (ETDEWEB)

    Marang, L.; Reiller, P.E. [CEA Saclay, Nucl Energy Div, DPC SECR, Lab Speciat Radionucleides and Mol, 91 - Gif sur Yvette (France); Marang, L.; Benedetti, M.F. [Univ Paris 07, Lab Geochim Eaux, IPGP UMR CNRS 7154, F-75205 Paris 13 (France); Eidner, S.; Kumke, M.U. [Univ Potsdam, Inst Chem, D-14476 Potsdam (Germany)

    2009-06-15

    The competition between REE, alkaline earth and d-transition metals for organic matter binding sites is still an open field of research; particularly, the mechanisms governing these phenomena need to be characterized in more detail. In this study, we examine spectroscopically the mechanisms of competitive binding of Eu(III)/Cu(II) and Eu(III)/Ca(II) pair to Gorleben humic acid (HA), as previously proposed in the framework of the NICA-Donnan model. The evolution of time-resolved laser induced luminescence spectra of humic-complexed Eu(Ill) showed two strikingly different environments for a comparable bound proportion for Cu(II) and Ca(II). Cu(II) seems to compete more effectively with Eu(III) inducing its release into the Donnan phase, and into the bulk solution as free Eu{sup 3+}. This is evidenced both by the shapes of the spectra and by the decrease in the luminescence decay times. In contrast with that, Ca(II) induces a modification of the HA structure, which enhances the luminescence of humic-bound Eu(III), and causes a minor modification of the chemical environment of the complexed rare earth ion. (authors)

  1. Gonadotropin-releasing hormone stimulation of gonadotropin subunit transcription: evidence for the involvement of calcium/calmodulin-dependent kinase II (Ca/CAMK II) activation in rat pituitaries.

    Science.gov (United States)

    Haisenleder, D J; Burger, L L; Aylor, K W; Dalkin, A C; Marshall, J C

    2003-07-01

    The intracellular pathways mediating GnRH regulation of gonadotropin subunit transcription remain to be fully characterized, and the present study examined whether calcium/calmodulin-dependent kinase II (Ca/CAMK II) plays a role in the rat pituitary. Preliminary studies demonstrated that a single pulse of GnRH given to adult rats stimulated a transient 2.5-fold rise in Ca/CAMK II activity (as determined by an increase in Ca/CAMK II phosphorylation), with peak values at 5 min, returning to basal 45 min after the pulse. Further studies examined the alpha, LHbeta, and FSHbeta transcriptional responses to GnRH or Bay K 8644+KCl (BK+KCl) pulses in vitro in the absence or presence of the Ca/CAMK II-specific inhibitor, KN-93. Gonadotropin subunit transcription was assessed by measuring primary transcripts (PTs) by quantitative RT-PCR. In time-course studies, both GnRH and BK+KCl pulses given alone increased all three subunit PTs after 6 h (2- to 4-fold). PT responses to GnRH increased over time (3- to 8-fold over basal at 24 h), although BK+KCl was ineffective after 24 h. KN-93 reduced the LHbeta and FSHbeta transcriptional responses to GnRH by 50-60% and completely suppressed the alphaPT response. In contrast, KN-93 showed no inhibitory effects on basal transcriptional activity or LH or FSH secretion. In fact, KN-93 tended to increase basal alpha, LHbeta, and FSHbeta PT levels and enhance LH secretory responses to GnRH. These results reveal that Ca/CAMK II plays a central role in the transmission of pulsatile GnRH signals from the plasma membrane to the rat alpha, LHbeta, and FSHbeta subunit genes.

  2. Mixed Inert scalar triplet dark matter, radiative neutrino masses and leptogenesis

    Directory of Open Access Journals (Sweden)

    Wen-Bin Lu

    2017-11-01

    Full Text Available The neutral component of an inert scalar multiplet with hypercharge can provide a stable dark matter particle when its real and imaginary parts have a splitting mass spectrum. Otherwise, a tree-level dark-matter-nucleon scattering mediated by the Z boson will be much above the experimental limit. In this paper we focus on a mixed inert scalar triplet dark matter scenario where a complex scalar triplet with hypercharge can mix with another real scalar triplet without hypercharge through their renormalizable coupling to the standard model Higgs doublet. We consider three specified cases that carry most of the relevant features of the full parameter space: (i the neutral component of the real triplet dominates the dark matter particle, (ii the neutral component of the complex triplet dominates the dark matter particle; and (iii the neutral components of the real and complex triplets equally constitute the dark matter particle. Subject to the dark matter relic abundance and direct detection constraint, we perform a systematic study on the allowed parameter space with particular emphasis on the interplay among triplet-doublet terms and gauge interactions. In the presence of these mixed inert scalar triplets, some heavy Dirac fermions composed of inert fermion doublets can be utilized to generate a tiny Majorana neutrino mass term at one-loop level and realize a successful leptogenesis for explaining the cosmic baryon asymmetry.

  3. Kinetic and thermodynamic studies of the Co(II) and Ni(II) ions removal from aqueous solutions by Ca-Mg phosphates.

    Science.gov (United States)

    Ivanets, A I; Srivastava, V; Kitikova, N V; Shashkova, I L; Sillanpää, M

    2017-03-01

    The aim of this work was to study the sorption kinetics and thermodynamics of Co(II) and Ni(II) from aqueous solutions by sorbents on the basis of hydrogen (PD-1) and tertiary (PD-2) Ca-Mg phosphates depending on the solution temperature and sorbents chemical composition. Kinetic studies of adsorption of Co(II) and Ni(II) ions onto samples of phosphate sorbents were performed in batch experiment at the temperatures 288, 303, 318 and 333 K. The sorbent dose was fixed at 10 g L-1, initial pH value 2.6, and contact time varied from 5 to 600 min. The kinetics of Co(II) and Ni(II) adsorption were analyzed by using pseudo-first order, pseudo-second order and intraparticle diffusion models. Thermodynamic parameters (ΔG°, ΔH° and ΔS°) for the sorption of Co(II) and Ni(II) were determined using the Gibbs-Helmholtz equation. The calculated kinetic parameters and corresponding correlation coefficients revealed that Co(II) and Ni(II) uptake process followed the pseudo-second order rate expression. Thermodynamic studies confirmed the spontaneous and endothermic nature of removal process which indicate that sorption of Co(II) and Ni(II) ions onto both phosphate sorbents is favoured at higher temperatures and has the chemisorptive mechanism. The data thus obtained would be useful for practical application of the low cost and highly effective Ca-Mg phosphate sorbents. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. Intensity formulas for triplet bands

    Science.gov (United States)

    Budo, A.

    1982-01-01

    Previous work in this area is surveyed and the mathematics involved in determining the quantitative intensity measurements in triplet bands is presented. Explicit expressions for the intensity distribution in the branches of the 3 Sigma-3 Pi and 1 Sigma-3Pi bands valid for all values of the coupling constant Y of the 3 Pi terms are given. The intensity distribution calculated according to the formulas given is compared with measurements of PH, 3 Pi-3 Sigma. Good quantitative agreement is obtained.

  5. Electronic Structure and Oxidation State Changes in the Mn4Ca Cluster of Photosystem II

    Energy Technology Data Exchange (ETDEWEB)

    Yano, Junko; Pushkar, Yulia; Messinger, Johannes; Bergmann, Uwe; Glatzel, Pieter; Yachandra, Vittal K

    2007-08-03

    Oxygen-evolving complex (Mn4Ca cluster) of Photosystem II cycles through five intermediate states (Si-states, i =0-4) before a molecule of dioxygen is released. During the S-state transitions, electrons are extracted from the OEC, either from Mn or alternatively from a Mn ligand. The oxidation state of Mn is widely accepted as Mn4(III2,IV2) and Mn4(III,IV3) for S1 and S2 states, while it is still controversial for the S0 and S3 states. We used resonant inelastic X-ray scattering (RIXS) to study the electronic structure of Mn4Ca complex in the OEC. The RIXS data yield two-dimensional plots that provide a significant advantage by obtaining both K-edge pre-edge and L-edge-like spectra (metal spin state) simultaneously. We have collected data from PSII samples in the each of the S-states and compared them with data from various inorganic Mncomplexes. The spectral changes in the Mn 1s2p3/2 RIXS spectra between the S-states were compared to those of the oxides of Mn and coordination complexes. The results indicate strong covalency for the electronic configuration in the OEC, and we conclude that the electron is transferred from a strongly delocalized orbital, compared to those in Mn oxides or coordination complexes. The magnitude for the S0 to S1, and S1 to S2 transitions is twice as large as that during the S2 to S3 transition, indicating that the electron for this transition is extracted from a highly delocalized orbital with little change in charge density at the Mn atoms.

  6. Electronic Structure and Oxidation State Changes in the Mn (4) Ca Cluster of Photosystem II

    Energy Technology Data Exchange (ETDEWEB)

    Yano, J.; Pushkar, Y.; Messinger, J.; Bergmann, U.; Glatzel, P.; Yachandra, V.K.; /SLAC

    2012-08-17

    Oxygen-evolving complex (Mn{sub 4}Ca cluster) of Photosystem II cycles through five intermediate states (S{sub i}-states, i = 0-4) before a molecule of dioxygen is released. During the S-state transitions, electrons are extracted from the OEC, either from Mn or alternatively from a Mn ligand. The oxidation state of Mn is widely accepted as Mn{sub 4}(III{sub 2},IV{sub 2}) and Mn{sub 4}(III,IV{sub 3}) for S{sub 1} and S{sub 2} states, while it is still controversial for the S{sub 0} and S{sub 3} states. We used resonant inelastic X-ray scattering (RIXS) to study the electronic structure of Mn{sub 4}Ca complex in the OEC. The RIXS data yield two-dimensional plots that provide a significant advantage by obtaining both K-edge pre-edge and L-edge-like spectra (metal spin state) simultaneously. We have collected data from PSII samples in the each of the S-states and compared them with data from various inorganic Mn complexes. The spectral changes in the Mn 1s2p{sub 3/2} RIXS spectra between the S-states were compared to those of the oxides of Mn and coordination complexes. The results indicate strong covalency for the electronic configuration in the OEC, and we conclude that the electron is transferred from a strongly delocalized orbital, compared to those in Mn oxides or coordination complexes. The magnitude for the S{sub 0} to S{sub 1}, and S{sub 1} to S{sub 2} transitions is twice as large as that during the S{sub 2} to S{sub 3} transition, indicating that the electron for this transition is extracted from a highly delocalized orbital with little change in charge density at the Mn atoms.

  7. Synthesis, spectroscopic and thermal studies of Mg(II), Ca(II), Sr(II) and Ba(II) diclofenac sodium complexes as anti-inflammatory drug and their protective effects on renal functions impairment and oxidative stress

    Science.gov (United States)

    El-Megharbel, Samy M.; Hamza, Reham Z.; Refat, Moamen S.

    2015-01-01

    The main task of our present study is the preparation of newly complexes of Mg(II), Ca(II), Sr(II) and Ba(II) with diclofenac which succeeded to great extent in alleviating the side effects of diclofenac alone and ameliorating the kidney function parameters and antioxidant capacities with respect to diclofenac treated group alone. The Mg(II), Ca(II), Sr(II) and Ba(II) with diclofenac have been synthesized and characterized using infrared, electronic and 1H NMR spectral, thermogravimetric and conductivity measurements. The diclofenac ligand has been found to act as bidentate chelating agent. Diclofenac complexes coordinate through the oxygen's of the carboxyl group. The molar ratio chelation is 1:2 (M2+-dic) with general formula [M(dic)2(H2O)2]ṡnH2O. Antibacterial screening of the alkaline earth metal complexes against Escherichia coli (Gram - ve), Bacillus subtilis (Gram + ve) and anti-fungal (Asperagillus oryzae, Asperagillus niger, Asperagillus flavus) were investigated. The kidney functions in male albino rats were ameliorated upon treatment with metal complexes of dic, which are represented by decreasing the levels of urea and uric acid to be located within normal values. The other looks bright spot in this article is the assessment of antioxidant defense system including SOD, CAT and MDA with the help of Sr2+, Mg2+ and Ca2+-dic complexes. The hormones related to kidney functions and stresses have been greatly ameliorated in groups treated with dic complexes in comparable with dic treated group.

  8. Triplet-triplet energy transfer and protection mechanisms against singlet oxygen in photosynthesis

    Science.gov (United States)

    Kihara, Shigeharu

    In photosynthesis, (bacterio)chlorophylls ((B)Chl) play a crucial role in light harvesting and electron transport. (B)Chls, however, are known to be potentially dangerous due to the formation of the triplet excited state which forms the singlet oxygen (1O2*) when exposed to the sunlight. Singlet oxygen is highly reactive and all modern organisms incorporate special protective mechanisms to minimize the oxidative damage. One of the conventional photoprotective mechanisms used by photosynthetic organisms is by the nearby carotenoids quenching the excess energy and releasing it by heat. In this dissertation, two major aspects of this process are studied. First, based on experimental data and model calculations, the oxygen content in a functioning oxygenic photosynthetic oxygen cell was determined. These organisms perform water splitting and as a result significant amount of oxygen can be formed within the organism itself. It was found, that contrary to some published estimates, the excess oxygen concentration generated within an individual cell is extremely low -- 0.025 ... 0.25 microM, i.e. about 103-104 times lower than the oxygen concentration in air saturated water. Such low concentrations imply that the first oxygenic photosynthetic cells that evolved in oxygen-free atmosphere of the Earth ~2.8 billion years ago might have invented the water splitting machinery (photosystem II) without the need for special oxygen-protective mechanisms, and the latter mechanisms could have evolved in the next 500 million years during slow rise of oxygen in the atmosphere. This result also suggests that proteins within photosynthetic membranes are not exposed to significant O2 levels and thus can be studied in vitro under the usual O2 levels. Second, the fate of triplet excited states in the Fenna Matthew Olson (FMO) pigment-protein complex is studied by means of time-resolved nanosecond spectroscopy and exciton model simulations. For the first time, the properties of several

  9. Effect of carticaine on the sarcoplasmic reticulum Ca2+-adenosine triphosphatase. II. Cations dependence.

    Science.gov (United States)

    Takara, Delia; Sánchez, Gabriel A; Toma, Augusto F; Bonazzola, Patricia; Alonso, Guillermo L

    2005-05-01

    Ca2+-ATPase is a major intrinsic protein in the sarcoplasmic reticulum (SR) from skeletal muscles. It actively transports Ca2+ from the cytoplasm to the SR lumen, reducing cytoplasmic [Ca2+] to promote muscle relaxation. Carticaine is a local anesthetic widely used in operative dentistry. We previously showed that carticaine inhibits SR Ca2+-ATPase activity and the coupled Ca(2+) uptake by isolated SR vesicles, and increases the rate of Ca2+ efflux from preloaded vesicles. We also found that these effects were antagonized by divalent cations, and concluded that they were mainly due to the direct interaction of carticaine with the Ca2+-ATPase protein. Here we present additional results on the modulation of the above effects of carticaine by Ca2+ and Mg2+. The activating effect of Ca2+ on the ATPase activity is competitively inhibited by carticaine, indicating a decreased Ca2+ binding to the high affinity Ca2+ transport sites. The activating effect of Mg2+ on the phosphorylation of Ca2+-ATPase by orthophosphate is also inhibited by carticaine. The anesthetic does not affect the reaction mechanism of the cations acting as cofactors of ATP in the catalytic site. On the basis of the present and our previous results, we propose a model that describes the effect of carticaine on the Ca2+-ATPase cycle.

  10. Immunohistochemical study of Ca2+/calmodulin-dependent protein kinase II in the Drosophila brain using a specific monoclonal antibody.

    Science.gov (United States)

    Takamatsu, Yoshiki; Kishimoto, Yasuko; Ohsako, Shunji

    2003-06-06

    To analyze the distribution of Drosophila calcium/calmodulin-dependent protein kinase II (dCaMKII) in the adult brain, we generated monoclonal antibodies against the bacterially expressed 490-amino acid (a.a.) form of dCaMKII. One of those, named #18 antibody, was used for this study. Western blot analysis of the adult head extracts showed that the antibody specifically detects multiple bands between 55 and 60 kDa corresponding to the molecular weights of the splicing isoforms of dCaMKII. Epitope mapping revealed that it was in the region between 199 and 283 a.a. of dCaMKII. Preferential dCaMKII immunoreactivity in the embryonic nervous system, adult thoracic ganglion and gut, and larval neuro-muscular junction (NMJ) was consistent with previous observations by in situ hybridization and immunostaining with a polyclonal antibody at the NMJ, indicating that the antibody is applicable to immunohistochemistry. Although dCaMKII immunoreactive signal was low in the retina, it was found at regular intervals in the outer margin of the compound eye. These signals were most likely to be interommatidial bristle mechanosensory neurons. dCaMKII immunoreactivity in the brain was observed in almost all regions and relatively higher staining was found in the neuropilar region than in the cortex. Higher dCaMKII immunoreactivity in the mushroom body (MB) was found in the entire gamma lobe including the heel, and dorsal tips of the alpha and alpha' lobes, while cores of alpha and beta lobes were stained light. Finding abundant dCaMKII accumulation in the gamma lobe suggested that this lobe might especially require high levels of dCaMKII expression to function properly among MB lobes.

  11. Urotensin II induction of neonatal cardiomyocyte hypertrophy involves the CaMKII/PLN/SERCA 2a signaling pathway.

    Science.gov (United States)

    Shi, Hongtao; Han, Qinghua; Xu, Jianrong; Liu, Wenyuan; Chu, Tingting; Zhao, Li

    2016-05-25

    Although studies have shown that Urotensin II (UII) can induce cardiomyocyte hypertrophy and UII-induced cardiomyocyte hypertrophy model has been widely used for hypertrophy research, but its precise mechanism remains unknown. Recent researches have demonstrated that UII-induced cardiomyocyte hypertrophy has a relationship with the changes of intracellular Ca(2+) concentration. Therefore, the aim of this study was to investigate the mechanisms of cardiomyocyte hypertrophy induced by UII and to explore whether the calcium/calmodulin-dependent protein kinase II (CaMKII)-mediated up-regulating of phospholamban (PLN) Thr17-phosphorylation signaling pathway contributed to UII-induced cardiomyocyte hypertrophy. Primary cultures of neonatal rat cardiomyocytes were stimulated for 48h with UII. Cell size, protein/DNA contents and intracellular Ca(2+) were determined. Phosphorylated and total forms of CaMKII, PLN and the total amount of serco/endo-plasmic reticulum ATPases (SERCA 2a) were quantified by western blot. The responses of cardiomyocytes to UII were also evaluated after pretreatment with the CaMKII inhibitor, KN-93. These results showed that UII increased cell size, protein/DNA ratio and intracellular Ca(2+), consistent with a hypertrophic response. Furthermore, the phosphorylation of CaMKII and its downstream target PLN (Thr17), SERCA 2a levels were up-regulated by UII treatment. Conversely, treatment with KN-93 reversed all those effects of UII. Taken together, the results suggest that UII can induce cardiomyocyte hypertrophy through CaMKII-mediated up-regulating of PLN Thr17-phosphorylation signaling pathway. Copyright © 2016 Elsevier B.V. All rights reserved.

  12. Conjoined twins in a triplet pregnancy

    OpenAIRE

    Ozcan, Huseyin C.; Ugur, Mete G.; Mustafa, Aynur; Kutlar, Irfan

    2017-01-01

    Conjoined twins are derived from division of a single fertilized ovum after the twelfth day of fertilization. Triplet conjoined twin is considered as a unique phenomenon that is accompanied with a wide variety of congenital abnormalities and also hazardous consequences for both fetuses and parents. We present an extremely rare case of conjoined twins in a triplet pregnancy with symmetric thoracoomphalopagus that was diagnosed in prenatal period by using ultrasound scanning and MRI. In triplet...

  13. CaMK II γ down regulation protects dorsal root ganglion neurons from ropivacaine hydrochloride neurotoxicity.

    Science.gov (United States)

    Wen, Xian-Jie; Li, Xiao-Hong; Li, Heng; Liang, Hua; Yang, Chen-Xiang; Wang, Han-Bing

    2017-07-12

    T-type calcium channels are intimately involved in the local anesthetics neurotoxicity. Does CaMKIIγ regulate T-type calcium currents in local anesthetics neurotoxicity? This study generated pAd-CaMKIIγ and pAd-shRNA adenovirus vectors to up- and down-regulate CaMKIIγ mRNA expression in dorsal root ganglion neurons (DRG). Normal DRG (Normal group), empty vector DRG (Empty vector group), pAd-CaMKIIγ DRG (pAd-CaMKIIγ group) and pAd-shRNA DRG (pAd-shRNA group) were treated or untreated with 3 mM ropivacaine hydrochloride for 4 h. Cell viability, apoptosis rate, CaMKIIγ, pCaMKIIγ, Cav3.2, and Cav3.3 expression were detected. Ultrastructural changes in DRG were observed under a transmission electron microscope. The results demonstrated that the cell viability of DRG treated with ropivacaine hydrochloride decreased markedly, the apoptosis rate, CaMKIIγ, pCaMKIIγ, Cav3.2, Cav3.3 expression increased significantly. CaMKIIγ up-regulation aggravated ropivacaine hydrochloride-induced cell damage and increased Cav3.2 and Cav3.3 expression. In conclusion, CaMKIIγ regulated Cav3.2 and Cav3.3 expression in DRG, which was involved with ropivacaine hydrochloride-induced cell injury.

  14. Inhibitory effects of KN-93, an inhibitor of Ca2+ calmodulin-dependent protein kinase II, on light-regulated root gravitropism in maize

    Science.gov (United States)

    Feldman, L. J.; Hidaka, H.

    1993-01-01

    Light is essential for root gravitropism in Zea mays L., cultivar Merit. It is hypothesized that calcium mediates this light-regulated response. KN-93, an inhibitor of calcium/calmodulin kinase II (CaMK II), inhibits light-regulated root gravitropism but does not affect light perception. We hypothesize that CaMK II, or a homologue, operates late in the light/gravity signal transduction chain. Here we provide evidence suggesting a possible physiological involvement of CaMK II in root gravitropism in plants.

  15. Tyrosine kinase is involved in angiotensin II-stimulated phospholipase D activation in aortic smooth muscle cells: function of Ca2+ influx.

    Science.gov (United States)

    Suzuki, A; Shinoda, J; Oiso, Y; Kozawa, O

    1996-03-01

    In the present study, we examined the effect of angiotensin II (Ang II) on phosphatidylcholine-hydrolyzing phospholipase D activity in subcultured rat aortic smooth muscle cells (SMC). Ang II dose-dependently stimulated the formation of choline and inositol phosphates. The effect of Ang II on the formation of inositol phosphates (EC50 was 0.249 +/- 0.091 nM) was more potent than that on the formation of choline (EC50 was 2.39 +/- 1.29 nM). A combination of Ang II and 12-O-tetradecanoylphorbol-13-acetate (TPA), an activator of protein kinase C, additively stimulated the formation of choline. Staurosporine, an inhibitor of protein kinases, inhibited the TPA-induced formation of choline, but had little effect on the Ang II-induced choline formation. Ang II stimulated Ca2+ influx from extracellular space time- and dose-dependently. The depletion of extracellular Ca2+ by (ethylenebis(oxyethylenenitrilo)) tetraacetic acid (EGTA) significantly reduced the Ang II-induced formation of choline. Genistein and tyrphostin, protein tyrosine kinase inhibitors, significantly suppressed the Ang II-induced Ca2+ influx. Genistein and tyrphostin also suppressed the Ang II-induced formation of choline. These results suggest that Ang II stimulates phosphatidylcholine-hydrolyzing phospholipase D due to Ca2+ influx from the extracellular space in rat aortic SMC, and that protein tyrosine kinase is involved in the Ang II-induced Ca2+ influx, resulting in the promotion of phosphatidylcholine hydrolysis.

  16. Stimulation of fibroblast proliferation by neokyotorphin requires Ca influx and activation of PKA, CaMK II and MAPK/ERK.

    Science.gov (United States)

    Sazonova, Olga V; Blishchenko, Elena Yu; Tolmazova, Anna G; Khachin, Dmitry P; Leontiev, Konstantin V; Karelin, Andrey A; Ivanov, Vadim T

    2007-01-01

    Neokyotorphin [TSKYR, hemoglobin alpha-chain fragment (137-141)] has previously been shown to enhance fibroblast proliferation, its effect depending on cell density and serum level. Here we show the dependence of the effect of neokyotorphin on cell type and its correlation with the effect of protein kinase A (PKA) activator 8-Br-cAMP, but not the PKC activator 4beta-phorbol 12-myristate, 13-acetate (PMA). In L929 fibroblasts, the proliferative effect of neokyotorphin was suppressed by the Ca2+ L-type channel inhibitors verapamil or nifedipine, the intracellular Ca2+ chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid acetoxymethyl ester, kinase inhibitors H-89 (PKA), KN-62 (Ca2+/calmodulin-dependent kinase II) and PD98059 (mitogen-activated protein kinase). The proliferative effect of 8-Br-cAMP was also suppressed by KN-62 and PD98059. PKC suppression (downregulation with PMA or inhibition with bisindolylmaleimide XI) did not affect neokyotorphin action. The results obtained point to a cAMP-like action for neokyotorphin.

  17. Sarcoplasmic reticulum Ca2+ uptake and leak properties, and SERCA isoform expression, in type I and type II fibres of human skeletal muscle.

    Science.gov (United States)

    Lamboley, C R; Murphy, R M; McKenna, M J; Lamb, G D

    2014-03-15

    The Ca(2+) uptake properties of the sarcoplasmic reticulum (SR) were compared between type I and type II fibres of vastus lateralis muscle of young healthy adults. Individual mechanically skinned muscle fibres were exposed to solutions with the free [Ca(2+)] heavily buffered in the pCa range (-log10[Ca(2+)]) 7.3-6.0 for set times and the amount of net SR Ca(2+) accumulation determined from the force response elicited upon emptying the SR of all Ca(2+). Western blotting was used to determine fibre type and the sarco(endo)plasmic reticulum Ca(2+)-ATPase (SERCA) isoform present in every fibre examined. Type I fibres contained only SERCA2 and displayed half-maximal Ca(2+) uptake rate at ∼pCa 6.8, whereas type II fibres contained only SERCA1 and displayed half-maximal Ca(2+) uptake rate at ∼pCa 6.6. Maximal Ca(2+) uptake rate was ∼0.18 and ∼0.21 mmol Ca(2+) (l fibre)(-1) s(-1) in type I and type II fibres, respectively, in good accord with previously measured SR ATPase activity. Increasing free [Mg(2+)] from 1 to 3 mM had no significant effect on the net Ca(2+) uptake rate at pCa 6.0, indicating that there was little or no calcium-induced calcium release occurring through the Ca(2+) release channels during uptake in either fibre type. Ca(2+) leakage from the SR at pCa 8.5, which is thought to occur at least in part through the SERCA, was ∼2-fold lower in type II fibres than in type I fibres, and was little affected by the presence of ADP, in marked contrast to the larger SR Ca(2+) leak observed in rat muscle fibres under the same conditions. The higher affinity of Ca(2+) uptake in the type I human fibres can account for the higher relative level of SR Ca(2+) loading observed in type I compared to type II fibres, and the SR Ca(2+) leakage characteristics of the human fibres suggest that the SERCAs are regulated differently from those in rat and contribute comparatively less to resting metabolic rate.

  18. The effects of ropivacaine hydrochloride on the expression of CaMK II mRNA in the dorsal root ganglion neurons.

    Science.gov (United States)

    Wen, Xianjie; Lai, Xiaohong; Li, Xiaohong; Zhang, Tao; Liang, Hua

    2016-12-01

    In this study, we identified the subtype of Calcium/calmodulin-dependent protein kinase II (CaMK II) mRNA in dorsal root ganglion neurons and observed the effects of ropivacaine hydrochloride in different concentration and different exposure time on the mRNA expression. Dorsal root ganglion neurons were isolated from the SD rats and cultured in vitro. The mRNA of the CaMK II subtype in dorsal root ganglion neurons were detected by real-time PCR. As well as, the dorsal root ganglion neurons were treated with ropivacaine hydrochloride in different concentration (1mM,2mM, 3mM and 4mM) for the same exposure time of 4h, or different exposure time (0h,2h,3h,4h and 6h) at the same concentration(3mM). The changes of the mRNA expression of the CaMK II subtype were observed with real-time PCR. All subtype mRNA of the CaMK II, CaMK IIα, CaMK IIβ, CaMK II δ, CaMK IIγ, can be detected in dorsal root ganglion neurons. With the increased of the concentration and exposure time of the ropivacaine hydrochloride, all the subtype mRNA expression increased. Ropivacaine hydrochloride up-regulate the CaMK IIβ, CaMK IIδ, CaMK IIg mRNA expression with the concentration and exposure time increasing. The nerve blocking or the neurotoxicity of the ropivacaine hydrochloride maybe involved with CaMK II. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  19. The octopamine receptor OAMB mediates ovulation via Ca2+/calmodulin-dependent protein kinase II in the Drosophila oviduct epithelium.

    Directory of Open Access Journals (Sweden)

    Hyun-Gwan Lee

    Full Text Available Ovulation is an essential physiological process in sexual reproduction; however, the underlying cellular mechanisms are poorly understood. We have previously shown that OAMB, a Drosophila G-protein-coupled receptor for octopamine (the insect counterpart of mammalian norepinephrine, is required for ovulation induced upon mating. OAMB is expressed in the nervous and reproductive systems and has two isoforms (OAMB-AS and OAMB-K3 with distinct capacities to increase intracellular Ca2+ or intracellular Ca2+ and cAMP in vitro. Here, we investigated tissue specificity and intracellular signals required for OAMB's function in ovulation. Restricted OAMB expression in the adult oviduct epithelium, but not the nervous system, reinstated ovulation in oamb mutant females, in which either OAMB isoform was sufficient for the rescue. Consistently, strong immunoreactivities for both isoforms were observed in the wild-type oviduct epithelium. To delineate the cellular mechanism by which OAMB regulates ovulation, we explored protein kinases functionally interacting with OAMB by employing a new GAL4 driver with restricted expression in the oviduct epithelium. Conditional inhibition of Ca2+/Calmodulin-dependent protein kinase II (CaMKII, but not protein kinase A or C, in the oviduct epithelium inhibited ovulation. Moreover, constitutively active CaMKII, but not protein kinase A, expressed only in the adult oviduct epithelium fully rescued the oamb female's phenotype, demonstrating CaMKII as a major downstream molecule conveying the OAMB's ovulation signal. This is consistent with the ability of both OAMB isoforms, whose common intracellular signal in vitro is Ca2+, to reinstate ovulation in oamb females. These observations reveal the critical roles of the oviduct epithelium and its cellular components OAMB and CaMKII in ovulation. It is conceivable that the OAMB-mediated cellular activities stimulated upon mating are crucial for secretory activities suitable for egg

  20. The Chromospheric network dynamics as derived from the analysis of CA II K and He I 1083 NM lines

    Science.gov (United States)

    Bocchialini, S.; Vial, J.-C.; Koutchmy, S.

    1994-10-01

    We present results of line profile analysis of observations simultaneously performed around the Ca II K and He I (1083 nm) lines, using the Horizontal Spectrograph of the Vacuum Tower Telescope of NSO/SP. From the spectral analysis of a 83 min long sequence of CCD spectra, we derive some dynamical properties of the main components of the quiet chromosphere: i) the magnetic network, ii) the cell interior. We present a whole set of amplitude spectra near 5 and 3 min periods for the two lines; K3 and He I velocity spectra extending up to 100 mHz are also considered, for the first time.

  1. Experimental insertions made of two symmetric triplets

    CERN Document Server

    D'Amico, T E

    1998-01-01

    The reported study is based on the analytical treatment developed for an experimental collider insertion made of two symmetric triplets,the inner triplet located near the interaction point (IP) and th e outer triplet preceding a regular lattice. These two triplets are assumed to be symmetric in their geometry and quadrupole strengths, but not in their Twiss parameters. The method is applied to an i nsertion of the type of an experimental LHC insertion. The drift between the IP and the first quadrupole is fixed and the inner triplet is constrained to achieve a beta-crossing with equal and opposit e slopes (alpha-values) in the two planes. The outer triplet acts then as a FODO transformer from beta-crossing to beta-crossing in order to match the lattice. The analysis provides in a given paramet er interval all the existing solutions for the distance between triplets and the total insertion length, as functions of one gradient and the quadrupole separation in the inner triplet. The variation of the quadrupole st...

  2. Spectroscopic, Elemental and Thermal Analysis, and Positron Annihilation Studies on Ca(II), Sr(II), Ba(II), Pb(II), and Fe(III) Penicillin G Potassium Complexes

    Science.gov (United States)

    Refat, M. S.; Sharshara, T.

    2015-11-01

    The [Pb(Pin)2] · 3H2O, [M(Pin)(H2O)2(Cl)] · nH2O (M = SrII, CaII or BaII; n = 0-1), and [Fe(Pin)2(Cl)(H2O)] · H2O penicillin G potassium (Pin) complexes were synthesized and characterized using elemental analyses, molar conductivity, thermal analysis and electronic spectroscopy techniques. The positron annihilation lifetime (PAL) and Doppler broadening (DB) techniques have been employed to probe the defects and structural changes of Pin ligand and its complexes. The PAL and DB line-shape parameters were discussed in terms of the structure, molecular weight, ligand-metal molar ratio, and other properties of the Pin complexes.

  3. Physicochemical impact studies of gamma rays on "aspirin" analgesics drug and its metal complexes in solid form: Synthesis, spectroscopic and biological assessment of Ca(II), Mg(II), Sr(II) and Ba(II) aspirinate complexes

    Science.gov (United States)

    Refat, Moamen S.; Sharshar, T.; Elsabawy, Khaled M.; Heiba, Zein K.

    2013-09-01

    Metal aspirinate complexes, M2(Asp)4, where M is Mg(II), Ca(II), Sr(II) or Ba(II) are formed by refluxed of aspirin (Asp) with divalent non-transition metal ions of group (II) and characterized by elemental analysis and spectroscopic measurements (infrared, electronic, 1H NMR, Raman, X-ray powder diffraction and scanning electron microscopy). Elemental analysis of the chelates suggests the stoichiometry is 1:2 (metal:ligand). Infrared spectra of the complexes agree with the coordination to the central metal atom through three donation sites of two oxygen atoms of bridge bidentate carboxylate group and oxygen atom of sbnd Cdbnd O of acetyl group. Infrared spectra coupled with the results of elemental analyzes suggested a distorted octahedral structure for the M(II) aspirinate complexes. Gamma irradiation was tested as a method for stabilization of aspirin as well as their complexes. The effect of gamma irradiation, with dose of 80 Gy, on the properties of aspirinate complexes was studied. The aspirinate chelates have been screened for their in vitro antibacterial activity against four bacteria, gram-positive (Bacillus subtilis and Staphylococcus aureus) and gram-negative (Escherichia coli and Pseudomonas aeruginosa) and two strains of fungus (Aspergillus flavus and Candida albicans). The metal chelates were shown to possess more antibacterial activity than the free aspirin chelate.

  4. Interplay between singlet and triplet excited states in a conformationally locked donor–acceptor dyad

    KAUST Repository

    Filatov, Mikhail A.

    2015-10-13

    The synthesis and photophysical characterization of a palladium(II) porphyrin – anthracene dyad bridged via short and conformationally rigid bicyclo[2.2.2]octadiene spacer were achieved. A spectroscopic investigation of the prepared molecule in solution has been undertaken to study electronic energy transfer in excited singlet and triplet states between the anthracene and porphyrin units. By using steady-state and time-resolved photoluminescence spectroscopy it was shown that excitation of the singlet excited state of the anthracene leads to energy transfer to the lower-lying singlet state of porphyrin. Alternatively, excitation of the porphyrin followed by intersystem crossing to the triplet state leads to very fast energy transfer to the triplet state of anthracene. The rate of this energy transfer has been determined by transient absorption spectroscopy. Comparative studies of the dynamics of triplet excited states of the dyad and reference palladium octaethylporphyrin (PdOEP) have been performed.

  5. Intracellular angiotensin II elicits Ca2+ increases in A7r5 vascular smooth muscle cells

    NARCIS (Netherlands)

    Filipeanu, CM; Brailoiu, E; Kok, JW; Henning, RH; De Zeeuw, D; Nelemans, SA

    2001-01-01

    Recent studies show that angiotensin II can act within the cell, possibly via intracellular receptors pharmacologically different from typical plasma membrane angiotensin II receptors. The signal transduction of intracellular angiotensin LI is unclear. Therefore. we investigated the effects of

  6. Singlet and triplet instability theorems

    Science.gov (United States)

    Yamada, Tomonori; Hirata, So

    2015-09-01

    A useful definition of orbital degeneracy—form-degeneracy—is introduced, which is distinct from the usual energy-degeneracy: Two canonical spatial orbitals are form-degenerate when the energy expectation value in the restricted Hartree-Fock (RHF) wave function is unaltered upon a two-electron excitation from one of these orbitals to the other. Form-degenerate orbitals tend to have isomorphic electron densities and occur in the highest-occupied and lowest-unoccupied molecular orbitals (HOMOs and LUMOs) of strongly correlated systems. Here, we present a mathematical proof of the existence of a triplet instability in a real or complex RHF wave function of a finite system in the space of real or complex unrestricted Hartree-Fock wave functions when HOMO and LUMO are energy- or form-degenerate. We also show that a singlet instability always exists in a real RHF wave function of a finite system in the space of complex RHF wave functions, when HOMO and LUMO are form-degenerate, but have nonidentical electron densities, or are energy-degenerate. These theorems provide Hartree-Fock-theory-based explanations of Hund's rule, a singlet instability in Jahn-Teller systems, biradicaloid electronic structures, and a triplet instability during some covalent bond breaking. They also suggest (but not guarantee) the spontaneous formation of a spin density wave (SDW) in a metallic solid. The stability theory underlying these theorems extended to a continuous orbital-energy spectrum proves the existence of an oscillating (nonspiral) SDW instability in one- and three-dimensional homogeneous electron gases, but only at low densities or for strong interactions.

  7. Singlet and triplet instability theorems

    Energy Technology Data Exchange (ETDEWEB)

    Yamada, Tomonori; Hirata, So, E-mail: sohirata@illinois.edu [Department of Chemistry, University of Illinois at Urbana-Champaign, 600 South Mathews Avenue, Urbana, Illinois 61801 (United States); CREST, Japan Science and Technology Agency, 4-1-8 Honcho, Kawaguchi, Saitama 332-0012 (Japan)

    2015-09-21

    A useful definition of orbital degeneracy—form-degeneracy—is introduced, which is distinct from the usual energy-degeneracy: Two canonical spatial orbitals are form-degenerate when the energy expectation value in the restricted Hartree–Fock (RHF) wave function is unaltered upon a two-electron excitation from one of these orbitals to the other. Form-degenerate orbitals tend to have isomorphic electron densities and occur in the highest-occupied and lowest-unoccupied molecular orbitals (HOMOs and LUMOs) of strongly correlated systems. Here, we present a mathematical proof of the existence of a triplet instability in a real or complex RHF wave function of a finite system in the space of real or complex unrestricted Hartree–Fock wave functions when HOMO and LUMO are energy- or form-degenerate. We also show that a singlet instability always exists in a real RHF wave function of a finite system in the space of complex RHF wave functions, when HOMO and LUMO are form-degenerate, but have nonidentical electron densities, or are energy-degenerate. These theorems provide Hartree–Fock-theory-based explanations of Hund’s rule, a singlet instability in Jahn–Teller systems, biradicaloid electronic structures, and a triplet instability during some covalent bond breaking. They also suggest (but not guarantee) the spontaneous formation of a spin density wave (SDW) in a metallic solid. The stability theory underlying these theorems extended to a continuous orbital-energy spectrum proves the existence of an oscillating (nonspiral) SDW instability in one- and three-dimensional homogeneous electron gases, but only at low densities or for strong interactions.

  8. DATE PRELIMINARE PRIVIND VIABILITATEA POLENULUI CA BIOINDICATOR AL CALITĂŢII AERULUI ÎN TIMIŞOARA

    Directory of Open Access Journals (Sweden)

    Nicoleta IANOVICI

    2008-01-01

    Full Text Available Această cercetare prezintă date obţinute prin prelevarea polenului de la patru specii (Plantago lanceolata, Plantago major, Ambrosia artemisiifolia, Tilia cordata şi testarea viabilităţii acestuia prin tratare cu TTC. Aceste date preliminare sunt insuficiente pentru a da o concluzie specifică. Oricum, se poate spune că viabilitatea polenului poate fi un parametru reprezentativ pentru a stabili care plante sunt mai bine adaptate mediului urban. Modificarea viabilităţii polenului indică prezenţa gazelor cu caracter poluant, rezultate mai ales din traficul rutier, la toate cele patru specii. Polenul de Plantago lanceolata şi Tilia cordata ar putea fi folosit ca bio-indicator al calităţii aerului într-un ecosistem urban.

  9. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ruitment factor; MAKTRSKSAATAAATSPKASPTAAKVTKNKVTKPSTASPSKTTKTKAVKKTTTKKATPKKEEEEKK... Ca19AnnotatedDec2004aaSeq orf19.124 >orf19.124; Contig19-10035; 67601..68698; CIC1*; protease substrate rec

  10. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available pothetical protein CaO19.1683 [Candida albicans SC5314] ... Length = 292 ... Query: 52 ... DLDGSSINQLDVWIEKLSKCEPLSETDVKKLCDMA...VEVLQFEENVQPVQVPVTICGDVHG 111 ... DLDGSSINQLDVWIEKLSKCEPLSETDVKKLCDMAVEVLQFEENVQPV...QVPVTICGDVHG Sbjct: 1 ... DLDGSSINQLDVWIEKLSKCEPLSETDVKKLCDMAVEVLQFEENVQPVQVPVTICGD

  11. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.5114 >orf19.5114; Contig19-10218; complement(13382...8..134301); GRD19; retrieval from vacuole to Golgi; MSKPFQPISDVINTSPKNKSQSFNEIYGEPENFLEIEVKNPLTHGYGSNLFTDYEI

  12. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2070 >orf19.2070; Contig19-10139; complement(144199..145761); RSC58*; remod...els the structure of chromatin complex; MKIVSSLQSHTTTDVTSIKNKYKNGQYSTPYQLFHDIKAVASI

  13. A novel mechanism for Ca2+/calmodulin-dependent protein kinase II targeting to L-type Ca2+channels that initiates long-range signaling to the nucleus.

    Science.gov (United States)

    Wang, Xiaohan; Marks, Christian R; Perfitt, Tyler L; Nakagawa, Terunaga; Lee, Amy; Jacobson, David A; Colbran, Roger J

    2017-10-20

    Neuronal excitation can induce new mRNA transcription, a phenomenon called excitation-transcription (E-T) coupling. Among several pathways implicated in E-T coupling, activation of voltage-gated L-type Ca 2+ channels (LTCCs) in the plasma membrane can initiate a signaling pathway that ultimately increases nuclear CREB phosphorylation and, in most cases, expression of immediate early genes. Initiation of this long-range pathway has been shown to require recruitment of Ca 2+ -sensitive enzymes to a nanodomain in the immediate vicinity of the LTCC by an unknown mechanism. Here, we show that activated Ca 2+ /calmodulin-dependent protein kinase II (CaMKII) strongly interacts with a novel binding motif in the N-terminal domain of Ca V 1 LTCC α1 subunits that is not conserved in Ca V 2 or Ca V 3 voltage-gated Ca 2+ channel subunits. Mutations in the Ca V 1.3 α1 subunit N-terminal domain or in the CaMKII catalytic domain that largely prevent the in vitro interaction also disrupt CaMKII association with intact LTCC complexes isolated by immunoprecipitation. Furthermore, these same mutations interfere with E-T coupling in cultured hippocampal neurons. Taken together, our findings define a novel molecular interaction with the neuronal LTCC that is required for the initiation of a long-range signal to the nucleus that is critical for learning and memory. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  14. Heme-induced Trypanosoma cruzi proliferation is mediated by CaM kinase II

    Energy Technology Data Exchange (ETDEWEB)

    Souza, C.F. [Laboratorio de Imunomodulacao e Protozoologia, Instituto Oswaldo Cruz, Fiocruz (Brazil); Carneiro, A.B.; Silveira, A.B. [Laboratorio de Sinalizacao Celular, Instituto de Bioquimica Medica, UFRJ (Brazil); Laranja, G.A.T. [Laboratorio de Interacao Tripanosomatideos e Vetores, Departamento de Bioquimica, IBRAG, UERJ, 20551-030 Rio de Janeiro (Brazil); Silva-Neto, M.A.C. [Laboratorio de Sinalizacao Celular, Instituto de Bioquimica Medica, UFRJ (Brazil); INCT, Entomologia Molecular (Brazil); Costa, S.C. Goncalves da [Laboratorio de Imunomodulacao e Protozoologia, Instituto Oswaldo Cruz, Fiocruz (Brazil); Paes, M.C., E-mail: mcpaes@uerj.br [Laboratorio de Interacao Tripanosomatideos e Vetores, Departamento de Bioquimica, IBRAG, UERJ, 20551-030 Rio de Janeiro (Brazil); INCT, Entomologia Molecular (Brazil)

    2009-12-18

    Trypanosoma cruzi, the etiologic agent of Chagas disease, is transmitted through triatomine vectors during their blood-meal on vertebrate hosts. These hematophagous insects usually ingest approximately 10 mM of heme bound to hemoglobin in a single meal. Blood forms of the parasite are transformed into epimastigotes in the crop which initiates a few hours after parasite ingestion. In a previous work, we investigated the role of heme in parasite cell proliferation and showed that the addition of heme significantly increased parasite proliferation in a dose-dependent manner . To investigate whether the heme effect is mediated by protein kinase signalling pathways, parasite proliferation was evaluated in the presence of several protein kinase (PK) inhibitors. We found that only KN-93, a classical inhibitor of calcium-calmodulin-dependent kinases (CaMKs), blocked heme-induced cell proliferation. KN-92, an inactive analogue of KN-93, was not able to block this effect. A T. cruzi CaMKII homologue is most likely the main enzyme involved in this process since parasite proliferation was also blocked when Myr-AIP, an inhibitory peptide for mammalian CaMKII, was included in the cell proliferation assay. Moreover, CaMK activity increased in parasite cells with the addition of heme as shown by immunological and biochemical assays. In conclusion, the present results are the first strong indications that CaMKII is involved in the heme-induced cell signalling pathway that mediates parasite proliferation.

  15. The Basic Properties of the Electronic Structure of the Oxygen-evolving Complex of Photosystem II Are Not Perturbed by Ca2+ Removal*

    Science.gov (United States)

    Lohmiller, Thomas; Cox, Nicholas; Su, Ji-Hu; Messinger, Johannes; Lubitz, Wolfgang

    2012-01-01

    Ca2+ is an integral component of the Mn4O5Ca cluster of the oxygen-evolving complex in photosystem II (PS II). Its removal leads to the loss of the water oxidizing functionality. The S2′ state of the Ca2+-depleted cluster from spinach is examined by X- and Q-band EPR and 55Mn electron nuclear double resonance (ENDOR) spectroscopy. Spectral simulations demonstrate that upon Ca2+ removal, its electronic structure remains essentially unaltered, i.e. that of a manganese tetramer. No redistribution of the manganese valence states and only minor perturbation of the exchange interactions between the manganese ions were found. Interestingly, the S2′ state in spinach PS II is very similar to the native S2 state of Thermosynechococcus elongatus in terms of spin state energies and insensitivity to methanol addition. These results assign the Ca2+ a functional as opposed to a structural role in water splitting catalysis, such as (i) being essential for efficient proton-coupled electron transfer between YZ and the manganese cluster and/or (ii) providing an initial binding site for substrate water. Additionally, a novel 55Mn2+ signal, detected by Q-band pulse EPR and ENDOR, was observed in Ca2+-depleted PS II. Mn2+ titration, monitored by 55Mn ENDOR, revealed a specific Mn2+ binding site with a submicromolar KD. Ca2+ titration of Mn2+-loaded, Ca2+-depleted PS II demonstrated that the site is reversibly made accessible to Mn2+ by Ca2+ depletion and reconstitution. Mn2+ is proposed to bind at one of the extrinsic subunits. This process is possibly relevant for the formation of the Mn4O5Ca cluster during photoassembly and/or D1 repair. PMID:22549771

  16. The basic properties of the electronic structure of the oxygen-evolving complex of photosystem II are not perturbed by Ca2+ removal.

    Science.gov (United States)

    Lohmiller, Thomas; Cox, Nicholas; Su, Ji-Hu; Messinger, Johannes; Lubitz, Wolfgang

    2012-07-13

    Ca(2+) is an integral component of the Mn(4)O(5)Ca cluster of the oxygen-evolving complex in photosystem II (PS II). Its removal leads to the loss of the water oxidizing functionality. The S(2)' state of the Ca(2+)-depleted cluster from spinach is examined by X- and Q-band EPR and (55)Mn electron nuclear double resonance (ENDOR) spectroscopy. Spectral simulations demonstrate that upon Ca(2+) removal, its electronic structure remains essentially unaltered, i.e. that of a manganese tetramer. No redistribution of the manganese valence states and only minor perturbation of the exchange interactions between the manganese ions were found. Interestingly, the S(2)' state in spinach PS II is very similar to the native S(2) state of Thermosynechococcus elongatus in terms of spin state energies and insensitivity to methanol addition. These results assign the Ca(2+) a functional as opposed to a structural role in water splitting catalysis, such as (i) being essential for efficient proton-coupled electron transfer between Y(Z) and the manganese cluster and/or (ii) providing an initial binding site for substrate water. Additionally, a novel (55)Mn(2+) signal, detected by Q-band pulse EPR and ENDOR, was observed in Ca(2+)-depleted PS II. Mn(2+) titration, monitored by (55)Mn ENDOR, revealed a specific Mn(2+) binding site with a submicromolar K(D). Ca(2+) titration of Mn(2+)-loaded, Ca(2+)-depleted PS II demonstrated that the site is reversibly made accessible to Mn(2+) by Ca(2+) depletion and reconstitution. Mn(2+) is proposed to bind at one of the extrinsic subunits. This process is possibly relevant for the formation of the Mn(4)O(5)Ca cluster during photoassembly and/or D1 repair.

  17. Inhibitions of late INa and CaMKII act synergistically to prevent ATX-II-induced atrial fibrillation in isolated rat right atria.

    Science.gov (United States)

    Liang, Faquan; Fan, Peidong; Jia, Jessie; Yang, Suya; Jiang, Zhan; Karpinski, Serge; Kornyeyev, Dmytro; Pagratis, Nikos; Belardinelli, Luiz; Yao, Lina

    2016-05-01

    Increases in late Na(+) current (late INa) and activation of Ca(2+)/calmodulin-dependent protein kinase (CaMKII) are associated with atrial arrhythmias. CaMKII also phosphorylates Nav1.5, further increasing late INa. The combination of a CaMKII inhibitor with a late INa inhibitor may be superior to each compound alone to suppress atrial arrhythmias. Therefore, we investigated the effect of a CaMKII inhibitor in combination with a late INa inhibitor on anemone toxin II (ATX-II, a late INa enhancer)-induced atrial arrhythmias. Rat right atrial tissue was isolated and preincubated with either the CaMKII inhibitor autocamtide-2-related inhibitory peptide (AIP), the late INa inhibitor GS458967, or both, and then exposed to ATX-II. ATX-II increased diastolic tension and caused fibrillation of isolated right atrial tissue. AIP (0.3μmol/L) and 0.1μmol/L GS458967 alone inhibited ATX-II-induced arrhythmias by 20±3% (mean±SEM, n=14) and 34±5% (n=13), respectively, whereas the two compounds in combination inhibited arrhythmias by 81±4% (n=10, pATX-induced increase of diastolic tension. Consistent with the mechanical and electrical data, 0.3μmol/L AIP and 0.1μmol/L GS458967 each inhibited ATX-II-induced CaMKII phosphorylation by 23±3% and 32±4%, whereas the combination of both compounds inhibited CaMKII phosphorylation completely. The effects of an enhanced late INa to induce arrhythmic activity and activation of CaMKII in atria are attenuated synergistically by inhibitors of late INa and CaMKII. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Synthesis, Structural Characterization, and Antitumor Activity of a Ca(II) Coordination Polymer Based on 1,6-Naphthalenedisulfonate and 4,4'-Bipyridyl.

    Science.gov (United States)

    Tai, Xishi; Zhao, Wenhua

    2013-08-16

    A novel Ca(II) coordination polymer, [CaL(4,4'-bipyridyl)(H₂O)₄]n (L = 1,6-naphthalenedisulfonate), was synthesized by reaction of calcium perchlorate with 1,6-naphthalenedisulfonic acid disodium salt and 4,4'-bipyridyl in CH₃CH₂OH/H₂O. It was characterized by elemental analysis, IR, molar conductivity and thermogravimetric analysis. X-ray crystallography reveals that the Ca(II) coordination polymer belongs to the orthorhombic system, with space group P2₁2₁2₁. The geometry of the Ca(II) ion is a distorted CaNO₆ pengonal bipyramid, arising from its coordination by four water molecules, one nitrogen atom of 4,4'-bipyridyl molecule, and two oxygen atoms from two L ligands. The complex molecules form a helical chain by self-assembly. The antitumor activity of 1,6-naphthalenedisulfonic acid disodium salt and the Ca(II) coordination polymer against human hepatoma smmc-7721 cell line and human lung adenocarcinoma A549 cell line reveals that the Ca(II) coordination polymer inhibits cell growth of human lung adenocarcinoma A549 cell line with IC50 value of 27 μg/mL, and is more resistive to human lung adenocarcinoma A549 cell line as compared to 1,6-naphthalenedisulfonic acid disodium salt.

  19. Dutch listeners' perception of Korean stop triplets

    NARCIS (Netherlands)

    Broersma, M.E.

    2009-01-01

    This study investigates Dutch listeners' perception of Korean stop triplets. Whereas Dutch distinguishes prevoiced and voiceless unaspirated stops, Korean distinguishes fortis, lenis, and aspirated stops. Here, perception of fortis, lenis, and aspirated bilabial (/pp/-/p/-/ph/), alveolar

  20. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.6369; >1tqmA 7 276 41 325 3e-71 ... gb|EAK97210.1| hy....13726 [Candida ... albicans SC5314] ... Length = 285 ... Query: 8 ... MRYLTSDDFRVLQAIELGSRNHELVPTQM...IHSIGGLKSPSATNRAIGDIAKLKLISRLRN 67 ... MRYLTSDDFRVLQAIELGSRNHELVPTQMIHSIG...GLKSPSATNRAIGDIAKLKLISRLRN Sbjct: 1 ... MRYLTSDDFRVLQAIELGSRNHELVPTQMIHSIGGLKSPSATNRAIGDIAKLKLISRLRN 60 ... Query

  1. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.1711; >1iq3A 15 104 3 93 2e-21 ... gb|EAL03000.1| potential EF Hand endocytosi...s protein End3p [Candida albicans ... SC5314] gb|EAL02871.1| potential EF Hand endocytosis

  2. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.3239; >1lv7A 48 256 339 536 1e-04 ... gb|AAW44927.1| sister chromatid cohesion...1] ref|XP_572234.1| ... sister chromatid cohesion-related protein, putative ... [Cryptococcus

  3. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4451; Contig19-10205; 80261..83395; RIA1*; RIbosome Assembly...; Elongation Factor Like | GTPase ... >orf19.4451; Contig19-10205; 80261..83395; RIA1*; RIbosome Assembly

  4. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rk protein [Candida albicans SC5314] ... gb|EAK91583.1| potential signalling network... Ca19AnnotatedDec2004aaSeq orf19.3505; >1unqA 2 108 330 443 2e-04 ... gb|EAK91599.1| potential signalling netwo

  5. ADSORPTION OF Ca(II, Pb(II AND Ag(I ON SULFONATO-SILICA HYBRID PREPARED FROM RICE HULL ASH

    Directory of Open Access Journals (Sweden)

    Siti Sulastri

    2011-12-01

    Full Text Available In this research, adsorption of Ca(II, Pb(II and Ag(I in aqueous solution onto sulfonato-silica hybrid (SSH prepared from rice hull ash (RHA has been studied. The preparation of SSH adsorbent was carried out by oxidation of mercapto-silica hybrid (MSH with hydrogen peroxide (H2O2 solution 33%. MSH was prepared, via sol-gel process, by adding 3 M hydrochloric acid solution to mixture of sodium silicate (Na2SiO3 solution and 3(trimethoxysilyl-1-propanthiol (MPTS to reach pH of 7.0. Solution of Na2SiO3 was generated from destruction of RHA with sodium hydroxide solution followed with heating at 500 °C for 30 min. The SSH produced was characterized with Fourier transform infrared (FTIR spectroscopy, X-ray diffraction (XRD analyzer, energy dispersive X-ray (EDX spectroscopy and determination of ion-exchange capacity for sodium ion (Na+. The adsorption of Ag(I and Ca(II were conducted in a batch system in various concentrations for one hour. The adsorbent ion was calculated based on difference of concentrations before and after adsorption process determined using atomic absorbance spectrophotometric (AAS method. The adsorption character was evaluated using model of isotherm Langmuir and Freundlich adsorption to calculate the capacity, constants and energy of adsorption. Result of characterization by EDX and FTIR showed qualitatively that SSH has been successfully synthesized which were indicated by appearance of characteristic absorbance of functional group namely silanol (Si-OH, siloxane (Si-O-Si, methylene (-CH2- and disappearance of mercapto group (SH. The XRD data showed amorphous structure of SSH, similar to silica gel (SG and MSH. The study of adsorption thermodynamics showed that oxidation of MSH into SSH increases the ion-exchange capacity for Na+ from 0.123 to 0.575 mmol/g. The change in functional group from silanol to mercapto and from mercapto to sulfonato increases the adsorption capacity of Ca(II. However, the capacity order of

  6. Josephson spin current in triplet superconductor junctions

    OpenAIRE

    Asano, Yasuhiro

    2006-01-01

    This paper theoretically discusses the spin current in spin-triplet superconductor / insulator / spin-triplet superconductor junctions. At low temperatures, a midgap Andreev resonant state anomalously enhances not only the charge current but also the spin current. The coupling between the Cooper pairs and the electromagnetic fields leads to the Frounhofer pattern in the direct current spin flow in magnetic fields and the alternative spin current under applied bias-voltages.

  7. Synthesis and spectral investigations of Cu(II) ion-doped NaCaAlPO4 F3 phosphor.

    Science.gov (United States)

    Manjari, V Pushpa; Krishna, Ch Rama; Reddy, Ch Venkata; Ravikumar, R V S S N

    2014-12-01

    Cu(II) ion-doped NaCaAlPO(4)F(3) phosphor has been synthesized using a solid state reaction method. The prepared sample is characterized by powder X-ray diffraction, scanning electron microscope, optical absorption, electron paramagnetic resonance photoluminescence and Fourier transform infrared spectroscopy techniques. The crystallite size evaluated from x-ray diffraction data is in nanometers. Scanning electron microscopy micrographs showed the presence of several irregular shaped particles. From optical absorption and electron paramagnetic resonance spectral data the doped Cu(II) ions are ascribed to distorted octahedral site symmetry. The synthesized phosphor exhibits emission bands in ultraviolet, blue and green regions under the excitation wavelength of 335 nm. The CIE chromaticity coordinates (x = 0.159, y = 0.204) also calculated for the prepared sample from the emission spectrum. The Fourier transform infrared spectroscopy spectrum revealed the characteristic vibrational bands of the prepared phosphor material. Copyright © 2014 John Wiley & Sons, Ltd.

  8. RG-II from Panax ginseng C.A. Meyer suppresses asthmatic reaction

    Directory of Open Access Journals (Sweden)

    In Duk Jung

    2012-02-01

    Full Text Available In asthma, T helper 2 (TH2-type cytokines such as interleukin(IL-4, IL-5, and IL-13 are produced by activated CD4+ T cells.Dendritic cells played an important role in determining thefate of naïve T cells into either TH1 or TH2 cells. Wedetermined whether RG-II regulates the TH1/TH2 immuneresponse by using an ovalbumin-induced murine model ofasthma. RG-II reduced IL-4 production but increased interferon-gamma production, and inhibited GATA-3 geneexpression. RG-II also inhibited asthmatic reactions includingan increase in the number of eosinophils in bronchoalveolarlavage fluid, an increase in inflammatory cell infiltration inlung tissues, airway luminal narrowing, and airway hyperresponsiveness.This study provides evidence that RG-II plays acritical role in ameliorating the pathogenic process ofasthmatic inflammation in mice. These findings provide newinsights into the immunotherapeutic role of RG-II in terms ofits effects in a murine model of asthma. [BMB reports 2012;45(2: 79-84

  9. Efficient delayed fluorescence via triplet-triplet annihilation for deep-blue electroluminescence.

    Science.gov (United States)

    Chou, P-Y; Chou, H-H; Chen, Y-H; Su, T-H; Liao, C-Y; Lin, H-W; Lin, W-C; Yen, H-Y; Chen, I-C; Cheng, C-H

    2014-07-04

    Four 2-(styryl)triphenylene derivatives (TSs) were synthesized for deep-blue dopant materials. By using a pyrene-containing compound, DMPPP, as the host, the TS-doped devices exhibited significant delayed fluorescence via triplet-triplet annihilation, providing the highest quantum efficiency of 10.2% and a current efficiency of 12.3 cd A(-1).

  10. Triplet energy transfer and triplet exciton recycling in singlet fission sensitized organic heterojunctions

    Science.gov (United States)

    Hamid, Tasnuva; Yambem, Soniya D.; Crawford, Ross; Roberts, Jonathan; Pandey, Ajay K.

    2017-08-01

    Singlet exciton fission is a process where an excited singlet state splits into two triplets, thus leading to generation of multiple excitons per absorbed photon in organic semiconductors. Herein, we report a detailed exciton management approach for multiexciton harvesting over a broadband region of the solar spectrum in singlet fission sensitized organic photodiodes. Through systematic studies on the model cascade of pentacene/rubrene/C60, we found that efficient photocurrent generation from pentacene can still occur despite the presence of a >10nm thick interlayer of rubrene in between the pentacene/C60 heterojunction. Our results show that thin rubrene interlayers of thickness operation a rather interesting result. We discuss the role of rubrene interlayer film discontinuity, triplet exciton reflection from rubrene interlayer and triplet energy transfer from rubrene to pentacene layer followed by diffusion of triplet excitons through rubrene as plausible mechanisms that would enable triplet excitons from pentacene to generate significant photocurrent in a multilayer organic heterojunction.

  11. CaMK-II modulation of GABA(A) receptors expressed in HEK293, NG108-15 and rat cerebellar granule neurons.

    Science.gov (United States)

    Houston, C M; Smart, T G

    2006-11-01

    The gamma-aminobutyric acid type A (GABA(A)) receptor is a pentameric ligand-gated ion channel responsible for fast synaptic inhibition in the brain. Phosphorylation of the GABA(A) receptor by serine/threonine protein kinases, at residues located in the intracellular loop between the third and fourth transmembrane domains of each subunit, can dynamically modulate receptor trafficking and function. In this study, we have assessed the effect that Ca(2+)-calmodulin-dependent protein kinase-II (CaMK-II) has on GABA(A) receptors. The intracellular application of preactivated CaMK-II failed to modulate the function of alphabeta and alphabetagamma subunit GABA(A) receptors heterologously expressed in human embryonic kidney (HEK)293 cells. However, application of similarly preactivated alpha-CaMK-II significantly potentiated the amplitudes of whole-cell GABA currents recorded from rat cultured cerebellar granule neurons and from recombinant GABA(A) receptors expressed in neuroblastoma, NG108-15, cells. The modulation by alpha-CaMK-II of current amplitude depended upon the subunit composition of GABA(A) receptors. alpha-CaMK-II potentiated GABA currents recorded from alpha1beta3 and alpha1beta3gamma2 GABA(A) receptors, but was unable to functionally modulate beta2 subunit-containing receptors. Similar results were obtained from beta2 -/- mouse cerebellar granule cell cultures and from rat granule cell cultures overexpressing recombinant alpha1beta2 or alpha1beta3 GABA(A) receptors. alpha-CaMK-II had a greater effect on the modulation of GABA responses mediated by alpha1beta3gamma2 compared with alpha1beta3 receptors, indicating a possible role for the gamma2 subunit in CaMK-II-mediated phosphorylation. In conclusion, CaMK-II can upregulate the function of GABA(A) receptors expressed in neurons or a neuronal cell line that is dependent on the beta subunit co-assembled into the receptor complex.

  12. Simvastatin pretreatment protects cerebrum from neuronal injury by decreasing the expressions of phosphor-CaMK II and AQP4 in ischemic stroke rats.

    Science.gov (United States)

    Zhu, Min-xia; Lu, Chao; Xia, Chun-mei; Qiao, Zhong-wei; Zhu, Da-nian

    2014-12-01

    Excitotoxicity and cytotoxic edema are the two major factors resulting in neuronal injury during brain ischemia and reperfusion. Ca2+/calmodulin-dependent protein kinase II (CaMK II), the downstream signal molecular of N-methyl-D-aspartate receptors (NMDARs), is a mediator in the excitotoxicity. Aquaporin 4 (AQP4), expressed mainly in the brain, is an important aquaporin to control the flux of water. In a previous study, we had reported that pretreatment of simvastatin protected the cerebrum from ischemia and reperfusion injury by decreasing neurological deficit score and infarct area (Zhu et al. PLoS One 7:e51552, 2012). The present study used a middle cerebral artery occlusion (MCAO) model to further explore the pleiotropic effect of simvastatin via CaMK II and AQP4. The results showed that simvastatin reduced degenerated cells and brain edema while decreasing the protein expressions of phosphor-CaMK II and AQP4, and increasing the ratios of Bcl-2/Bax, which was independent of cholesterol-lowering effect. Immunocomplexes formed between the subunit of NMDARs-NR3A and AQP4 were detected for the first time. It was concluded that simvastatin could protect the cerebrum from neuronal excitotoxicity and cytotoxic edema by downregulating the expressions of phosphor-CaMK II and AQP4, and that the interaction between NR3A and AQP4 might provide the base for AQP4 involving in the signaling pathways mediated by NMDARs.

  13. Vector quarks in the Higgs triplet model

    Science.gov (United States)

    Bahrami, Sahar; Frank, Mariana

    2014-08-01

    We analyze the effects of introducing vector fermions in the Higgs triplet model. In this scenario, the model contains, in addition to the Standard Model particle content, one triplet Higgs representation and a variety of vectorlike fermion states, including singlet, doublet, and triplet states. We investigate the electroweak precision variables and impose restrictions on model parameters. We show that, for some representations, introducing vector quarks significantly alters the constraints on the mass of the doubly charged Higgs boson, bringing it in closer agreement with present experimental constraints. We also study the effects of introducing the vectorlike fermions on neutral Higgs phenomenology, in particular on the loop-dominated decays H→γγ and H→Zγ, and the restrictions they impose on the parameter space.

  14. A code for optimising triplet layout

    CERN Document Server

    AUTHOR|(CDS)2141109; Seryi, Andrei; Abelleira, Jose; Cruz Alaniz, Emilia

    2017-01-01

    One of the main challenges when designing final focus systems of particle accelerators is maximising the beam stay clear in the strong quadrupole magnets of the inner triplet. Moreover it is desirable to keep the quadrupoles in the inner triplet as short as possible for space and costs reasons but also to reduce chromaticity and simplify corrections schemes. An algorithm that explores the triplet parameter space to optimise both these aspects was written. It uses thin lenses as a first approximation for a broad parameter scan and MADX for more precise calculations. The thin lens algorithm is significantly faster than a full scan using MADX and relatively precise at indicating the approximate area where the optimum solution lies.

  15. Variation of Supergranule Parameters with Solar Cycles: Results from Century-long Kodaikanal Digitized Ca ii K Data

    Energy Technology Data Exchange (ETDEWEB)

    Chatterjee, Subhamoy; Mandal, Sudip; Banerjee, Dipankar, E-mail: dipu@iiap.res.in [Indian Institute of Astrophysics, Koramangala, Bangalore 560034 (India)

    2017-06-01

    The Ca ii K spectroheliograms spanning over a century (1907–2007) from Kodaikanal Solar Observatory, India, have recently been digitized and calibrated. Applying a fully automated algorithm (which includes contrast enhancement and the “Watershed method”) to these data, we have identified the supergranules and calculated the associated parameters, such as scale, circularity, and fractal dimension. We have segregated the quiet and active regions and obtained the supergranule parameters separately for these two domains. In this way, we have isolated the effect of large-scale and small-scale magnetic fields on these structures and find a significantly different behavior of the supergranule parameters over solar cycles. These differences indicate intrinsic changes in the physical mechanism behind the generation and evolution of supergranules in the presence of small-scale and large-scale magnetic fields. This also highlights the need for further studies using solar dynamo theory along with magneto-convection models.

  16. Investigation of Neuronal Cell Type-Specific Gene Expression of Ca2+/Calmodulin-dependent Protein Kinase II.

    Directory of Open Access Journals (Sweden)

    Mima Kazuko

    2002-01-01

    Full Text Available The promoter activity of the rat Ca2+/calmodulin-dependent protein kinase II gene was analyzed using the luciferase reporter gene in neuronal and non-neuronal cell lines. Neuronal cell type-specific promoter activity was found in the 5'-flanking region of &agr; and &bgr; isoform genes of the kinase. Silencer elements were also found further upstream of promoter regions. A brain-specific protein bound to the DNA sequence of the 5'-flanking region of the gene was found by gel mobility shift analysis in the nuclear extract of the rat brain, including the cerebellum, forebrain, and brainstem, but not in that of non-neuronal tissues, including liver, kidney and spleen. The luciferase expression system and gel shift analysis can be used as an additional and better index by which to monitor gene expression in most cell types.

  17. Odd triplet superconductivity in ultrasmall quantum dots

    Energy Technology Data Exchange (ETDEWEB)

    Weiss, Stephan; Koenig, Juergen [Theoretische Physik, Universitaet Duisburg-Essen and CENIDE (Germany); Sothmann, Bjoern [Institut fuer Theoretische Physik und Astrophysik, Universitaet Wuerzburg (Germany)

    2016-07-01

    We report on the possibility to create odd frequency Cooper pairs in proximized interacting quantum dots attached to ferromagnetic leads. Spin blockade effects together with induced superconductivity allow electron pairs with same spin at different times to carry superconducting correlations. Besides the conventional finite singlet pairing amplitude on the dot, only odd frequency triplet pairing is possible here. This is in contrast to the double dot case. We demonstrate how the order parameter for odd-frequency triplet pairing as well as the differential Andreev conductance are influenced when tuning gate and/or bias voltages, the angle of magnetizations of the leads and the coupling to the nearby superconductor.

  18. Ultrabright fluorescent OLEDS using triplet sinks

    Science.gov (United States)

    Zhang, Yifan; Forrest, Stephen R; Thompson, Mark

    2013-06-04

    A first device is provided. The first device further comprises an organic light emitting device. The organic light emitting device further comprises an anode, a cathode, and an emissive layer disposed between the anode and the cathode. The emissive layer further comprises an organic host compound, an organic emitting compound capable of fluorescent emission at room temperature, and an organic dopant compound. The triplet energy of the dopant compound is lower than the triplet energy of the host compound. The dopant compound does not strongly absorb the fluorescent emission of the emitting compound.

  19. Direct Detection of Oxygen Ligation to the Mn4Ca Cluster of Photosystem II by X-ray Emission Spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Pushkar, Yulia; Long, Xi; Glatzel, Pieter; Brudvig, Gary W.; Dismukes, G. Charles; Collins, Terrence J.; Yachandra, Vittal K.; Yano, Junko; Bergmann, Uwe

    2009-06-16

    Ligands play critical roles during the catalytic reactions in metalloproteins through bond formation/breaking, protonation/deprotonation, and electron/spin delocalization. While there are well-defined element-specific spectroscopic handles, such as X-ray spectroscopy and EPR, to follow the chemistry of metal catalytic sites in a large protein matrix, directly probing particular ligand atoms like C, N, and O is challenging due to their abundance in the protein. FTIR/Raman and ligand-sensitive EPR techniques such as ENDOR and ESEEM have been applied to study metal-ligand interactions. X-ray absorption spectroscopy (XAS) can also indirectly probe the ligand environment; its element-specificity allows us to focus only on the catalytic metal site, and EXAFS and XANES provide metal-ligand distances, coordination numbers, and symmetry of ligand environments. However, the information is limited, since one cannot distinguish among ligand elements with similar atomic number (i.e. C, N. and O). As an alternative and a more direct method to probe the specific metal-ligand chemistry in the protein matrix, we investigated the application of X-ray emission spectroscopy (XES). Using this technique we have identified the oxo-bridging ligands of the Mn{sub 4}Ca complex of photosystem II (PS II), a multisubunit membrane protein, that catalyzes the water oxidizing reaction. The catalytic mechanism has been studied intensively by Mn XAS. The fundamental question of this reaction, however, is how the water molecules are ligated to the Mn{sub 4}Ca cluster and how the O-O bond formation occurs before the evolution of O{sub 2}. This implies that it is necessary to follow the chemistry of the oxygen ligands in order to understand the mechanism.

  20. Complicaciones tardías en diabetes mellitus tipo 2 en el Hospital II Essalud - Cañete

    Directory of Open Access Journals (Sweden)

    Charlton Fernando Untiveros Mayorga

    2004-04-01

    Full Text Available Objetivo: Determinar las características clínicas y las complicaciones tardías en los pacientes con diabetes tipo 2 atendidos en los consultorios de medicina general y del Programa de Diabetes del Hospital II EsSALUD-Cañete. Material y Métodos: Se realizó un estudio descriptivo de serie de casos en el que se evaluaron 94 pacientes con diabetes tipo 2 elegidos aleatoriamente durante su control ambulatorio, realizándose una entrevista y evaluación clínica durante los meses de junio y julio del 2001. Resultados: La población de pacientes estudiada tuvo una edad promedio de 64.56 + 11.61. Cincuenta y tres pacientes eran mujeres (56.4%. El 68.1% de los pacientes recibían hipoglicemiantes orales y el 11.7% requerían del uso de insulina. Los transtornos lipídicos predominantes fueron la elevación del LDL-Colesterol y disminución del HDL-Colesterol. La retinopatía diabética (88.9% e hipertensión arterial (61.3% fueron las complicaciones más frecuentes. Vasculopatía periférica, neuropatía periférica y neuropatía autonómica fueron otras complicaciones crónicas frecuentes halladas en la población de estudio. Conclusiones: Las complicaciones cardiovasculares (micro y macrovasculares en la población de pacientes con diabetes tipo 2 atendidos ambulatoriamente en el Hospital II EsSALUD-Cañete fueron las más frecuentes. (Rev Med Hered 2004; 15:64-69.

  1. Complexin II plays a positive role in Ca2+-triggered exocytosis by facilitating vesicle priming

    DEFF Research Database (Denmark)

    Cai, Haijiang; Reim, Kerstin; Varoqueaux, Frederique

    2008-01-01

    SNARE-mediated exocytosis is a multistage process central to synaptic transmission and hormone release. Complexins (CPXs) are small proteins that bind very rapidly and with a high affinity to the SNARE core complex, where they have been proposed recently to inhibit exocytosis by clamping...... the complex and inhibiting membrane fusion. However, several other studies also suggest that CPXs are positive regulators of neurotransmitter release. Thus, whether CPXs are positive or negative regulators of exocytosis is not known, much less the stage in the vesicle life cycle at which they function. Here......, we systematically dissect the vesicle stages leading up to exocytosis using a knockout-rescue strategy in a mammalian model system. We show that adrenal chromaffin cells from CPX II knockout mice exhibit markedly diminished releasable vesicle pools (comprising the readily and slowly releasable pools...

  2. Phosphorylation of the PCNA binding domain of the large subunit of replication factor C by Ca2+/calmodulin-dependent protein kinase II inhibits DNA synthesis

    DEFF Research Database (Denmark)

    Maga, G; Mossi, R; Fischer, R

    1997-01-01

    delta and epsilon. The DNA and PCNA binding domains of the large 140 kDa subunit of human RF-C have been recently cloned [Fotedar, R., Mossi, R., Fitzgerald, P., Rousselle, T., Maga, G., Brickner, H., Messier, H., Khastilba. S., Hübscher, U., & Fotedar, A. (1996) EMBO J. 15, 4423-4433]. Here we show...... that the PCNA binding domain is phosphorylated by the Ca2+/calmodulin-dependent protein kinase II (CaMKII), an enzyme required for cell cycle progression in eukaryotic cells. The DNA binding domain, on the other hand, is not phosphorylated. Phosphorylation by CaMKII reduces the binding of PCNA to RF...

  3. Triplet transport in thin films: fundamentals and applications.

    Science.gov (United States)

    Li, Xin; Tang, Ming Lee

    2017-04-18

    Triplet excitons are key players in multi-excitonic processes like singlet fission and triplet-triplet annihilation based photon upconversion, which may be useful in next-generation photovoltaic devices, photocatalysis and bioimaging. Here, we present an overview of experimental and theoretical work on triplet energy transfer, with a focus on triplet transport in thin films. We start with the theory describing Dexter-mediated triplet energy transfer and the fundamental parameters controlling this process. Then we summarize current experimental methods used to measure the triplet exciton diffusion length. Finally, the use of hierarchically ordered structures to improve the triplet diffusion length is presented, before concluding with an outlook on the remaining challenges.

  4. Structural basis for triplet repeat disorders

    DEFF Research Database (Denmark)

    Baldi, Pierre; Brunak, Søren; Chauvin, Yves

    1999-01-01

    Motivation: Over a dozen major degenerative disorders, including myotonic distrophy, Huntington's disease and fragile X syndrome result from unstable expansions of particular trinucleotides. Remarkably, only some of all the possible triplets, namely CAG/CTG, CGG/CCG and GAA/TTC, have been...

  5. The role of Ca{sup 2+}/calmodulin-dependent protein kinase II and calcineurin in TNF-α-induced myocardial hypertrophy

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Gui-Jun [Department of Infectious Diseases, First Affiliated Hospital, China Medical University, Shenyang Liaoning Province (China); Liaoning Medical College, Jinzhou (China); Wang, Hong-Xin; Yao, Yu-Sheng; Guo, Lian-Yi [Liaoning Medical College, Jinzhou (China); Liu, Pei [Department of Infectious Diseases, First Affiliated Hospital, China Medical University, Shenyang Liaoning Province (China)

    2012-07-27

    We investigated whether Ca{sup 2+}/calmodulin-dependent kinase II (CaMKII) and calcineurin (CaN) are involved in myocardial hypertrophy induced by tumor necrosis factor α (TNF-α). The cardiomyocytes of neonatal Wistar rats (1-2 days old) were cultured and stimulated by TNF-α (100 µg/L), and Ca{sup 2+} signal transduction was blocked by several antagonists, including BAPTA (4 µM), KN-93 (0.2 µM) and cyclosporin A (CsA, 0.2 µM). Protein content, protein synthesis, cardiomyocyte volumes, [Ca{sup 2+}]{sub i} transients, CaMKIIδ{sub B} and CaN were evaluated by the Lowry method, [{sup 3}H]-leucine incorporation, a computerized image analysis system, a Till imaging system, and Western blot analysis, respectively. TNF-α induced a significant increase in protein content in a dose-dependent manner from 10 µg/L (53.56 µg protein/well) to 100 µg/L (72.18 µg protein/well), and in a time-dependent manner from 12 h (37.42 µg protein/well) to 72 h (42.81 µg protein/well). TNF-α (100 µg/L) significantly increased the amplitude of spontaneous [Ca{sup 2+}]{sub i} transients, the total protein content, cell size, and [{sup 3}H]-leucine incorporation in cultured cardiomyocytes, which was abolished by 4 µM BAPTA, an intracellular Ca{sup 2+} chelator. The increases in protein content, cell size and [{sup 3}H]-leucine incorporation were abolished by 0.2 µM KN-93 or 0.2 µM CsA. TNF-α increased the expression of CaMKIIδ{sub B} by 35.21% and that of CaN by 22.22% compared to control. These effects were abolished by 4 µM BAPTA, which itself had no effect. These results suggest that TNF-α induces increases in [Ca{sup 2+}]{sub i}, CaMKIIδ{sub B} and CaN and promotes cardiac hypertrophy. Therefore, we hypothesize that the Ca{sup 2+}/CaMKII- and CaN-dependent signaling pathways are involved in myocardial hypertrophy induced by TNF-α.

  6. Interglobular Diffusion of an Energy Donor in Triplet-Triplet Energy Transfer in Proteins

    Directory of Open Access Journals (Sweden)

    Andrey G. Melnikov

    2013-01-01

    Full Text Available The triplet-triplet energy transfer between polar molecules of luminescent probe (eosin as an energy donor and nonpolar molecules of energy acceptor (anthracene is studied. Both the donor and the acceptor are bound to human serum albumin by noncovalent bonds. A dependence of rate constant of triplet-triplet energy transfer on human serum albumin concentration is revealed. A rate constant of eosin output from protein globules is determined. It is shown that the energy transfer occurs as a result of interglobular diffusion of eosin. The obtained results indicate that a protein-luminescent probe based sensor can be used for testing a concentration of polycyclic aromatic hydrocarbons in proteins.

  7. Asymmetric inelastic inert doublet dark matter from triplet scalar leptogenesis

    Energy Technology Data Exchange (ETDEWEB)

    Arina, Chiara, E-mail: chiara.arina@physik.rwth-aachen.de [Institut fuer Theoretische Teilchenphysik und Kosmologie, RWTH Aachen, 52056 Aachen (Germany); Sahu, Narendra, E-mail: Narendra.Sahu@ulb.ac.be [Service de Physique Theorique, Universite Libre de Bruxelles, CP225, Bld du Triomphe, 1050 Brussels (Belgium)

    2012-01-21

    The nature of dark matter (DM) particles and the mechanism that provides their measured relic abundance are currently unknown. In this paper we investigate inert scalar and vector like fermion doublet DM candidates with a charge asymmetry in the dark sector, which is generated by the same mechanism that provides the baryon asymmetry, namely baryogenesis-via-leptogenesis induced by decays of scalar triplets. At the same time the model gives rise to neutrino masses in the ballpark of oscillation experiments via type II seesaw. We discuss possible sources of depletion of asymmetry in the DM and visible sectors and solve the relevant Boltzmann equations for quasi-equilibrium decay of triplet scalars. A Monte-Carlo-Markov-Chain analysis is performed for the whole parameter space. The survival of the asymmetry in the dark sector leads to inelastic scattering off nuclei. We then apply Bayesian statistic to infer the model parameters favoured by the current experimental data, in particular the DAMA annual modulation and XENON100 exclusion limit. The latter strongly disfavours asymmetric scalar doublet DM of mass O(TeV) as required by DM-DM-bar oscillations, while an asymmetric vector like fermion doublet DM with mass around 100 GeV is a good candidate for DAMA annual modulation yet satisfying the constraints from XENON100 data.

  8. Intracellular translocation of calmodulin and Ca{sup 2+}/calmodulin-dependent protein kinase II during the development of hypertrophy in neonatal cardiomyocytes

    Energy Technology Data Exchange (ETDEWEB)

    Gangopadhyay, Jaya Pal, E-mail: jaya@bbri.org [Boston Biomedical Research Institute, Watertown, MA 02472 (United States); Ikemoto, Noriaki [Boston Biomedical Research Institute, Watertown, MA 02472 (United States); Department of Neurology, Harvard Medical School, Boston, MA 02115 (United States)

    2010-05-28

    We have recently shown that stimulation of cultured neonatal cardiomyocytes with endothelin-1 (ET-1) first produces conformational disorder within the ryanodine receptor (RyR2) and diastolic Ca{sup 2+} leak from the sarcoplasmic reticulum (SR), then develops hypertrophy (HT) in the cardiomyocytes (Hamada et al., 2009 ). The present paper addresses the following question. By what mechanism does crosstalk between defective operation of RyR2 and activation of the HT gene program occur? Here we show that the immuno-stain of calmodulin (CaM) is localized chiefly in the cytoplasmic area in the control cells; whereas, in the ET-1-treated/hypertrophied cells, major immuno-staining is localized in the nuclear region. In addition, fluorescently labeled CaM that has been introduced into the cardiomyocytes using the BioPORTER system moves from the cytoplasm to the nucleus with the development of HT. The immuno-confocal imaging of Ca{sup 2+}/CaM-dependent protein kinase II (CaMKII) also shows cytoplasm-to-nucleus shift of the immuno-staining pattern in the hypertrophied cells. In an early phase of hypertrophic growth, the frequency of spontaneous Ca{sup 2+} transients increases, which accompanies with cytoplasm-to-nucleus translocation of CaM. In a later phase of hypertrophic growth, further increase in the frequency of spontaneous Ca{sup 2+} transients results in the appearance of trains of Ca{sup 2+} spikes, which accompanies with nuclear translocation of CaMKII. The cardio-protective reagent dantrolene (the reagent that corrects the de-stabilized inter-domain interaction within the RyR2 to a normal mode) ameliorates aberrant intracellular Ca{sup 2+} events and prevents nuclear translocation of both CaM and CaMKII, then prevents the development of HT. These results suggest that translocation of CaM and CaMKII from the cytoplasm to the nucleus serves as messengers to transmit the pathogenic signal elicited in the surface membrane and in the RyR2 to the nuclear transcriptional

  9. Age-dependent targeting of protein phosphatase 1 to Ca2+/calmodulin-dependent protein kinase II by spinophilin in mouse striatum.

    Directory of Open Access Journals (Sweden)

    Anthony J Baucum

    Full Text Available Mechanisms underlying age-dependent changes of dendritic spines on striatal medium spiny neurons are poorly understood. Spinophilin is an F-actin- and protein phosphatase 1 (PP1-binding protein that targets PP1 to multiple downstream effectors to modulate dendritic spine morphology and function. We found that calcium/calmodulin-dependent protein kinase II (CaMKII directly and indirectly associates with N- and C-terminal domains of spinophilin, but F-actin can displace CaMKII from the N-terminal domain. Spinophilin co-localizes PP1 with CaMKII on the F-actin cytoskeleton in heterologous cells, and spinophilin co-localizes with synaptic CaMKII in neuronal cultures. Thr286 autophosphorylation enhances the binding of CaMKII to spinophilin in vitro and in vivo. Although there is no change in total levels of Thr286 autophosphorylation, maturation from postnatal day 21 into adulthood robustly enhances the levels of CaMKII that co-immunoprecipitate with spinophilin from mouse striatal extracts. Moreover, N- and C-terminal domain fragments of spinophilin bind more CaMKII from adult vs. postnatal day 21 striatal lysates. Total levels of other proteins that interact with C-terminal domains of spinophilin decrease during maturation, perhaps reducing competition for CaMKII binding to the C-terminal domain. In contrast, total levels of α-internexin and binding of α-internexin to the spinophilin N-terminal domain increases with maturation, perhaps bridging an indirect interaction with CaMKII. Moreover, there is an increase in the levels of myosin Va, α-internexin, spinophilin, and PP1 in striatal CaMKII immune complexes isolated from adult and aged mice compared to those from postnatal day 21. These changes in spinophilin/CaMKII interactomes may contribute to changes in striatal dendritic spine density, morphology, and function during normal postnatal maturation and aging.

  10. Calcium elevation at fertilization coordinates phosphorylation of XErp1/Emi2 by Plx1 and CaMK II to release metaphase arrest by cytostatic factor.

    Science.gov (United States)

    Liu, Junjun; Maller, James L

    2005-08-23

    Vertebrate oocytes are arrested at second meiotic metaphase by cytostatic factor (CSF) while awaiting fertilization. Accumulating evidence has suggested that inhibition of the anaphase-promoting complex/cyclosome (APC/C) is responsible for this arrest. Xenopus polo-like kinase 1 (Plx1) is required for activation of the APC/C at the metaphase-anaphase transition, and calcium elevation, upon fertilization/activation of eggs, acting through calmodulin-dependent kinase II (CaMKII) is sufficient to activate the APC/C and terminate CSF arrest. However, connections between the Plx1 pathway and the CaMKII pathway have not been identified. Overexpression of Plx1 causes CSF release in the absence of calcium, and depletion of Plx1 from egg extracts blocks induction of CSF release by calcium and CaMKII. Prior phosphorylation of the APC/C inhibitor XErp1/Emi2 by CaMK II renders it a good substrate for Plx1, and phosphorylation by both kinases together promotes its degradation in egg extracts. The pathway is enhanced by the ability of Plx1 to cause calcium-independent activation of CaMKII. The results identify the targets of CaMKII and Plx1 that promote egg activation and define the first known pathway of CSF release in which an APC/C inhibitor is targeted for degradation only when both CaMKII and Plx1 are active after calcium elevation at fertilization. Plx1 with an intact polo-box domain is necessary for release of CSF arrest and sufficient when overexpressed. It acts at the same level as CaMKII in the pathway of calcium-induced CSF release by cooperating with CaMKII to regulate APC/C regulator(s), such as XErp1/Emi2, rather than by directly activating the APC/C itself.

  11. An atlas of Calcium triplet spectra of active galaxies

    CERN Document Server

    Garcia-Rissmann, A; Asari, N V; Fernandes, R C; Schmitt, H; González-Delgado, R M; Storchi-Bergmann, T

    2005-01-01

    We present a spectroscopic atlas of active galactic nuclei covering the region around the 8498, 8542, 8662 Calcium triplet (CaT) lines. The sample comprises 78 objects, divided into 43 Seyfert 2s, 26 Seyfert 1s, 3 Starburst and 6 normal galaxies. The spectra pertain to the inner ~300 pc in radius, and thus sample the central kinematics and stellar populations of active galaxies. The data are used to measure stellar velocity dispersions (sigma_star) both with cross-correlation and direct fitting methods. These measurements are found to be in good agreement with each-other and with those in previous studies for objects in common. The CaT equivalent width is also measured. We find average values and sample dispersions of W_CaT of 4.6+/-2.0, 7.0 and 7.7+/-1.0 angstrons for Seyfert 1s, Seyfert 2s and normal galaxies, respectively. We further present an atlas of [SIII]\\lambda 9069 emission line profiles for a subset of 40 galaxies. These data are analyzed in a companion paper which addresses the connection between ...

  12. X-Ray Damage to the Mn4Ca Complex in Single Crystals of Photosystem II: A Case Study for Metalloprotein Crystallography

    National Research Council Canada - National Science Library

    Junko Yano; Jan Kern; Klaus-Dieter Irrgang; Matthew J. Latimer; Uwe Bergmann; Pieter Glatzel; Yulia Pushkar; Jacek Biesiadka; Bernhard Loll; Kenneth Sauer; Johannes Messinger; Athina Zouni; Vittal K. Yachandra; Judith P. Klinman

    2005-01-01

    X-ray absorption spectroscopy was used to measure the damage caused by exposure to x-rays to the Mn Ca active site in single crystals of photosystem II as a function of dose and energy of x-rays, temperature, and time...

  13. Triplet excited state properties in variable gap π-conjugated donor–acceptor–donor chromophores

    KAUST Repository

    Cekli, Seda

    2016-02-12

    A series of variable band-gap donor–acceptor–donor (DAD) chromophores capped with platinum(II) acetylide units has been synthesized and fully characterized by electrochemical and photophysical methods, with particular emphasis placed on probing triplet excited state properties. A counter-intuitive trend of increasing fluorescence quantum efficiency and lifetime with decreasing excited state energy (optical gap) is observed across the series of DAD chromophores. Careful study of the excited state dynamics, including triplet yields (as inferred from singlet oxygen sensitization), reveals that the underlying origin of the unusual trend in the fluorescence parameters is that the singlet–triplet intersystem crossing rate and yield decrease with decreasing optical gap. It is concluded that the rate of intersystem crossing decreases as the LUMO is increasingly localized on the acceptor unit in the DAD chromophore, and this result is interpreted as arising because the extent of spin–orbit coupling induced by the platinum heavy metal centers decreases as the LUMO is more localized on the acceptor. In addition to the trend in intersystem crossing, the results show that the triplet decay rates follow the Energy Gap Law correlation over a 1.8 eV range of triplet energy and 1000-fold range of triplet decay rates. Finally, femtosecond transient absorption studies for the DAD chromophores reveals a strong absorption in the near-infrared region which is attributed to the singlet excited state. This spectral band appears to be general for DAD chromophores, and may be a signature of the charge transfer (CT) singlet excited state.

  14. The MUSCLES Treasury Survey. IV. Scaling Relations for Ultraviolet, Ca ii K, and Energetic Particle Fluxes from M Dwarfs

    Energy Technology Data Exchange (ETDEWEB)

    Youngblood, Allison; France, Kevin; Loyd, R. O. Parke; Mason, James P. [Laboratory for Atmospheric and Space Physics, University of Colorado, 600 UCB, Boulder, CO 80309 (United States); Brown, Alexander [Center for Astrophysics and Space Astronomy, University of Colorado, 389 UCB, Boulder, CO 80309 (United States); Schneider, P. Christian [European Space Research and Technology Centre (ESA/ESTEC), Keplerlaan 1, 2201 AZ Noordwijk (Netherlands); Tilley, Matt A. [Department of Earth and Space Sciences, University of Washington, Box 351310, Seattle, WA 98195 (United States); Berta-Thompson, Zachory K.; Kowalski, Adam [Department of Astrophysical and Planetary Sciences, University of Colorado, 2000 Colorado Ave., Boulder, CO 80305 (United States); Buccino, Andrea; Mauas, Pablo J. D. [Dpto. de Física, Facultad de Ciencias Exactas y Naturales (FCEN), Universidad de Buenos Aires (UBA), Buenos Aires (Argentina); Froning, Cynthia S. [Department of Astronomy/McDonald Observatory, C1400, University of Texas at Austin, Austin, TX 78712 (United States); Hawley, Suzanne L. [Astronomy Department, Box 351580, University of Washington, Seattle, WA 98195 (United States); Linsky, Jeffrey [JILA, University of Colorado and NIST, 440 UCB, Boulder, CO 80309 (United States); Redfield, Seth [Astronomy Department and Van Vleck Observatory, Wesleyan University, Middletown, CT 06459 (United States); Miguel, Yamila [Observatoire de la Cote d’Azur, Boulevard de l’Observatoire, CS 34229 F-06304 NICE Cedex 4 (France); Newton, Elisabeth R. [Massachusetts Institute of Technology, 77 Massachusetts Ave., Cambridge, MA 02138 (United States); Rugheimer, Sarah, E-mail: allison.youngblood@colorado.edu [School of Earth and Environmental Sciences, University of St. Andrews, Irvine Building, North Street, St. Andrews, KY16 9AL (United Kingdom); and others

    2017-07-01

    Characterizing the UV spectral energy distribution (SED) of an exoplanet host star is critically important for assessing its planet’s potential habitability, particularly for M dwarfs, as they are prime targets for current and near-term exoplanet characterization efforts and atmospheric models predict that their UV radiation can produce photochemistry on habitable zone planets different from that on Earth. To derive ground-based proxies for UV emission for use when Hubble Space Telescope ( HST ) observations are unavailable, we have assembled a sample of 15 early to mid-M dwarfs observed by HST and compared their nonsimultaneous UV and optical spectra. We find that the equivalent width of the chromospheric Ca ii K line at 3933 Å, when corrected for spectral type, can be used to estimate the stellar surface flux in ultraviolet emission lines, including H i Ly α . In addition, we address another potential driver of habitability: energetic particle fluxes associated with flares. We present a new technique for estimating soft X-ray and >10 MeV proton flux during far-UV emission line flares (Si iv and He ii) by assuming solar-like energy partitions. We analyze several flares from the M4 dwarf GJ 876 observed with HST and Chandra as part of the MUSCLES Treasury Survey and find that habitable zone planets orbiting GJ 876 are impacted by large Carrington-like flares with peak soft X-ray fluxes ≥10{sup −3} W m{sup −2} and possible proton fluxes ∼10{sup 2}–10{sup 3} pfu, approximately four orders of magnitude more frequently than modern-day Earth.

  15. The MUSCLES Treasury Survey. IV. Scaling Relations for Ultraviolet, Ca II K, and Energetic Particle Fluxes from M Dwarfs

    Science.gov (United States)

    Youngblood, Allison; France, Kevin; Parke Loyd, R. O.; Brown, Alexander; Mason, James P.; Schneider, P. Christian; Tilley, Matt A.; Berta-Thompson, Zachory K.; Buccino, Andrea; Froning, Cynthia S.; Hawley, Suzanne L.; Linsky, Jeffrey; Mauas, Pablo J. D.; Redfield, Seth; Kowalski, Adam; Miguel, Yamila; Newton, Elisabeth R.; Rugheimer, Sarah; Segura, Antígona; Roberge, Aki; Vieytes, Mariela

    2017-07-01

    Characterizing the UV spectral energy distribution (SED) of an exoplanet host star is critically important for assessing its planet’s potential habitability, particularly for M dwarfs, as they are prime targets for current and near-term exoplanet characterization efforts and atmospheric models predict that their UV radiation can produce photochemistry on habitable zone planets different from that on Earth. To derive ground-based proxies for UV emission for use when Hubble Space Telescope (HST) observations are unavailable, we have assembled a sample of 15 early to mid-M dwarfs observed by HST and compared their nonsimultaneous UV and optical spectra. We find that the equivalent width of the chromospheric Ca II K line at 3933 Å, when corrected for spectral type, can be used to estimate the stellar surface flux in ultraviolet emission lines, including H I Lyα. In addition, we address another potential driver of habitability: energetic particle fluxes associated with flares. We present a new technique for estimating soft X-ray and >10 MeV proton flux during far-UV emission line flares (Si IV and He II) by assuming solar-like energy partitions. We analyze several flares from the M4 dwarf GJ 876 observed with HST and Chandra as part of the MUSCLES Treasury Survey and find that habitable zone planets orbiting GJ 876 are impacted by large Carrington-like flares with peak soft X-ray fluxes ≥10-3 W m-2 and possible proton fluxes ˜102-103 pfu, approximately four orders of magnitude more frequently than modern-day Earth.

  16. Synthesis and Exciton Dynamics of Triplet Sensitized Conjugated Polymers

    KAUST Repository

    Andernach, Rolf

    2015-07-22

    We report the synthesis of a novel polythiophene-based host-guest copolymer incorporating a Pt-porphyrin complex (TTP-Pt) into the backbone for efficient singlet to triplet polymer exciton sensitization. We elucidated the exciton dynamics in thin films of the material by means of Transient Absorption Spectrosopcy (TAS) on multiple timescales and investigated the mechanism of triplet exciton formation. During sensitization, single exciton diffusion is followed by exciton transfer from the polymer backbone to the complex where it undergoes intersystem crossing to the triplet state of the complex. We directly monitored the triplet exciton back transfer from the Pt-porphyrin to the polymer and find that 60% of the complex triplet excitons are transferred with a time constant of 1087 ps. We propose an equilibrium between polymer and porphyrin triplet states as a result of the low triplet diffusion length in the polymer backbone and hence an increased local triplet population resulting in increased triplet-triplet annihilation. This novel system has significant implications for the design of novel materials for triplet sensitized solar cells and up-conversion layers.

  17. Combining minutiae triplets and quaternion orthogonal moments for fingerprint verification

    Science.gov (United States)

    Haloui, Lamyae; En-Nahnahi, Noureddine; Ouatik, Said El Alaoui

    2017-05-01

    We introduce a hybrid fingerprint recognition method built from minutiae and quaternion orthogonal moments. The proposed algorithm includes four steps: extraction of the minutiae triplets (m-triplets), first pass of triplets minutiae matching, validation step of these triplets by characterizing their neighboring gray-level image information through feature vectors of quaternion radial moments, and an adequate similarity measure. By boosting the local minutiae matching step, we avoid consolidation and global matching. To show the added-value of our method, several algorithms for extracting and matching m-triplets are considered and an experimental comparison is established. Experiments are carried out using all four parts of the FVC2004 dataset. Results indicate that the combination of the geometrical features and the quaternion radial moments of the m-triplets leads to an improvement in the overall fingerprint matching performance and demonstrate the expected gain of integrating a validation step in an m-triplets based fingerprint matching algorithm.

  18. Cardiac CaM Kinase II Genes δ and γ Contribute to Adverse Remodeling but Redundantly Inhibit Calcineurin-Induced Myocardial Hypertrophy

    Science.gov (United States)

    Kreusser, Michael M.; Lehmann, Lorenz H.; Keranov, Stanislav; Hoting, Marc-Oscar; Oehl, Ulrike; Kohlhaas, Michael; Reil, Jan-Christian; Neumann, Kay; Schneider, Michael D.; Hill, Joseph A.; Dobrev, Dobromir; Maack, Christoph; Maier, Lars S.; Gröne, Hermann-Josef; Katus, Hugo A.; Olson, Eric N.; Backs, Johannes

    2014-01-01

    Background Ca2+-dependent signaling through CaM Kinase II (CaMKII) and calcineurin was suggested to contribute to adverse cardiac remodeling. However, the relative importance of CaMKII versus calcineurin for adverse cardiac remodeling remained unclear. Methods and Results We generated double-knockout mice (DKO) lacking the 2 cardiac CaMKII genes δ and γ specifically in cardiomyocytes. We show that both CaMKII isoforms contribute redundantly to phosphorylation not only of phospholamban, ryanodine receptor 2, and histone deacetylase 4, but also calcineurin. Under baseline conditions, DKO mice are viable and display neither abnormal Ca2+ handling nor functional and structural changes. On pathological pressure overload and β-adrenergic stimulation, DKO mice are protected against cardiac dysfunction and interstitial fibrosis. But surprisingly and paradoxically, DKO mice develop cardiac hypertrophy driven by excessive activation of endogenous calcineurin, which is associated with a lack of phosphorylation at the auto-inhibitory calcineurin A site Ser411. Likewise, calcineurin inhibition prevents cardiac hypertrophy in DKO. On exercise performance, DKO mice show an exaggeration of cardiac hypertrophy with increased expression of the calcineurin target gene RCAN1-4 but no signs of adverse cardiac remodeling. Conclusions We established a mouse model in which CaMKII’s activity is specifically and completely abolished. By the use of this model we show that CaMKII induces maladaptive cardiac remodeling while it inhibits calcineurin-dependent hypertrophy. These data suggest inhibition of CaMKII but not calcineurin as a promising approach to attenuate the progression of heart failure. PMID:25124496

  19. Delayed interval delivery in a triplet gestation.

    Science.gov (United States)

    Wooldridge, Rachel J; Oliver, Emily A; Singh, Tulika

    2012-11-27

    A 27-year-old Ghanaian primigravida with a known triamniotic trichorionic triplet pregnancy presented at 17 weeks gestation following a miscarriage of one triplet at home. Examination and investigation revealed no signs of imminent delivery or infection. After careful counselling with regard to prognosis and options available for management, the couple opted for intervention including rescue cerclage. The patient received antibiotic prophylaxis for five days and daily progesterone suppositories until delivery. An ultrasound scan was performed every three weeks to monitor fetal growth and cervical length. At 24 weeks corticosteroids for fetal lung maturity were given. At 31 weeks gestation she experienced spontaneous rupture of membranes followed by active labour and forceps delivery. There were no maternal complications. Both babies were born in a good condition, but required ventilatory support for 72 h.

  20. Delayed interval delivery in a triplet gestation

    Science.gov (United States)

    Wooldridge, Rachel J; Oliver, Emily A; Singh, Tulika

    2012-01-01

    A 27-year-old Ghanaian primigravida with a known triamniotic trichorionic triplet pregnancy presented at 17 weeks gestation following a miscarriage of one triplet at home. Examination and investigation revealed no signs of imminent delivery or infection. After careful counselling with regard to prognosis and options available for management, the couple opted for intervention including rescue cerclage. The patient received antibiotic prophylaxis for five days and daily progesterone suppositories until delivery. An ultrasound scan was performed every three weeks to monitor fetal growth and cervical length. At 24 weeks corticosteroids for fetal lung maturity were given. At 31 weeks gestation she experienced spontaneous rupture of membranes followed by active labour and forceps delivery. There were no maternal complications. Both babies were born in a good condition, but required ventilatory support for 72 h. PMID:23188854

  1. Triplet fermions and Dirac fermions in borophene

    Science.gov (United States)

    Ezawa, Motohiko

    2017-07-01

    Borophene is a monolayer materials made of boron. A perfect planar boropehene called β12 borophene has Dirac cones and they are well reproduced by a tight-binding model according to recent experimental and first-principles calculation results. We explicitly derive a Dirac theory for β12 borophene. Dirac cones are gapless when the inversion symmetry exists, while they are gapped when it is broken. In addition, three-band touching points emerge together with pseudospin triplet fermions when all transfer energy is equal and all onsite energy is equal. The three-band touching is slightly resolved otherwise. We construct effective three-band theories for triplet fermions. We also study the edge states of borophene nanoribbons, which show various behaviors depending on the way of edge terminations.

  2. Twin and Triplet Drugs in Opioid Research

    Science.gov (United States)

    Fujii, Hideaki

    Twin and triplet drugs are defined as compounds that contain respectively two and three pharmacophore components exerting pharmacological effects in a molecule. The twin drug bearing the same pharmacophores is a "symmetrical twin drug", whereas that possessing different pharmacophores is a "nonsymmetrical twin drug." In general, the symmetrical twin drug is expected to produce more potent and/or selective pharmacological effects, whereas the nonsymmetrical twin drug is anticipated to show both pharmacological activities stemming from the individual pharmacophores (dual action). On the other hand, nonsymmetrical triplet drugs, which have two of the same pharmacophores and one different moiety, are expected to elicit both increased pharmacological action and dual action. The two identical portions could bind the same receptor sites simultaneously while the third portion could bind a different receptor site or enzyme. This review will mainly focus on the twin and triplet drugs with an evaluation of their in vivo pharmacological effects, and will also include a description of their pharmacology and synthesis.

  3. Inhibition of late sodium current suppresses calcium-related ventricular arrhythmias by reducing the phosphorylation of CaMK-II and sodium channel expressions.

    Science.gov (United States)

    Wei, Xiao-Hong; Yu, Shan-Dong; Ren, Lu; Huang, Si-Hui; Yang, Qiao-Mei; Wang, Ping; Chu, Yan-Peng; Yang, Wei; Ding, Yan-Sheng; Huo, Yong; Wu, Lin

    2017-04-20

    Cardiac arrhythmias associated with intracellular calcium inhomeostasis are refractory to antiarrhythmic therapy. We hypothesized that late sodium current (I Na) contributed to the calcium-related arrhythmias. Monophasic action potential duration at 90% completion of repolarization (MAPD90) was significantly increased and ventricular arrhythmias were observed in hearts with increased intracellular calcium concentration ([Ca(2+)]i) by using Bay K 8644, and the increase became greater in hearts treated with a combination of ATX-II and Bay K 8644 compared to Bay K 8644 alone. The prolongations caused by Bay K 8644 and frequent episodes of ventricular tachycardias, both in absence and presence of ATX-II, were significantly attenuated or abolished by late I Na inhibitors TTX and eleclazine. In rabbit ventricular myocytes, Bay K 8644 increased I CaL density, calcium transient and myocyte contraction. TTX and eleclazine decreased the amplitude of late I Na, the reverse use dependence of MAPD90 at slower heart rate, and attenuated the increase of intracellular calcium transient and myocyte contraction. TTX diminished the phosphorylation of CaMKII-δ and Nav 1.5 in hearts treated with Bay K 8644 and ATX-II. In conclusion, late I Na contributes to ventricular arrhythmias and its inhibition is plausible to treat arrhythmias in hearts with increased [Ca(2+)]i.

  4. Calmodulin kinase II inhibition limits the pro-arrhythmic Ca2+ waves induced by cAMP-phosphodiesterase inhibitors.

    Science.gov (United States)

    Bobin, Pierre; Varin, Audrey; Lefebvre, Florence; Fischmeister, Rodolphe; Vandecasteele, Grégoire; Leroy, Jérôme

    2016-05-01

    A major concern of using phosphodiesterase (PDE) inhibitors in heart failure is their potential to increase mortality by inducing arrhythmias. By diminishing cyclic adenosine monophosphate (cAMP) hydrolysis, they promote protein kinase A (PKA) activity under β-adrenergic receptor (β-AR) stimulation, hence enhancing Ca(2+) cycling and contraction. Yet, cAMP also activates CaMKII via PKA or the exchange protein Epac, but it remains unknown whether these pathways are involved in the pro-arrhythmic effect of PDE inhibitors. Excitation-contraction coupling was investigated in isolated adult rat ventricular myocytes loaded with Fura-2 and paced at 1 Hz allowing coincident measurement of intracellular Ca(2+) and sarcomere shortening. The PDE4 inhibitor Ro 20-1724 (Ro) promoted the inotropic effects of the non-selective β-AR agonist isoprenaline (Iso) and also spontaneous diastolic Ca(2+) waves (SCWs). PDE4 inhibition potentiated RyR2 and PLB phosphorylation at specific PKA and CaMKII sites increasing sarcoplasmic reticulum (SR) Ca(2+) load and SR Ca(2+) leak measured in a 0Na(+)/0Ca(2+) solution ± tetracaine. PKA inhibition suppressed all the effects of Iso ± Ro, whereas CaMKII inhibition prevented SR Ca(2+) leak and diminished SCW incidence without affecting the inotropic effects of Ro. Inhibition of Epac2 but not Epac1 diminished the occurrence of SCWs. PDE3 inhibition with cilostamide induced an SR Ca(2+) leak, which was also blocked by CaMKII inhibition. Our results show that PDE inhibitors exert inotropic effects via PKA but lead to SCWs via both PKA and CaMKII activation partly via Epac2, suggesting the potential use of CaMKII inhibitors as adjuncts to PDE inhibition to limit their pro-arrhythmic effects. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author 2016. For permissions please email: journals.permissions@oup.com.

  5. Preoperative sensitivity and specificity for early-stage ovarian cancer when combining cancer antigen CA-125II, CA 15-3, CA 72-4, and macrophage colony-stimulating factor using mixtures of multivariate normal distributions

    NARCIS (Netherlands)

    Skates, S.J.; Horick, N.; Yu, Y.H.; Xu, F.J.; Berchuck, A.; Havrilesky, L.J.; de Bruijn, H.W.A.; van der Zee, A.G.J.; Woolas, R.P.; Jacobs, I.J.; Zhang, 27727; Bast, R.C.; Zhang, Z

    2004-01-01

    Purpose In CA-125–based ovarian cancer screening trials, overall specificity and screening sensitivity of ultrasound after an elevated CA-125 exceeded 99.6% and 70%, respectively, thereby yielding a positive predictive value (PPV) exceeding 10%. However, sensitivity for early-stage disease was only

  6. Dentate gyrus-cornu ammonis (CA) 4 volume is decreased and associated with depressive episodes and lipid peroxidation in bipolar II disorder: Longitudinal and cross-sectional analyses.

    Science.gov (United States)

    Elvsåshagen, Torbjørn; Zuzarte, Pedro; Westlye, Lars T; Bøen, Erlend; Josefsen, Dag; Boye, Birgitte; Hol, Per K; Malt, Ulrik F; Young, L Trevor; Andreazza, Ana C

    2016-12-01

    Reduced dentate gyrus volume and increased oxidative stress have emerged as potential pathophysiological mechanisms in bipolar disorder. However, the relationship between dentate gyrus volume and peripheral oxidative stress markers remains unknown. Here, we examined dentate gyrus-cornu ammonis (CA) 4 volume longitudinally in patients with bipolar II disorder (BD-II) and healthy controls and investigated whether BD-II is associated with elevated peripheral levels of oxidative stress. We acquired high-resolution structural 3T-magnetic resonance imaging (MRI) images and quantified hippocampal subfield volumes using an automated segmentation algorithm in individuals with BD-II (n=29) and controls (n=33). The participants were scanned twice, at study inclusion and on average 2.4 years later. In addition, we measured peripheral levels of two lipid peroxidation markers (4-hydroxy-2-nonenal [4-HNE] and lipid hydroperoxides [LPH]). First, we demonstrated that the automated hippocampal subfield segmentation technique employed in this work reliably measured dentate gyrus-CA4 volume. Second, we found a decreased left dentate gyrus-CA4 volume in patients and that a larger number of depressive episodes between T1 and T2 predicted greater volume decline. Finally, we showed that 4-HNE was elevated in BD-II and that 4-HNE was negatively associated with left and right dentate gyrus-CA4 volumes in patients. These results are consistent with a role for the dentate gyrus in the pathophysiology of bipolar disorder and suggest that depressive episodes and elevated oxidative stress might contribute to hippocampal volume decreases. In addition, these findings provide further support for the hypothesis that peripheral lipid peroxidation markers may reflect brain alterations in bipolar disorders. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  7. Indirect Effect of Supersymmetric Triplets in Stop Decays

    CERN Document Server

    de Blas, J; Ostdiek, B; Quiros, M

    2014-01-01

    We study an extension of the minimal supersymmetric standard model with a zero hypercharge triplet, and the effect that such a particle has on stop decays. This model has the capability of predicting a 125.5 GeV Higgs even in the presence of light stops and it can modify the diphoton rate by means of the extra charged fermion triplet coupled to the Higgs. Working in the limit where the scalar triplet decouples, and with small values of mA, we find that the fermion triplet can greatly affect the branching ratios of the stops, even in the absence of a direct stop-triplet coupling. We compare the triplet extension with the MSSM and discuss how the additional fields affect the search for stop pair production.

  8. Sarcoplasmic reticulum Ca2+ uptake rate and endogenous content in MHC I and MHC II fibres of human skeletal muscle following prolonged exercise in highly trained

    DEFF Research Database (Denmark)

    Ørtenblad, Niels; Nielsen, Jens Steen

    load time was increased by 8% (P direct measures that the SR Ca2+ loading time decreases in MHCI fibres following prolonged cycling exercise in highly trained humans, however...... no differences in eSR content between the fibre types before exercise and no change with exhaustive exercise. The loading time was 17% slower in MHC II fibres (13.4 ± 0.2 vs 15.7 ± 0.2 sec, MHCI and MHCII respectively). However, the maximum loading capacity was higher in MHC II fibres. Following exercise the SR...

  9. Effects of sodium houttuyfonate on phosphorylation of CaMK II, CREB and ERK 1/2 and expression of c-Fos in macrophages.

    Science.gov (United States)

    Wang, Dayong; Noda, Yukihiro; Zhou, Yuan; Nitta, Atsumi; Nabeshima, Toshitaka; Yu, Qinghai

    2004-08-01

    The purpose of this research is to investigate the effects of sodium houttuyfonate on the phosphorylation of CaMK II, CREB and ERK 1/2, and the expression of c-Fos. Macrophages were cultured in vitro with or without sodium houttuyfonate in the culture medium. After cell culture, macrophages were lysed and the lysate of the macrophages was collected for analysis. Western-blotting method was adopted to investigate the phosphorylation or the expression of these signal elements. It was found in this research that the phosphorylation levels of CaMK II and CREB and the expression of c-Fos protein in macrophages were increased by sodium houttuyfonate treatment; however, the phosphorylation level of ERK 1/2 was not affected by the treatment.

  10. Berbamine inhibits the growth of liver cancer cells and cancer initiating cells by targeting Ca2+/Calmodulin-dependent protein kinase II

    OpenAIRE

    Meng, Zhipeng; Li, Tao; Ma, Xiaoxiao; Wang, Xiaoqiong; Van Ness, Carl; Gan, Yichao; Zhou, Hong; Tang, Jinfen; Lou, Guiyu; Wang, Yafan; Wu, Jun; Yen, Yun; Xu, Rongzhen; Huang, Wendong

    2013-01-01

    Liver cancer is the third leading cause of cancer deaths worldwide but no effective treatment toward liver cancer is available so far. Therefore, there is an unmet medical need to identify novel therapies to efficiently treat liver cancer and improve the prognosis of this disease. Here we report that berbamine (BBM) and one of its derivatives, bbd24, potently suppressed liver cancer cell proliferation and induced cancer cell death by targeting Ca2+/calmodulin-dependent protein kinase II (CAMK...

  11. [Effect of Electroacupuncture Intervention on CaMK II-CREB Pathway in Spinal Cord in Rats with Spared Nerve Injury].

    Science.gov (United States)

    Yan, Li-ping; Hou, Bao-quan; Li, Shou-dong; Wang, Ling-ling; Ma, Cheng

    2015-10-01

    To observe the effect of electroacupuncture (EA) stimulation of "Weizhong" (BL 40)-"Huantiao" (GB 30) on expression of phosphorylated calcium/calmodulin dependent protein kinase II (p-CaMK II) and cAMP response element binding protein (p-CREB) in the spinal cord in rats with spared nerve injury (SNI), so as to explore its mechanism underlying easing neuropathic pain. Sixty SD rats were randomly divided into five groups: control (sham-operation) , model, EA, AP-5 (a NMDA receptor antagonist) and L-NAME (a non-selective nitric oxide synthase, NOS inhibitor) (n = 12 in each group). The neuropathic pain model was established by sectioning the right tibal nerve and common peroneal nerve. EA intervention (2 Hz, 1 mA, increasing 1 mA/10 min) was applied to "Weizhong" (BL 40) and "Huantiao" (GB 30) on the injured side for 30 min, once a day for 7 days. Rats of the AP-5 and L-NAME groups were treated by intragastric administration of AP-5 (0.7 mg · kg(-1) · d(-1)) and L-NAME (60 mg · kg(-1) · d(-1)) respectively from the 11 th day after operation, once daily for 7 days. The mechanical pain thresholds were measured before the SNI procedure (baseline) and at the 10th and 16th day after the procedure. The expression of p-CaMK II protein and p-CREB protein and gene of the spinal cord (L4-L6 segments) was determined by Western blot and fluorescence quantitative-polymerase chain reaction (PCR), separately. In comparison to the control group, the mechanical pain threshold was significantly decreased in the model group (P CaMK II and p-CREB proteins and CREB mRNA in the spinal cord were significantly higher in the model group than in the control group (P CaMK II and p-CREB proteins and CREB mRNA were obviously down-regulated in the EA group (P 0.055. EA intervention of BL 40-GB 30 may alleviate pain in neuropathic pain rats, which may be related to its effects in down-regulating spinal CaMK II-CREB pathway function.

  12. The entangled triplet pair state in acene and heteroacene materials

    Science.gov (United States)

    Yong, Chaw Keong; Musser, Andrew J.; Bayliss, Sam L.; Lukman, Steven; Tamura, Hiroyuki; Bubnova, Olga; Hallani, Rawad K.; Meneau, Aurélie; Resel, Roland; Maruyama, Munetaka; Hotta, Shu; Herz, Laura M.; Beljonne, David; Anthony, John E.; Clark, Jenny; Sirringhaus, Henning

    2017-07-01

    Entanglement of states is one of the most surprising and counter-intuitive consequences of quantum mechanics, with potent applications in cryptography and computing. In organic materials, one particularly significant manifestation is the spin-entangled triplet-pair state, which mediates the spin-conserving fission of one spin-0 singlet exciton into two spin-1 triplet excitons. Despite long theoretical and experimental exploration, the nature of the triplet-pair state and inter-triplet interactions have proved elusive. Here we use a range of organic semiconductors that undergo singlet exciton fission to reveal the photophysical properties of entangled triplet-pair states. We find that the triplet pair is bound with respect to free triplets with an energy that is largely material independent (~30 meV). During its lifetime, the component triplets behave cooperatively as a singlet and emit light through a Herzberg-Teller-type mechanism, resulting in vibronically structured photoluminescence. In photovoltaic blends, charge transfer can occur from the bound triplet pairs with >100% photon-to-charge conversion efficiency.

  13. Identification of redundant and synergetic circuits in triplets of electrophysiological data

    Science.gov (United States)

    Erramuzpe, Asier; Ortega, Guillermo J.; Pastor, Jesus; de Sola, Rafael G.; Marinazzo, Daniele; Stramaglia, Sebastiano; Cortes, Jesus M.

    2015-12-01

    Objective. Neural systems are comprised of interacting units, and relevant information regarding their function or malfunction can be inferred by analyzing the statistical dependencies between the activity of each unit. While correlations and mutual information are commonly used to characterize these dependencies, our objective here is to extend interactions to triplets of variables to better detect and characterize dynamic information transfer. Approach. Our approach relies on the measure of interaction information (II). The sign of II provides information as to the extent to which the interaction of variables in triplets is redundant (R) or synergetic (S). Three variables are said to be redundant when a third variable, say Z, added to a pair of variables (X, Y), diminishes the information shared between X and Y. Similarly, the interaction in the triplet is said to be synergetic when conditioning on Z enhances the information shared between X and Y with respect to the unconditioned state. Here, based on this approach, we calculated the R and S status for triplets of electrophysiological data recorded from drug-resistant patients with mesial temporal lobe epilepsy in order to study the spatial organization and dynamics of R and S close to the epileptogenic zone (the area responsible for seizure propagation). Main results. In terms of spatial organization, our results show that R matched the epileptogenic zone while S was distributed more in the surrounding area. In relation to dynamics, R made the largest contribution to high frequency bands (14-100 Hz), while S was expressed more strongly at lower frequencies (1-7 Hz). Thus, applying II to such clinical data reveals new aspects of epileptogenic structure in terms of the nature (redundancy versus synergy) and dynamics (fast versus slow rhythms) of the interactions. Significance. We expect this methodology, robust and simple, can reveal new aspects beyond pair-interactions in networks of interacting units in other

  14. The neonatal outcome in twin versus triplet and quadruplet pregnancies

    Directory of Open Access Journals (Sweden)

    Fatemeh Nasseri

    2009-02-01

    Full Text Available

    • BACKGROUND: To assess the risk of neonatal mortality and morbidity in twin, triplet and quadruplet pregnancies.
    • METHODS: In a retrospective study, the neonatal outcome of all twin, triplet and quadruplet gestations delivered from October 2001 to September 2006 was reviewed. The neonatal outcome of triples and quadruplets was compared with a matched group of twins for gestational age.
    • RESULTS: During a 5-year period, 511 sets of twin pregnancies, 42 sets of triplet and 5 sets of quadruplet pregnancies were studied. The mean of gestational age for twins, triplets and quadruplets were 33.92 ± 3.5 weeks, 30.92 ± 3.8 weeks and 31.60 ± 2.0 weeks, respectively, (P = 0.0001. Triplets and quadruplets weighed less than twins, (P = 0.0001. Neonatal mortality was 13.5% for twins, 26.8% for triplets and 30% for quadruplets. In vitro fertilization, use of ovulation induction agents, and cesarean delivery in the women with triplet and quadruplet were significantly higher than in those with twin pregnancies, (P = 0.0001. The mean age of mothers with triplets and quadruplets was significantly higher than with twins (P = 0.026. There was not a significant difference in respiratory and non-respiratory short outcomes between triplets, quadruplets and twins when matched for gestational age. Apgar score at 1 and 5 minutes was significantly lower in triplets and quadruplets than twins. There was no influence of birth order on neonatal mortality of triplet pregnancy. Neonatal mortality of triplet births was significantly decreased over the 5 years of the study period.
    • CONCLUSIONS: Triplets and quadruplets have a similar neonatal outcome as twins when matched for gestational age. There is no influence of birth on the neonatal mortality of triplet pregnancy. It appears that outcome is mainly dependent on gestational age.
    • KEYWORDS: Neonatal

    • Far-infrared radiation acutely increases nitric oxide production by increasing Ca{sup 2+} mobilization and Ca{sup 2+}/calmodulin-dependent protein kinase II-mediated phosphorylation of endothelial nitric oxide synthase at serine 1179

      Energy Technology Data Exchange (ETDEWEB)

      Park, Jung-Hyun; Lee, Sangmi [Department of Molecular Medicine and Ewha Medical Research Institute, Ewha Womans University Medical School, Seoul 158-710 (Korea, Republic of); Cho, Du-Hyong [Department of Neuroscience, School of Medicine, Konkuk University, Seoul 143-701 (Korea, Republic of); Park, Young Mi [Department of Molecular Medicine and Ewha Medical Research Institute, Ewha Womans University Medical School, Seoul 158-710 (Korea, Republic of); Kang, Duk-Hee [Division of Nephrology, Department of Internal Medicine, Ewha Womans University Medical School, Seoul 158-710 (Korea, Republic of); Jo, Inho, E-mail: inhojo@ewha.ac.kr [Department of Molecular Medicine and Ewha Medical Research Institute, Ewha Womans University Medical School, Seoul 158-710 (Korea, Republic of)

      2013-07-12

      Highlights: •Far-infrared (FIR) radiation increases eNOS-Ser{sup 1179} phosphorylation and NO production in BAEC. •CaMKII and PKA mediate FIR-stimulated increases in eNOS-Ser{sup 1179} phosphorylation. •FIR increases intracellular Ca{sup 2+} levels. •Thermo-sensitive TRPV Ca{sup 2+} channels are unlikely to be involved in the FIR-mediated eNOS-Ser{sup 1179} phosphorylation pathway. -- Abstract: Repeated thermal therapy manifested by far-infrared (FIR) radiation improves vascular function in both patients and mouse model with coronary heart disease, but its underlying mechanism is not fully understood. Using FIR as a thermal therapy agent, we investigate the molecular mechanism of its effect on endothelial nitric oxide synthase (eNOS) activity and NO production. FIR increased the phosphorylation of eNOS at serine 1179 (eNOS-Ser{sup 1179}) in a time-dependent manner (up to 40 min of FIR radiation) in bovine aortic endothelial cells (BAEC) without alterations in eNOS expression. This increase was accompanied by increases in NO production and intracellular Ca{sup 2+} levels. Treatment with KN-93, a selective inhibitor of Ca{sup 2+}/calmodulin-dependent protein kinase II (CaMKII) and H-89, a protein kinase A inhibitor, inhibited FIR radiation-stimulated eNOS-Ser{sup 1179} phosphorylation. FIR radiation itself also increased the temperature of culture medium. As transient receptors potential vanilloid (TRPV) ion channels are known to be temperature-sensitive calcium channels, we explore whether TRPV channels mediate these observed effects. Reverse transcription-PCR assay revealed two TRPV isoforms in BAEC, TRPV2 and TRPV4. Although ruthenium red, a pan-TRPV inhibitor, completely reversed the observed effect of FIR radiation, a partial attenuation (∼20%) was found in cells treated with Tranilast, TRPV2 inhibitor. However, ectopic expression of siRNA of TRPV2 showed no significant alteration in FIR radiation-stimulated eNOS-Ser{sup 1179} phosphorylation. This

    • Excess Ca(2+) does not alleviate but increases the toxicity of Hg(2+) to photosystem II in Synechocystis sp. (Cyanophyta).

      Science.gov (United States)

      Zhang, Daoyong; Deng, Chunnuan; Pan, Xiangliang

      2013-11-01

      This study demonstrated that excess Ca(2+) increased the toxicity of Hg(2+) to PSII of cyanobacterium Synechocystis sp. using fast rise chlorophyll fluorescence test. Excess Ca(2+) increased the inhibitory effect of Hg(2+) on O2 evolution. Exposure to Hg(2+) caused increase in functional antenna size (ABS/RC), trapping rate of reaction center (TR0/RC), dissipated energy flux per reaction center (DI0/RC) and maximum quantum yield of non-photochemical deexcitation ( [Formula: see text] ), indicating that some reaction centers were transformed to dissipation sinks under Hg(2+) stress. Hg(2+) stress slowed down electron transport on both donor side and acceptor side and caused accumulation of P680(+). Excess Ca(2+) intensified all the Hg(2+) toxic effects on PSII function and led to dysfunction of PSII. The number of reaction centers that were transformed into dissipation sinks increased with increasing Ca(2+) concentration. Copyright © 2013 Elsevier Inc. All rights reserved.

    • The Drosophila transcription factor Adf-1 (nalyot) regulates dendrite growth by controlling FasII and Staufen expression downstream of CaMKII and neural activity.

      Science.gov (United States)

      Timmerman, Christina; Suppiah, Somu; Gurudatta, Baraka V; Yang, Jingping; Banerjee, Christopher; Sandstrom, David J; Corces, Victor G; Sanyal, Subhabrata

      2013-07-17

      Memory deficits in Drosophila nalyot mutants suggest that the Myb family transcription factor Adf-1 is an important regulator of developmental plasticity in the brain. However, the cellular functions for this transcription factor in neurons or molecular mechanisms by which it regulates plasticity remain unknown. Here, we use in vivo 3D reconstruction of identifiable larval motor neuron dendrites to show that Adf-1 is required cell autonomously for dendritic development and activity-dependent plasticity of motor neurons downstream of CaMKII. Adf-1 inhibition reduces dendrite growth and neuronal excitability, and results in motor deficits and altered transcriptional profiles. Surprisingly, analysis by comparative chromatin immunoprecipitation followed by sequencing (ChIP-Seq) of Adf-1, RNA Polymerase II (Pol II), and histone modifications in Kc cells shows that Adf-1 binding correlates positively with high Pol II-pausing indices and negatively with active chromatin marks such as H3K4me3 and H3K27ac. Consistently, the expression of Adf-1 targets Staufen and Fasciclin II (FasII), identified through larval brain ChIP-Seq for Adf-1, is negatively regulated by Adf-1, and manipulations of these genes predictably modify dendrite growth. Our results imply mechanistic interactions between transcriptional and local translational machinery in neurons as well as conserved neuronal growth mechanisms mediated by cell adhesion molecules, and suggest that CaMKII, Adf-1, FasII, and Staufen influence crucial aspects of dendrite development and plasticity with potential implications for memory formation. Further, our experiments reveal molecular details underlying transcriptional regulation by Adf-1, and indicate active interaction between Adf-1 and epigenetic regulators of gene expression during activity-dependent neuronal plasticity.

    • A Phase II Trial of Neoadjuvant MK-2206, an AKT Inhibitor, with Anastrozole in Clinical Stage II or III PIK3CA-Mutant ER-Positive and HER2-Negative Breast Cancer.

      Science.gov (United States)

      Ma, Cynthia X; Suman, Vera; Goetz, Matthew P; Northfelt, Donald; Burkard, Mark E; Ademuyiwa, Foluso; Naughton, Michael; Margenthaler, Julie; Aft, Rebecca; Gray, Richard; Tevaarwerk, Amye; Wilke, Lee; Haddad, Tufia; Moynihan, Timothy; Loprinzi, Charles; Hieken, Tina; Barnell, Erica K; Skidmore, Zachary L; Feng, Yan-Yang; Krysiak, Kilannin; Hoog, Jeremy; Guo, Zhanfang; Nehring, Leslie; Wisinski, Kari B; Mardis, Elaine; Hagemann, Ian S; Vij, Kiran; Sanati, Souzan; Al-Kateb, Hussam; Griffith, Obi L; Griffith, Malachi; Doyle, Laurence; Erlichman, Charles; Ellis, Matthew J

      2017-09-05

      Purpose: Hyperactivation of AKT is common and associated with endocrine resistance in estrogen receptor-positive (ER(+)) breast cancer. The allosteric pan-AKT inhibitor MK-2206 induced apoptosis in PIK3CA-mutant ER(+) breast cancer under estrogen-deprived condition in preclinical studies. This neoadjuvant phase II trial was therefore conducted to test the hypothesis that adding MK-2206 to anastrozole induces pathologic complete response (pCR) in PIK3CA mutant ER(+) breast cancer.Experimental Design: Potential eligible patients with clinical stage II/III ER(+)/HER2(-) breast cancer were preregistered and received anastrozole (goserelin if premenopausal) for 28 days in cycle 0 pending tumor PIK3CA sequencing. Patients positive for PIK3CA mutation in the tumor were eligible to start MK-2206 (150 mg orally weekly, with prophylactic prednisone) on cycle 1 day 2 (C1D2) and to receive a maximum of four 28-day cycles of combination therapy before surgery. Serial biopsies were collected at preregistration, C1D1 and C1D17.Results: Fifty-one patients preregistered and 16 of 22 with PIK3CA-mutant tumors received study drug. Three patients went off study due to C1D17 Ki67 >10% (n = 2) and toxicity (n = 1). Thirteen patients completed neoadjuvant therapy followed by surgery. No pCRs were observed. Rash was common. MK-2206 did not further suppress cell proliferation and did not induce apoptosis on C1D17 biopsies. Although AKT phosphorylation was reduced, PRAS40 phosphorylation at C1D17 after MK-2206 persisted. One patient acquired an ESR1 mutation at surgery.Conclusions: MK-2206 is unlikely to add to the efficacy of anastrozole alone in PIK3CA-mutant ER(+) breast cancer and should not be studied further in the target patient population. Clin Cancer Res; 1-10. ©2017 AACR. ©2017 American Association for Cancer Research.

    • Triplet pregnancies in a southeastern Nigerian Hospital: Before the ...

      African Journals Online (AJOL)

      optimize the outcome of these pregnancies, especially now that the incidence is bound to increase due to assisted reproductive technologies. Key words: Antenatal complications; Ebonyi State; incidence; increased medical bill; perinatal mortality; triplet pregnancies. Triplet pregnancies in a southeastern Nigerian Hospital: ...

    • Regularities of Twin, Triplet and Multiplet Prime Numbers

      OpenAIRE

      Weber, H. J.

      2011-01-01

      Classifications of twin primes are established and then applied to triplets that generalize to all higher multiplets. Mersenne and Fermat twins and triplets are treated in this framework. Regular prime number multiplets are related to quadratic and cubic prime number generating polynomials.

  1. Triplet repeat DNA structures and human genetic disease: dynamic ...

    Indian Academy of Sciences (India)

    Triplet repeat DNA structures and human genetic disease: dynamic mutations from dynamic DNA. Richard R Sinden Vladimir N ... Different models have been proposed for the expansion of triplet repeats, most of which presume the formation of alternative DNA structures in repeat tracts. One of the most likely structures, ...

  2. Maternal and perinatal complications in triplet compared with twin pregnancy

    NARCIS (Netherlands)

    J.G. Santema (Job); P. Bourdrez (Petra); H.C.S. Wallenburg (Henk)

    1995-01-01

    textabstractObjective: To compare maternal and perinatal complications in triplet and twin pregnancies. Study design: Case-controlled study in the setting of a University Hospital. Each pregnancy of a consecutive series of 40 triplet pregnancies of 20 weeks or more was matched for parity and

  3. cyclo-addition reaction of triplet carbonyl compounds to substituted ...

    Indian Academy of Sciences (India)

    Unknown

    MC-SCF/6-31G* study of the singlet and triplet Pa- terno–Büchi reaction using formaldehyde and ethylene as model systems ... theoretical study on the regioselectivity of the Pa- terno–Büchi photocyclo-addition of triplet acetone ...... A103 1274; (c) Chattaraj P K and Pod- dar J 1999 J. Phys. Chem. A103 8691; (d) Sengupta.

  4. Ca2+/Calmodulin-Dependent Protein Kinase II and Androgen Signaling Pathways Modulate MEF2 Activity in Testosterone-Induced Cardiac Myocyte Hypertrophy

    Directory of Open Access Journals (Sweden)

    Javier Duran

    2017-09-01

    Full Text Available Testosterone is known to induce cardiac hypertrophy through androgen receptor (AR-dependent and -independent pathways, but the molecular underpinnings of the androgen action remain poorly understood. Previous work has shown that Ca2+/calmodulin-dependent protein kinase II (CaMKII and myocyte-enhancer factor 2 (MEF2 play key roles in promoting cardiac myocyte growth. In order to gain mechanistic insights into the action of androgens on the heart, we investigated how testosterone affects CaMKII and MEF2 in cardiac myocyte hypertrophy by performing studies on cultured rat cardiac myocytes and hearts obtained from adult male orchiectomized (ORX rats. In cardiac myocytes, MEF2 activity was monitored using a luciferase reporter plasmid, and the effects of CaMKII and AR signaling pathways on MEF2C were examined by using siRNAs and pharmacological inhibitors targeting these two pathways. In the in vivo studies, ORX rats were randomly assigned to groups that were administered vehicle or testosterone (125 mg⋅kg-1⋅week-1 for 5 weeks, and plasma testosterone concentrations were determined using ELISA. Cardiac hypertrophy was evaluated by measuring well-characterized hypertrophy markers. Moreover, western blotting was used to assess CaMKII and phospholamban (PLN phosphorylation, and MEF2C and AR protein levels in extracts of left-ventricle tissue from control and testosterone-treated ORX rats. Whereas testosterone treatment increased the phosphorylation levels of CaMKII (Thr286 and phospholambam (PLN (Thr17 in cardiac myocytes in a time- and concentration-dependent manner, testosterone-induced MEF2 activity and cardiac myocyte hypertrophy were prevented upon inhibition of CaMKII, MEF2C, and AR signaling pathways. Notably, in the hypertrophied hearts obtained from testosterone-administered ORX rats, both CaMKII and PLN phosphorylation levels and AR and MEF2 protein levels were increased. Thus, this study presents the first evidence indicating that

  5. ZnT-1, ZnT-3, CaMK II, PRG-1 expressions in hippocampus following neonatal seizure-induced cognitive deficit in rats.

    Science.gov (United States)

    Ni, Hong; Jiang, Yu-Wu; Tao, Lu-Yang; Jin, Mei-Fang; Wu, Xi-Ru

    2009-02-10

    Epilepsy in children is associated with a broad spectrum of cognitive deficits, which is associated with hippocampal mossy fiber sprouting. The underlying molecular mechanisms involved in mossy fiber sprouting in hippocampus following developmental seizures are not completely known. We studied the timing of cognitive dysfunction following neonatal seizures and the relation of this cognitive impairment to zinc transporter 1 (ZnT-1), 3 (ZnT-3), calcium/calmodulin-dependent protein kinase II (CaMK II), plasticity-related gene 1 (PRG-1) expression in hippocampus. A seizure was induced by inhalant flurothyl daily in neonatal Sprague-Dawley rats from postnatal day 6 (P6). Rats were assigned into the single-seizure group (SS), the recurrent-seizure group (RS, seizures induced in six consecutive days), and the control group. During P41-P46 and P85-P90, the rats were tested for spatial learning and memory abilities with automatic Morris water maze task. At P90, mossy fiber sprouting and gene expression in hippocampus were determined subsequently by Timm staining and RT-PCR methods. The escape latencies from the water maze were significantly longer in rats of RS group than those of the control and SS groups at d4 of the first maze test and at d3, d4 of the second maze test. As far as Spatial Probe Test was concerned, the frequency of passing through the platform quadrant was significantly decreased in RS group than that in control and SS groups in the entire two probe tests. In rats with recurrent seizures (RS group), there was an increased distribution of Timm granules in both the supragranular region of the dentate gyrus and the stratum pyramidale of CA3 subfield in RS group, while remaining barely visible in control and SS groups; the Timm scores in CA3 and dentate gyrus in the RS animals were significantly higher than that in the control and SS groups. RT-PCR densitometry analysis showed that the ratios of hippocampal ZnT-1 to beta-actin of SS and RS group were decreased

  6. Strongly exchange-coupled triplet pairs in an organic semiconductor

    Science.gov (United States)

    Weiss, Leah R.; Bayliss, Sam L.; Kraffert, Felix; Thorley, Karl J.; Anthony, John E.; Bittl, Robert; Friend, Richard H.; Rao, Akshay; Greenham, Neil C.; Behrends, Jan

    2017-02-01

    From biological complexes to devices based on organic semiconductors, spin interactions play a key role in the function of molecular systems. For instance, triplet-pair reactions impact operation of organic light-emitting diodes as well as photovoltaic devices. Conventional models for triplet pairs assume they interact only weakly. Here, using electron spin resonance, we observe long-lived, strongly interacting triplet pairs in an organic semiconductor, generated via singlet fission. Using coherent spin manipulation of these two-triplet states, we identify exchange-coupled (spin-2) quintet complexes coexisting with weakly coupled (spin-1) triplets. We measure strongly coupled pairs with a lifetime approaching 3 μs and a spin coherence time approaching 1 μs, at 10 K. Our results pave the way for the utilization of high-spin systems in organic semiconductors.

  7. The Anthocyanin Delphinidin 3-Rutinoside Stimulates Glucagon-Like Peptide-1 Secretion in Murine GLUTag Cell Line via the Ca2+/Calmodulin-Dependent Kinase II Pathway.

    Directory of Open Access Journals (Sweden)

    Masaki Kato

    Full Text Available Glucagon-like peptide-1 (GLP-1 is an incretin hormone secreted from enteroendocrine L-cells. Although several nutrients induce GLP-1 secretion, there is little evidence to suggest that non-nutritive compounds directly increase GLP-1 secretion. Here, we hypothesized that anthocyanins induce GLP-1 secretion and thereby significantly contribute to the prevention and treatment of diabetes. Delphinidin 3-rutinoside (D3R was shown to increase GLP-1 secretion in GLUTag L cells. The results suggested that three hydroxyl or two methoxyl moieties on the aromatic ring are essential for the stimulation of GLP-1 secretion. Notably, the rutinose moiety was shown to be a potent enhancer of GLP-1 secretion, but only in conjunction with three hydroxyl moieties on the aromatic ring (D3R. Receptor antagonist studies revealed that D3R-stimulates GLP-1 secretion involving inositol 1,4,5-trisphosphate receptor-mediated intracellular Ca2+ mobilization. Treatment of GLUTag cells with a Ca2+/calmodulin-dependent kinaseII (CaMKII inhibitor (KN-93 abolished D3R-stimulated GLP-1 secretion. In addition, treatment of GLUTag cells with D3R resulted in activation of CaMKII. Pre-treatment of cells with a G protein-coupled receptor (GPR 40/120 antagonist (GW1100 also significantly decreased D3R-stimulated GLP-1 secretion. These observations suggest that D3R stimulates GLP-1 secretion in GLUTag cells, and that stimulation of GLP-1 secretion by D3R is mediated via Ca2+-CaMKII pathway, which may possibly be mediated by GPR40/120. These findings provide a possible molecular mechanism of GLP-1 secretion in intestinal L-cells mediated by foods or drugs and demonstrate a novel biological function of anthocyanins in regards to GLP-1 secretion.

  8. [In vitro studies of Raf-CREB, Akt-CREB, and CaMK II -CREB signal transduction pathway regulated by ginsenosides Rb1, Rg1 and Re].

    Science.gov (United States)

    Wang, Ting-Ting; Dong, Xian-Zhe; Liu, Wan-Wan; Chen, Yi-Hong; Liu, Ping

    2014-06-01

    Effects of ginsenoside Rb1, Rg1 and Re on neurotrophic factor signal transduction pathway using liposome-mediated transfection of eukaryotic cells approach. The injury model was established by treating SH-SY5Y cells with 0.6 mmol x L(-1) of corticosterone (CORT) by 24 h. SH-SY5Y cell were pretreated with CORT for 30 min followed by co-treated with 120,60 and 20 micromol x L(-1) of Rb1, 120, 80 and 40 micromol x L(-1) of Rg1 and 120, 80 and 40 micromol x L(-1) of Re for 24 h. Cells viability was determined by Cell Counting Kit (CCK) assay. CREB expressing Luciferase reporter gene was constructed and transfected with plasmid containing hRaf, hcAMP, hAkt, hCaMK gene into human embryonic kidney (HEK293) cells using liposornal transfection reagent lipofection 2000. The expression of CREB before and after it addion of Rb1, Rg1 and Re was examined by Luc assay system and Western blotting. Compared with normal control group, CORT significantly decreased the viability of SH-SY5Y cells to 67.21% (P CaMK II. Rb1, Rg1 and Re protects SH-SY5Y cells from CORT-induced damage and the neuroprotective mechanism may be associated with the Raf-CREB, Akt-CREB and CaMK II -CREB pathways.

  9. Quantum mechanics/molecular mechanics simulation of the ligand vibrations of the water-oxidizing Mn4CaO5 cluster in photosystem II.

    Science.gov (United States)

    Nakamura, Shin; Noguchi, Takumi

    2016-10-11

    During photosynthesis, the light-driven oxidation of water performed by photosystem II (PSII) provides electrons necessary to fix CO 2 , in turn supporting life on Earth by liberating molecular oxygen. Recent high-resolution X-ray images of PSII show that the water-oxidizing center (WOC) is composed of an Mn 4 CaO 5 cluster with six carboxylate, one imidazole, and four water ligands. FTIR difference spectroscopy has shown significant structural changes of the WOC during the S-state cycle of water oxidation, especially within carboxylate groups. However, the roles that these carboxylate groups play in water oxidation as well as how they should be properly assigned in spectra are unresolved. In this study, we performed a normal mode analysis of the WOC using the quantum mechanics/molecular mechanics (QM/MM) method to simulate FTIR difference spectra on the S 1 to S 2 transition in the carboxylate stretching region. By evaluating WOC models with different oxidation and protonation states, we determined that models of high-oxidation states, Mn(III) 2 Mn(IV) 2 , satisfactorily reproduced experimental spectra from intact and Ca-depleted PSII compared with low-oxidation models. It is further suggested that the carboxylate groups bridging Ca and Mn ions within this center tune the reactivity of water ligands bound to Ca by shifting charge via their π conjugation.

  10. Triplet-triplet annihilation photon-upconversion: towards solar energy applications.

    Science.gov (United States)

    Gray, Victor; Dzebo, Damir; Abrahamsson, Maria; Albinsson, Bo; Moth-Poulsen, Kasper

    2014-06-14

    Solar power production and solar energy storage are important research areas for development of technologies that can facilitate a transition to a future society independent of fossil fuel based energy sources. Devices for direct conversion of solar photons suffer from poor efficiencies due to spectrum losses, which are caused by energy mismatch between the optical absorption of the devices and the broadband irradiation provided by the sun. In this context, photon-upconversion technologies are becoming increasingly interesting since they might offer an efficient way of converting low energy solar energy photons into higher energy photons, ideal for solar power production and solar energy storage. This perspective discusses recent progress in triplet-triplet annihilation (TTA) photon-upconversion systems and devices for solar energy applications. Furthermore, challenges with evaluation of the efficiency of TTA-photon-upconversion systems are discussed and a general approach for evaluation and comparison of existing systems is suggested.

  11. Far-infrared radiation acutely increases nitric oxide production by increasing Ca(2+) mobilization and Ca(2+)/calmodulin-dependent protein kinase II-mediated phosphorylation of endothelial nitric oxide synthase at serine 1179.

    Science.gov (United States)

    Park, Jung-Hyun; Lee, Sangmi; Cho, Du-Hyong; Park, Young Mi; Kang, Duk-Hee; Jo, Inho

    2013-07-12

    Repeated thermal therapy manifested by far-infrared (FIR) radiation improves vascular function in both patients and mouse model with coronary heart disease, but its underlying mechanism is not fully understood. Using FIR as a thermal therapy agent, we investigate the molecular mechanism of its effect on endothelial nitric oxide synthase (eNOS) activity and NO production. FIR increased the phosphorylation of eNOS at serine 1179 (eNOS-Ser(1179)) in a time-dependent manner (up to 40min of FIR radiation) in bovine aortic endothelial cells (BAEC) without alterations in eNOS expression. This increase was accompanied by increases in NO production and intracellular Ca(2+) levels. Treatment with KN-93, a selective inhibitor of Ca(2+)/calmodulin-dependent protein kinase II (CaMKII) and H-89, a protein kinase A inhibitor, inhibited FIR radiation-stimulated eNOS-Ser(1179) phosphorylation. FIR radiation itself also increased the temperature of culture medium. As transient receptors potential vanilloid (TRPV) ion channels are known to be temperature-sensitive calcium channels, we explore whether TRPV channels mediate these observed effects. Reverse transcription-PCR assay revealed two TRPV isoforms in BAEC, TRPV2 and TRPV4. Although ruthenium red, a pan-TRPV inhibitor, completely reversed the observed effect of FIR radiation, a partial attenuation (∼20%) was found in cells treated with Tranilast, TRPV2 inhibitor. However, ectopic expression of siRNA of TRPV2 showed no significant alteration in FIR radiation-stimulated eNOS-Ser(1179) phosphorylation. This study suggests that FIR radiation increases NO production via increasing CaMKII-mediated eNOS-Ser(1179) phosphorylation but TRPV channels may not be involved in this pathway. Our results may provide the molecular mechanism by which FIR radiation improves endothelial function. Copyright © 2013 Elsevier Inc. All rights reserved.

  12. Spontaneous Heterotopic Triplet Pregnancy With Tubal Rupture

    Directory of Open Access Journals (Sweden)

    Lima Arsala MBBS, BBMedSci

    2014-04-01

    Full Text Available The recent increase in heterotopic pregnancies has been largely attributed to the increased use of assisted reproduction technologies. We report the rare case of a multiparous woman with a spontaneous conception resulting in a triplet heterotopic pregnancy: a twin intrauterine pregnancy and a single right tubal ectopic pregnancy. Heterotopic pregnancy is a rare and potentially life-threatening condition in which simultaneous gestations occur at 2 or more implantation sites. It is infrequent in natural conception cycles, occurring in 1:30 000 pregnancies. However, the prevalence is rising with the increased use of assisted reproduction techniques to that of 1:100 to 1:500 in these patient subgroups, highlighting the need to incorporate it into a clinician’s diagnostic algorithm.

  13. Triplet to Singleton-A Successful Outcome

    Directory of Open Access Journals (Sweden)

    Priya Varshney

    2014-07-01

    Full Text Available We are presenting a case report of triplet pregnancy in a 25 years old lady, in whom single fetal reduction was done at 10 weeks. At 29 weeks, ultrasonography showed fetal demise of second twin. Conservative management was done, after evaluating the status of second twin. Maternal and fetal monitoring was done with PT INR, Ultrasound Doppler weekly till 33 weeks when an emergency cesarean was done due to preterm labour pains. A healthy baby of 1.8 kg was born along with a macerated IUD of 500 gms. Mother and baby are healthy on follow up till date. Hence conservative management should be followed in single fetus demise in twin pregnancy with proper monitoring.

  14. Preferential triplet over singlet emission of Zn in laser-induced plasmas

    Science.gov (United States)

    Pardede, Marincan; Hedwig, Rinda; Lahna, Kurnia; Idris, Nasrullah; Nur Abdulmadjid, Syahrun; Jobiliong, Eric; Suyanto, Hery; Tjia, May On; Jie Lie, Tjung; Sukra Lie, Zener; Hendrik Kurniawan, Koo; Wihardjo, Erning; Kagawa, Kiichiro

    2017-06-01

    An experimental study is performed on the time-dependent intensity variations of Zn emission focusing on the triplet (Zn I 481.0 nm) and singlet (Zn I 636.2 nm) emission lines induced under three experimental conditions. A single nanosecond (ns) Nd:YAG laser in standard laser-induced breakdown spectroscopy (LIBS) setup is employed for the investigation of direct shock wave-induced emission characteristics with N2 ambient gas at 0.4 kPa and the different effects of He ambient gas at 2 kPa. An additional two-laser system consisting of ns and picosecond (ps) lasers in an orthogonal setup is used to study the exclusive role of a He-assisted excitation (HAE) process for the generation of those two Zn emission lines. The results of this study consistently exhibit the dominant triplet emission over the singlet emission marked by initial maximum intensity ratios of 8 and 12 obtained from the experiments using a single-laser setup in N2 and He ambient gases, respectively, indicating the significant contribution of the HAE mechanism to the enhanced and longer lasting Zn emission in He gas. The experiment using the special two-laser setup further demonstrates the exclusive role of the HAE process in the Zn emission featuring an even markedly higher triplet/singlet intensity ratio of 22. Thus, the results of this study suggest the possibly more general nature of dominant triplet emission phenomena previously found in laser-induced He and Ca emission spectra.

  15. Pb(II) and Zn(II) adsorption onto Na- and Ca-montmorillonites in acetic acid/acetate medium: experimental approach and geochemical modeling.

    Science.gov (United States)

    Ghayaza, Mariem; Le Forestier, Lydie; Muller, Fabrice; Tournassat, Christophe; Beny, Jean-Michel

    2011-09-01

    Smectites are usually used as a clay barrier at the bottom of subsurface waste landfills due to their low permeability and their capacity to retain pollutants. The Na- and Ca-saturated SWy2 montmorillonites were interacted with initial Zn(NO(3))(2) or Pb(NO(3))(2) concentrations ranging from 10(-6) to 10(-2)M with a solid/liquid ratio of 10 g L(-1) and using acetic acid/acetate as buffer at pH 5 in order to reproduce a biodegradable leachate of a young landfill. These experiments revealed that Zn and Pb sorption onto Na-SWy2 is higher than that onto Ca-SWy2 in the whole range of concentrations. Metal retention into both montmorillonites increases with the decrease in acetic acid/acetate concentration. The two-site protolysis model with no electrostatic term (2SPNE model) was used to model these experiments. As the experimental data of Zn sorption were well fitted, this model was validated and has been improved by taking into account the metal-acetate complexation in solution. In order to validate the model for Pb sorption, new selectivity coefficients have been determined, namely logK(c)(PbNa)=0.5 for Na-montmorillonite and logK(c)(PbCa)=0.3 for Ca-montmorillonite. Copyright © 2011 Elsevier Inc. All rights reserved.

  16. Initiation of caspase-independent death in mouse mesangial cells by Cd2+: involvement of p38 kinase and CaMK-II.

    Science.gov (United States)

    Liu, Ying; Templeton, Douglas M

    2008-11-01

    Cadmium (Cd) is a toxic metal with multiple effects on cell signaling and cell death. We studied the effects of Cd(2+) on quiescent mouse mesangial cells in serum-free conditions. Cadmium induces cell death over 6 h through annexin V+ states without or with causing uptake of propidium iodide, termed apoptotic and apoptosis-like death, respectively. Little or no necrosis is observed, and cell death is caspase-independent and associated with nuclear translocation of the apoptosis-inducing factor, AIF. We previously showed that Cd(2+) increased phosphorylation of Erk and CaMK-II, and CaMK-II activation increased cell death in an Erk-independent manner. Here we demonstrate that Cd(2+) increases Jnk and p38 kinase phosphorylation, and inhibition of p38-but not of Jnk-increases cell viability by suppressing apoptosis in preference to apoptosis-like death. Neither p38 kinase nor CaMK-II inhibition protects against a decrease in mitochondrial membrane potential, psi, indicating that kinase-mediated death is either independent of, or involves events downstream of a mitochondrial pathway. However, both the antioxidant N-acetyl cysteine (NAC) and the mitochondrial membrane-stabilizing agent cyclosporine A (CsA) partially preserve psi, suppress activation of p38 kinase, and partially protect the cells from Cd(2+)-induced death. Whereas the effect of CsA is on apoptosis, NAC acts on apoptosis-like death. Inhibition of glutathione synthesis exacerbates a Cd(2+)-dependent increase in cellular peroxides and favors apoptosis-like death over apoptosis. The caspase-independence of these modes of cell death is not due to an absence of this machinery in the mesangial cells: when they are exposed to Cd(2+) for longer periods in the presence of serum, procaspase-3 and PARP are cleaved and caspase inhibition is protective. We conclude that Cd(2+) can kill mesangial cells by multiple pathways, including caspase-dependent and -independent apoptotic and apoptosis-like death. Necrosis is not

  17. Triplet correlations among similarly tuned cells impact population coding

    Directory of Open Access Journals (Sweden)

    Natasha Alexandra Cayco Gajic

    2015-05-01

    Full Text Available Which statistical features of spiking activity matter for how stimuli are encoded in neural populations? A vast body of work has explored how firing rates in individual cells and correlations in the spikes of cell pairs impact coding. Recent experiments have shown evidence for the existence of higher-order spiking correlations, which describe simultaneous firing in triplets and larger ensembles of cells; however, little is known about their impact on encoded stimulus information. Here, we take a first step toward closing this gap. We vary triplet correlations in small (approximately 10 cell neural populations while keeping single cell and pairwise statistics fixed at typically reported values. This connection with empirically observed lower-order statistics important, as it places strong constraints on the level of triplet correlations that can occur. For each value of triplet correlations, we estimate the performance of the neural population on a two-stimulus discrimination task. We find that the allowed changes in the level of triplet correlations can significantly enhance coding, in particular if triplet correlations differ for the two stimuli. In this scenario, triplet correlations must be included in order to accurately quantify the functionality of neural populations. When both stimuli elicit similar triplet correlations, however, pairwise models provide relatively accurate descriptions of coding accuracy. We explain our findings geometrically via the skew that triplet correlations induce in population-wide distributions of neural responses. Finally, we calculate how many samples are necessary to accurately measure spiking correlations of this type, providing an estimate of the necessary recording times in future experiments.

  18. Conjoined twins in a triplet pregnancy. A rare obstetrical dilemma.

    Science.gov (United States)

    Ozcan, Huseyin C; Ugur, Mete G; Mustafa, Aynur; Kutlar, Irfan

    2017-03-01

    Conjoined twins are derived from division of a single fertilized ovum after the twelfth day of fertilization. Triplet conjoined twin is considered as a unique phenomenon that is accompanied with a wide variety of congenital abnormalities and also hazardous consequences for both fetuses and parents. We present an extremely rare case of conjoined twins in a triplet pregnancy with symmetric thoracoomphalopagus that was diagnosed in prenatal period by using ultrasound scanning and MRI. In triplet pregnancies, we should be aware about the possibility of conjoined twins. If there are severe congenital malformations, termination of pregnancy should be recommended immediately after the diagnosis regardless of gestational age, particularly in early gestational age.

  19. Non-Linear Advanced Control of the LHC Inner Triplet Heat Exchanger Test Unit

    CERN Document Server

    Blanco-Viñuela, E; De Prada-Moraga, C; Cristea, S

    2002-01-01

    The future Large Hadron Collider (LHC) at CERN will include eight interaction region final focus magnet systems, the so-called "Inner Triplet", one on each side of the four beam collision points. The Inner Triplets will be cooled in a static bath of pressurized He II nominally at 1.9 K. This temperature is a control parameter and has very severe constraints in order to avoid the transition from the superconducting to normal resistive state. The main difference in these special zones with respect to a regular LHC cell is higher dynamic heat load unevenly distributed which modifies largely the process characteristics and hence the controller performance. Several control strategies have already been tested at CERN in a pilot plant (LHC String Test) which reproduced a LHC half-cell. In order to validate a common control structure along the whole LHC ring, a Nonlinear Model Predictive Control (NMPC) has been developed and implemented in the Inner Triplet Heat Exchanger Unit (IT-HXTU) at CERN. Automation of the Inn...

  20. Roles of EDTA washing and Ca{sup 2+} regulation on the restoration of anammox granules inhibited by copper(II)

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zheng-Zhe; Cheng, Ya-Fei; Zhou, Yu-Huang; Buayi, Xiemuguli [Department of Environmental Science and Engineering, Hangzhou Normal University, Hangzhou 310036 (China); Key Laboratory of Hangzhou City for Ecosystem Protection and Restoration, Hangzhou Normal University, Hangzhou 310036 (China); Jin, Ren-Cun, E-mail: jrczju@aliyun.com [Department of Environmental Science and Engineering, Hangzhou Normal University, Hangzhou 310036 (China); Key Laboratory of Hangzhou City for Ecosystem Protection and Restoration, Hangzhou Normal University, Hangzhou 310036 (China)

    2016-01-15

    Highlights: • 80.5% of the Cu in anammox granules was introduced via adsorption. • Cu(II) internalized on/into AnAOB cells plays a crucial role in toxicity. • EDTA washing contributes to the detoxification of anammox granules. • Ca{sup 2+} can stimulate the re-growth of damaged anammox consortium. - Abstract: We investigated the feasibility of using ethylene diamine tetraacetic acid (EDTA) washing followed by Ca{sup 2+} enhancement for the recovery of anammox reactors inhibited by Cu(II). Kinetic experiments and batch activity assays were employed to determine the optimal concentration of EDTA and washing time; and the performance and physiological dynamics were tracked by continuous-flow monitoring to evaluate the long-term effects. The two-step desorption process revealed that the Cu in anammox granules was primarily introduced via adsorption (approximately, 80.5%), and the portion of Cu in the dispersible layer was predominant (accounting for 71.1%). Afterwards, the Cu internalized in the cells (approximately, 14.7%) could diffuse out of the cells and be gradually washed out of the reactor over the next 20 days. The Ca{sup 2+} addition that followed led to an accelerated nitrogen removal rate recovery slope (0.1491 kgN m{sup −3} d{sup −2}) and a normal biomass growth rate (0.054 d{sup −1}). The nitrogen removal rate returned to normal levels within 90 days and gradual improvements in granular characteristics were also achieved. Therefore, this study provides a new insight that externally removing the adsorbed heavy metals followed by internally repairing the metabolic system may represent an optimal restoration strategy for anammox consortium damaged by heavy metals.

  1. Dark matter in the Higgs triplet model

    Science.gov (United States)

    Bahrami, Sahar; Frank, Mariana

    2015-04-01

    The inability to predict neutrino masses and the existence of dark matter are two essential shortcomings of the Standard Model. The Higgs triplet model provides an elegant resolution of neutrino masses via the seesaw mechanism. We show here that introducing vectorlike leptons in the model also provides a resolution to the problem of dark matter. We investigate constraints, including the invisible decay width of the Higgs boson and the electroweak precision variables, and impose restrictions on model parameters. We analyze the effect of the relic density constraint on the mass and Yukawa coupling of dark matter. We also calculate the cross sections for indirect and direct dark matter detection and show our model predictions for the neutrino and muon fluxes from the Sun, and the restrictions they impose on the parameter space. With the addition of vectorlike leptons, the model is completely consistent with dark matter constraints, in addition to improving electroweak precision and doubly charged mass restrictions, which are rendered consistent with present experimental data.

  2. Higher-Spin Triplet Fields and String Theory

    Directory of Open Access Journals (Sweden)

    D. Sorokin

    2010-01-01

    Full Text Available We review basic properties of reducible higher-spin multiplets, called triplets, and demonstrate how they naturally appear as part of the spectrum of String Field Theory in the tensionless limit. We show how in the frame-like formulation the triplet fields are endowed with the geometrical meaning of being components of higher-spin vielbeins and connections and present actions describing their free dynamics.

  3. Neutrosophic Duplet Semi-Group and Cancellable Neutrosophic Triplet Groups

    Directory of Open Access Journals (Sweden)

    Xiaohong Zhang

    2017-11-01

    Full Text Available The notions of the neutrosophic triplet and neutrosophic duplet were introduced by Florentin Smarandache. From the existing research results, the neutrosophic triplets and neutrosophic duplets are completely different from the classical algebra structures. In this paper, we further study neutrosophic duplet sets, neutrosophic duplet semi-groups, and cancellable neutrosophic triplet groups. First, some new properties of neutrosophic duplet semi-groups are funded, and the following important result is proven: there is no finite neutrosophic duplet semi-group. Second, the new concepts of weak neutrosophic duplet, weak neutrosophic duplet set, and weak neutrosophic duplet semi-group are introduced, some examples are given by using the mathematical software MATLAB (MathWorks, Inc., Natick, MA, USA, and the characterizations of cancellable weak neutrosophic duplet semi-groups are established. Third, the cancellable neutrosophic triplet groups are investigated, and the following important result is proven: the concept of cancellable neutrosophic triplet group and group coincide. Finally, the neutrosophic triplets and weak neutrosophic duplets in BCI-algebras are discussed.

  4. COX-1-derived PGE2 and PGE2 type 1 receptors are vital for angiotensin II-induced formation of reactive oxygen species and Ca(2+) influx in the subfornical organ.

    Science.gov (United States)

    Wang, Gang; Sarkar, Pallabi; Peterson, Jeffrey R; Anrather, Josef; Pierce, Joseph P; Moore, Jamie M; Feng, Ji; Zhou, Ping; Milner, Teresa A; Pickel, Virginia M; Iadecola, Costantino; Davisson, Robin L

    2013-11-15

    Regulation of blood pressure by angiotensin II (ANG II) is a process that involves the reactive oxygen species (ROS) and calcium. We have shown that ANG-II type 1 receptor (AT1R) and prostaglandin E2 (PGE2) type 1 receptors (EP1R) are required in the subfornical organ (SFO) for ROS-mediated hypertension induced by slow-pressor ANG-II infusion. However, the signaling pathway associated with this process remains unclear. We sought to determine mechanisms underlying the ANG II-induced ROS and calcium influx in mouse SFO cells. Ultrastructural studies showed that cyclooxygenase 1 (COX-1) codistributes with AT1R in the SFO, indicating spatial proximity. Functional studies using SFO cells revealed that ANG II potentiated PGE2 release, an effect dependent on AT1R, phospholipase A2 (PLA2) and COX-1. Furthermore, both ANG II and PGE2 increased ROS formation. While the increase in ROS initiated by ANG II, but not PGE2, required the activation of the AT1R/PLA2/COX-1 pathway, both ANG II and PGE2 were dependent on EP1R and Nox2 as downstream effectors. Finally, ANG II potentiated voltage-gated L-type Ca(2+) currents in SFO neurons via the same signaling pathway required for PGE2 production. Blockade of EP1R and Nox2-derived ROS inhibited ANG II and PGE2-mediated Ca(2+) currents. We propose a mechanism whereby ANG II increases COX-1-derived PGE2 through the AT1R/PLA2 pathway, which promotes ROS production by EP1R/Nox2 signaling in the SFO. ANG II-induced ROS are coupled with Ca(2+) influx in SFO neurons, which may influence SFO-mediated sympathoexcitation. Our findings provide the first evidence of a spatial and functional framework that underlies ANG-II signaling in the SFO and reveal novel targets for antihypertensive therapies.

  5. The fine tuning of carotenoid-chlorophyll interactions in light-harvesting complexes: an important requisite to guarantee efficient photoprotection via triplet-triplet energy transfer in the complex balance of the energy transfer processes

    Science.gov (United States)

    Di Valentin, Marilena; Carbonera, Donatella

    2017-08-01

    Triplet-triplet energy transfer (TTET) from the chlorophyll to the carotenoid triplet state is the process exploited by photosynthetic systems to protect themselves from singlet oxygen formation under light-stress conditions. A deep comprehension of the molecular strategies adopted to guarantee TTET efficiency, while at the same time maintaining minimal energy loss and efficient light-harvesting capability, is still lacking. The paramagnetic nature of the triplet state makes electron paramagnetic resonance (EPR) the method of choice when investigating TTET. In this review, we focus on our extended comparative study of two photosynthetic antenna complexes, the Peridinin-chlorophyll a-protein of dinoflagellates and the light-harvesting complex II of higher plants, in order to point out important aspects of the molecular design adopted in the photoprotection strategy. We have demonstrated that a proper analysis of the EPR data allows one to identify the pigments involved in TTET and, consequently, gain an insight into the structure of the photoprotective sites. The structural information has been complemented by a detailed description of the electronic structure provided by hyperfine spectroscopy. All these elements represent the fundamental building blocks toward a deeper understanding of the requirements for efficient photoprotection, which is fundamental to guarantee the prolonged energy conversion action of photosynthesis.

  6. MEDIUL ACADEMIC CA FACTOR DE ASIGURARE A CONTINUITĂŢII ŞI INTERCONEXIUNII DINTRE CICLURILE ÎNVĂŢĂMÂNTULUI SUPERIOR

    Directory of Open Access Journals (Sweden)

    Maia ŞEVCIUC

    2017-03-01

    Full Text Available În articol este abordată problema privind mediul academic ca factor de asigurare a continuităţii şi interconexiunii dintre ciclurile învăţământului superior. În acest sens sunt analizate diferite concepte cu referire la mediul academic, sunt deduse principiile de concepere a unui mediu academic eficient, dar şi modalităţi de realizare a continuităţii şi inter­conexiunii dintre ciclurile învăţământului superior. Sunt propuse sugestii de asigurare a continuităţii şi interconexiunii dintre ciclurile învăţământului superior.ACADEMIC ENVIRONMENT AS A FACTOR IN ENSURING CONTINUITY AND INTERCONNECTION BETWEEN CYCLES OF HIGHER EDUCATIONThe article addressed academics as a factor of continuity and interconnection between cycles of higher education. In this sense analyzed different concepts with reference to academia, they are deducted design principles of an academic environment effectively, but also ways of continuity and interconnection between cycles of higher education, are proposed suggestions to ensure continuity and interconnection between cycles of higher education.

  7. New Triplet Sensitization Routes for Photon Upconversion: Thermally Activated Delayed Fluorescence Molecules, Inorganic Nanocrystals, and Singlet-to-Triplet Absorption.

    Science.gov (United States)

    Yanai, Nobuhiro; Kimizuka, Nobuo

    2017-10-17

    Photon upconversion based on triplet-triplet annihilation (TTA-UC) has attracted much interest because of its possible applications to renewable energy production and biological fields. In particular, the UC of near-infrared (NIR) light to visible (vis) light is imperative to overcome the Shockley-Queisser limit of single-junction photovoltaic cells, and the efficiency of photocatalytic hydrogen production from water can also be improved with the aid of vis-to-ultraviolet (UV) UC. However, both processes have met limitations in the wavelength range, efficiency, and sensitivity for weak incident light. This Account describes recent breakthroughs that solve these major problems, new triplet sensitization routes to significantly enlarge the range of conversion wavelength by minimizing the energy loss during intersystem crossing (ISC) of triplet sensitizers or bypassing the ISC process. The photochemical processes of TTA-UC in general start with the absorption of longer wavelength incident light by triplet sensitizers, which generate the triplet states via ISC. This ISC inevitably accompanies the energy loss of hundreds of millielectronvolts, which significantly limits the TTA-UC with large anti-Stokes shifts. The small S1-T1 gap of molecules showing thermally activated delayed fluorescence (TADF) allows the sensitization of emitters with the highest T1 and S1 energy levels ever employed in TTA-UC, which results in efficient vis-to-UV UC. As alternatives to molecular sensitizers in the NIR region, inorganic nanocrystals with broad NIR absorption bands have recently been shown to work as effective sensitizers for NIR-to-vis TTA-UC. Their small exchange splitting minimizes the energy loss during triplet sensitization. The modification of nanocrystal surfaces with organic acceptors via coordination bonds allows efficient energy transfer between the components and succeeding TTA processes. To remove restrictions on the energy loss during ISC, molecules with direct singlet-to-triplet

  8. MiR-152 may silence translation of CaMK II and induce spontaneous immune tolerance in mouse liver transplantation.

    Science.gov (United States)

    Wang, Yan; Tian, Yang; Ding, Yuan; Wang, Jingcheng; Yan, Sheng; Zhou, Lin; Xie, Haiyang; Chen, Hui; Li, Hui; Zhang, Jinhua; Zhao, Jiacong; Zheng, Shusen

    2014-01-01

    Spontaneous immune tolerance in mouse liver transplantation has always been a hotspot in transplantation-immune research. Recent studies revealed that regulatory T cells (Tregs), hepatic satellite cells and Kupffer cells play a potential role in spontaneous immune tolerance, however the precise mechanism of spontaneous immune tolerance is still undefined. By using Microarray Chips, we investigated different immune regulatory factors to decipher critical mechanisms of spontaneous tolerance after mouse liver transplantation. Allogeneic (C57BL/6-C3H) and syngeneic (C3H-C3H) liver transplantation were performed by 6-8 weeks old male C57BL/6 and C3H mice. Graft samples (N = 4 each group) were collected from 8 weeks post-operation mice. 11 differentially expressed miRNAs in allogeneic grafts (Allografts) vs. syngeneic grafts (Syngrafts) were identified using Agilent Mouse miRNA Chips. It was revealed that 185 genes were modified by the 11 miRNAs, furthermore, within the 185 target genes, 11 of them were tightly correlated with immune regulation after Gene Ontology (GO), Kyoto Encyclopedia of Genes and Genomes (KEGG) analysis and Genbank data cross-comparison. Verified by real-time PCR and western blot, our results indicated that mRNA expression levels of IL-6 and TAB2 were respectively down regulated following miR-142-3p and miR-155 augment. In addition, increased miR-152 just silenced mRNA of CaMK II and down-regulated translation of CaMK II in tolerated liver grafts, which may play a critical role in immune regulation and spontaneous tolerance induction of mouse liver transplantation.

  9. MiR-152 may silence translation of CaMK II and induce spontaneous immune tolerance in mouse liver transplantation.

    Directory of Open Access Journals (Sweden)

    Yan Wang

    Full Text Available Spontaneous immune tolerance in mouse liver transplantation has always been a hotspot in transplantation-immune research. Recent studies revealed that regulatory T cells (Tregs, hepatic satellite cells and Kupffer cells play a potential role in spontaneous immune tolerance, however the precise mechanism of spontaneous immune tolerance is still undefined. By using Microarray Chips, we investigated different immune regulatory factors to decipher critical mechanisms of spontaneous tolerance after mouse liver transplantation. Allogeneic (C57BL/6-C3H and syngeneic (C3H-C3H liver transplantation were performed by 6-8 weeks old male C57BL/6 and C3H mice. Graft samples (N = 4 each group were collected from 8 weeks post-operation mice. 11 differentially expressed miRNAs in allogeneic grafts (Allografts vs. syngeneic grafts (Syngrafts were identified using Agilent Mouse miRNA Chips. It was revealed that 185 genes were modified by the 11 miRNAs, furthermore, within the 185 target genes, 11 of them were tightly correlated with immune regulation after Gene Ontology (GO, Kyoto Encyclopedia of Genes and Genomes (KEGG analysis and Genbank data cross-comparison. Verified by real-time PCR and western blot, our results indicated that mRNA expression levels of IL-6 and TAB2 were respectively down regulated following miR-142-3p and miR-155 augment. In addition, increased miR-152 just silenced mRNA of CaMK II and down-regulated translation of CaMK II in tolerated liver grafts, which may play a critical role in immune regulation and spontaneous tolerance induction of mouse liver transplantation.

  10. Crystal structure of calcium dinickel(II iron(III tris(orthophosphate: CaNi2Fe(PO43

    Directory of Open Access Journals (Sweden)

    Said Ouaatta

    2017-06-01

    Full Text Available The title compound, CaNi2Fe(PO43, was synthesized by solid-state reactions. Its structure is closely related to that of α-CrPO4 in the space group Imma. Except for two O atoms in general positions, all atoms are located in special positions. The three-dimensional framework is built up from two types of sheets extending parallel to (100. The first sheet is made up from two edge-sharing [NiO6] octahedra, leading to the formation of [Ni2O10] double octahedra that are connected to two PO4 tetrahedra through a common edge and corners. The second sheet results from rows of corner-sharing [FeO6] octahedra and PO4 tetrahedra forming an infinite linear chain. These layers are linked together through common corners of PO4 tetrahedra and [FeO6] octahedra, resulting in an open three-dimensional framework that delimits two types of channels parallel to [100] and [010] in which the eightfold-coordinated CaII cations are located.

  11. The TRPC1 Ca2+-permeable channel inhibits exercise-induced protection against high-fat diet-induced obesity and type II diabetes.

    Science.gov (United States)

    Krout, Danielle; Schaar, Anne; Sun, Yuyang; Sukumaran, Pramod; Roemmich, James N; Singh, Brij B; Claycombe-Larson, Kate J

    2017-12-15

    The transient receptor potential canonical channel-1 (TRPC1) is a Ca 2+ -permeable channel found in key metabolic organs and tissues, including the hypothalamus, adipose tissue, and skeletal muscle. Loss of TRPC1 may alter the regulation of cellular energy metabolism resulting in insulin resistance thereby leading to diabetes. Exercise reduces insulin resistance, but it is not known whether TRPC1 is involved in exercise-induced insulin sensitivity. The role of TRPC1 in adiposity and obesity-associated metabolic diseases has not yet been determined. Our results show that TRPC1 functions as a major Ca 2+ entry channel in adipocytes. We have also shown that fat mass and fasting glucose concentrations were lower in TRPC1 KO mice that were fed a high-fat (HF) (45% fat) diet and exercised as compared with WT mice fed a HF diet and exercised. Adipocyte numbers were decreased in both subcutaneous and visceral adipose tissue of TRPC1 KO mice fed a HF diet and exercised. Finally, autophagy markers were decreased and apoptosis markers increased in TRPC1 KO mice fed a HF diet and exercised. Overall, these findings suggest that TRPC1 plays an important role in the regulation of adiposity via autophagy and apoptosis and that TRPC1 inhibits the positive effect of exercise on type II diabetes risk under a HF diet-induced obesity environment.

  12. Crystal structure of calcium dinickel(II) iron(III) tris-(orthophosphate): CaNi2Fe(PO4)3.

    Science.gov (United States)

    Ouaatta, Said; Assani, Abderrazzak; Saadi, Mohamed; El Ammari, Lahcen

    2017-06-01

    The title compound, CaNi2Fe(PO4)3, was synthesized by solid-state reactions. Its structure is closely related to that of α-CrPO4 in the space group Imma. Except for two O atoms in general positions, all atoms are located in special positions. The three-dimensional framework is built up from two types of sheets extending parallel to (100). The first sheet is made up from two edge-sharing [NiO6] octa-hedra, leading to the formation of [Ni2O10] double octa-hedra that are connected to two PO4 tetra-hedra through a common edge and corners. The second sheet results from rows of corner-sharing [FeO6] octa-hedra and PO4 tetra-hedra forming an infinite linear chain. These layers are linked together through common corners of PO4 tetra-hedra and [FeO6] octa-hedra, resulting in an open three-dimensional framework that delimits two types of channels parallel to [100] and [010] in which the eightfold-coordinated Ca(II) cations are located.

  13. Regulation of aldosterone production from zona glomerulosa cells by ANG II and cAMP: evidence for PKA-independent activation of CaMK by cAMP.

    Science.gov (United States)

    Gambaryan, Stepan; Butt, Elke; Tas, Piet; Smolenski, Albert; Allolio, Bruno; Walter, Ulrich

    2006-03-01

    Aldosterone production in zona glomerulosa (ZG) cells of adrenal glands is regulated by various extracellular stimuli (K(+), ANG II, ACTH) that all converge on two major intracellular signaling pathways: an increase in cAMP production and calcium (Ca(2+)) mobilization. However, molecular events downstream of the increase in intracellular cAMP and Ca(2+) content are controversial and far from being completely resolved. Here, we found that Ca(2+)/calmodulin-dependent protein kinases (CaMKs) play a predominant role in the regulation of aldosterone production stimulated by ANG II, ACTH, and cAMP. The specific CaMK inhibitor KN93 strongly reduced ANG II-, ACTH-, and cAMP-stimulated aldosterone production. In in vitro kinase assays and intact cells, we could show that cAMP-induced activation of CaMK, using the adenylate cyclase activator forskolin or the cAMP-analog Sp-5,6-DCI-cBIMPS (cBIMPS), was not mediated by PKA. Activation of the recently identified cAMP target protein Epac (exchange protein directly activated by cAMP) by 8-pCPT-2'-O-Me-cAMP had no effect on CaMK activity and aldosterone production. Furthermore, we provide evidence that cAMP effects in ZG cells do not involve Ca(2+) or MAPK signaling. Our results suggest that ZG cells, in addition to PKA and Epac/Rap proteins, contain other as yet unidentified cAMP mediator(s) involved in regulating CaMK activity and aldosterone secretion.

  14. STELLAR METALLICITIES AND KINEMATICS IN A GAS-RICH DWARF GALAXY : FIRST CALCIUM TRIPLET SPECTROSCOPY OF RED GIANT BRANCH STARS IN WLM

    NARCIS (Netherlands)

    Leaman, Ryan; Cole, Andrew A.; Venn, Kim A.; Tolstoy, Eline; Irwin, Mike J.; Szeifert, Thomas; Skillman, Evan D.; McConnachie, Alan W.

    2009-01-01

    We present the first determination of the radial velocities and metallicities of 78 red giant stars in the isolated dwarf irregular galaxy WLM. Observations of the calcium II triplet in these stars were made with FORS2 at the VLT-UT2 in two separated fields of view in WLM, and the [Fe/H] values were

  15. Unifying darko-lepto-genesis with scalar triplet inflation

    Energy Technology Data Exchange (ETDEWEB)

    Arina, Chiara, E-mail: chiara.arina@physik.rwth-aachen.de [Institut fuer Theoretische Teilchenphysik und Kosmologie, RWTH Aachen, 52056 Aachen (Germany); Gong, Jinn-Ouk, E-mail: jinn-ouk.gong@cern.ch [Theory Division, CERN, CH-1211 Geneve 23 (Switzerland); Sahu, Narendra, E-mail: nsahu@iith.ac.in [Department of Physics, IIT Hyderabad, Yeddumailaram 502 205, Andhra Pradesh (India)

    2012-12-21

    We present a scalar triplet extension of the standard model to unify the origin of inflation with neutrino mass, asymmetric dark matter and leptogenesis. In presence of non-minimal couplings to gravity the scalar triplet, mixed with the standard model Higgs, plays the role of inflaton in the early Universe, while its decay to SM Higgs, lepton and dark matter simultaneously generate an asymmetry in the visible and dark matter sectors. On the other hand, in the low energy effective theory the induced vacuum expectation value of the triplet gives sub-eV Majorana masses to active neutrinos. We investigate the model parameter space leading to successful inflation as well as the observed dark matter to baryon abundance. Assuming the standard model like Higgs mass to be at 125-126 GeV, we found that the mass scale of the scalar triplet to be Less-Than-Or-Equivalent-To O(10{sup 9}) GeV and its trilinear coupling to doublet Higgs is Less-Than-Or-Equivalent-To 0.09 so that it not only evades the possibility of having a metastable vacuum in the standard model, but also lead to a rich phenomenological consequences as stated above. Moreover, we found that the scalar triplet inflation strongly constrains the quartic couplings, while allowing for a wide range of Yukawa couplings which generate the CP asymmetries in the visible and dark matter sectors.

  16. Long-lived, colour-triplet scalars from unnaturalness

    Energy Technology Data Exchange (ETDEWEB)

    Barnard, James; Cox, Peter [ARC Centre of Excellence for Particle Physics at the Terascale,School of Physics, The University of Melbourne,Victoria 3010 (Australia); Gherghetta, Tony [School of Physics and Astronomy, University of Minnesota,Minneapolis, Minnesota 55455 (United States); Spray, Andrew [ARC Centre of Excellence for Particle Physics at the Terascale,School of Physics, The University of Melbourne,Victoria 3010 (Australia); Center for Theoretical Physics of the Universe, Institute for Basic Science (IBS),Daejeon, 34051 (Korea, Republic of)

    2016-03-01

    Long-lived, colour-triplet scalars are a generic prediction of unnatural, or split, composite Higgs models where the spontaneous global-symmetry breaking scale f≳10 TeV and an unbroken SU(5) symmetry is preserved. Since the triplet scalars are pseudo Nambu-Goldstone bosons they are split from the much heavier composite-sector resonances and are the lightest exotic, coloured states. This makes them ideal to search for at colliders. Due to discrete symmetries the triplet scalar decays via a dimension-six term and given the large suppression scale f is often metastable. We show that existing searches for collider-stable R-hadrons from Run-I at the LHC forbid a triplet scalar mass below 845 GeV, whereas with 300 fb{sup −1} at 13 TeV triplet scalar masses up to 1.4 TeV can be discovered. For shorter lifetimes displaced-vertex searches provide a discovery reach of up to 1.8 TeV. In addition we present exclusion and discovery reaches of future hadron colliders as well as indirect limits that arise from modifications of the Higgs couplings.

  17. Method for measurement of transition probabilities by laser-induced breakdown spectroscopy based on CSigma graphs-Application to Ca II spectral lines

    Science.gov (United States)

    Aguilera, J. A.; Aragón, C.; Manrique, J.

    2015-07-01

    We propose a method for determination of transition probabilities by laser-induced breakdown spectroscopy that avoids the error due to self-absorption. The method relies on CSigma graphs, a generalization of curves of growth which allows including several lines of various elements in the same ionization state. CSigma graphs are constructed including reference lines of an emitting species with well-known transition probabilities, together with the lines of interest, both in the same ionization state. The samples are fused glass disks prepared from small concentrations of compounds. When the method is applied, the concentration of the element of interest in the sample must be controlled to avoid the failure of the homogeneous plasma model. To test the method, the transition probabilities of 9 Ca II lines arising from the 4d, 5s, 5d and 6s configurations are measured using Fe II reference lines. The data for 5 of the studied lines, mainly from the 5d and 6s configurations, had not been measured previously.

  18. Ternary wurtzite CaAgBi materials family: A playground for essential and accidental, type-I and type-II Dirac fermions

    Science.gov (United States)

    Chen, Cong; Wang, Shan-Shan; Liu, Lei; Yu, Zhi-Ming; Sheng, Xian-Lei; Chen, Ziyu; Yang, Shengyuan A.

    2017-09-01

    Based on their formation mechanisms, Dirac points in three-dimensional systems can be classified as accidental or essential. The former can be further distinguished into type I and type II, depending on whether the Dirac cone spectrum is completely tipped over along a certain direction. Here we predict the coexistence of all three kinds of Dirac points in the low-energy band structure of CaAgBi-family materials with a stuffed wurtzite structure. Two pairs of accidental Dirac points reside on the rotational axis, with one pair being type I and the other pair type II; while another essential Dirac point is pinned at the high symmetry point on the Brillouin zone boundary. Due to broken inversion symmetry, the band degeneracy around accidental Dirac points is completely lifted except along the rotational axis, realizing a kind of birefringent Dirac fermions, which may enable the splitting of chiral carriers at a ballistic p -n junction with a double negative refraction effect. We clarify their symmetry protections, and find both the Dirac cone and Fermi arc topological surface states.

  19. Conservation of spin polarization during triplet-triplet energy transfer in reconstituted peridinin-chlorophyll-protein complexes.

    Science.gov (United States)

    Di Valentin, Marilena; Tait, Claudia; Salvadori, Enrico; Ceola, Stefano; Scheer, Hugo; Hiller, Roger G; Carbonera, Donatella

    2011-11-17

    Peridinin-chlorophyll-protein (PCP) complexes, where the N-terminal domain of native PCP from Amphidinium carterae has been reconstituted with different chlorophyll (Chl) species, have been investigated by time-resolved EPR in order to elucidate the details of the triplet-triplet energy transfer (TTET) mechanism. This spectroscopic approach exploits the concept of spin conservation during TTET, which leads to recognizable spin-polarization effects in the observed time-resolved EPR spectra. The spin polarization produced at the acceptor site (peridinin) depends on the initial polarization of the donor (chlorophyll) and on the relative geometric arrangement of the donor-acceptor spin axes. A variation of the donor triplet state properties in terms of population probabilities or triplet spin axis directions, as produced by replacement of chlorophyll a (Chl a) with non-native chlorophyll species (ZnChl a and BacterioChl a) in the reconstituted complexes, is unambiguously reflected in the polarization pattern of the carotenoid triplet state. For the first time, in the present investigation spin-polarization conservation has been shown to occur among natural cofactors in protein complexes during the TTET process. Proving the validity of the assumption of spin conservation adopted in the EPR spectral analysis, the results reinforce the hypothesis that in PCP proteins peridinin 614, according to X-ray nomenclature (Hofmann, E.; et al. Science 1996, 272, 1788-1791), is the carotenoid of election in the photoprotection mechanism based on TTET.

  20. Homo- or Hetero- Triplet-Triplet Annihilation? A Case Study with Perylene-Bodipy Dyads/Triads

    KAUST Repository

    Cui, Xiaoneng

    2017-07-06

    The photophysical processes of intramolecular ‘ping-pong’ energy transfers in the iodinated reference dyad BDP-I2-Py, as well as the uniodinated dyad BDP-Py and triad BDP-2Py, were studied. For BDP-I2-Py, a forward Förster resonance energy transfer (FRET) from the perylene (Py) unit to the diiodoBDP unit (7 ps) and a backward triplet energy transfer (TTET, 3 ns) from the diiodoBDP unit to the Py unit were observed. For the BDP-Py and BDP-2Py systems, a FRET (5 ~ 8 ps) and a photo-induced electron transfer (PET) (1-1.5 ns) were observed in acetonitrile. The uniodinated dyad and triad were used as the triplet energy acceptor and emitter for a TTA upconversion with palladium tetraphenyltetrabenzoporphyrin as the triplet photosensitizer. A maximum upconversion quantum yield of 12.6 % was measured. Given that the dyad (BDP-Py) contains one BDP unit and one Py unit, while the triad (BDP-2Py) contains two Py units and one BDP unit, and based on the results from steady-state femtosecond and nanosecond transient optical spectroscopies, it is concluded that neither intramolecular homo- triplet-triplet annihilation (TTA) nor intramolecular hetero-TTA is possible during a TTA upconversion for those upconversion systems.

  1. Zac1/GPR39 phosphorylating CaMK-II contributes to the distinct roles of Pax3 and Pax7 in myogenic progression.

    Science.gov (United States)

    Yang, Qiumei; Li, Ye; Zhang, Xulong; Chen, Daiwen

    2017-11-02

    Both Pax3 and Pax7 can activate a large panel of genes involved in muscle stem cell function. Despite a significant overlap in their transcriptional network, functional difference between them is observed. After overexpressing Pax3 or Pax7 in C2C12, we find both Zac1 and GPR39 are upregulated by Pax7 but not Pax3. Further studies suggest Zac1 interacts directly with Pax7, which can regulate GPR39 expression by activating Zac1. In addition, the effect of Zac1/GPR39 system on myogenic progression has been illuminated: Zac1/GPR39 can promote myogenic differentiation and produce type-II muscle fibers. Gait analysis verifies that transplanting GFP-labeled Pax7 RV/siZac1 transfected cells into mdx mice with muscle injury would delay muscle function repair. Molecular mechanism studies reveal the Zac1/GPR39 system is associated with different myogenic functions of Pax3 and Pax7: Pax7 activates Zac1/GPR39, which mediates the phosphorylation of CaMK-II, resulting in p-ERK1/2 dephosphorylation and β-catenin inhibition, that promotes the formation of type-II muscle fibers; cells lacking Zac1/GPR39 system tend to remain stemness and form type-I muscle fibers after induced differentiation. This study will help the better understanding of the molecular mechanism of Pax3 and Pax7 in the regulation of myogenic progression and muscle fiber types, laying the providing suitable targets for the treatment of muscle diseases. Copyright © 2017. Published by Elsevier B.V.

  2. Pyridine-2,6-diyl dinitroxides as room-temperature triplet ligands

    Energy Technology Data Exchange (ETDEWEB)

    Kawakami, Hinako; Tonegawa, Asato; Ishida, Takayuki, E-mail: takayuki.ishida@uec.ac.jp [Department of Engineering Science, The University of Electro-Communications, Tokyo (Japan)

    2016-02-01

    We have proposed tert-butyl 2-pyridyl nitroxide radicals as a promising paramagnetic chelating ligand, where the direct radical-metal bond leads to strong magnetic interaction. We successfully synthesized and isolated PyBN derivatives (pyridine-2,6-diyl bis(tert-butyl nitroxides)). The molecular and crystal structures of the target biradicals, MesPyBN, AntPyBN and tBuOPyBN were determined from the X-ray crystal structure analysis, which possess mesityl, 9-anthryl and tert-butoxy groups at the 5-position of the pyridine ring, respectively. The ground triplet state was characterized by means of SQUID susceptometry for each compound. On heating, the χ{sub m}T values of all the PyBN derivatives increased and reached a plateau at ca. 1.0 cm{sup 3} K mol{sup −1} at 300 K. It implies that biradicals behaved as triplet molecules even at room temperature, or 2J/k{sub B} >> 300 K. From the decay monitored in solution electron-spin resonance spectroscopy, MesPyBN was the most persistent, while tBuOPyBN was the most reactive, of the three.

  3. Triplet supertree heuristics for the tree of life.

    Science.gov (United States)

    Lin, Harris T; Burleigh, J Gordon; Eulenstein, Oliver

    2009-01-30

    There is much interest in developing fast and accurate supertree methods to infer the tree of life. Supertree methods combine smaller input trees with overlapping sets of taxa to make a comprehensive phylogenetic tree that contains all of the taxa in the input trees. The intrinsically hard triplet supertree problem takes a collection of input species trees and seeks a species tree (supertree) that maximizes the number of triplet subtrees that it shares with the input trees. However, the utility of this supertree problem has been limited by a lack of efficient and effective heuristics. We introduce fast hill-climbing heuristics for the triplet supertree problem that perform a step-wise search of the tree space, where each step is guided by an exact solution to an instance of a local search problem. To realize time efficient heuristics we designed the first nontrivial algorithms for two standard search problems, which greatly improve on the time complexity to the best known (naïve) solutions by a factor of n and n2 (the number of taxa in the supertree). These algorithms enable large-scale supertree analyses based on the triplet supertree problem that were previously not possible. We implemented hill-climbing heuristics that are based on our new algorithms, and in analyses of two published supertree data sets, we demonstrate that our new heuristics outperform other standard supertree methods in maximizing the number of triplets shared with the input trees. With our new heuristics, the triplet supertree problem is now computationally more tractable for large-scale supertree analyses, and it provides a potentially more accurate alternative to existing supertree methods.

  4. Triplet State Resonance Raman Spectrum of all-trans-diphenylbutadiene

    DEFF Research Database (Denmark)

    Wilbrandt, Robert Walter; Grossman, W.E.L.; Killough, P.M

    1984-01-01

    The resonance Raman spectrum of all-trans-diphenylbutadiene (DPB) in its ground state and the resonance Raman spectrum (RRS) of DPB in its short-lived electronically excited triplet state are reported. Transient spectra were obtained by a pump-probe technique using two pulsed lasers....... The preresonance spectrum of the ground state is not significantly changed from that of the nonresonance spectrum. In the resonance spectrum of the triplet state the double-bond stretching mode of the butadiene part is shifted by 43 cm-1 downward to 1582 cm-1 whereas the single-bond stretching mode is essentially...

  5. Study of the triplet periodicity phase shifts in genes.

    Science.gov (United States)

    Korotkov, Eugene V; Korotkova, Maria A

    2010-03-25

    The definition of a phase shift of triplet periodicity (TP) is introduced. The mathematical algorithm for detection of TP phase shift of nucleotide sequences has been developed. Gene sequences from Kegg-46 data bank were analyzed with a purpose of searching genes with a phase shift of TP. The presence of a phase shift of triplet periodicity has been shown for 318329 genes (approximately 10% from the number of genes in Kegg-46). We suppose that shifts of the TP phase may indicate the shifts of reading frame (RF) in genes. A relationship between the phase shifts of TP and the frame shifts in genes is discussed.

  6. Triplet-singlet conversion by broadband optical pumping

    OpenAIRE

    Horchani, Ridha; Lignier, Hans; Bouloufa-Maafa, Nadia; Fioretti, Andrea; Pillet, Pierre; Comparat, Daniel

    2012-01-01

    We demonstrate the conversion of cold Cs_{2} molecules initially distributed over several vibrational levels of the lowest triplet state a^{3}\\Sigma_{u}^{+} into the singlet ground state X^{1}\\Sigma_{g}^{+}. This conversion is realized by a broadband laser exciting the molecules to a well-chosen state from which they may decay to the singlet state throug\\textcolor{black}{h two sequential single-photon emission steps: Th}e first photon populates levels with mixed triplet-singlet character, mak...

  7. CHROMOSPHERIC POLARIZATION IN THE PHOTOSPHERIC SOLAR OXYGEN INFRARED TRIPLET

    Energy Technology Data Exchange (ETDEWEB)

    Del Pino Alemán, Tanausú; Trujillo Bueno, Javier [Instituto de Astrofísica de Canarias, E-38205 La Laguna, Tenerife (Spain)

    2015-07-20

    We present multilevel radiative transfer modeling of the scattering polarization observed in the solar O i infrared triplet around 777 nm. We demonstrate that the scattering polarization pattern observed on the solar disk forms in the chromosphere, far above the photospheric region where the bulk of the emergent intensity profiles originate. We investigate the sensitivity of the polarization pattern to the thermal structure of the solar atmosphere and to the presence of weak magnetic fields (10{sup −2}–100 G) through the Hanle effect, showing that the scattering polarization signals of the oxygen infrared triplet encode information on the magnetism of the solar chromosphere.

  8. Effect of Temperature and Pressure on Correlation Energy in a Triplet State of a Two Electron Spherical Quantum Dot

    Directory of Open Access Journals (Sweden)

    A. Rejo Jeice

    2013-09-01

    Full Text Available The combined effect of hydrostatic pressure and temperature on correlation energy in a triplet state of two electron spherical quantum dot with square well potential is computed. The result is presented taking GaAs dot as an example. Our result shows the correlation energies are inegative in the triplet state contrast to the singlet state ii it increases with increase in pressure  iiifurther decreases due to the application  of temperature iv it approaches zero as dot size approaches infinity and v it contribute 10% decrement in total confined energy to the narrow dots. All the calculations have been carried out with finite models and the results are compared with existing literature.

  9. Discovery of 4-sulfamoyl-phenyl-β-lactams as a new class of potent carbonic anhydrase isoforms I, II, IV and VII inhibitors: The first example of subnanomolar CA IV inhibitors.

    Science.gov (United States)

    Angapelly, Srinivas; Ramya, P V Sri; Angeli, Andrea; Monti, Simona Maria; Buonanno, Martina; Alvala, Mallika; Supuran, Cladiu T; Arifuddin, Mohammed

    2017-01-15

    A series of benzenesulfonamides incorporating 1,3,4-trisubstituted-β-lactam moieties was prepared from sulfanilamide Schiff bases and in situ obtained ketenes, by using the Staudinger cycloaddition reaction. The new compounds were assayed as inhibitors of four human isoforms of the metalloenzyme carbonic anhydrase (hCA, EC 4.2.1.1) involved in various physiological/pathological conditions, hCA I, II, IV and VII. Excellent inhibitory activity was observed against all these isoforms, as follows: hCA I, involved in some eye diseases was inhibited with KIs in the range of 7.3-917nM; hCA II, an antiglaucoma drug target, with KIs in the range of 0.76-163nM. hCA IV, an isoform involved in several pathological conditions such as glaucoma, retinitis pigmentosa and edema was potently inhibited by the lactam-sulfonamides, with KIs in the range of 0.53-51.0nM, whereas hCA VII, a recently validated anti-neuropathic pain target was the most inhibited isoform by these derivatives, with KIs in the range of 0.68-9.1nM. The structure-activity relationship for inhibiting these CAs with the new lactam-sulfonamides is discussed in detail. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Validated Zinc Finger Protein Designs for All 16 GNN DNA Triplet Targets

    National Research Council Canada - National Science Library

    Qiang Liu; ZhenQin Xia; Casey C. Case

    2002-01-01

    .... We started with a subgroup of the 64 triplets, the GNN-binding fingers. The GNN-binding fingers have been examined in several studies, but previous studies did not produce specific fingers for all of the 16 GNN triplets...

  11. Twin Fetuses Papyraeci in a Spontaneous Triplet Pregnancy ...

    African Journals Online (AJOL)

    weighed 2.3 kg with Apgar score of 7 and 10 in 1st and 5th min,. Twin Fetuses Papyraeci in a Spontaneous Triplet. Pregnancy Presenting with Unexplained Preterm. Contractions. Bukar M, Chama CM, Bako BG, Jonathan BI. Department of Obstetrics and Gynecology, University of Maiduguri Teaching Hospital, Maiduguri, ...

  12. comparison of the minutiae quadruplets and minutiae triplets ...

    African Journals Online (AJOL)

    The new minutiae quadruplet structure has several advantages over the minutiae triplet structure. References. 1. Germain, R.S., Califano, A., Colville, S. Fingerprint Matching Using Transformation. Parameter Clustering. IEEE Computational. Science & Engineering. IEEE, pp 42-29. 2. Bhanu, B. and Tan, X. Fingerprint Index-.

  13. Triplet repeat DNA structures and human genetic disease: dynamic ...

    Indian Academy of Sciences (India)

    Unknown

    of triplet repeats (Pearson and Sinden 1998a; Sinden. 1999). Expansions or deletions can occur by simple. Table 1. Trinucleotide repeats in human genetic disease. Repeat length. Disease. Gene. Locus. Repeata. Normal. Pre- mutation. Disease. Protein/possible biological effect of expansion. Fragile X syndrome. FMR1.

  14. Dark Matter from the Supersymmetric Custodial Triplet Model

    CERN Document Server

    Delgado, Antonio; Ostdiek, Bryan; Quiros, Mariano

    2015-01-01

    The Supersymmetric Custodial Triplet Model (SCTM) adds to the particle content of the MSSM three $SU(2)_L$ triplet chiral superfields with hypercharge $Y=(0,\\pm1)$. At the superpotential level the model respects a global $SU(2)_L \\otimes SU(2)_R$ symmetry only broken by the Yukawa interactions. The pattern of vacuum expectation values of the neutral doublet and triplet scalar fields depends on the symmetry pattern of the Higgs soft breaking masses. We study the cases where this symmetry is maintained in the Higgs sector, and when it is broken only by the two doublets attaining different vacuum expectation values. In the former case, the symmetry is spontaneously broken down to the vectorial subgroup $SU(2)_V$ and the $\\rho$ parameter is protected by the custodial symmetry. However in both situations the $\\rho$ parameter is protected at tree level, allowing for light triplet scalars with large vacuum expectation values. We find that over a large range of parameter space, a light neutralino can supply the corre...

  15. Triplet states at an O vacancy in alpha-quartz

    DEFF Research Database (Denmark)

    Lægsgaard, Jesper

    2002-01-01

    The energy landscape of an alpha-quartz O vacancy in the lowest triplet state is investigated. Four local minima are identified and geometries, total energies, and electron paramagnetic resonance (EPR) parameters are obtained. On the basis of calculated values for the magnetic dipole interaction...

  16. Stability of singlet and triplet trions in carbon nanotubes

    DEFF Research Database (Denmark)

    Rønnow, Troels Frimodt; Pedersen, Thomas Garm; Cornean, Horia

    2009-01-01

    We investigate singlet and triplet trion states in semiconducting carbon nanotubes using a one-dimensional model. It is concluded that singlet trion states in bind up to 13.5% stronger than exciton states, and that they lower the optical transition energy with up to 50% of the tight binding band...

  17. Predissociation and autoionization of triplet Rydberg states in molecular hydrogen

    NARCIS (Netherlands)

    Dinu, L.; Picard, Y.J.; Zande, W.J. van der

    2004-01-01

    We present single-photon spectroscopy in molecular hydrogen starting from the metastable c(3)Pi(u)(-) state to a number of triplet nd-Rydberg states (v=0-4, n=12-20). Using fast beam spectroscopy both the autoionization channel and the predissociation channel are quantified, field free, as well as

  18. Dicephalus dibrachius dipus conjoined twins in a triplet pregnancy ...

    African Journals Online (AJOL)

    Conjoined twins occurring in a triplet pregnancy is a rare occurrence. We present a case of undiagnosed dicephalic conjoined twins occurring in a multigravida with triple pregnancy delivered by caesarian section. The anatomical and pathologic findings in these twins after their demise are described with a brief review of ...

  19. Unifying darko-lepto-genesis with scalar triplet inflation

    CERN Document Server

    Arina, Chiara; Sahu, Narendra

    2012-01-01

    We present a scalar triplet extension of the standard model to unify the origin of inflation with neutrino mass, asymmetric dark matter and leptogenesis. In presence of non-minimal couplings to gravity the scalar triplet, mixed with the standard model Higgs, plays the role of inflaton in the early Universe, while its decay to SM Higgs, lepton and dark matter simultaneously generate an asymmetry in the visible and dark matter sectors. On the other hand, in the low energy effective theory the induced vacuum expectation value of the triplet gives sub-eV Majorana masses to active neutrinos. We investigate the model parameter space leading to successful inflation as well as the observed dark matter to baryon abundance. Assuming the standard model like Higgs mass to be at 125-126 GeV, we found that the mass scale of the scalar triplet to be ~ O(10^9) GeV and its trilinear coupling to doublet Higgs is ~ 0.09 so that it not only evades the possibility of having a metastable vacuum in the standard model, but also lead...

  20. The chemical abundances of the stellar populations in the Leo I and II dSph galaxies

    Science.gov (United States)

    Bosler, Tammy L.; Smecker-Hane, Tammy A.; Stetson, Peter B.

    2007-06-01

    We have obtained calcium abundances and radial velocities for 102 red giant branch (RGB) stars in the Leo I dwarf spheroidal galaxy (dSph) and 74 RGB stars in the Leo II dSph using the low-resolution spectrograph (LRIS) on the Keck I 10-m telescope. We report on the calcium abundances [Ca/H] derived from the strengths of the CaII triplet absorption lines at 8498, 8542 and 8662 Å in the stellar spectra using a new empirical CaII triplet calibration to [Ca/H]. The two galaxies have different average [Ca/H] values of -1.34 +/- 0.02 for Leo I and -1.65 +/- 0.02 for Leo II with intrinsic abundance dispersions of 1.2 and 1.0 dex, respectively. The typical random and total errors in derived abundances are 0.10 and 0.17 dex per star. For comparison to the existing literature, we also converted our CaII measurements to [Fe/H] on the scale of Carretta and Gratton (1997) though we discuss why this may not be the best determinant of metallicity; Leo I has a mean [Fe/H] = -1.34 and Leo II has a mean [Fe/H] = -1.59. The metallicity distribution function of Leo I is approximately Gaussian in shape with an excess at the metal-rich end, while that of Leo II shows an abrupt cut-off at the metal-rich end. The lower mean metallicity of Leo II is consistent with the fact that it has a lower luminosity, hence lower the total mass than Leo I; thus, the evolution of Leo II may have been affected more by mass lost in galactic winds. Our direct and independent measurement of the metallicity distributions in these dSph will allow a more accurate star-formation histories to be derived from future analysis of their colour-magnitude diagrams(CMDs). Data presented herein were obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation. E

  1. Fetomaternal Outcome in Triplet and Quadruplet Pregnancies: A Retrospective Study

    Directory of Open Access Journals (Sweden)

    Maasoumeh Mirzamoradi

    2017-06-01

    Full Text Available Background: In recent decades, there has been a dramatic increase in the prevalence of multiple pregnancies. An important reason is the increased use of assisted reproductive techniques for conception. Despite the advances in prenatal care, maternal and neonatal morbidity and mortality caused by multiple pregnancies are still high. Aim: This study aimed to evaluate the fetomaternal complications in higher order multiple pregnancies. Design: The design is a retrospective study. Setting: Triplet and quadruplet pregnancies were investigated in this study. Methods: This study investigated the outcome of triplet and quadruplet pregnancies born alive at the Mahdiyeh hospital, Tehran, Iran from 2006 to 2015. Results: In this study, 111 triplet pregnancies and 24 quadruplet pregnancies were studied, 80% of which resulted from assisted reproductive technology. The average age of pregnancy termination was 31 weeks, the average weight of the first to third neonates was 1400 g and the average weight of the fourth neonate was 700 g. The most common reason for early termination of pregnancy was preterm labor, the most maternal complication was uterine atony and the most common neonatal complication was pre-maturity and then respiratory distress syndrome (RDS. The mean age of mother in triplets’ deliveries was significantly lower than in the quadruplets. The average weight of the first to third neonates, the average of 1st and 5th minutes Apgar score of the first neonates and the average gestational age of termination for the first and second neonates in triplets was significantly higher than in the quadruplets. Hospitalization due to preterm labor in quadruplets’ delivery was significantly higher than in triplets. Conclusion: Higher order multiple pregnancies are associated with higher maternal and neonatal complications. Mothers with such pregnancies needs more care in the prenatal period, during labor and in the postpartum period, and also their

  2. Structural basis for triplet repeat disorders: a computational analysis.

    Science.gov (United States)

    Baldi, P; Brunak, S; Chauvin, Y; Pedersen, A G

    1999-11-01

    Over a dozen major degenerative disorders, including myotonic distrophy, Huntington's disease and fragile X syndrome, result from unstable expansions of particular trinucleotides. Remarkably, only some of all the possible triplets, namely CAG/CTG, CGG/CCG and GAA/TTC, have been associated with the known pathological expansions. This raises some basic questions at the DNA level. Why do particular triplets seem to be singled out? What is the mechanism for their expansion and how does it depend on the triplet itself? Could other triplets or longer repeats be involved in other diseases? Using several different computational models of DNA structure, we show that the triplets involved in the pathological repeats generally fall into extreme classes. Thus, CAG/CTG repeats are particularly flexible, whereas GCC, CGG and GAA repeats appear to display both flexible and rigid (but curved) characteristics depending on the method of analysis. The fact that (1) trinucleotide repeats often become increasingly unstable when they exceed a length of approximately 50 repeats, and (2) repeated 12-mers display a similar increase in instability above 13 repeats, together suggest that approximately 150 bp is a general threshold length for repeat instability. Since this is about the length of DNA wrapped up in a single nucleosome core particle, we speculate that chromatin structure may play an important role in the expansion mechanism. We furthermore suggest that expansion of a dodecamer repeat, which we predict to have very high flexibility, may play a role in the pathogenesis of the neurodegenerative disorder multiple system atrophy (MSA). pfbaldi@ics.uci.edu, yves@netid.com, brunak@cbs.dtu.dk, gorm@cbs.dtu.dk.

  3. Berbamine inhibits the growth of liver cancer cells and cancer-initiating cells by targeting Ca²⁺/calmodulin-dependent protein kinase II.

    Science.gov (United States)

    Meng, Zhipeng; Li, Tao; Ma, Xiaoxiao; Wang, Xiaoqiong; Van Ness, Carl; Gan, Yichao; Zhou, Hong; Tang, Jinfen; Lou, Guiyu; Wang, Yafan; Wu, Jun; Yen, Yun; Xu, Rongzhen; Huang, Wendong

    2013-10-01

    Liver cancer is the third leading cause of cancer deaths worldwide but no effective treatment toward liver cancer is available so far. Therefore, there is an unmet medical need to identify novel therapies to efficiently treat liver cancer and improve the prognosis of this disease. Here, we report that berbamine and one of its derivatives, bbd24, potently suppressed liver cancer cell proliferation and induced cancer cell death by targeting Ca(2+)/calmodulin-dependent protein kinase II (CAMKII). Furthermore, berbamine inhibited the in vivo tumorigenicity of liver cancer cells in NOD/SCID mice and downregulated the self-renewal abilities of liver cancer-initiating cells. Chemical inhibition or short hairpin RNA-mediated knockdown of CAMKII recapitulated the effects of berbamine, whereas overexpression of CAMKII promoted cancer cell proliferation and increased the resistance of liver cancer cells to berbamine treatments. Western blot analyses of human liver cancer specimens showed that CAMKII was hyperphosphorylated in liver tumors compared with the paired peritumor tissues, which supports a role of CAMKII in promoting human liver cancer progression and the potential clinical use of berbamine for liver cancer therapies. Our data suggest that berbamine and its derivatives are promising agents to suppress liver cancer growth by targeting CAMKII. Mol Cancer Ther; 12(10); 2067-77. ©2013 AACR.

  4. Large Negative Thermal Expansion and Anomalous Behavior on Compression in Cubic ReO 3 -Type A II B IV F 6 : CaZrF 6 and CaHfF 6

    Energy Technology Data Exchange (ETDEWEB)

    Hancock, Justin C.; Chapman, Karena W.; Halder, Gregory J.; Morelock, Cody R.; Kaplan, Benjamin S.; Gallington, Leighanne C.; Bongiorno, Angelo; Han, Chu; Zhou, Si; Wilkinson, Angus P.

    2015-06-09

    CaZrF6 and CaHfF6 display much stronger negative thermal expansion (NTE) (alpha(L100 K) similar to -18 and -22 ppm K-1, respectively) than ZrW2O8 and other corner-shared framework structures. Their NTE is comparable to that reported for framework solids containing multiatom bridges, such as metal cyanides and metal-organic frameworks. However, they are formable as ceramics, transparent over a wide wavelength range and can be handled in air; these characteristics can be beneficial for applications. The NTE of CaZrF6 is strongly temperature-dependent, and first-principles calculations show that it is largely driven by vibrational modes below similar to 150 cm(-1). CaZrF6 is elastically soft with a bulk modulus (K-300K) of 37 GPa and, upon compression, starts to disorder at similar to 400 MPa. The strong NTE of CaZrF6, which remains cubic to <10 K, contrasts with cubic CoZrF6, which only displays modest NTE above its rhombohedral to cubic phase transition at similar to 270 K. CaZrF6 and CaHfF6 belong to a large and compositionally diverse family of materials, A(II)B(IV)F(6), providing for a detailed exploration of the chemical and structural factors controlling NTE and many opportunities for the design of controlled thermal expansion materials.

  5. Red-light-controllable liquid-crystal soft actuators via low-power excited upconversion based on triplet-triplet annihilation.

    Science.gov (United States)

    Jiang, Zhen; Xu, Ming; Li, Fuyou; Yu, Yanlei

    2013-11-06

    A red-light-controllable soft actuator has been achieved, driven by low-power excited triplet-triplet annihilation-based upconversion luminescence (TTA-UCL). First, a red-to-blue TTA-based upconversion system with a high absolute quantum yield of 9.3 ± 0.5% was prepared by utilizing platinum(II) tetraphenyltetrabenzoporphyrin (PtTPBP) as the sensitizer and 9,10-bis(diphenylphosphoryl)anthracene (BDPPA) as the annihilator. In order to be employed as a highly effective phototrigger of photodeformable cross-linked liquid-crystal polymers (CLCPs), the PtTPBP&BDPPA system was incorporated into a rubbery polyurethane film and then assembled with an azotolane-containing CLCP film. The generating assembly film bent toward the light source when irradiated with a 635 nm laser at low power density of 200 mW cm(-2) because the TTA-UCL was effectively utilized by the azotolane moieties in the CLCP film, inducing their trans-cis photoisomerization and an alignment change of the mesogens via an emission-reabsorption process. It is the first example of a soft actuator in which the TTA-UCL is trapped and utilized to create photomechanical effect. Such advantages of using this novel red-light-controllable soft actuator in potential biological applications have also been demonstrated as negligible thermal effect and its excellent penetration ability into tissues. This work not only provides a novel photomanipulated soft actuation material system based on the TTA-UCL technology but also introduces a new technological application of the TTA-based upconversion system in photonic devices.

  6. In Vivo Post-Cardiac Arrest Myocardial Dysfunction Is Supported by Ca2+/Calmodulin-Dependent Protein Kinase II-Mediated Calcium Long-Term Potentiation and Mitigated by Alda-1, an Agonist of Aldehyde Dehydrogenase Type 2.

    Science.gov (United States)

    Woods, Christopher; Shang, Ching; Taghavi, Fouad; Downey, Peter; Zalewski, Adrian; Rubio, Gabriel R; Liu, Jing; Homburger, Julian R; Grunwald, Zachary; Qi, Wei; Bollensdorff, Christian; Thanaporn, Porama; Ali, Ayyaz; Riemer, Kirk; Kohl, Peter; Mochly-Rosen, Daria; Gerstenfeld, Edward; Large, Stephen; Ali, Ziad; Ashley, Euan

    2016-09-27

    Survival after sudden cardiac arrest is limited by postarrest myocardial dysfunction, but understanding of this phenomenon is constrained by a lack of data from a physiological model of disease. In this study, we established an in vivo model of cardiac arrest and resuscitation, characterized the biology of the associated myocardial dysfunction, and tested novel therapeutic strategies. We developed rodent models of in vivo postarrest myocardial dysfunction using extracorporeal membrane oxygenation resuscitation followed by invasive hemodynamics measurement. In postarrest isolated cardiomyocytes, we assessed mechanical load and Ca(2) (+)-induced Ca(2+) release (CICR) simultaneously using the microcarbon fiber technique and observed reduced function and myofilament calcium sensitivity. We used a novel fiberoptic catheter imaging system and a genetically encoded calcium sensor, GCaMP6f, to image CICR in vivo. We found potentiation of CICR in isolated cells from this extracorporeal membrane oxygenation model and in cells isolated from an ischemia/reperfusion Langendorff model perfused with oxygenated blood from an arrested animal but not when reperfused in saline. We established that CICR potentiation begins in vivo. The augmented CICR observed after arrest was mediated by the activation of Ca(2+)/calmodulin-dependent protein kinase II (CaMKII). Increased phosphorylation of CaMKII, phospholamban, and ryanodine receptor 2 was detected in the postarrest period. Exogenous adrenergic activation in vivo recapitulated Ca(2+) potentiation but was associated with lesser CaMKII activation. Because oxidative stress and aldehydic adduct formation were high after arrest, we tested a small-molecule activator of aldehyde dehydrogenase type 2, Alda-1, which reduced oxidative stress, restored calcium and CaMKII homeostasis, and improved cardiac function and postarrest outcome in vivo. Cardiac arrest and reperfusion lead to CaMKII activation and calcium long-term potentiation, which

  7. Heats of Formation of Triplet Ethylene, Ethylidene, and Acetylene

    Energy Technology Data Exchange (ETDEWEB)

    Nguyen, M.T.; Matus, M.H.; Lester Jr, W.A.; Dixon, David A.

    2007-06-28

    Heats of formation of the lowest triplet state of ethylene and the ground triplet state of ethylidene have been predicted by high level electronic structure calculations. Total atomization energies obtained from coupled-cluster CCSD(T) energies extrapolated to the complete basis set limit using correlation consistent basis sets (CBS), plus additional corrections predict the following heats of formation in kcal/mol: Delta H0f(C2H4,3A1) = 80.1 at 0 K and 78.5 at 298 K, and Delta H0f(CH3CH,3A") = 86.8 at 0 K and 85.1 at 298 K, with an error of less than +-1.0 kcal/mol. The vertical and adiabatic singlet-triplet separation energies of ethylene were calculated as Delta ES-T,vert = 104.1 and Delta ES-T,adia = 65.8 kcal/mol. These results are in excellent agreement with recent quantum Monte Carlo (DMC) values of 103.5 +- 0.3 and 66.4 +- 0.3 kcal/mol. Both sets of computational values differ from the experimental estimate of 58 +- 3 kcal/mol for the adiabatic splitting. The computed singlet-triplet gap at 0 K for acetylene is Delta ES-T,adia(C2H2) = 90.5 kcal/mol, which is in notable disagreement with the experimental value of 82.6 kcal/mol. The heat of formation of the triplet is Delta H0f(C2H2,3B2) = 145.3 kcal/mol. There is a systematic underestimation of the singlet-triplet gaps in recent photodecomposition experiments by ~;;7 to 8 kcal/mol. For vinylidene, we predict Delta H0f(H2CC,1A1) = 98.8 kcal/mol at 298 K (exptl. 100.3 +- 4.0), Delta H0f(H2CC,3B2) = 146.2 at 298 K, and an energy gap Delta ES-T-adia(H2CC) = 47.7 kcal/mol.

  8. Analysis of Functional Motions in Brownian Molecular Machines with an Efficient Block Normal Mode Approach: Myosin-II and Ca2+-ATPase

    Science.gov (United States)

    Li, Guohui; Cui, Qiang

    2004-01-01

    The structural flexibilities of two molecular machines, myosin and Ca2+-ATPase, have been analyzed with normal mode analysis and discussed in the context of their energy conversion functions. The normal mode analysis with physical intermolecular interactions was made possible by an improved implementation of the block normal mode (BNM) approach. The BNM results clearly illustrated that the large-scale conformational transitions implicated in the functional cycles of the two motor systems can be largely captured with a small number of low-frequency normal modes. Therefore, the results support the idea that structural flexibility is an essential part of the construction principle of molecular motors through evolution. Such a feature is expected to be more prevalent in motor proteins than in simpler systems (e.g., signal transduction proteins) because in the former, large-scale conformational transitions often have to occur before the chemical events (e.g., ATP hydrolysis in myosin and ATP binding/phosphorylation in Ca2+-ATPase). This highlights the importance of Brownian motions associated with the protein domains that are involved in the functional transitions; in this sense, Brownian molecular machines is an appropriate description of molecular motors, although the normal mode results do not address the origin of the ratchet effect. The results also suggest that it might be more appropriate to describe functional transitions in some molecular motors as intrinsic elastic motions modulating local structural changes in the active site, which in turn gets stabilized by the subsequent chemical events, in contrast with the conventional idea of local changes somehow getting amplified into larger-scale motions. In the case of myosin, for example, we favor the idea that Brownian motions associated with the flexible converter propagates to the Switch I/II region, where the salt-bridge formation gets stabilized by ATP hydrolysis, in contrast with the textbook notion that ATP

  9. The N = 1 Triplet Vertex Operator Superalgebras: Twisted Sector

    Directory of Open Access Journals (Sweden)

    Drazen Adamovic

    2008-12-01

    Full Text Available We classify irreducible σ-twisted modules for the N = 1 super triplet vertex operator superalgebra SW(m introduced recently [Adamovic D., Milas A., Comm. Math. Phys., to appear, arXiv:0712.0379]. Irreducible graded dimensions of σ-twisted modules are also determined. These results, combined with our previous work in the untwisted case, show that the SL(2,Z-closure of the space spanned by irreducible characters, irreducible supercharacters and σ-twisted irreducible characters is (9m + 3-dimensional. We present strong evidence that this is also the (full space of generalized characters for SW(m. We are also able to relate irreducible SW(m characters to characters for the triplet vertex algebra W(2m + 1, studied in [Adamovic D., Milas A., Adv. Math. 217 (2008, 2664-2699, arXiv:0707.1857].

  10. Confinement sensitivity in quantum dot singlet-triplet relaxation

    Science.gov (United States)

    Wesslén, C. J.; Lindroth, E.

    2017-11-01

    Spin-orbit mediated phonon relaxation in a two-dimensional quantum dot is investigated using different confining potentials. Elliptical harmonic oscillator and cylindrical well results are compared to each other in the case of a two-electron GaAs quantum dot subjected to a tilted magnetic field. The lowest energy set of two-body singlet and triplet states are calculated including spin-orbit and magnetic effects. These are used to calculate the phonon induced transition rate from the excited triplet to the ground state singlet for magnetic fields up to where the states cross. The roll of the cubic Dresselhaus effect, which is found to be much more important than previously assumed, and the positioning of ‘spin hot-spots’ are discussed and relaxation rates for a few different systems are exhibited.

  11. Evidence for coherent spicule oscillations from correcting Hinode/SOT Ca II H in the south-east limb of the Sun

    Science.gov (United States)

    Ahangarzadeh Maralani, A. R.; Tavabi, E.; Ajabshirizadeh, A.

    2017-05-01

    Wave theories of heating of the chromosphere, corona and solar wind due to photospheric fluctuations are strengthened by the existence of the wave coherency observed up to the transition region. The coherency of intensity oscillations of solar spicules was explored using the Solar Optical Telescope (SOT) on the Hinode spacecraft with increasing height above the solar limb in the active region. We used time sequences near the south-east region from the Hinode/SOT for the Ca II H line obtained on 2015 April 3 and applied the de-convolution procedure to the spicule to illustrate how effectively our restoration method works on fine structures such as spicules. Moreover, the intensity oscillations at different heights above the solar limb were analysed through wavelet transforms. Afterwards, the phase difference was measured between oscillations at two heights in search of evidence for coherent oscillations. The results of the wavelet transformations revealed dominant period peaks for 2, 4, 5.5 and 6.5 min at four separate heights. The dominant frequencies for a coherency level higher than 75 per cent were found to be around 5.5 and 8.5 mHz. Mean phase speeds of 155-360 km s-1 were measured. We found that the mean phase speeds increased with height. The results suggest that the energy flux carried by coherent waves into the corona and heliosphere may be several times larger than previous estimates that were based solely on constant velocities. We provide compelling evidence for the existence of upwardly propagating coherent waves.

  12. Regulation of intracellular signaling cascades by GNRH pulse frequency in the rat pituitary: roles for CaMK II, ERK, and JNK activation.

    Science.gov (United States)

    Burger, Laura L; Haisenleder, Daniel J; Aylor, Kevin W; Marshall, John C

    2008-11-01

    Pulsatile GnRH (GNRH) differentially regulates LH and FSH subunit genes, with faster frequencies favoring Lhb transcription and slower favoring Fshb. Various intracellular pathways mediate the effects of GNRH, including CaMK II (CAMK2), ERK, and JNK. We examined whether activation of these pathways is regulated by GNRH pulse frequency in vivo. GNRH-deficient rats received GNRH pulses (25 ng i.v. every 30 or 240 min for 8 h, vehicle to controls). Pituitaries were collected 5 min after the last pulse, bisected, and one half processed for RNA (to measure beta subunit primary transcripts [PTs]) and the other for protein. Phosphorylated CAMK2 (phospho-CAMK2), ERK (mitogen-activated protein kinase 1/3 [MAPK1/3], also known as p42 ERK2 and p44 ERK1, respectively), and JNK (MAPK8/9, also known as p46 JNK1 and p54 JNK2, respectively) were determined by Western blotting. The 30-min pulses maximally stimulated Lhb PT (8-fold), whereas 240 min was optimal for Fshb PT (3-fold increase). Both GNRH pulse frequencies increased phospho-CAMK2 4-fold. Activation of MAPK1/3 was stimulated by both 30- and 240-min pulses, but phosphorylation of MAPK3 was significantly greater following slower GNRH pulses (240 min: 4-fold, 30 min: 2-fold). MAPK8/9 activation was unchanged by pulsatile GNRH in this paradigm, but as previous results showed that GNRH-induced activation of MAPK8/9 is delayed, 5 min after GNRH may not be optimal to observe MAPK8/9 activation. These data show that CAMK2 is activated by GNRH, but not in a frequency-dependant manner, whereas MAPK3 is maximally stimulated by slow-frequency GNRH pulses. Thus, the ERK response to slow pulse frequency is part of the mechanisms mediating Fhb transcriptional responses to GNRH.

  13. Regulation of Intracellular Signaling Cascades by GNRH Pulse Frequency in the Rat Pituitary: Roles for CaMK II, ERK, and JNK Activation1

    Science.gov (United States)

    Burger, Laura L.; Haisenleder, Daniel J.; Aylor, Kevin W.; Marshall, John C.

    2008-01-01

    Pulsatile GnRH (GNRH) differentially regulates LH and FSH subunit genes, with faster frequencies favoring Lhb transcription and slower favoring Fshb. Various intracellular pathways mediate the effects of GNRH, including CaMK II (CAMK2), ERK, and JNK. We examined whether activation of these pathways is regulated by GNRH pulse frequency in vivo. GNRH-deficient rats received GNRH pulses (25 ng i.v. every 30 or 240 min for 8 h, vehicle to controls). Pituitaries were collected 5 min after the last pulse, bisected, and one half processed for RNA (to measure beta subunit primary transcripts [PTs]) and the other for protein. Phosphorylated CAMK2 (phospho-CAMK2), ERK (mitogen-activated protein kinase 1/3 [MAPK1/3], also known as p42 ERK2 and p44 ERK1, respectively), and JNK (MAPK8/9, also known as p46 JNK1 and p54 JNK2, respectively) were determined by Western blotting. The 30-min pulses maximally stimulated Lhb PT (8-fold), whereas 240 min was optimal for Fshb PT (3-fold increase). Both GNRH pulse frequencies increased phospho-CAMK2 4-fold. Activation of MAPK1/3 was stimulated by both 30- and 240-min pulses, but phosphorylation of MAPK3 was significantly greater following slower GNRH pulses (240 min: 4-fold, 30 min: 2-fold). MAPK8/9 activation was unchanged by pulsatile GNRH in this paradigm, but as previous results showed that GNRH-induced activation of MAPK8/9 is delayed, 5 min after GNRH may not be optimal to observe MAPK8/9 activation. These data show that CAMK2 is activated by GNRH, but not in a frequency-dependant manner, whereas MAPK3 is maximally stimulated by slow-frequency GNRH pulses. Thus, the ERK response to slow pulse frequency is part of the mechanisms mediating Fhb transcriptional responses to GNRH.. PMID:18716286

  14. Coronavirus phylogeny based on triplets of nucleic acids bases

    Science.gov (United States)

    Liao, Bo; Liu, Yanshu; Li, Renfa; Zhu, Wen

    2006-04-01

    We considered the fully overlapping triplets of nucleotide bases and proposed a 2D graphical representation of protein sequences consisting of 20 amino acids and a stop code. Based on this 2D graphical representation, we outlined a new approach to analyze the phylogenetic relationships of coronaviruses by constructing a covariance matrix. The evolutionary distances are obtained through measuring the differences among the two-dimensional curves.

  15. Josephson Effect in Singlet Superconductor-Ferromagnet-Triplet Superconductor Junction

    OpenAIRE

    Choi, Chi-Hoon

    2017-01-01

    We study the current-phase relation of a ballistic SIFIT junction, consisting of a spin-singlet superconductor (S), a weak ferromagnetic metal (F), a spin-triplet superconductor (T), and insulating ferromagnetic interfaces (I). We use the generalized quasiclassical formalism developed by A. Millis et al. to compute the current density and the free energy of the junction for arbitrary orientation of the magnetizations of the junction barrier. We investigate in detail the effect of the distribu...

  16. Triplet-repeat microsatellites shared among hard and soft pines.

    Science.gov (United States)

    Kutil, B L; Williams, C G

    2001-01-01

    Vascular plant species have shown a low level of microsatellite conservation compared to many animal species. Finding trans-specific microsatellites for plants may be improved by using a priori knowledge of genome organization. Fifteen triplet-repeat microsatellites from hard pine (Pinus taeda L.) were tested for trans-specific amplification across seven hard pines (P. palustris Mill., P. echinata Mill., P. radiata D. Don., P. patula Schiede et Deppe, P. halepensis Mill., P. kesiya Royle), a soft pine (P. strobus L.), and Picea rubens Sargent. Seven of 15 microsatellites had trans-specific amplification in both hard and soft pine subgenera. Two P. taeda microsatellites had conserved flanking regions and repeat motifs in all seven hard pines, soft pine P. strobus, and P. rubens. Perfect triplet-repeat P. taeda microsatellites appear to be better candidates for trans-specific polymorphism than compound microsatellites. Not all perfect triplet-repeat microsatellites were conserved, but all conserved microsatellites had perfect repeat motifs. Persistent microsatellites PtTX2123 and PtTX3020 had highly conserved flanking regions and a conserved repeat motif composition with variable repeat unit numbers. Using trinucleotide microsatellites improved trans-specific microsatellite recovery among hard and soft pine species.

  17. Polaron pair mediated triplet generation in polymer/fullerene blends

    KAUST Repository

    Dimitrov, Stoichko D.

    2015-03-04

    Electron spin is a key consideration for the function of organic semiconductors in light-emitting diodes and solar cells, as well as spintronic applications relying on organic magnetoresistance. A mechanism for triplet excited state generation in such systems is by recombination of electron-hole pairs. However, the exact charge recombination mechanism, whether geminate or nongeminate and whether it involves spin-state mixing is not well understood. In this work, the dynamics of free charge separation competing with recombination to polymer triplet states is studied in two closely related polymer-fullerene blends with differing polymer fluorination and photovoltaic performance. Using time-resolved laser spectroscopic techniques and quantum chemical calculations, we show that lower charge separation in the fluorinated system is associated with the formation of bound electron-hole pairs, which undergo spin-state mixing on the nanosecond timescale and subsequent geminate recombination to triplet excitons. We find that these bound electron-hole pairs can be dissociated by electric fields.

  18. Semantic similarity: normative ratings for 185 Spanish noun triplets.

    Science.gov (United States)

    Moldovan, Cornelia D; Ferré, Pilar; Demestre, Josep; Sánchez-Casas, Rosa

    2015-09-01

    The present study introduces the first Spanish database with normative ratings of semantic similarity for 185 word triplets. Each word triplet is constituted by a target word (e.g., guisante [pea]) and two semantically related and nonassociatively related words: a word highly related in meaning to the target (e.g., judía [bean]), and a word less related in meaning to the target (e.g., patata [potato]). The degree of meaning similarity was assessed by 332 participants by using a semantic similarity rating task on a 9-point scale. Pairs having a value of semantic similarity ranging from 5 to 9 were classified as being more semantically related, whereas those with values ranging from 2 to 4.99 were considered as being less semantically related. The relative distance between the two pairs for the same target ranged from 0.48 to 5.07 points. Mean comparisons revealed that participants rated the more similar words as being significantly more similar in meaning to the target word than were the less similar words. In addition to the semantic similarity norms, values of concreteness and familiarity of each word in a triplet are provided. The present database can be a very useful tool for scientists interested in designing experiments to examine the role of semantics in language processing. Since the variable of semantic similarity includes a wide range of values, it can be used as either a continuous or a dichotomous variable. The full database is available in the supplementary materials.

  19. Arrested coalescence of viscoelastic droplets: triplet shape and restructuring

    Science.gov (United States)

    Dahiya, Prerna; DeBenedictis, Andrew; Atherton, Timothy J.; Caggioni, Marco; Prescott, Stuart W.; Hartel, Richard W.; Spicer, Patrick T.

    The stability of shapes formed by three viscoelastic droplets during their arrested coalescence has been investigated using micromanipulation experiments. Addition of a third droplet to arrested droplet doublets is shown to be controlled by the balance between interfacial pressures driving coalescence and internal elasticity that resists total consolidation. The free fluid available within the droplets controls the transmission of stress during droplet combination and allows connections to occur via formation of a neck between the droplets. The anisotropy of three-droplet systems adds complexity to the symmetric case of two-droplet aggregates because of the multiplicity of orientations possible for the third droplet. When elasticity dominates, the initial orientation of the third droplet is preserved in the triplet's final shape. When elasticity is dominated by the interfacial driving force, the final shape can deviate strongly from the initial positioning of droplets. Movement of the third droplet to a more compact packing occurs, driven by liquid meniscus expansion that minimizes the surface energy of the triplet. A range of compositions and orientations are examined and the resulting domains of restructuring and stability are mapped based on the final triplet structure. A geometric and a physical model are used to explain the mechanism driving meniscus-induced restructuring and are related to the impact of these phenomena on multiple droplet emulsions.

  20. Sirenomelia in a Nigerian triplet: a case report

    Directory of Open Access Journals (Sweden)

    Wonodi Woroma

    2011-09-01

    Full Text Available Abstract Introduction Sirenomelia, also known as mermaid syndrome, is a very rare fatal congenital abnormality in which the legs are fused together, giving them the appearance of a mermaid's tail. It is commonly associated with abnormal kidney development, genital and rectal abnormalities. A handful of cases have been reported in other parts of the world, however, no cases have previously been reported in a Nigerian neonate. To the best of our knowledge, we believe that this is the first case reported from West Africa and in a triplet. Case presentation A 16-hour-old baby boy, the second of a set of Nigerian triplets, presented to our facility with fusion of the entire lower limbs, imperforate anus, indiscernible genital structures, single umbilical artery and a neural tube defect. His parents were from the Hausa ethnic group and not related. Conclusion Sirenomelia has not been previously described in a set of triplets, and it is hoped that this report from West Africa will give information about the non-racial predilection of this condition.

  1. CART peptide in the nucleus accumbens shell inhibits cocaine-induced locomotor sensitization to transient overexpression of α-Ca2+/Calmodulin-dependent Protein Kinase II.

    Science.gov (United States)

    Xiong, Lixia; Meng, Qing; Sun, Xi; Lu, Xiangtong; Fu, Qiang; Peng, Qinghua; Yang, Jianhua; Oh, Ki-Wan; Hu, Zhen Zhen

    2018-01-04

    Cocaine- and amphetamine-regulated transcript (CART) peptide is a widely distributed neurotransmitter that attenuates cocaine-induced locomotor activity when injected into the nucleus accumbens (NAc). Our previous work first confirmed that the inhibitory mechanism of the CART peptide on cocaine-induced locomotor activity is related to a reduction in cocaine-enhanced phosphorylated Ca2+ /calmodulin-dependent protein kinaseIIα (pCaMKIIα) and the enhancement of cocaine-induced D3R function. The present study investigated whether CART peptide inhibited cocaine-induced locomotor activity via inhibition of interactions between pCaMKIIα and the D3 dopamine receptor (D3R). We demonstrated that lentivirus-mediated gene transfer transiently increased pCaMKIIα expression, which peaked at 10 days after microinjection into the rat NAc shell, and induced a significant increase in Ca2+ influx along with greater behavioral sensitivity in the open field test after intraperitoneal injections of cocaine (15 mg/kg). However, western blot analysis and coimmunoprecipitation demonstrated that CART peptide treatment in lentivirus-transfected CaMKIIα-overexpressing NAc rat tissues or cells prior to cocaine administration inhibited the cocaine-induced Ca2+ influx and attenuated the cocaine-increased pCaMKIIα expression in lentivirus-transfected CaMKIIα-overexpressing cells. CART peptide decreased the cocaine-enhanced phosphorylated cAMP response element binding protein (pCREB) expression via inhibition of the pCaMKIIα-D3R interaction, which may account for the prolonged locomotor sensitization induced by repeated cocaine treatment in lentivirus-transfected CaMKIIα-overexpressing cells. These results provide strong evidence for the inhibitory modulation of CART peptide in cocaine-induced locomotor sensitization. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  2. Entanglement and Metrology with Singlet-Triplet Qubits

    Science.gov (United States)

    Shulman, Michael Dean

    Electron spins confined in semiconductor quantum dots are emerging as a promising system to study quantum information science and to perform sensitive metrology. Their weak interaction with the environment leads to long coherence times and robust storage for quantum information, and the intrinsic tunability of semiconductors allows for controllable operations, initialization, and readout of their quantum state. These spin qubits are also promising candidates for the building block for a scalable quantum information processor due to their prospects for scalability and miniaturization. However, several obstacles limit the performance of quantum information experiments in these systems. For example, the weak coupling to the environment makes inter-qubit operations challenging, and a fluctuating nuclear magnetic field limits the performance of single-qubit operations. The focus of this thesis will be several experiments which address some of the outstanding problems in semiconductor spin qubits, in particular, singlet-triplet (S-T0) qubits. We use these qubits to probe both the electric field and magnetic field noise that limit the performance of these qubits. The magnetic noise bath is probed with high bandwidth and precision using novel techniques borrowed from the field of Hamiltonian learning, which are effective due to the rapid control and readout available in S-T 0 qubits. These findings allow us to effectively undo the undesired effects of the fluctuating nuclear magnetic field by tracking them in real-time, and we demonstrate a 30-fold improvement in the coherence time T2*. We probe the voltage noise environment of the qubit using coherent qubit oscillations, which is partially enabled by control of the nuclear magnetic field. We find that the voltage noise bath is frequency-dependent, even at frequencies as high as 1MHz, and it shows surprising and, as of yet, unexplained temperature dependence. We leverage this knowledge of the voltage noise environment, the

  3. Stereological analysis of Ca(2+)/calmodulin-dependent protein kinase II alpha -containing dorsal root ganglion neurons in the rat: colocalization with isolectin Griffonia simplicifolia, calcitonin gene-related peptide, or vanilloid receptor 1.

    Science.gov (United States)

    Carlton, Susan M; Hargett, Gregory L

    2002-06-17

    The enzyme Ca(2+)/calmodulin-dependent protein kinase II (CaMKII) is widely distributed in the nervous system. A previous report describes immunostaining for CaMKII alpha in dorsal root ganglion (DRG) neurons. In this study, CaMKII alpha is colocalized in the rat with three putative markers of nociceptive DRG neurons, isolectin Griffonia simplicifolia (I-B4), identifying small-diameter, "peptide-poor" neurons; calcitonin gene-related peptide (CGRP), identifying " peptide-rich" neurons; or the vanilloid receptor 1 (VR1), identifying neurons activated by heat, acid, and capsaicin. Lumbar 4 and 5 DRG sections were labeled using immunofluorescence or lectin binding histochemistry, and percentages of single and double-labeled CaMKIIalpha neurons were determined. Stereological estimates of total neuron number in the L4 DRG were 13,815 +/- 2,798 and in the L5 DRG were 14,111 +/- 4,043. Percentages of single-labeled L4 DRG neurons were 41% +/- 2% CaMKII alpha, 38% +/- 3% I-B4, 44% +/- 3% CGRP, and 32% +/- 6% VR1. Percentages of single-labeled L5 DRG neurons were 44% +/- 5% CaMKII alpha, 48% +/- 2% I-B4, 41% +/- 7% CGRP, and 39% +/- 14% VR1. For L4 and L5, respectively, estimates of double-labeled CaMKII alpha neurons showed 34% +/- 2% and 38% +/- 17% labeled for I-B4, 25% +/- 14% and 19% +/- 10% labeled for CGRP, and 37% +/- 7% and 38% +/- 5% labeled for VR1. Conversely, for L4 and L5, respectively, 39% +/- 14% and 38% +/- 7% I-B4 binding neurons, 24% +/- 12% and 23% +/- 10% CGRP neurons, and 42% +/- 7% and 35% +/- 7% VR1 neurons labeled for CaMKIIalpha. The mean diameter of CaMKII alpha - labeled neurons was approximately 27 microm, confirming that this enzyme was preferentially localized in small DRG neurons. The results indicate that subpopulations of DRG neurons containing CaMKII alpha are likely to be involved in the processing of nociceptive information. Thus, this enzyme may play a critical role in the modulation of nociceptor activity and plasticity of primary

  4. A study on missing lines in the synthetic solar spectrum near the Ca triplet

    Science.gov (United States)

    Kitamura, Jessica R.; Martins, Lucimara P.; Coelho, Paula

    2017-04-01

    Synthetic stellar spectra are extensively used for many different applications in astronomy, from stellar studies (such as in the determination of atmospheric parameters of observed stellar spectra), to extragalactic studies (e.g. as one of the main ingredients of stellar population models). One of the main ingredients of synthetic spectral libraries are the atomic and molecular line lists, which contain the data required to model all the absorption lines that should appear in these spectra. Although currently available line lists contain millions of lines, a relatively small fraction of these lines have accurate derived or measured transition parameters. As a consequence, many of these lines contain errors in the electronic transition parameters that can reach up to 200%. Furthermore, even for the Sun, our closest and most studied star, state-of-the-art synthetic spectra does not reproduce all the observed lines, indicating transitions that are missing in the line lists of the computed synthetic spectra. Given the importance and wide range of applications of these models, improvement of their quality is urgently necessary. In this work we catalogued missing lines in the atomic and molecular line lists used for the calculation of the synthetic spectra in the region of Gaia, comparing a solar model computed via a recent line list with a high quality solar atlas available in the literature. After that, we attempted the calibration of their atomic parameters with the code ALLiCE; the calibrated line parameters are publicly available for use.

  5. Phosphorylation at Ser²⁶ in the ATP-binding site of Ca²⁺/calmodulin-dependent kinase II as a mechanism for switching off the kinase activity.

    Science.gov (United States)

    Yilmaz, Mehtap; Gangopadhyay, Samudra S; Leavis, Paul; Grabarek, Zenon; Morgan, Kathleen G

    2013-02-07

    CaMKII (Ca²⁺/calmodulin-dependent kinase II) is a serine/threonine phosphotransferase that is capable of long-term retention of activity due to autophosphorylation at a specific threonine residue within each subunit of its oligomeric structure. The γ isoform of CaMKII is a significant regulator of vascular contractility. Here, we show that phosphorylation of CaMKII γ at Ser²⁶, a residue located within the ATP-binding site, terminates the sustained activity of the enzyme. To test the physiological importance of phosphorylation at Ser²⁶, we generated a phosphospecific Ser²⁶ antibody and demonstrated an increase in Ser²⁶ phosphorylation upon depolarization and contraction of blood vessels. To determine if the phosphorylation of Ser²⁶ affects the kinase activity, we mutated Ser²⁶ to alanine or aspartic acid. The S26D mutation mimicking the phosphorylated state of CaMKII causes a dramatic decrease in Thr²⁸⁷ autophosphorylation levels and greatly reduces the catalytic activity towards an exogenous substrate (autocamtide-3), whereas the S26A mutation has no effect. These data combined with molecular modelling indicate that a negative charge at Ser²⁶ of CaMKII γ inhibits the catalytic activity of the enzyme towards its autophosphorylation site at Thr²⁸⁷ most probably by blocking ATP binding. We propose that Ser²⁶ phosphorylation constitutes an important mechanism for switching off CaMKII activity.

  6. Probing the Correlated Triplet Pair in TIPS-Pentacene Using Transient Absorption Microscopy

    Science.gov (United States)

    Folie, Brendan D.; Ginsberg, Naomi S.

    Singlet fission, the process by which a singlet exciton splits into two triplet excitons, has been shown to increase the efficiency of photovoltaics made from organic semiconductors. Fission is believed to occur via a correlated triplet pair intermediate, but direct measurements of this state remain scant. We use polarization-resolved white light transient absorption microscopy to observe the correlated triplet pair in TIPS-Pentacene, a common model system. We are able to measure the binding energy of the triplet pair, and find that this interaction tends to diminish the triplet absorbance spectrum. Our results shed light on the kinetics and electronic structure of the correlated triplet pair, which have important implications for the creation of singlet fission based photovoltaic devices.

  7. [Molecular oxygen quenching of the singlet and triplet states of poryphyrins].

    Science.gov (United States)

    Dzhagarov, B M; Salokhiddinov, K I; Bondarev, S L

    1978-01-01

    Rate constants of molecular oxygen quenching in solutions of singlet and triplet states of chlorophyll porphyrines molecules and their complexes with metals were measured with the help of the methods of laser photolysis, impulse fluorometry and luminescence. It has been shown that the quenching of fluorescence results from the intensification of intercombinational transition into the triplet state. The mechanism of quenching of the triplet state is discussed.

  8. Mixed Inert scalar triplet dark matter, radiative neutrino masses and leptogenesis

    OpenAIRE

    Lu, Wen-Bin; Gu, Pei-Hong

    2017-01-01

    The neutral component of an inert scalar multiplet with hypercharge can provide a stable dark matter particle when its real and imaginary parts have a splitting mass spectrum. Otherwise, a tree-level dark-matter-nucleon scattering mediated by the Z boson will be much above the experimental limit. In this paper we focus on a mixed inert scalar triplet dark matter scenario where a complex scalar triplet with hypercharge can mix with another real scalar triplet without hypercharge through their ...

  9. Three-Nucleon Forces and Triplet Pairing in Neutron Matter

    Science.gov (United States)

    Papakonstantinou, P.; Clark, J. W.

    2017-12-01

    The existence of superfluidity of the neutron component in the core of a neutron star, associated specifically with triplet P-wave pairing, is currently an open question that is central to interpretation of the observed cooling curves and other neutron-star observables. Ab initio theoretical calculations aimed at resolving this issue face unique challenges in the relevant high-density domain, which reaches beyond the saturation density of symmetrical nuclear matter. These issues include uncertainties in the three-nucleon (3N) interaction and in the effects of strong short-range correlations—and more generally of in-medium modification of nucleonic self-energies and interactions. A survey of existing solutions of the gap equations in the triplet channel demonstrates that the net impact on the gap magnitude of 3N forces, coupled channels, and mass renormalization shows extreme variation dependent on specific theoretical inputs, in some cases even pointing to the absence of a triplet gap, thus motivating a detailed analysis of competing effects within a well-controlled model. In the present study, we track the effects of the 3N force and in-medium modifications in the representative case of the ^3P_2 channel, based on the Argonne v_{18} two-nucleon (2N) interaction supplemented by 3N interactions of the Urbana IX family. Sensitivity of the results to the input interaction is clearly demonstrated. We point out consistency issues with respect to the simultaneous treatment of 3N forces and in-medium effects, which warrant further investigation. We consider this pilot study as the first step toward a systematic and comprehensive exploration of coupled-channel ^3P F_2 pairing using a broad range of 2N and 3N interactions from the current generation of refined semi-phenomenological models and models derived from chiral effective field theory.

  10. Exploring the triplet parameters space to optimise the final focus of the FCC-hh

    CERN Document Server

    AUTHOR|(CDS)2141109; Abelleira, Jose; Seryi, Andrei; Cruz Alaniz, Emilia

    2017-01-01

    One of the main challenges when designing final focus systems of particle accelerators is maximising the beam stay clear in the strong quadrupole magnets of the inner triplet. Moreover it is desirable to keep the quadrupoles in the triplet as short as possible for space and costs reasons but also to reduce chromaticity and simplify corrections schemes. An algorithm that explores the triplet parameter space to optimise both these aspects was written. It uses thin lenses as a first approximation and MADX for more precise calculations. In cooperation with radiation studies, this algorithm was then applied to design an alternative triplet for the final focus of the Future Circular Collider (FCC-hh).

  11. Capturing triplet emission in white organic light emitting devices

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Jai [Faculty of EHSE, School of Engineering and IT, B-purple-12, Charles Darwin University, Darwin, NT 0909 (Australia)

    2011-08-15

    The state-of-the art in the white organic light emitting devices (WOLEDs) is reviewed for further developments with a view to enhance the capture of triplet emission. In particular, applying the new exciton-spin-orbit-photon interaction operator as a perturbation, rates of spontaneous emission are calculated in a few phosphorescent materials and compared with experimental results. For iridium based phosphorescent materials the rates agree quite well with the experimental results. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  12. Status of the LHC inner triplet quadrupole program at Fermilab

    CERN Document Server

    Andreev, N; Bauer, P; Bossert, R; Brandt, J; Carson, J; Caspi, S; Chichili, D R; Chiesa, L; Darve, C; Di Marco, J; Fehér, S; Ghosh, A; Glass, H; Huang, Y; Kerby, J S; Lamm, M J; Markarov, A A; McInturff, A D; Nicol, T H; Nobrega, A; Novitski, I; Ogitsu, T; Orris, D; Ozelis, J P; Page, T; Peterson, T; Rabehl, Roger Jon; Robotham, W; Sabbi, G L; Scanlan, R M; Schlabach, P; Sylvester, C D; Strait, J B; Tartaglia, M; Tompkins, J C; Velev, G V; Yadav, S; Zlobin, A V

    2001-01-01

    Fermilab, in collaboration with LBNL and BNL, is developing a quadrupole for installation in the interaction region inner triplets of the LHC. This magnet is required to have an operating gradient of 215 T/m across a 70 mm coil bore, and operates in superfluid helium at 1.9 K. A 2 m magnet program addressing mechanical, magnetic, quench protection, and thermal issues associated with the design was completed earlier this year, and production of the first full length, cryostatted prototype magnet is underway. This paper summarizes the conclusions of the 2 m program, and the design and status of the first full-length prototype magnet. (11 refs).

  13. Holstein polarons and triplet bipolarons with NNN hopping

    Science.gov (United States)

    Chakraborty, Monodeep; Taraphder, A.; Berciu, Mona

    2017-05-01

    We study the ground state of 1D Holstein single polaron with next nearest neighbour electron hopping (NNN), employing a variational approximation based on exact diagonalization. Our investigation reveals that, depending upon the sign and magnitude of the NNN hopping integral with respect to nearest neighbour hopping, the polaron band minima may occur at non-zero kGS. We compare the present scenario with the SSH polarons, where a similar feature is also observed, albeit, due to very different mechanism. Our initial investigation of triplet bipolarons, in presence of an attractive extended Hubbard interactions, further substantiates the differences between the present model and the SSH model.

  14. Influence of Ca/Mg ratio on phytoextraction properties of Salix viminalis. II. Secretion of low molecular weight organic acids to the rhizosphere.

    Science.gov (United States)

    Magdziak, Z; Kozlowska, M; Kaczmarek, Z; Mleczek, M; Chadzinikolau, T; Drzewiecka, K; Golinski, P

    2011-01-01

    A hydroponic experiment in a phytotron was performed to investigate the effect of two different Ca/Mg ratios (4:1 and 1:10) and trace element ions (Cd, Cu, Pb and Zn) in solution on the efficiency of low molecular weight organic acid (LMWOA) formation in Salix viminalis rhizosphere. Depending on the Ca/Mg ratio and presence of selected trace elements at 0.5mM concentration, the amount and kind of LMWOAs in the rhizosphere were significantly affected. In physiological 4:1 Ca/Mg ratio the following complex of acids was observed: malonic (Pb, Zn), citric, lactic, maleic and succinic (Zn) acids. Under 1:10 Ca/Mg ratio, citric (Cd, Zn), maleic and succinic (Cd, Cu, Pb, Zn) acids were seen. Additionally, high accumulation of zinc and copper in all systems was observed, with the exception of those where one of the metals was at higher concentration. Summing up, the results indicate a significant role of LMWOAs in Salix phytoremediation abilities. Both effects can be modulated depending on the mutual Ca/Mg ratio. Copyright © 2010 Elsevier Inc. All rights reserved.

  15. Mode of conception of triplets and high order multiple pregnancies.

    LENUS (Irish Health Repository)

    Basit, I

    2012-03-01

    A retrospective audit was performed of all high order multiple pregnancies (HOMPs) delivered in three maternity hospitals in Dublin between 1999 and 2008. The mode of conception for each pregnancy was established with a view to determining means of reducing their incidence. A total of 101 HOMPs occurred, 93 triplet, 7 quadruplet and 1 quintuplet. Information regarding the mode of conception was available for 78 (81%) pregnancies. Twenty eight (27.7%) were spontaneous, 34 (33.7%) followedlVF\\/ICSI\\/FET treatment (in-vitro fertilisation, intracytoplasmic sperm injection, frozen embryo transfer), 16 (15.8%) resulted from Clomiphene Citrate treatment and 6 (6%) followed ovulation induction with gonadotrophins. Triplet and HOMPs are a major cause of maternal, feta land neonatal morbidity. Many are iatrogenic, arising from fertility treatments including Clomiphene. Reducing the numbers of embryos transferred will address IVF\\/ICSI\\/FET-related multiple pregnancy rates and this is currently happening in Ireland. Clomiphene and gonadotrophins should only be prescribed when appropriate resources are available to monitor patients adequately.

  16. Room temperature triplet state spectroscopy of organic semiconductors.

    Science.gov (United States)

    Reineke, Sebastian; Baldo, Marc A

    2014-01-21

    Organic light-emitting devices and solar cells are devices that create, manipulate, and convert excited states in organic semiconductors. It is crucial to characterize these excited states, or excitons, to optimize device performance in applications like displays and solar energy harvesting. This is complicated if the excited state is a triplet because the electronic transition is 'dark' with a vanishing oscillator strength. As a consequence, triplet state spectroscopy must usually be performed at cryogenic temperatures to reduce competition from non-radiative rates. Here, we control non-radiative rates by engineering a solid-state host matrix containing the target molecule, allowing the observation of phosphorescence at room temperature and alleviating constraints of cryogenic experiments. We test these techniques on a wide range of materials with functionalities spanning multi-exciton generation (singlet exciton fission), organic light emitting device host materials, and thermally activated delayed fluorescence type emitters. Control of non-radiative modes in the matrix surrounding a target molecule may also have broader applications in light-emitting and photovoltaic devices.

  17. Gemini/GRACES spectroscopy of stars in Tri II

    Science.gov (United States)

    Venn, K. A.; Starkenburg, E.; Malo, L.; Martin, N.; Laevens, B. P. M.

    2017-04-01

    The chemical abundance ratios and radial velocities for two stars in the recently discovered Triangulum II faint dwarf galaxy have been determined from high-resolution, medium signal-to-noise ratio spectra from the Gemini Remote Access to CFHT ESPaDonS Spectrograph facility. These stars have stellar parameters and metallicities similar to those derived from their photometry and medium-resolution Ca II triplet spectra, and supports that Triangulum II has a metallicity spread consistent with chemical evolution in a dwarf galaxy. The elemental abundances show that both stars have typical calcium abundances and barium upper limits for their metallicities, but low magnesium and sodium. This chemical composition resembles some stars in dwarf galaxies, attributed to inhomogeneous mixing in a low star formation environment, and/or yields from only a few supernova events. One of our targets (Star40) has an enhancement in potassium, and resembles some stars in the unusual outer halo star cluster, NGC 2419. Our other target (Star46) appears to be a binary based on a change in its radial velocity (Δvrad = 24.5 ±2.1 km s-1). This is consistent with variations found in binary stars in other dwarf galaxies. While this serves as a reminder of the high binary fraction in these ultrafaint dwarf galaxies, this particular object has had little impact on the previous determination of the velocity dispersion in Triangulum II.

  18. Switching of the triplet excited state of rhodamine-C60 dyads.

    Science.gov (United States)

    Wang, Fen; Cui, Xiaoneng; Lou, Zhangrong; Zhao, Jianzhang; Bao, Ming; Li, Xingwei

    2014-12-21

    Acid-switching of the triplet excited state in rhodamine-C60 dyads was achieved. The rhodamine moiety acts as an acid-activated visible light-harvesting antenna and C60 as the singlet energy acceptor and the spin converter, and production of the triplet state was enhanced in the presence of acid.

  19. Delocalisation of photoexcited triplet states probed by transient EPR and hyperfine spectroscopy

    Science.gov (United States)

    Richert, Sabine; Tait, Claudia E.; Timmel, Christiane R.

    2017-07-01

    Photoexcited triplet states play a crucial role in photochemical mechanisms: long known to be of paramount importance in the study of photosynthetic reaction centres, they have more recently also been shown to play a major role in a number of applications in the field of molecular electronics. Their characterisation is crucial for an improved understanding of these processes with a particular focus on the determination of the spatial distribution of the triplet state wavefunction providing information on charge and energy transfer efficiencies. Currently, active research in this field is mostly focussed on the investigation of materials for organic photovoltaics (OPVs) and organic light emitting diodes (OLEDs). As the properties of triplet states and their spatial extent are known to have a major impact on device performance, a detailed understanding of the factors governing triplet state delocalisation is at the basis of the further development and improvement of these devices. Electron Paramagnetic Resonance (EPR) has proven a valuable tool in the study of triplet state properties and both experimental methods as well as data analysis and interpretation techniques have continuously improved over the last few decades. In this review, we discuss the theoretical and practical aspects of the investigation of triplet states and triplet state delocalisation by transient continuous wave and pulse EPR and highlight the advantages and limitations of the presently available techniques and the current trends in the field. Application of EPR in the study of triplet state delocalisation is illustrated on the example of linear multi-porphyrin chains designed as molecular wires.

  20. Two Birds with One Stone: Tailoring Singlet Fission for Both Triplet Yield and Exciton Diffusion Length

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Tong [Department of Chemistry, Purdue University, West Lafayette IN 47907 USA; Wan, Yan [Department of Chemistry, Purdue University, West Lafayette IN 47907 USA; Guo, Zhi [Department of Chemistry, Purdue University, West Lafayette IN 47907 USA; Johnson, Justin [National Renewable Energy Laboratory, 15013 Denver West Pkwy Golden CO 80401 USA; Huang, Libai [Department of Chemistry, Purdue University, West Lafayette IN 47907 USA

    2016-06-27

    By direct imaging of singlet and triplet populations with ultrafast microscopy, it is shown that the triplet diffusion length and singlet fission yield can be simultaneously optimized for tetracene and its derivatives, making them ideal structures for application in bilayer solar cells.

  1. GAA triplet-repeats cause nucleosome depletion in the human genome.

    Science.gov (United States)

    Zhao, Hongyu; Xing, Yongqiang; Liu, Guoqing; Chen, Ping; Zhao, Xiujuan; Li, Guohong; Cai, Lu

    2015-08-01

    Although there have been many investigations into how trinucleotide repeats affect nucleosome formation and local chromatin structure, the nucleosome positioning of GAA triplet-repeats in the human genome has remained elusive. In this work, the nucleosome occupancy around GAA triplet-repeats across the human genome was computed statistically. The results showed a nucleosome-depleted region in the vicinity of GAA triplet-repeats in activated and resting CD4(+) T cells. Furthermore, the A-tract was frequently adjacent to the upstream region of GAA triplet-repeats and could enhance the depletion surrounding GAA triplet-repeats. In vitro chromatin reconstitution assays with GAA-containing plasmids also demonstrated that the inserted GAA triplet-repeats destabilized the ability of recombinant plasmids to assemble nucleosomes. Our results suggested that GAA triplet-repeats have lower affinity to histones and can change local nucleosome positioning. These findings may be helpful for understanding the mechanism of Friedreich's ataxia, which is associated with GAA triplet-repeats at the chromatin level. Copyright © 2015 Elsevier Inc. All rights reserved.

  2. Effect of Ca2+/Sr2+ substitution on the electronic structure of the oxygen-evolving complex of photosystem II: a combined multifrequency EPR, 55Mn-ENDOR, and DFT study of the S2 state.

    Science.gov (United States)

    Cox, Nicholas; Rapatskiy, Leonid; Su, Ji-Hu; Pantazis, Dimitrios A; Sugiura, Miwa; Kulik, Leonid; Dorlet, Pierre; Rutherford, A William; Neese, Frank; Boussac, Alain; Lubitz, Wolfgang; Messinger, Johannes

    2011-03-16

    The electronic structures of the native Mn(4)O(x)Ca cluster and the biosynthetically substituted Mn(4)O(x)Sr cluster of the oxygen evolving complex (OEC) of photosystem II (PSII) core complexes isolated from Thermosynechococcus elongatus, poised in the S(2) state, were studied by X- and Q-band CW-EPR and by pulsed Q-band (55)Mn-ENDOR spectroscopy. Both wild type and tyrosine D less mutants grown photoautotrophically in either CaCl(2) or SrCl(2) containing media were measured. The obtained CW-EPR spectra of the S(2) state displayed the characteristic, clearly noticeable differences in the hyperfine pattern of the multiline EPR signal [Boussac et al. J. Biol. Chem.2004, 279, 22809-22819]. In sharp contrast, the manganese ((55)Mn) ENDOR spectra of the Ca and Sr forms of the OEC were remarkably similar. Multifrequency simulations of the X- and Q-band CW-EPR and (55)Mn-pulsed ENDOR spectra using the Spin Hamiltonian formalism were performed to investigate this surprising result. It is shown that (i) all four manganese ions contribute to the (55)Mn-ENDOR spectra; (ii) only small changes are seen in the fitted isotropic hyperfine values for the Ca(2+) and Sr(2+) containing OEC, suggesting that there is no change in the overall spin distribution (electronic coupling scheme) upon Ca(2+)/Sr(2+) substitution; (iii) the changes in the CW-EPR hyperfine pattern can be explained by a small decrease in the anisotropy of at least two hyperfine tensors. It is proposed that modifications at the Ca(2+) site may modulate the fine structure tensor of the Mn(III) ion. DFT calculations support the above conclusions. Our data analysis also provides strong support for the notion that in the S(2) state the coordination of the Mn(III) ion is square-pyramidal (5-coordinate) or octahedral (6-coordinate) with tetragonal elongation. In addition, it is shown that only one of the currently published OEC models, the Siegbahn structure [Siegbahn, P. E. M. Acc. Chem. Res.2009, 42, 1871-1880, Pantazis

  3. Dielectric transitions and relaxations in Ca(ii)Co(iii)-based cyanometallate frameworks with a rare (6,6)-connected nia topology.

    Science.gov (United States)

    Liu, Yu-Ling; Zhang, Wen

    2017-12-19

    A series of cyanometallate frameworks A[CaCo(CN) 6 ] (A = protonated guanidine, urea or thiourea guest) exhibit a rare (6,6)-connected nia topology with the Schläfli symbol of (4 12 ·6 3 )(4 9 ·6 6 ) and thermally driven dielectric transitions and relaxations without evident structural phase transitions.

  4. The TRPC1 CA2+-permeable channel inhibits exercise-induced protection against high-fat diet-induced obesity and type II diabetes

    Science.gov (United States)

    The transient receptor potential canonical channel-1 (TRPC1) is a Ca2+ permeable channel found in key metabolic organs and tissues, including the hypothalamus, adipose tissue, and skeletal muscle, making it a likely candidate for the regulation of cellular energy metabolism. However, the exact role ...

  5. Novel nootropic drug sunifiram improves cognitive deficits via CaM kinase II and protein kinase C activation in olfactory bulbectomized mice.

    Science.gov (United States)

    Moriguchi, Shigeki; Tanaka, Tomoya; Tagashira, Hideaki; Narahashi, Toshio; Fukunaga, Kohji

    2013-04-01

    Alzheimer's disease (AD) shows degeneration of the cholinergic system in the medial septum, thereby eliciting down-regulation of the olfactory function in patients. We have previously reported that olfactory bulbectomized (OBX) mice show hippocampus-dependent memory impairment as assessed by memory-related behavioral tasks and hippocampal long-term potentiation (LTP). In the present study, we focused whether novel pyrrolidone nootropic drug sunifiram improves both memory impairment and depression observed in OBX mice. OBX mice were administered once a day for 7-12 days with sunifiram (0.01-1.0mg/kg p.o.) from 10 days after operation with or without gavestinel (10mg/kg i.p.), which is glycine-binding site inhibitor of N-methyl-d-aspartate receptor (NMDAR). The spatial reference memory assessed by Y-maze and short-term memory assessed by novel object recognition task were significantly improved by sunifiram treatment in OBX mice. Sunifiram also restored hippocampal LTP injured in OBX mice without treatment with gavestinel. By contrast, sunifiram treatment did not ameliorate the depressive behaviors assessed by tail suspension task in OBX mice. Notably, sunifiram treatment restored CaMKIIα (Thr-286) autophosphorylation and GluR1 (Ser-831) phosphorylation in the hippocampal CA1 region from OBX mice to the levels of control mice. Likewise, sunifiram treatment improved PKCα (Ser-657) autophosphorylation and NR1 (Ser-896) phosphorylation to the control levels. Stimulation of CaMKII and PKC autophosphorylation by sunifiram was significantly inhibited by pre-treatment with gavestinel. However, sunifiram treatment did not affect the phosphorylation of CaMKIV (Thr-196) and ERK. Taken together, sunifiram ameliorates OBX-induced deficits of memory-related behaviors and impaired LTP in the hippocampal CA1 region via stimulation of glycine-binding site of NMDAR. Copyright © 2013 Elsevier B.V. All rights reserved.

  6. Sensitized Triplet Formation of Chlorophyll-A and beta-Carotene

    DEFF Research Database (Denmark)

    Jensen, Nina Mejlhede; Wilbrandt, Robert Walter; Pagsberg, Palle Bjørn

    1980-01-01

    The naphthalene-sensitized formation of triplet excited chlorophyll-a (Chl-a) and all-transß-carotene has been studied by pulse radiolysis. The rate constants for transfer of triplet energy from naphthalene to Chl-a and all-transß-carotene in benzene at 25°C are (3.6 ± 0.6)·109M-1 s-1 and (10.7 ± 1...... of dose for Chl-a and all-transß-carotene, respectively. The rate constants for triplet-triplet annihilation are (1.4 ± 0.3)·109M-1 s-1 for Chl-a and (3.6 ± 0.4)·109M-1 s-1 for all-transß carotene. The nearly constant ratio k(ß-carotene)/k(Chl-a) for the bimolecular triplet energy transfer rate constants...

  7. Generalization of the possible algebraic basis of q-triplets

    Science.gov (United States)

    Tsallis, Constantino

    2017-02-01

    The so called q-triplets were conjectured in 2004 [C. Tsallis, Physica A 340, 1 (2004)] and then found in nature in 2005 [L.F. Burlaga, A.F. Vinas, Physica A 356, 375 (2005)]. A relevant further step was achieved in 2005 [C. Tsallis, M. Gell-Mann, Y. Sato, PNAS 102, 15377 (2005)] when the possibility was advanced that they could reflect an entire infinite algebra based on combinations of the self-dual relations q → 2 - q ( additive duality) and q → 1/ q ( multiplicative duality). The entire algebra collapses into the single fixed point q = 1, corresponding to the Boltzmann-Gibbs entropy and statistical mechanics. For q ≠ 1, an infinite set of indices q appears, corresponding in principle to an infinite number of physical properties of a given complex system describable in terms of the so called q-statistics. The basic idea that is put forward is that, for a given universality class of systems, a small number (typically one or two) of independent q indices exist, the infinite others being obtained from these few ones by simply using the relations of the algebra. The q-triplets appear to constitute a few central elements of the algebra. During the last decade, an impressive amount of q-triplets have been exhibited in analytical, computational, experimental and observational results in natural, artificial and social systems. Some of them do satisfy the available algebra constructed solely with the additive and multiplicative dualities, but some others seem to violate it. In the present work we generalize those two dualities with the hope that a wider set of systems can be handled within. The basis of the generalization is given by the selfdual relation q → q a ( q) ≡ (( a+2)- aq) / ( a-( a-2) q) ( a ∈ R). We verify that q a (1) = 1, and that q 2( q) = 2 - q and q 0( q) = 1/ q. To physically motivate this generalization, we briefly review illustrative applications of q-statistics, in order to exhibit possible candidates where the present generalized

  8. Inhibition of late sodium current suppresses calcium-related ventricular arrhythmias by reducing the phosphorylation of CaMK-II and sodium channel expressions

    National Research Council Canada - National Science Library

    Xiao-Hong Wei; Shan-Dong Yu; Lu Ren; Si-Hui Huang; Qiao-Mei Yang; Ping Wang; Yan-Peng Chu; Wei Yang; Yan-Sheng Ding; Yong Huo; Lin Wu

    2017-01-01

    .... The prolongations caused by Bay K 8644 and frequent episodes of ventricular tachycardias, both in absence and presence of ATX-II, were significantly attenuated or abolished by late INa inhibitors TTX and eleclazine...

  9. Design of an Air-Core HTS quadruple triplet for a heavy ion accelerator

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zhan; Wei, Shaoqing; Lee, Sang Jin [Uiduk University, Gyeongju (Korea, Republic of)

    2016-12-15

    In recent years, high-temperature superconductor (HTS) Quadruple Triplets are being developed for heavy ion accelerators, because the HTS magnets are suitable to withstand radiation and high heat loads in the hot cell of accelerators. Generally, an iron yoke, which costs a mass of material, was employed to enhance the magnetic field when a quadrupole magnet was designed. The type of the magnet is called iron-dominated magnet, because the total magnetic field was mainly induced by the iron. However, in the HTS superconductor iron-dominated magnets, the coil-induced field also can have a certain proportion. Therefore, the air-core HTS quadrupole magnets can be considered instead of the iron-core HTS quadrupole magnet to be employed to save the iron material. This study presents the design of an air-core HTS quadruple triplet which consists three by air-core HTS quadruple magnet and compare the design result with that of an iron-core HTS quadruple triplet. First, the characteristics of an air-core HTS quadrupole magnet were analyzed to select the magnet system for the magnetic field uniformity impairment. Then, the field uniformity was improved(< 0.1%) exactly using evolution strategy (ES) method for each iron-core HTS quadrupole magnet and the air-core HTS quadruple triplet was established. Finally, the designed air-core triplet was compared with the iron-core HTS quadruple triplet, and the results of beam trajectories were presented with both the HTS quadruple triplet systems to show that the air-core triplet can be employed instead of the iron-core HTS triplet. The design of the air-core quadruple triplet was suggested for a heavy ion accelerator.

  10. Carbonic anhydrase isozymes IV and II in urinary membranes from carbonic anhydrase II-deficient patients

    Energy Technology Data Exchange (ETDEWEB)

    Sato, Seiji; Zhu, Xin L.; Sly, W.S. (Saint Louis Univ. School of Medicine, MO (USA))

    1990-08-01

    Carbonic anhydrase II (CA II) deficiency has been shown to be the primary defect in the recessively inherited syndrome of osteopetrosis with renal tubular acidosis. Until now, the absence of CA II in kidney of CA II-deficient patients has not been shown directly, and the status of the membrane-associated CA in kidney of CA II-deficient patients has been unclear. To address these questions, the authors analyzed urinary membranes and soluble fractions from normal and CA II-deficient subjects. The CA activity in membrane fractions of normal urine was found to comprise two components-(i) a vesicle-enclosed, sodium dodecyl sulfate (SDS)-sensitive fraction, which was shown immunochemically to be the 29-kDa CA II, and (ii) an SDS-resistant fraction, which was due to native and cleaved forms of the 35-kDa, membrane-anchored isozyme CA IV. Urinary membranes from CA II-deficient patients showed little or no SDS-sensitive activity and no immunoreactivity for CA II, providing direct evidence that their mutation, which produces CA II deficiency in erythrocytes, also affects CA II in kidney. CA IV activity and immunoreactivity were present in normal amounts in urinary membranes from CA II-deficient patients. They conclude from the enzymatic and immunological evidence presented that both CA II and CA IV are present in urinary membranes from normal subjects, that renal CA IV is present but renal CA II is absent in urinary membranes from patients with the CA II-deficiency syndrome, and that the methods presented should be useful in studying renal CA II and renal CA IV in other disorders of impaired bicarbonate reabsorption.

  11. Inhibition of late sodium current suppresses calcium-related ventricular arrhythmias by reducing the phosphorylation of CaMK-II and sodium channel expressions

    OpenAIRE

    Xiao-Hong Wei; Shan-Dong Yu; Lu Ren; Si-Hui Huang; Qiao-Mei Yang; Ping Wang; Yan-Peng Chu; Wei Yang; Yan-Sheng Ding; Yong Huo; Lin Wu

    2017-01-01

    Cardiac arrhythmias associated with intracellular calcium inhomeostasis are refractory to antiarrhythmic therapy. We hypothesized that late sodium current (I Na) contributed to the calcium-related arrhythmias. Monophasic action potential duration at 90% completion of repolarization (MAPD90) was significantly increased and ventricular arrhythmias were observed in hearts with increased intracellular calcium concentration ([Ca2+]i) by using Bay K 8644, and the increase became greater in hearts t...

  12. Performance of ROMA based on Architect CA 125 II and HE4 values in Chinese women presenting with a pelvic mass: A multicenter prospective study.

    Science.gov (United States)

    Shen, Fengxian; Lu, Shiming; Peng, Yibing; Yang, Fan; Chen, Yan; Lin, Yingying; Yang, Chen; Wu, Li; Li, Huijun; Zheng, Yijie

    2017-08-01

    We evaluated the performance of human epididymis protein 4 (HE4), cancer antigen 125(CA 125) and Risk of Ovarian Malignancy Algorithm (ROMA) in distinguishing between benign and malignant pelvic masses in Chinese women. From April to December 2012, women with a pelvic mass scheduled to have surgery were enrolled in a prospective, multi-center study conducted in 5 different regions in China. Preoperative serum concentrations of HE4 and CA 125 were examined and ROMA was calculated. A total of 684 women with a pelvic mass were included, of which 482 were diagnosed with benign conditions and 202 were diagnosed with malignant ovarian tumors. At cutoffs of 7.4% and 25.3% for ROMA, the sensitivities and specificities were 85.6% and 81.7% for all patients, 85.7% and 81.5% for premenopausal women, and 85.6% and 83.9% for postmenopausal women, respectively. The ROC-AUC of ROMA was significantly better than that of HE4 (P=0.0003) or CA 125 (P<0.0001) for all malignant diseases (including EOC, Non-EOC, LMP, metastases and other pelvic malignancy with no involvement of the ovaries) compared with benign diseases for all patients. We demonstrated the efficiency of ROMA in the distinction of ovarian cancers from benign disease in a multiple-regions Chinese population, especially in premenopausal women. Copyright © 2017 Elsevier B.V. All rights reserved.

  13. Can the 750-GeV diphoton resonance be the singlet Higgs boson of custodial Higgs triplet model?

    Directory of Open Access Journals (Sweden)

    Cheng-Wei Chiang

    2016-09-01

    Full Text Available The observation of diphoton excess around the mass of 750 GeV in LHC Run-II motivates us to consider whether the singlet Higgs boson in the custodial Higgs triplet model can serve as a good candidate because an earlier study of comprehensive parameter scan shows that it can have the right mass in the viable mass spectra. By assuming the singlet Higgs mass at 750 GeV, its total width less than 50 GeV and imposing constraints from the LHC 8-TeV data, we identify an approximately linear region on the (vΔ,α plane along which the exotic Higgs boson masses satisfy a specific hierarchy and have lower possible spectra, where vΔ denotes the triplet vacuum expectation value and α is the mixing angle between the singlet Higgs boson and the standard model-like Higgs boson. Although the diphoton decay rate can be enhanced by charged Higgs bosons running in the loop in this region, it is mostly orders of magnitude smaller than that required for the observed production rate, except for the small vΔ region when the diphoton fusion production mechanism becomes dominant. Nonetheless, this part of parameter space suffers from the problems of breakdown of perturbativity and large uncertainties in the photon parton distribution function of proton.

  14. Physical conditions in CaFe interstellar clouds

    OpenAIRE

    Gnacinski, P.; Krogulec, M.

    2007-01-01

    Interstellar clouds that exhibit strong Ca I and Fe I lines were called CaFe clouds. The ionisation equilibrium equations were used to model the column densities of Ca II, Ca I, K I, Na I, Fe I and Ti II in CaFe clouds. The chemical composition of CaFe clouds is that of the Solar System and no depletion of elements onto dust grains is seen. The CaFe clouds have high electron densities n=1 cm^-3 that leads to high column densities of neutral Ca and Fe.

  15. Switching of the triplet excited state of rhodamine/naphthaleneimide dyads: an experimental and theoretical study.

    Science.gov (United States)

    Cui, Xiaoneng; Zhao, Jianzhang; Lou, Zhangrong; Li, Shujing; Wu, Huijian; Han, Ke-Li

    2015-01-02

    Rhodamine-bromonaphthaleneimide (RB-NI) and rhodamine-bromonaphthalenediimide (RB-NDI) dyads were prepared for switching of the triplet excited states. Bromo-NI or bromo-NDI parts in the dyads are the spin converters, i.e., the triplet state producing modules, whereas the RB unit is the acid-activatable electron donor/energy acceptor. NI and NDI absorb at 359 and 541 nm, and the T1 state energy levels are 2.25 and 1.64 eV, respectively. RB undertakes the reversible spirolactam (RB-c) ↔ opened amide (RB-o) transformation. RB-c shows no visible light absorption, and the triplet-state energy level is ET1 = 3.36 eV. Conversely RB-o shows strong absorption at 557 nm, and ET1 is 1.73 eV. Thus, the acid-activated fluorescence-resonance-energy-transfer (FRET) competes with the ISC of NI or NDI. No triplet state was observed for the dyads with nanosecond time-resolved transient absorption spectroscopy. Upon addition of acid, strong fluorescence and long-living triplet excited states were observed. Thus, the producing of triplet state is acid-activatable. The triplet state of RB-NI is localized on RB-o part, whereas in RB-NDI the triplet state is delocalized on both the NDI and RB-o units. The ISC of spin converter was not outcompeted by RET. These studies are useful for switching of triplet excited state.

  16. The Lowest Triplet of Tetracyanoquinodimethane via UV-vis Absorption Spectroscopy with Br-Containing Solvents.

    Science.gov (United States)

    Khvostenko, Olga G; Kinzyabulatov, Renat R; Khatymova, Laysan Z; Tseplin, Evgeniy E

    2017-10-05

    This study was undertaken to find the previously unknown lowest triplet of the isolated molecule of tetracyanoquinodimethane (TCNQ), which is a widely used organic semiconductor. The problem is topical because the triplet excitation of this compound is involved in some processes which occur in electronic devices incorporating TCNQ and its derivatives, and information on the TCNQ triplet is needed for better understanding of these processes. The lowest triplet of TCNQ was obtained at 1.96 eV using UV-vis absorption spectroscopy with Br-containing solvents. Production of the triplet band with sufficient intensity in the spectra was provided by the capacity of the Br atom to augment the triplet excitation and through using a 100 mm cuvette. The assignment of the corresponding spectral band to the triplet transition was made by observation that this band appeared only in the spectra recorded in Br-containing solvents but not in spectra recorded in other solvents. Additional support for the triplet assignment came from the overall UV-vis absorption spectra of TCNQ recorded in various solvents, using a 10 mm cuvette, in the 1.38-6.5 eV energy range. Singlet transitions of the neutral TCNQ(o) molecule and doublet transitions of the TCNQ(¯) negative ion were identified in these overall spectra and were assigned with TD B3LYP/6-31G calculations. Determination of the lowest triplet of TCNQ attained in this work may be useful for theoretical studies and practical applications of this important compound.

  17. [Outcome of triplet pregnancies managed for twin-to-twin transfusion syndrome: A single center experience].

    Science.gov (United States)

    Chalouhi, G E; Quibel, T; Benzina, N; Bernard, J-P; Essaoui, M; Ville, Y

    2016-10-01

    Study the outcomes of triplet pregnancies (GGG) complicated with twin-to-twin transfusion syndrome (TTTS) treated with laser fetoscopy. Retrospective study of interventions, outcomes and perinatal follow-up of GGG treated for TTS. Between 2002 and 2013, 25 GGG complicated by TTTS were seen in our center, 20 dichorionic and 5 monochorionic. The mean gestational age (GA) at diagnosis of TTTS was 19.7 GW (±2.4) with 2, 4, 16 and 1 pregnancies at Quintero's stage I, II, III and V, respectively. They had a fetoscopy at an average GA of 19 GW and 6 days. There were 3 (13.0%) late miscarriages. The average GA at delivery was of 29.6 GW overall (26.3 GW and 31.1 GW in monochorionic and dichorionic pregnancies respectively). The overall fetal survival rate was 57.97% (40% and 66.7% in the group of monochorionic dichorionic pregnancies, respectively). However, neonatal mortality (<28 days) is 17.5%. GGG operated by fetoscopy for TTTS have a survival rate of three, at least 2 and at least 1 fetus of 21.7%, 69.6% and 82.6% respectively. The overall fetal survival rate is 59.97%. There is a tendency for better survival rates in dichorionic GGG compared to monochorionic GGG (P=0.079). Copyright © 2016. Published by Elsevier Masson SAS.

  18. Electronic structure of the Mn4OxCa cluster in the S0 and S2 states of the oxygen-evolving complex of photosystem II based on pulse 55Mn-ENDOR and EPR spectroscopy.

    Science.gov (United States)

    Kulik, Leonid V; Epel, Boris; Lubitz, Wolfgang; Messinger, Johannes

    2007-11-07

    The heart of the oxygen-evolving complex (OEC) of photosystem II is a Mn4OxCa cluster that cycles through five different oxidation states (S0 to S4) during the light-driven water-splitting reaction cycle. In this study we interpret the recently obtained 55Mn hyperfine coupling constants of the S0 and S2 states of the OEC [Kulik et al. J. Am. Chem. Soc. 2005, 127, 2392-2393] on the basis of Y-shaped spin-coupling schemes with up to four nonzero exchange coupling constants, J. This analysis rules out the presence of one or more Mn(II) ions in S0 in methanol (3%) containing samples and thereby establishes that the oxidation states of the manganese ions in S0 and S2 are, at 4 K, Mn4(III, III, III, IV) and Mn4(III, IV, IV, IV), respectively. By applying a "structure filter" that is based on the recently reported single-crystal EXAFS data on the Mn4OxCa cluster [Yano et al. Science 2006, 314, 821-825] we (i) show that this new structural model is fully consistent with EPR and 55Mn-ENDOR data, (ii) assign the Mn oxidation states to the individual Mn ions, and (iii) propose that the known shortening of one 2.85 A Mn-Mn distance in S0 to 2.75 A in S1 [Robblee et al. J. Am. Chem. Soc. 2002, 124, 7459-7471] corresponds to a deprotonation of a mu-hydroxo bridge between MnA and MnB, i.e., between the outer Mn and its neighboring Mn of the mu3-oxo bridged moiety of the cluster. We summarize our results in a molecular model for the S0 --> S1 and S1 --> S2 transitions.

  19. Adsorption of acetanilide herbicides on soil and its components. II. Adsorption and catalytic hydrolysis of diethatyl-ethyl on saturated Na(+)-, K(+)-, Ca(2+)-, and Mg(2+)-montmorillonite.

    Science.gov (United States)

    Liu, W P; Fang, Z; Liu, H J; Yang, W C

    2001-04-01

    Adsorption and catalytic hydrolysis of the herbicide diethatyl-ethyl [N-chloroacetyl-N-(2,6-diethylphenyl)glycine ethyl ester] on homoionic Na(+)-, K(+)-, Ca(2+)-, and Mg(2+)-montmorillonite clays were investigated in water solution. The Freundlich adsorption coefficient, Ki, got from isotherms on clay followed the order of Na+ approximately K+ > Mg2+ approximately Ca2+. Analysis of FT-IR spectra of diethatyl-ethyl adsorbed on clay suggests probable bonding at the carboxyl and amide carbonyl groups of the herbicide. The rate of herbicide hydrolysis in homoionic clay suspensions followed the same order as that for adsorption, indicating that adsorption may have preceded and thus caused hydrolysis. Preliminary product identification showed that hydrolysis occurred via nucleophilic substitution at the carboxyl carbon, causing the cleavage of the ester bond and formation of diethatyl and its dechlorinated derivative, and at the amide carbon, yielding an ethyl ester derivative and its acid. These pathways also suggest that hydrolysis of diethatyl-ethyl was catalyzed by adsorption on the clay surface.

  20. ISORROPIA II: a computationally efficient thermodynamic equilibrium model for K+─Ca²+─Mg²+─NH4+─Na+─SO4²-─NO3-─Cl-─H2O aerosols

    Directory of Open Access Journals (Sweden)

    C. Fountoukis

    2007-09-01

    Full Text Available This study presents ISORROPIA II, a thermodynamic equilibrium model for the K+–Ca2+–Mg2+–NH4+–Na+–SO42−–NO3−–Cl−–H2O aerosol system. A comprehensive evaluation of its performance is conducted against water uptake measurements for laboratory aerosol and predictions of the SCAPE2 thermodynamic module over a wide range of atmospherically relevant conditions. The two models agree well, to within 13% for aerosol water content and total PM mass, 16% for aerosol nitrate and 6% for aerosol chloride and ammonium. Largest discrepancies were found under conditions of low RH, primarily from differences in the treatment of water uptake and solid state composition. In terms of computational speed, ISORROPIA II was more than an order of magnitude faster than SCAPE2, with robust and rapid convergence under all conditions. The addition of crustal species does not slow down the thermodynamic calculations (compared to the older ISORROPIA code because of optimizations in the activity coefficient calculation algorithm. Based on its computational rigor and performance, ISORROPIA II appears to be a highly attractive alternative for use in large scale air quality and atmospheric transport models.

  1. Forest Biomass Mapping from Prism Triplet, Palsar and Landsat Data

    Science.gov (United States)

    Ranson, J.; Sun, G.; Ni, W.

    2014-12-01

    The loss of sensitivity at higher biomass levels is a common problem in biomass mapping using optical multi-spectral data or radar backscattering data due to the lack of information on canopy vertical structure. Studies have shown that adding implicit information of forest vertical structure improves the performance of forest biomass mapping from optical reflectance and radar backscattering data. LiDAR, InSAR and stereo imager are the data sources for obtaining forest structural information. The potential of providing information on forest vertical structure by stereoscopic imagery data has drawn attention recently due to the availability of high-resolution digital stereo imaging from space and the advances of digital stereo image processing software. The Panchromatic Remote-sensing Instrument for Stereo Mapping (PRISM) onboard the Advanced Land Observation Satellite (ALOS) has acquired multiple global coverage from June 2006 to April 2011 providing a good data source for regional/global forest studies. In this study, five PRISM triplets acquired on June 14, 2008, August 19 and September 5, 2009; PALSAR dual-pol images acquired on July 12, 2008 and August 30, 2009; and LANDSAT 5 TM images acquired on September 5, 2009 and the field plot data collected in 2009 and 2010 were used to map forest biomass at 50m pixel in an area of about 4000 km2in Maine, USA ( 45.2 deg N 68.6 deg W). PRISM triplets were used to generate point cloud data at 2m pixel first and then the average height of points above NED (National Elevation Dataset) within a 50m by 50m pixel was calculated. Five images were mosaicked and used as canopy height information in the biomass estimation along with the PALSAR HH, HV radar backscattering and optical reflectance vegetation indices from L-5 TM data. A small portion of this region was covered by the Land Vegetation and Ice Sensor (LVIS) in 2009. The biomass maps from the LVIS data was used to evaluate the results from combined use of PRISM, PALSAR and

  2. Filling the gap. Human cranial remains from Gombore II (Melka Kunture, Ethiopia; ca. 850 ka) and the origin of Homo heidelbergensis.

    Science.gov (United States)

    Profico, Antonio; Di Vincenzo, Fabio; Gagliardi, Lorenza; Piperno, Marcello; Manzi, Giorgio

    2016-06-20

    African archaic humans dated to around 1,0 Ma share morphological affinities with Homo ergaster and appear distinct in cranio-dental morphology from those of the Middle Pleistocene that are referred to Homo heidelbergensis. This observation suggests a taxonomic and phylogenetic discontinuity in Africa that ranges across the Matuyama/Brunhes reversal (780 ka). Yet, the fossil record between roughly 900 and 600 ka is notoriously poor. In this context, the Early Stone Age site of Gombore II, in the Melka Kunture formation (Upper Awash, Ethiopia), provides a privileged case-study. In the Acheulean layer of Gombore II, somewhat more recent than 875 ±10 ka, two large cranial fragments were discovered in 1973 and 1975 respectively: a partial left parietal (Melka Kunture 1) and a right portion of the frontal bone (Melka Kunture 2), which probably belonged to the same cranium. We present here the first detailed description and computer-assisted reconstruction of the morphology of the cranial vault pertaining to these fossil fragments. Our analysis suggest that the human fossil specimen from Gombore II fills a phenetic gap between Homo ergaster and Homo heidelbergensis. This appears in agreement with the chronology of such a partial cranial vault, which therefore represents at present one of the best available candidates (if any) for the origin of Homo heidelbergensis in Africa.

  3. Controlling Long-Lived Triplet Generation from Intramolecular Singlet Fission in the Solid State

    KAUST Repository

    Pace, Natalie A.

    2017-11-30

    The conjugated polymer poly(benzothiophene dioxide) (PBTDO1) has recently been shown to exhibit efficient intramolecular singlet fission in solution. In this paper, we investigate the role of intermolecular interactions in triplet separation dynamics after singlet fission. We use transient absorption spectroscopy to determine the singlet fission rate and triplet yield in two polymers differing only by side chain motif in both solution and the solid state. Whereas solid-state films show singlet fission rates identical to those measured in solution, the average lifetime of the triplet population increases dramatically, and is strongly dependent on side-chain identity. These results show that it may be necessary to carefully engineer the solid-state microstructure of these “singlet fission polymers” in order to produce the long-lived triplets needed to realize efficient photovoltaic devices.

  4. Coherent storage of photoexcited triplet states using 29Si nuclear spins in silicon.

    Science.gov (United States)

    Akhtar, Waseem; Filidou, Vasileia; Sekiguchi, Takeharu; Kawakami, Erika; Itahashi, Tatsumasa; Vlasenko, Leonid; Morton, John J L; Itoh, Kohei M

    2012-03-02

    Pulsed electron paramagnetic resonance spectroscopy of the photoexcited, metastable triplet state of the oxygen-vacancy center in silicon reveals that the lifetime of the m(s)=±1 sublevels differs significantly from that of the m(s)=0 state. We exploit this significant difference in decay rates to the ground singlet state to achieve nearly ~100% electron-spin polarization within the triplet. We further demonstrate the transfer of a coherent state of the triplet electron spin to, and from, a hyperfine-coupled, nearest-neighbor (29)Si nuclear spin. We measure the coherence time of the (29)Si nuclear spin employed in this operation and find it to be unaffected by the presence of the triplet electron spin and equal to the bulk value measured by nuclear magnetic resonance.

  5. IceBridge UAF Lidar Profiler L1B Geolocated Surface Elevation Triplets

    Data.gov (United States)

    National Aeronautics and Space Administration — The NASA IceBridge UAF Lidar Profiler L1B Geolocated Surface Elevation Triplets data set contains surface profiles of Alaska Glaciers acquired using the airborne...

  6. Theory of triplet optical absorption in oligoacenes: From naphthalene to heptacene

    Energy Technology Data Exchange (ETDEWEB)

    Chakraborty, Himanshu, E-mail: chakraborty.himanshu@gmail.com; Shukla, Alok, E-mail: shukla@phy.iitb.ac.in [Department of Physics, Indian Institute of Technology Bombay, Powai, Mumbai 400076 (India)

    2014-10-28

    In this paper, we present a detailed theory of the triplet states of oligoacenes containing up to seven rings, i.e., starting from naphthalene all the way up to heptacene. In particular, we present results on the optical absorption from the first triplet excited state 1{sup 3}B{sub 2u}{sup +} of these oligomers, computed using the Pariser-Parr-Pople model Hamiltonian, and a correlated electron approach employing the configuration-interaction methodology at various levels. Excitation energies of various triplets states obtained by our calculations are in good agreement with the experimental results, where available. The computed triplet spectra of oligoacenes exhibits rich structure dominated by two absorption peaks of high intensities, which are well separated in energy, and are caused by photons polarized along the conjugation direction. This prediction of ours can be tested in future experiments performed on oriented samples of oligoacenes.

  7. Controlling Long-Lived Triplet Generation from Intramolecular Singlet Fission in the Solid State

    Energy Technology Data Exchange (ETDEWEB)

    Pace, Natalie A. [National Renewable Energy Laboratory, 15013 Denver West Parkway, Golden, Colorado 80401, United States; Department; Zhang, Weimin [Center; Arias, Dylan H. [National Renewable Energy Laboratory, 15013 Denver West Parkway, Golden, Colorado 80401, United States; McCulloch, Iain [Center; KSC,; Rumbles, Garry [National Renewable Energy Laboratory, 15013 Denver West Parkway, Golden, Colorado 80401, United States; Department; Renewable; Johnson, Justin C. [National Renewable Energy Laboratory, 15013 Denver West Parkway, Golden, Colorado 80401, United States

    2017-12-06

    The conjugated polymer poly(benzothiophene dioxide) (PBTDO1) has recently been shown to exhibit efficient intramolecular singlet fission in solution. We investigate the role of intermolecular interactions in triplet separation dynamics after singlet fission. We use transient absorption spectroscopy to determine the singlet fission rate and triplet yield in two polymers differing only by side-chain motif in both solution and the solid state. Whereas solid-state films show singlet fission rates identical to those measured in solution, the average lifetime of the triplet population increases dramatically and is strongly dependent on side-chain identity. These results show that it may be necessary to carefully engineer the solid-state microstructure of these 'singlet fission polymers' to produce the long-lived triplets needed to realize efficient photovoltaic devices.

  8. IceBridge Riegl Laser Altimeter L2 Geolocated Surface Elevation Triplets V001

    Data.gov (United States)

    National Aeronautics and Space Administration — The IceBridge Riegl Laser Altimeter L2 Geolocated Surface Elevation Triplets (ILUTP2) data set contains surface range values for Antarctica and Greenland derived...

  9. A genetic defect caused by a triplet repeat expansion in Arabidopsis thaliana.

    Science.gov (United States)

    Sureshkumar, Sridevi; Todesco, Marco; Schneeberger, Korbinian; Harilal, Ramya; Balasubramanian, Sureshkumar; Weigel, Detlef

    2009-02-20

    Variation in the length of simple DNA triplet repeats has been linked to phenotypic variability in microbes and to several human disorders. Population-level forces driving triplet repeat contraction and expansion in multicellular organisms are, however, not well understood. We have identified a triplet repeat-associated genetic defect in an Arabidopsis thaliana variety collected from the wild. The Bur-0 strain carries a dramatically expanded TTC/GAA repeat in the intron of the ISOPROPYL MALATE ISOMERASE LARGE SUB UNIT1 (IIL1; At4g13430) gene. The repeat expansion causes an environment-dependent reduction in IIL1 activity and severely impairs growth of this strain, whereas contraction of the expanded repeat can reverse the detrimental phenotype. The Bur-0 IIL1 defect thus presents a genetically tractable model for triplet repeat expansions and their variability in natural populations.

  10. Design and construction of triplet atmospheric cold plasma jet for sterilization

    Directory of Open Access Journals (Sweden)

    F. Sohbatzadeh

    2014-03-01

    Full Text Available In this paper, construction of triplet atmospheric plasma jet using argon, air, oxygen and nitrogen gases is reported. Bactericidal effect of the plasma jet is also investigated. To that end, longitudinal geometric configuration for the electrodes was chosen because it would increase the jet length. Electrical characteristics, jet length dependencies on the applied voltage and gas flow rate were decided, experimentally. Relative concentrations of chemical reactive species such as ozone, atomic oxygen, NOx compounds and hydroxyl were measured using optical emission spectroscopy. It was seen that atomic oxygen and ozone concentrations with triplet plasma jet are more than the concentration of single plasma jet. Triplet plasma jet was also used for sterilization of solid and liquid surfaces to disinfect gram-negative and gram-positive Escherichia coli and Streptococcus pyogenes bacteria. The results verified the effectiveness of the triplet plasma jet for killing bacteria.

  11. IceBridge Riegl Laser Altimeter L2 Geolocated Surface Elevation Triplets

    Data.gov (United States)

    National Aeronautics and Space Administration — The IceBridge Riegl Laser Altimeter L2 Geolocated Surface Elevation Triplets (ILUTP2) data set contains surface range values for Antarctica and Greenland derived...

  12. Mechanism of the Decay of Thymine Triplets in DNA Single Strands.

    Science.gov (United States)

    Pilles, Bert M; Bucher, Dominik B; Liu, Lizhe; Clivio, Pascale; Gilch, Peter; Zinth, Wolfgang; Schreier, Wolfgang J

    2014-05-01

    The decay of triplet states and the formation of cyclobutane pyrimidine dimers (CPDs) after UV excitation of the all-thymine oligomer (dT)18 and the locked dinucleotide TLpTL were studied by nanosecond IR spectroscopy. IR marker bands characteristic for the CPD lesion and the triplet state were observed from ∼1 ns (time resolution of the setup) onward. The amplitudes of the CPD marker bands remain constant throughout the time range covered (up to 10 μs). The triplet decays with a time constant of ∼10 ns presumably via a biradical intermediate (lifetime ∼60 ns). This biradical has often been invoked as an intermediate for CPD formation via the triplet channel. The present results lend strong support to the existence of this intermediate, yet there is no indication that its decay contributes significantly to CPD formation.

  13. Computer Simulation Studies of CTG Triplet Repeat Sequences

    Science.gov (United States)

    Rasaiah, Jayendran. C.; Lynch, Joshua

    1998-03-01

    Long segments of CTG trinucleotide repeats in human DNA are correlated with a class of neurological diseases (myotonic dystrophy, fragile-X syndrome, and Kenndy's disease). These diseases are characterized by genetic anticipation and are thought to arise from replication errors caused by unusual conformations of CTG repeat segments. We have studied the properties of a single short segment of double starnded DNA with CTG repeats in 0.5 M sodium chloride solution with molecular dynamics simulations. The simulations are carried out in the micro canonical ensemble using an all-atom force field with CHARMM parameters. The TIPS3 water model is used to simulate a molecular solvent. Electrostatic interactions are calculated by Ewald summation and the equations of motion integrated using a Verlet algorithm in conjunction with SHAKE constrained dynamics to maintain bond lengths. The simulation of CTG repeat sequence is compared with a control system containing CAG triplet repeats to determine possible differencesin the conformation and elasticity of the two sequences.

  14. Spiro-linked hyperbranched architecture in electrophosphorescent conjugated polymers for tailoring triplet energy back transfer.

    Science.gov (United States)

    Shao, Shiyang; Ma, Zhihua; Ding, Junqiao; Wang, Lixiang; Jing, Xiabin; Wang, Fosong

    2012-04-17

    A spiro-linked hyperbranched architecture has been incorporated into electrophosphorescent conjugated polymers for the first time, aiming at simultaneously tailoring the intra- and intermolecular triplet energy back transfer from the phosphorescent guest to the conjugated polymer host. Based on a prototype with this unique structure, slower decay of triplet excitons, and 5-8 fold enhancement of device efficiencies are obtained compared with the conventional blending counterpart. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Picosecond laser studies of the charge-transfer reaction of excited triplet diphenylcarbene with electron donors

    Science.gov (United States)

    Sitzmann, E. V.; Langan, J.; Eisenthal, K. B.

    1983-12-01

    Evidence of a one-electron transfer process in a carbene reaction has been observed for the first time. The example is the quenching of the photoexcited triplet state of diphenylcarbene ( 3*DPC) by electron donors. Measurement of the fluorescence lifetime as a function of donor concentration yielded the bimolecular rate constant, 3* k. An explanation is offered as to why 3* and 1DPC react efficiently with amines as well as alcohols, whereas the ground triplet, 3DPC, does not.

  16. Possible evidence for spin-transfer torque induced by spin-triplet supercurrent

    KAUST Repository

    Li, Lailai

    2017-10-04

    Cooper pairs in superconductors are normally spin singlet. Nevertheless, recent studies suggest that spin-triplet Cooper pairs can be created at carefully engineered superconductor-ferromagnet interfaces. If Cooper pairs are spin-polarized they would transport not only charge but also a net spin component, but without dissipation, and therefore minimize the heating effects associated with spintronic devices. Although it is now established that triplet supercurrents exist, their most interesting property - spin - is only inferred indirectly from transport measurements. In conventional spintronics, it is well known that spin currents generate spin-transfer torques that alter magnetization dynamics and switch magnetic moments. The observation of similar effects due to spin-triplet supercurrents would not only confirm the net spin of triplet pairs but also pave the way for applications of superconducting spintronics. Here, we present a possible evidence for spin-transfer torques induced by triplet supercurrents in superconductor/ferromagnet/superconductor (S/F/S) Josephson junctions. Below the superconducting transition temperature T_c, the ferromagnetic resonance (FMR) field at X-band (~ 9.0 GHz) shifts rapidly to a lower field with decreasing temperature due to the spin-transfer torques induced by triplet supercurrents. In contrast, this phenomenon is absent in ferromagnet/superconductor (F/S) bilayers and superconductor/insulator/ferromagnet/superconductor (S/I/F/S) multilayers where no supercurrents pass through the ferromagnetic layer. These experimental observations are discussed with theoretical predictions for ferromagnetic Josephson junctions with precessing magnetization.

  17. Interaction of LDL receptor-related protein 4 (LRP4) with postsynaptic scaffold proteins via its C-terminal PDZ domain-binding motif, and its regulation by Ca/calmodulin-dependent protein kinase II.

    Science.gov (United States)

    Tian, Qing-Bao; Suzuki, Tatsuo; Yamauchi, Takashi; Sakagami, Hiroyuki; Yoshimura, Yoshiyuki; Miyazawa, Shoko; Nakayama, Kohzo; Saitoh, Fuminori; Zhang, Jing-Ping; Lu, Yonghao; Kondo, Hisatake; Endo, Shogo

    2006-06-01

    We cloned here a full-length cDNA of Dem26[Tian et al. (1999)Mol. Brain Res., 72, 147-157], a member of the low-density lipoprotein (LDL) receptor gene family from the rat brain. We originally named the corresponding protein synaptic LDL receptor-related protein (synLRP) [Tian et al. (2002) Soc. Neurosci. Abstr., 28, 405] and have renamed it LRP4 to accord it systematic nomenclature (GenBank(TM) accession no. AB073317). LRP4 protein interacted with postsynaptic scaffold proteins such as postsynaptic density (PSD)-95 via its C-terminal tail sequence, and associated with N-methyl-D-aspartate (NMDA)-type glutamate receptor subunit. The mRNA of LRP4 was localized to dendrites, as well as somas, of neuronal cells, and the full-length protein of 250 kDa was highly concentrated in the brain and localized to various subcellular compartments in the brain, including synaptic fractions. Immunocytochemical study using cultured cortical neurons suggested surface localization in the neuronal cells both in somas and dendrites. Ca(2+)/calmodulin-dependent protein kinase II (CaMKII) phosphorylated the C-terminal cytoplasmic region of LRP4 at Ser1887 and Ser1900, and the phosphorylation at the latter site suppressed the interaction of the protein with PSD-95 and synapse-associated protein 97 (SAP97). These findings suggest a postsynaptic role for LRP4, a putative endocytic multiligand receptor, and a mechanism in which CaMKII regulates PDZ-dependent protein-protein interactions and receptor dynamics.

  18. First Metallicty Distribution From CaT Spectroscopy of RGB Stars in the Dwarf Irregular Galaxy WLM

    Science.gov (United States)

    Leaman, Ryan; Cole, A.; Venn, K.; Tolstoy, E.; Irwin, M.; Szeifert, T.

    2007-07-01

    A metallicity distribution for the central bar region of the dwarf irregular galaxy WLM is presented from VLT FORS2 spectra of 46 red giant stars, as well as radial velocities for the member stars in this field. The [Fe/H] values were derived using the near infrared Ca II triplet lines as a tracer of metallicity (see Grocholski et al. 2006, Rutledge et al. 1997) and is conformed to a metallicity scale with the aid of four calibrating globular clusters. Although limited by small number statistics in this preliminary release, the ability to study the metallicitiy with respect to velocity and physical location of the member stars is invaluable in helping to characterize the formation and enrichment history of these kind of stellar populations - as has been found from CaT analysis of RGB stars in the Sculptor and Fornax galaxies. (Tolstoy et al. 2004, Battaglia et al. 2006) Specifically, the metallicty distribution for the WLM stellar population(s) can be tied to the recent HST star formation history study (Dolphin, 2000) which places estimates on the frequency and duration of star formation episodes in WLM. The isolated nature of WLM allows a unique opportunity to analyze the enrichment and star formation history of a low luminosity stellar population, which presumably has had a less complicated evolution due to minimal local group interactions. Research for this study was funded in part by NSERC Discovery Grant Program #327292-06.

  19. Katanin localization requires triplet microtubules in Chlamydomonas reinhardtii.

    Directory of Open Access Journals (Sweden)

    Jessica M Esparza

    Full Text Available Centrioles and basal bodies are essential for a variety of cellular processes that include the recruitment of proteins to these structures for both centrosomal and ciliary function. This recruitment is compromised when centriole/basal body assembly is defective. Mutations that cause basal body assembly defects confer supersensitivity to Taxol. These include bld2, bld10, bld12, uni3, vfl1, vfl2, and vfl3. Flagellar motility mutants do not confer sensitivity with the exception of mutations in the p60 (pf19 and p80 (pf15 subunits of the microtubule severing protein katanin. We have identified additional pf15 and bld2 (ε-tubulin alleles in screens for Taxol sensitivity. Null pf15 and bld2 alleles are viable and are not essential genes in Chlamydomonas. Analysis of double mutant strains with the pf15-3 and bld2-6 null alleles suggests that basal bodies in Chlamydomonas may recruit additional proteins beyond katanin that affect spindle microtubule stability. The bld2-5 allele is a hypomorphic allele and its phenotype is modulated by nutritional cues. Basal bodies in bld2-5 cells are missing proximal ends. The basal body mutants show aberrant localization of an epitope-tagged p80 subunit of katanin. Unlike IFT proteins, katanin p80 does not localize to the transition fibers of the basal bodies based on an analysis of the uni1 mutant as well as the lack of colocalization of katanin p80 with IFT74. We suggest that the triplet microtubules are likely to play a key role in katanin p80 recruitment to the basal body of Chlamydomonas rather than the transition fibers that are needed for IFT localization.

  20. Determination of activities of human carbonic anhydrase II inhibitors ...

    African Journals Online (AJOL)

    Purpose: To evaluate the activities of new curcumin analogs as carbonic anhydrase II (CA-II) inhibitor. Methods: Carbonic anhydrase II (CA-II) inhibition was determined by each ligand capability to inhibit the esterase activity of CA-II using 4-NPA as a substrate in 96-well plates. Dimethyl sulfoxide was used to dissolve each ...

  1. Clinical Significance of Serum HE4, CA125, CA724, and CA19-9 in Patients With Endometrial Cancer.

    Science.gov (United States)

    Bian, Jing; Sun, Xiaoxu; Li, Bo; Ming, Liang

    2017-08-01

    Serum markers with increased sensitivity and specificity for endometrial cancer are required. To date, no good marker has met this standard. The aims of our study were to evaluate the utility of tumor markers HE4, CA125, CA724, and CA19-9 as potential markers in patients diagnosed with endometrial cancer. Blood samples from 105 patients with endometrial cancer and 87 healthy women were analyzed by Roche electrochemiluminescent immunoassay, and serum values were measured for the following biomarkers: HE4, CA125, CA724, and CA19-9. Serum HE4, CA125, CA724, and CA19-9 concentrations were significantly higher in patients with endometrial cancer, compared with controls ( P endometrial cancer, HE4 had higher sensitivity (58%), positive predictive value (60%), and negative predictive value (67%) than any other single tumor marker, and in the combination of HE4, CA125, CA724, and CA19-9, the sensitivity and positive predictive values reached 59.1% and 88%, respectively. Meanwhile, the receiver operating characteristic area under the curve of the combination of the 4 markers was significantly increased than any other group, either in stage I or in stage II to IV cases. HE4 and CA125 both correlate with advanced age; in addition, HE4 was related to pathology subtypes and positive adnexal involvement, CA125 was related to International Federation of Gynecology and Obstetrics stage, CA19-9 was related to International Federation of Gynecology and Obstetrics stage, and CA724 was correlated with positive lymph node. Combination of HE4, CA125, CA724, and CA19-9 has the highest value in diagnosing endometrial cancer, and they can be a useful tissue immune marker for patients with endometrial cancer.

  2. CaMKII in the Cardiovascular System: Sensing Redox States

    Science.gov (United States)

    Erickson, Jeffrey R.; He, B. Julie; Grumbach, Isabella M.; Anderson, Mark E

    2013-01-01

    The multifunctional Ca2+ and calmodulin-dependent protein kinase II (CaMKII) is now recognized to play a central role in pathological events in the cardiovascular system. CaMKII has diverse downstream targets that promote vascular disease, heart failure and arrhythmias, so improved understanding of CaMKII signaling has the potential to lead to new therapies for cardiovascular disease. CaMKII is a multimeric serine-threonine kinase that is initially activated by binding calcified calmodulin (Ca2+/CaM). Under conditions of sustained exposure to elevated Ca2+/CaM CaMKII transitions into a Ca2+/CaM-autonomous enzyme by two distinct but parallel processes. Autophosphorylation of threonine 287 in the CaMKII regulatory domain ‘traps’ CaMKII into an open configuration even after Ca2+/CaM unbinding. More recently, our group identified a pair of methionines (281/282) in the CaMKII regulatory domain that undergo a partially reversible oxidation which, like autophosphorylation, prevents CaMKII from inactivating after Ca2+/CaM unbinding. Here we review roles of CaMKII in cardiovascular disease with an eye to understanding how CaMKII may act as a transduction signal to connect pro-oxidant conditions into specific downstream pathological effects that are relevant to rare and common forms of cardiovascular disease. PMID:21742790

  3. Serotonin regulates 6-phosphofructo-1-kinase activity in a PLC-PKC-CaMK II- and Janus kinase-dependent signaling pathway.

    Science.gov (United States)

    Coelho, Wagner Santos; Sola-Penna, Mauro

    2013-01-01

    Serotonin (5-HT) is a hormone that has been implicated in the regulation of many physiological and pathological events. One of the most intriguing properties of this hormone is its ability to up-regulate mitosis. Moreover, 5-HT stimulates glucose uptake and up-regulates PFK activity through the 5-HT(2A) receptor, resulting in the phosphorylation of a tyrosine residue of PFK and the intracellular redistribution of PFK within skeletal muscle. The present study investigated some of the signaling intermediates involved in the effects of 5-HT on 6-phosphofructo-1-kinase (PFK) regulation from skeletal muscle using kinetic assessments, immunoprecipitation, and western blotting assays. Our results demonstrate that 5-HT stimulates PFK from skeletal muscle via phospholipase C (PLC). The activation of PLC in skeletal muscle leads to the recruitment of protein kinase C (PKC) and calmodulin and the stimulation of calmodulin kinase II, which associates with PFK upon 5-HT action. Alternatively, 5-HT loses its ability to up-regulate PFK activity when Janus kinase is inhibited, suggesting that 5-HT is able to control glycolytic flux in the skeletal muscle of mice by recruiting different pathways and controlling PFK activity.

  4. Three-dimensional triplet tracking for LHC and future high rate experiments

    Science.gov (United States)

    Schöning, A.

    2014-10-01

    The hit combinatorial problem is a main challenge for track reconstruction and triggering at high rate experiments. At hadron colliders the dominant fraction of hits is due to low momentum tracks for which multiple scattering (MS) effects dominate the hit resolution. MS is also the dominating source for hit confusion and track uncertainties in low energy precision experiments. In all such environments, where MS dominates, track reconstruction and fitting can be largely simplified by using three-dimensional (3D) hit-triplets as provided by pixel detectors. This simplification is possible since track uncertainties are solely determined by MS if high precision spatial information is provided. Fitting of hit-triplets is especially simple for tracking detectors in solenoidal magnetic fields. The over-constrained 3D-triplet method provides a complete set of track parameters and is robust against fake hit combinations. Full tracks can be reconstructed step-wise by connecting hit triplet combinations from different layers, thus heavily reducing the combinatorial problem and accelerating track linking. The triplet method is ideally suited for pixel detectors where hits can be treated as 3D-space points. With the advent of relatively cheap and industrially available CMOS-sensors the construction of highly granular full scale pixel tracking detectors seems to be possible also for experiments at LHC or future high energy (hadron) colliders. In this paper tracking performance studies for full-scale pixel detectors, including their optimisation for 3D-triplet tracking, are presented. The results obtained for different types of tracker geometries and different reconstruction methods are compared. The potential of reducing the number of tracking layers and - along with that - the material budget using this new tracking concept is discussed. The possibility of using 3D-triplet tracking for triggering and fast online reconstruction is highlighted.

  5. Triplet state spectra and dynamics of peridinin analogs having different extents of pi-electron conjugation.

    Science.gov (United States)

    Kaligotla, Shanti; Doyle, Sara; Niedzwiedzki, Dariusz M; Hasegawa, Shinji; Kajikawa, Takayuki; Katsumura, Shigeo; Frank, Harry A

    2010-03-01

    The Peridinin-Chlorophyll a-Protein (PCP) complex has both an exceptionally efficient light-harvesting ability and a highly effective protective capacity against photodynamic reactions involving singlet oxygen. These functions can be attributed to presence of a substantial amount of the highly-substituted and complex carotenoid, peridinin, in the protein and the facts that the low-lying singlet states of peridinin are higher in energy than those of chlorophyll (Chl) a, but the lowest-lying triplet state of peridinin is below that of Chl a. Thus, singlet energy can be transferred from peridinin to Chl a, but the Chl a triplet state is quenched before it can sensitize the formation of singlet oxygen. The present investigation takes advantage of Chl a as an effective triplet state donor to peridinin and explores the triplet state spectra and dynamics of a systematic series of peridinin analogs having different numbers of conjugated carbon-carbon double bonds. The carotenoids investigated are peridinin, which has a C(37) carbon skeleton and eight conjugated carbon-carbon double bonds, and three synthetic analogs: C(33)-peridinin, having two less double bonds than peridinin, C(35)-peridinin which has one less double bond than peridinin, and C(39)-peridinin which has one more double bond than peridinin. In this study, the behavior of the triplet state spectra and kinetics exhibited by these molecules has been investigated in polar and nonpolar solvents and reveals a substantial effect of both pi-electron conjugated chain length and solvent environment on the spectral lineshapes. However, only a small dependence of these factors is observed on the kinetics of triplet energy transfer from Chl a and on carotenoid triplet state deactivation to the ground state.

  6. Polymer triplet energy levels need not limit photocurrent collection in organic solar cells.

    Science.gov (United States)

    Schlenker, Cody W; Chen, Kung-Shih; Yip, Hin-Lap; Li, Chang-Zhi; Bradshaw, Liam R; Ochsenbein, Stefan T; Ding, Feizhi; Li, Xiaosong S; Gamelin, Daniel R; Jen, Alex K-Y; Ginger, David S

    2012-12-05

    We study charge recombination via triplet excited states in donor/acceptor organic solar cells and find that, contrary to intuition, high internal quantum efficiency (IQE) can be obtained in polymer/fullerene blend devices even when the polymer triplet state is significantly lower in energy than the intermolecular charge transfer (CT) state. Our model donor system comprises the copolymer PIDT-PhanQ: poly(indacenodithiophene-co-phenanthro[9,10-b]quinoxaline), which when blended with phenyl-C(71)-butyric acid methyl ester (PC(71)BM) is capable of achieving power conversion efficiencies of 6.0% and IQE ≈ 90%, despite the fact that the polymer triplet state lies 300 meV below the interfacial CT state. However, as we push the open circuit voltage (V(OC)) higher by tailoring the fullerene reduction potential, we observe signatures of a new recombination loss process near V(OC) = 1.0 V that we do not observe for PCBM-based devices. Using photoinduced absorption and photoluminescence spectroscopy, we show that a new recombination path opens via the fullerene triplet manifold as the energy of the lowest CT state approaches the energy of the fullerene triplet. This pathway appears active even in cases where direct recombination via the polymer triplet remains thermodynamically accessible. These results suggest that kinetics, as opposed to thermodynamics, can dominate recombination via triplet excitons in these blends and that optimization of charge separation and kinetic suppression of charge recombination may be fruitful paths for the next generation of panchromatic organic solar cell materials with high V(OC) and J(SC).

  7. Mechanical Strain Regulates Osteoblast Proliferation Through Ca(2+)-CaMK-CREB Signal Pathway.

    Science.gov (United States)

    Guo, Yong; Lv, Qi; Zou, Xian-Qiong; Yan, Zhi-Xiong; Yan, Yu-Xian

    2016-06-20

    Objective To investigate the effects of mechanical strain on Ca(2+)-calmodulin dependent kinase (CaMK)-cAMP response element binding protein (CREB) signal pathway and proliferation of osteoblasts.Methods Using a four-point bending device, MC3T3-E1 cells were exposed to mechanical tensile strains of 2500 µs and 5000 µs at 0.5 Hz respectively. The intracellular free Ca(2+) ([Ca(2+)]i) concentration and calmodulin activity were assayed by fluorospectrophotometry, CaMK II β, CREB, and phosphorylated (activated) CREB (p-CREB) were assessed by Western blot, and cells proliferation was assayed with MTT. Pretreatment with verapamil was carried out to block Ca(2+) channel, and inhibitor U73122 was used to inhibit phospholipase C (PLC).Results Mechanical strains of 2500 µs and 5000 µs for 1 to 10 minutes both increased [Ca(2+)]i level of the cells. The 2500 µs strain, a periodicity of 1 h/d for 3 days, activated calmodulin, elevated protein levels of CaMK II β and p-CREB, and promoted cells proliferation, which were attenuated by pretreatment of verapamil or U73122. The effects of 5000 µs strain on calmodulin, CaMK II β, p-CREB and proliferation were contrary to 2500 µs strain.Conclusion The mechanical strain regulates osteoblasts proliferation through Ca(2+)-CaMK-CREB signal pathway via Ca(2+) channel and PLC/IP3 transduction cascades.

  8. Matrix genetics, part 1: permutations of positions in triplets and symmetries of genetic matrices

    CERN Document Server

    Petoukhov, Sergey V

    2008-01-01

    The hidden connection between the degeneracy of the vertebrate mitochondria genetic code and the positional permutations inside genetic triplets is described. The Kronecker family of the genetic matrices is investigated, which is based on the genetic matrix [C A; U G], where C, A, U, G are the letters of the genetic alphabet. The natural system of binary numeration of genetic multiplets in the genetic matrices is proposed. The matrix [C A; U G] in the third Kronecker power is the (8*8)-matrix, which contains 64 triplets. When 64 triplets in this matrix are numbered in accordance with the natural system, the coincidence with the famous table of 64 hexagrams of the ancient Chinese book "I Ching" arises. It is significant that peculiarities of the degeneracy of the vertebrate mitochondria genetic code are reflected in the symmetrical black-and-white mosaic of this genetic (8*8)-matrix of 64 triplets. This matrix is reformed into a new mosaic matrix when internal positions in all triplets are permuted simultaneou...

  9. Control the length of beam trajectory with a quadruple triplet for heavy ion accelerator

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zhan; Wei, Shaoqing; Lee, Sang Jin [Uiduk University, Gyeongju (Korea, Republic of); Kim, Do Gyun; Kim, Jang Youl [Rare Isotope Science Project, Institute for Basic Science, Daejeon (Korea, Republic of)

    2016-12-15

    Beam trajectory is needed to be controlled in heavy ion accelerator system. Quadruple magnets are widely used in heavy ion accelerator for focusing the transporting particles. A quadruple triplet system which consists of three consecutive quadrupoles, Q1, Q2 and Q3, is used to control beam trajectory at a focused position. Q1 and Q3 have symmetry with respect to Q2. The beam trajectory in magnet system is affected by higher order fields existed in real fields. For quadrupoles, the representation simulation of beam trajectory was carried out to study the beam trajectory and to estimate an effect of higher order field in triplet system. SCALA program was used to simulate the beam trajectory in OperaTM. SCALA can analyze a large number of beam trajectories at the same time by adjusting the size of finite element of the emitter. With OperaTM and MatlabTM programs, the position of focused beam spot in quadruple triplet system can be increased or decreased using evolution strategy (ES) method, therefore the length of triplet system can be controlled. Finally, the quadruple triplet system with the appropriate length and expected beam spot range was suggested in this paper.

  10. Energy-donor phosphorescence quenching study of triplet–triplet energy transfer between UV absorbers

    Energy Technology Data Exchange (ETDEWEB)

    Kikuchi, Azusa; Nakabai, Yuya [Department of Chemistry, Graduate School of Engineering, Yokohama National University, Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan); Oguchi-Fujiyama, Nozomi; Miyazawa, Kazuyuki [Shiseido Research Center, Hayabuchi, Tsuzuki-ku, Yokohama 224-8558 (Japan); Yagi, Mikio, E-mail: yagimiki@ynu.ac.jp [Department of Chemistry, Graduate School of Engineering, Yokohama National University, Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan)

    2015-10-15

    The intermolecular triplet–triplet energy transfer from a photounstable UV-A absorber, 4-tert-butyl-4′-methoxydibenzoylmethane (BMDBM), to UV-B absorbers, 2-ethylhexyl 4-methoxycinnamate (octyl methoxycinnamate, OMC), octocrylene (OCR) and dioctyl 4-methoxybenzylidenemalonate (DOMBM) has been observed using a 355 nm laser excitation in rigid solutions at 77 K. The decay curves of the energy-donor phosphorescence in the presence of the UV-B absorbers deviate from the exponential decay at the initial stage of the decay. The Stern–Volmer formulation is not valid in rigid solutions because molecular diffusion is impossible. The experimental results indicate that the rate constant of triplet–triplet energy transfer from BMDBM to the UV-B absorbers, k{sub T–T}, decreases in the following order: k{sub T–T} (BMDBM–DOMBM)>k{sub T–T} (BMDBM–OMC)≥k{sub T–T} (BMDBM–OCR). The presence of DOMBM enhances the photostability of the widely used combination of UV-A and UV-B absorbers, BMDBM and OCR. The effects of the triplet–triplet energy transfer on the photostability of BMDBM are discussed. - Highlights: • The intermolecular triplet–triplet energy transfer between UV absorbers was observed. • The phosphorescence decay deviates from exponential at the initial stage of decay. • The effects of triplet–triplet energy transfer on the photostability are discussed.

  11. Interface currents and magnetization in singlet-triplet superconducting heterostructures: Role of chiral and helical domains

    Science.gov (United States)

    Romano, Alfonso; Noce, Canio; Vekhter, Ilya; Cuoco, Mario

    2017-08-01

    Chiral and helical domain walls are generic defects of topological spin-triplet superconductors. We study theoretically the magnetic and transport properties of superconducting singlet-triplet-singlet heterostructure as a function of the phase difference between the singlet leads in the presence of chiral and helical domains inside the spin-triplet region. The local inversion symmetry breaking at the singlet-triplet interface allows the emergence of a static phase-controlled magnetization and generally yields both spin and charge currents flowing along the edges. The parity of the domain wall number affects the relative orientation of the interface moments and currents, while in some cases the domain walls themselves contribute to spin and charge transport. We demonstrate that singlet-triplet heterostructures are a generic prototype to generate and control nondissipative spin and charge effects, putting them in a broader class of systems exhibiting spin-Hall, anomalous Hall effects and similar phenomena. Features of the electron transport and magnetic effects at the interfaces can be employed to assess the presence of domains in chiral/helical superconductors.

  12. Triplet State Formation in Photovoltaic Blends of DPP-Type Copolymers and PC71BM

    KAUST Repository

    Ochsmann, Julian R.

    2015-04-29

    The exciton dynamics in pristine films of two structurally related low-bandgap diketopyrrolopyrrole (DPP)-based donor–acceptor copolymers and the photophysical processes in bulk heterojunction solar cells using DPP copolymer:PC71BM blends are investigated by broadband transient absorption (TA) pump-probe experiments covering the vis–near-infrared spectral and fs–μs dynamic range. The experiments reveal surprisingly short exciton lifetimes in the pristine poly­mer films in conjunction with fast triplet state formation. An in-depth analysis of the TA data by multivariate curve resolution analysis shows that in blends with fullerene as acceptor ultrafast exciton dissociation creates charge carriers, which then rapidly recombine on the sub-ns timescale. Furthermore, at the carrier densities created by pulsed laser excitation the charge carrier recombination leads to a substantial population of the polymer triplet state. In fact, virtually quantitative formation of triplet states is observed on the sub-ns timescale. However, the quantitative triplet formation on the sub-ns timescale is not in line with the power conversion efficiencies of devices indicating that triplet state formation is an intensity-dependent process in these blends and is reduced under solar illumination conditions, as free charge carriers can be extracted from the photoactive layer in devices.

  13. El sitio Bajo del Coypar II: Las evidencias más tempranas (CA. 1000 AP del proceso agropastoril en la Puna Meridional Argentina (Antofagasta de la Sierra, Catamarca

    Directory of Open Access Journals (Sweden)

    Silvina Vigliani

    2005-01-01

    Full Text Available El sitio Bajo del Coypar II (BC II es un conjunto de estructuras de pequeñas dimensiones ubicado sobre una saliente de la ladera de los cerros del Coypar, frente y alrededor del cual se distribuye una gran superficie de campos de cultivo prehispánicos, (Bajo del Coypar I de aproximadamente 1000 ha. En un trabajo anterior se postuló que este amplio sistema de producción agrícola se originó hacia el final del proceso regional tardío (ca. 1300 AP en asociación con el crecimiento del principal centro habitacional de la región, La Alumbrera (Olivera et.al, 1994 y que luego fue apropiado y ampliado por el Incario. En el presente trabajo se plantean tres objetivos generales: conocer el tipo de actividades que se realizaban en el conjunto de estructuras de BC II, establecer la asociación que había entre este conjunto de estructuras y el sistema de producción agrícola e identificar posibles cambios en el uso del espacio a lo largo del tiempo. En un principio se pensó que Bajo del Coypar II formaba parte de la ampliación del espacio productivo implementada por el Imperio Incaico. Las investigaciones llevadas a cabo en el mismo permitieron determinar que efectivamente hacia las etapas más tardías y en asociación con el Incario había una estrecha relación con el sector agrícola, evidenciado en una alta frecuencia de vasijas para el almacenaje y/o el procesamiento de sustancias secas. Sin embargo, también revelaron ocupaciones más tempranas vinculadas a grupos o unidades domésticas con un desarrollo creciente de las prácticas agrícolas. De este modo, la actividad agro-pastoril fue, en este sector de la Puna meridional, mucho más temprana de lo que pensábamos.

  14. Neutrino mass hierarchy and Majorana CP phases within the Higgs triplet model at the LHC

    CERN Document Server

    Garayoa, Julia

    2008-01-01

    Neutrino masses may be generated by the VEV of an $SU(2)_L$ Higgs triplet. We assume that the doubly charged component of such a triplet has a mass in the range of several 100 GeV, such that it is accessible at LHC. Its decay into like-sign leptons provides a clean experimental signature, which allows for a direct test of the neutrino mass matrix. By exploring the branching ratios of this decay into leptons of various flavours, we show that within this model the type of the neutrino mass spectrum (normal, inverted or quasi-degenerate) might actually be resolved at the LHC. Furthermore, we show that within the Higgs triplet model for neutrino mass the decays of the doubly charged scalar into like-sign lepton pairs at the LHC provide a possibility to determine the Majorana CP phases of the lepton mixing matrix.

  15. Nonlocal Andreev entanglements and triplet correlations in graphene with spin-orbit coupling

    Science.gov (United States)

    Beiranvand, Razieh; Hamzehpour, Hossein; Alidoust, Mohammad

    2017-10-01

    Using a wave function Dirac Bogoliubov-de Gennes method, we demonstrate that the tunable Fermi level of a graphene layer in the presence of Rashba spin-orbit coupling (RSOC) allows for producing an anomalous nonlocal Andreev reflection and equal spin superconducting triplet pairing. We consider a graphene nanojunction of a ferromagnet-RSOC-superconductor-ferromagnet configuration and study scattering processes, the appearance of spin triplet correlations, and charge conductance in this structure. We show that the anomalous crossed Andreev reflection is linked to the equal spin triplet pairing. Moreover, by calculating current cross-correlations, our results reveal that this phenomenon causes negative charge conductance at weak voltages and can be revealed in a spectroscopy experiment, and may provide a tool for detecting the entanglement of the equal spin superconducting pair correlations in hybrid structures.

  16. Single-stage quintuplet for upgrading triplet based lens system: Simulation for Atomki microprobe

    Science.gov (United States)

    Ponomarov, Artem; Rajta, Istvan; Nagy, Gyula; Romanenko, Oleksandr V.

    2017-08-01

    Among different configurations of lens systems for nuclear microprobes, the most common one is a triplet of magnetic quadrupole lenses. Nowadays, microanalysis and material modification will undoubtedly benefit from an improvement in spatial resolution. This work presents the results of simulations for improvement of the Oxford Triplet lens system at the Atomki microprobe with consideration of its system parameters and measured beam brightness distribution. For this purpose, an additional single-unit doublet of lenses with two power supplies was introduced. Using earlier developed methods, such a quintuplet system was optimized in order to determine the parameters which provided the highest resolution for different current operational modes with the same microprobe geometry. The tolerances for lens positioning accuracy were also calculated. The obtained quintuplet parameters indicate a resolution improvement for the Atomki microprobe compared to the Oxford Triplet system and these results validate further experimental testing of the proposed quintuplet.

  17. Reactions of excited triplet states of metal substituted myoglobin with dioxygen and quinone.

    Science.gov (United States)

    Papp, S; Vanderkooi, J M; Owen, C S; Holtom, G R; Phillips, C M

    1990-01-01

    The triplet state absorption and phosphorescence of Zn and Pd derivatives of myoglobin were compared. Both metal derivatives exhibit long triplet state lifetimes at room temperature, but whereas the Pd derivative showed exponential decay and an isosbestic point in the transient absorption spectra, the decay of the Zn derivative was nonsingle exponential and the transient absorption spectra showed evidence of more than one excited state species. No difference was seen in triplet quenching by oxygen for either derivative, indicating that differences in the polypeptide chain between the two derivatives are not large enough to affect oxygen penetrability. Quenching was also observed by anthraquinone sulfonate. In this case, the possibility of long-range transfer by an exchange mechanism is considered. PMID:2383630

  18. iTriplet, a rule-based nucleic acid sequence motif finder

    Directory of Open Access Journals (Sweden)

    Gunderson Samuel I

    2009-10-01

    Full Text Available Abstract Background With the advent of high throughput sequencing techniques, large amounts of sequencing data are readily available for analysis. Natural biological signals are intrinsically highly variable making their complete identification a computationally challenging problem. Many attempts in using statistical or combinatorial approaches have been made with great success in the past. However, identifying highly degenerate and long (>20 nucleotides motifs still remains an unmet challenge as high degeneracy will diminish statistical significance of biological signals and increasing motif size will cause combinatorial explosion. In this report, we present a novel rule-based method that is focused on finding degenerate and long motifs. Our proposed method, named iTriplet, avoids costly enumeration present in existing combinatorial methods and is amenable to parallel processing. Results We have conducted a comprehensive assessment on the performance and sensitivity-specificity of iTriplet in analyzing artificial and real biological sequences in various genomic regions. The results show that iTriplet is able to solve challenging cases. Furthermore we have confirmed the utility of iTriplet by showing it accurately predicts polyA-site-related motifs using a dual Luciferase reporter assay. Conclusion iTriplet is a novel rule-based combinatorial or enumerative motif finding method that is able to process highly degenerate and long motifs that have resisted analysis by other methods. In addition, iTriplet is distinguished from other methods of the same family by its parallelizability, which allows it to leverage the power of today's readily available high-performance computing systems.

  19. Codon size reduction as the origin of the triplet genetic code.

    Directory of Open Access Journals (Sweden)

    Pavel V Baranov

    Full Text Available The genetic code appears to be optimized in its robustness to missense errors and frameshift errors. In addition, the genetic code is near-optimal in terms of its ability to carry information in addition to the sequences of encoded proteins. As evolution has no foresight, optimality of the modern genetic code suggests that it evolved from less optimal code variants. The length of codons in the genetic code is also optimal, as three is the minimal nucleotide combination that can encode the twenty standard amino acids. The apparent impossibility of transitions between codon sizes in a discontinuous manner during evolution has resulted in an unbending view that the genetic code was always triplet. Yet, recent experimental evidence on quadruplet decoding, as well as the discovery of organisms with ambiguous and dual decoding, suggest that the possibility of the evolution of triplet decoding from living systems with non-triplet decoding merits reconsideration and further exploration. To explore this possibility we designed a mathematical model of the evolution of primitive digital coding systems which can decode nucleotide sequences into protein sequences. These coding systems can evolve their nucleotide sequences via genetic events of Darwinian evolution, such as point-mutations. The replication rates of such coding systems depend on the accuracy of the generated protein sequences. Computer simulations based on our model show that decoding systems with codons of length greater than three spontaneously evolve into predominantly triplet decoding systems. Our findings suggest a plausible scenario for the evolution of the triplet genetic code in a continuous manner. This scenario suggests an explanation of how protein synthesis could be accomplished by means of long RNA-RNA interactions prior to the emergence of the complex decoding machinery, such as the ribosome, that is required for stabilization and discrimination of otherwise weak triplet codon

  20. Singlet triplet transition of a two-electron quantum ring in magnetic and electric fields

    Science.gov (United States)

    Malet, F.; Pi, M.; Serra, Ll.; Lipparini, E.

    2008-03-01

    We present an exact numerical calculation of the spin phase diagram of a two-electron quantum ring as a function of an applied in-plane electric field E and a perpendicular magnetic field B. In general, large E and B favour, respectively, singlet and triplet states. At low fields, however, the spin phase diagram shows singlet-triplet oscillations and the formation of spin islands surrounded by the complementary phase. Calculations of the density dipole excitation spectrum as a function of the electric field are also reported.

  1. Energy Deposition Studies for the Hi-Lumi LHC Inner Triplet Magnets

    CERN Document Server

    Mokhov, N.V.; Striganov, Sergei I.; Tropin, Igor S.; Cerutti, Francesco; Esposito, Luigi Salvatore; Lechner, Anton

    2015-01-01

    A detailed model of the High Luminosity LHC inner triplet region with new large-aperture Nb3Sn magnets, field maps, corrector packages, and segmented tungsten inner absorbers was built and implemented into the FLUKA and MARS15 codes. In the optimized configuration, the peak power density averaged over the magnet inner cable width is safely below the quench limit. For the integrated luminosity of 3000 fb -1, the peak dose in the innermost magnet insulator ranges from 20 to 35 MGy. Dynamic heat loads to the triplet magnet cold mass are calculated to evaluate the cryogenic capability. In general, FLUKA and MARS results are in a very good agreement.

  2. Spectrally tunable mollow triplet emission from a coherently excited quantum dot in a microcavity

    DEFF Research Database (Denmark)

    Ulrich, Sven M.; Ates, Serkan; Reitzenstein, Stephan

    2010-01-01

    Resonance fluorescence of excitonic s-shell emission from a coherently pumped single InGaAs/GaAs quantum dot inside a micropillar cavity has been investigated in dependence on optical pump power and laser detuning, respectively. For strong purely resonant excitation, Mollow triplet spectra with l...... with large Rabi splittings of j~­j » 60¹eV have been observed. Laser detuning-dependent series revealed the pronounced asymmetry of the emission triplet as predicted by theory. From our data, an electrical dipole moment of ¹ » 17:8§0:5 Debye could be derived for the excitonic state....

  3. Evidence for triplet superconductivity in a superconductor-ferromagnet spin valve.

    Science.gov (United States)

    Leksin, P V; Garif'yanov, N N; Garifullin, I A; Fominov, Ya V; Schumann, J; Krupskaya, Y; Kataev, V; Schmidt, O G; Büchner, B

    2012-08-03

    We have studied the dependence of the superconducting (SC) transition temperature on the mutual orientation of magnetizations of Fe1 and Fe2 layers in the spin valve system CoO(x)/Fe1/Cu/Fe2/Pb. We find that this dependence is nonmonotonic when passing from the parallel to the antiparallel case and reveals a distinct minimum near the orthogonal configuration. The analysis of the data in the framework of the SC triplet spin valve theory gives direct evidence for the long-range triplet superconductivity arising due to noncollinearity of the two magnetizations.

  4. Energy deposition studies for the High-Luminosity Large Hadron Collider inner triplet magnets

    CERN Document Server

    Mokhov, N.V.; Tropin, I.S.; Cerutti, F.; Esposito, L.S.; Lechner, A.

    2015-05-06

    A detailed model of the High Luminosity LHC inner triplet region with new large-aperture Nb3Sn magnets, field maps, corrector packages, and segmented tungsten inner absorbers was built and implemented into the FLUKA and MARS15 codes. In the optimized configuration, the peak power density averaged over the magnet inner cable width is safely below the quench limit. For the integrated luminosity of 3000 fb-1, the peak dose in the innermost magnet insulator ranges from 20 to 35 MGy. Dynamic heat loads to the triplet magnet cold mass are calculated to evaluate the cryogenic capability. In general, FLUKA and MARS results are in a very good agreement.

  5. Charge Transfer and Triplet States in High Efficiency OPV Materials and Devices

    Science.gov (United States)

    Dyakonov, Vladimir

    2013-03-01

    The advantage of using polymers and molecules in electronic devices, such as light-emitting diodes (LED), field-effect transistors (FET) and, more recently, solar cells (SC) is justified by the unique combination of high device performance and processing of the semiconductors used. Power conversion efficiency of nanostructured polymer SC is in the range of 10% on lab scale, making them ready for up-scaling. Efficient charge carrier generation and recombination in SC are strongly related to dissociation of the primary singlet excitons. The dissociation (or charge transfer) process should be very efficient in photovoltaics. The mechanisms governing charge carrier generation, recombination and transport in SC based on the so-called bulk-heterojunctions, i.e. blends of two or more semiconductors with different electron affinities, appear to be very complex, as they imply the presence of the intermediate excited states, neutral and charged ones. Charge transfer states, or polaron pairs, are the intermediate states between free electrons/holes and strongly bound excitons. Interestingly, the mostly efficient OLEDs to date are based on the so-called triplet emitters, which utilize the triplet-triplet annihilation process. In SC, recent investigations indicated that on illumination of the device active layer, not only mobile charges but also triplet states were formed. With respect to triplets, it is unclear how these excited states are generated, via inter-system crossing or via back transfer of the electron from acceptor to donor. Triplet formation may be considered as charge carrier loss channel; however, the fusion of two triplets may lead to a formation of singlet excitons instead. In such case, a generation of charges by utilizing of the so far unused photons will be possible. The fundamental understanding of the processes involving the charge transfer and triplet states and their relation to nanoscale morphology and/or energetics of blends is essential for the

  6. Quantum Yield of Cyclobutane Pyrimidine Dimer Formation Via the Triplet Channel Determined by Photosensitization.

    Science.gov (United States)

    Liu, Lizhe; Pilles, Bert M; Gontcharov, Julia; Bucher, Dominik B; Zinth, Wolfgang

    2016-01-21

    UV-induced formation of the cyclobutane pyrimidine dimer (CPD) lesion is investigated by stationary and time-resolved photosensitization experiments. The photosensitizer 2'-methoxyacetophenone with high intersystem crossing efficiency and large absorption cross-section in the UV-A range was used. A diffusion controlled reaction model is presented. Time-resolved experiments confirmed the validity of the reaction model and provided information on the dynamics of the triplet sensitization process. With a series of concentration dependent stationary illumination experiments, we determined the quantum efficiency for CPD formation from the triplet state of the thymine dinucleotide TpT to be 4 ± 0.2%.

  7. Early fetal reduction to twin versus prophylactic cervical cerclage for triplet pregnancies conceived with assisted reproductive techniques

    Directory of Open Access Journals (Sweden)

    Mohamed Sayed Abdelhafez

    2018-02-01

    Conclusion: Early transvaginal reduction of triplets to twins leads to improved obstetric outcomes as it decreases prematurity and its related neonatal morbidities and mortality without increase in the miscarriage rate. Early fetal reduction seems to be better than continuation of triplet pregnancies with prophylactic placement of cervical cerclage.

  8. Synthesis and Exciton Dynamics of Donor-Orthogonal Acceptor Conjugated Polymers: Reducing the Singlet–Triplet Energy Gap

    KAUST Repository

    Freeman, David M. E.

    2017-06-09

    The presence of energetically low-lying triplet states is a hallmark of organic semiconductors. Even though they present a wealth of interesting photophysical properties, these optically dark states significantly limit optoelectronic device performance. Recent advances in emissive charge-transfer molecules have pioneered routes to reduce the energy gap between triplets and

  9. The Role of Birthweight Discordance in the Intellectual and Motor Outcome for Triplets at Early School Age

    Science.gov (United States)

    Natalucci, Giancarlo; Seitz, Jochen; Von Siebenthal, Kurt; Bucher, Hans U.; Milinari, Luciano; Jenni, Oskar G.; Latal, Beatrice

    2011-01-01

    Aim: We assessed motor and intellectual outcome in triplets at school age and investigated the predictive value of perinatal and demographic factors. Methods: Seventy-one live-born newborn infants (24 triplet pregnancies) were prospectively enrolled at birth. At the age of 6 years, 58 children (31 males, 27 females; mean gestational age 31.2wks…

  10. Triplet transitions of neutral CO in the spectra of comets and the abundance of CO/sub 2/ or molecules containing the CO group in comets

    Energy Technology Data Exchange (ETDEWEB)

    Biermann, L.

    1976-03-01

    The high-dispersion spectra of comet Mrkos (1957 V) taken at Mt. Palomar by J. L. Greenstein and remeasured by A. Woszczyk contain many unidentified weak lines. The possibility that some of these lines belong to transitions between triplet levels of neutral CO molecules is investigated. Their presence would suggest excitation related to the dissociative recombination of a parent containing the CO group, which is first ionized by solar uv. Of 31 CO lines (of the Asundi and Triplet systems), 14 are masked by known or by questionably identified lines as statistically expected. Of the remaining 17, 13 coincide within a few tenths of an Angstrom with an unidentified line and 4 do not. These results are contrary to statistical expectations. (Some members of the third positive system of CO, which might be present, have not been included in the figures.) Although these figures strongly favor the identification proposed, the numbers are not large enough to support entirely the argument of a small statistical probability (0.2 percent) of the observed state. Also, the rotational structure of the CO bands for the triplet systems needs further investigation. C. F. Lillie's observations of comet Bennett (1970 II) between 1200 and 1800 A, especially of the fourth positive system of CO, seem to favor a cometary atmosphere characterized by a large relative abundance of CO/sub 2/ and/or molecules containing the CO group. A model outlined for comet Bennett at 0.8 a.u. seems to be approximately consistent with observations. The chemical aspects, however, especially need further consideration. New observations, particularly of the Cameron bands of CO, are needed to settle the questions raised.

  11. Two-dimensional structural ordering in a chromophoric ionic liquid for triplet energy migration-based photon upconversion.

    Science.gov (United States)

    Hisamitsu, Shota; Yanai, Nobuhiro; Kouno, Hironori; Magome, Eisuke; Matsuki, Masaya; Yamada, Teppei; Monguzzi, Angelo; Kimizuka, Nobuo

    2017-11-03

    A novel chromophoric ionic liquid (IL) with two-dimensional (2D) nanostructural order is developed, and its structure-property relationship is investigated by harnessing photon upconversion based on triplet energy migration. An ion pair of 9,10-diphenylanthracene-2-sulphonate (DPAS) and asymmetric quaternary phosphonium ion exhibited both ionic crystal (IC) and supercooled IL phases at room temperature. Single crystal X-ray analysis of the IC phase showed an alternate alignment of polar (ionic) and non-polar (non-ionic) layers, and this layered structure was basically maintained even in the IL phase. The diffusion length of triplet excitons in the IL phase, obtained by the analysis of upconverted emission in succession to triplet-triplet annihilation (TTA), is larger than the domain size estimated from powder X-ray analysis. This suggests that triplet excitons in chromophoric ILs can diffuse over the nanostructured domains.

  12. Programmable Triplet Formation and Decay in Metal-Organic Chromophores

    Science.gov (United States)

    2011-12-13

    naphthalimide. After pulsed 355-nm laser excitation, the two ground-state imide 3 CO bands in each compound are bleached and two substantially...lower energy vibrations are produced; the lower energy feature appears as two distinct bands split by an overlapping transient bleach . Model studies...II) Chloro Complexes: Molecular Catalysts for the Photogeneration of Hydrogen from Water or Simply Precursors for Colloidal Platinum? Du, P

  13. Role of mismatch repair enzymes in GAA·TTC triplet-repeat expansion in Friedreich ataxia induced pluripotent stem cells.

    Science.gov (United States)

    Du, Jintang; Campau, Erica; Soragni, Elisabetta; Ku, Sherman; Puckett, James W; Dervan, Peter B; Gottesfeld, Joel M

    2012-08-24

    The genetic mutation in Friedreich ataxia (FRDA) is a hyperexpansion of the triplet-repeat sequence GAA·TTC within the first intron of the FXN gene. Although yeast and reporter construct models for GAA·TTC triplet-repeat expansion have been reported, studies on FRDA pathogenesis and therapeutic development are limited by the availability of an appropriate cell model in which to study the mechanism of instability of the GAA·TTC triplet repeats in the human genome. Herein, induced pluripotent stem cells (iPSCs) were generated from FRDA patient fibroblasts after transduction with the four transcription factors Oct4, Sox2, Klf4, and c-Myc. These cells were differentiated into neurospheres and neuronal precursors in vitro, providing a valuable cell model for FRDA. During propagation of the iPSCs, GAA·TTC triplet repeats expanded at a rate of about two GAA·TTC triplet repeats/replication. However, GAA·TTC triplet repeats were stable in FRDA fibroblasts and neuronal stem cells. The mismatch repair enzymes MSH2, MSH3, and MSH6, implicated in repeat instability in other triplet-repeat diseases, were highly expressed in pluripotent stem cells compared with fibroblasts and neuronal stem cells and occupied FXN intron 1. In addition, shRNA silencing of MSH2 and MSH6 impeded GAA·TTC triplet-repeat expansion. A specific pyrrole-imidazole polyamide targeting GAA·TTC triplet-repeat DNA partially blocked repeat expansion by displacing MSH2 from FXN intron 1 in FRDA iPSCs. These studies suggest that in FRDA, GAA·TTC triplet-repeat instability occurs in embryonic cells and involves the highly active mismatch repair system.

  14. Role of Mismatch Repair Enzymes in GAA·TTC Triplet-repeat Expansion in Friedreich Ataxia Induced Pluripotent Stem Cells*

    Science.gov (United States)

    Du, Jintang; Campau, Erica; Soragni, Elisabetta; Ku, Sherman; Puckett, James W.; Dervan, Peter B.; Gottesfeld, Joel M.

    2012-01-01

    The genetic mutation in Friedreich ataxia (FRDA) is a hyperexpansion of the triplet-repeat sequence GAA·TTC within the first intron of the FXN gene. Although yeast and reporter construct models for GAA·TTC triplet-repeat expansion have been reported, studies on FRDA pathogenesis and therapeutic development are limited by the availability of an appropriate cell model in which to study the mechanism of instability of the GAA·TTC triplet repeats in the human genome. Herein, induced pluripotent stem cells (iPSCs) were generated from FRDA patient fibroblasts after transduction with the four transcription factors Oct4, Sox2, Klf4, and c-Myc. These cells were differentiated into neurospheres and neuronal precursors in vitro, providing a valuable cell model for FRDA. During propagation of the iPSCs, GAA·TTC triplet repeats expanded at a rate of about two GAA·TTC triplet repeats/replication. However, GAA·TTC triplet repeats were stable in FRDA fibroblasts and neuronal stem cells. The mismatch repair enzymes MSH2, MSH3, and MSH6, implicated in repeat instability in other triplet-repeat diseases, were highly expressed in pluripotent stem cells compared with fibroblasts and neuronal stem cells and occupied FXN intron 1. In addition, shRNA silencing of MSH2 and MSH6 impeded GAA·TTC triplet-repeat expansion. A specific pyrrole-imidazole polyamide targeting GAA·TTC triplet-repeat DNA partially blocked repeat expansion by displacing MSH2 from FXN intron 1 in FRDA iPSCs. These studies suggest that in FRDA, GAA·TTC triplet-repeat instability occurs in embryonic cells and involves the highly active mismatch repair system. PMID:22798143

  15. Algorithms for Computing the Triplet and Quartet Distances for Binary and General Trees

    DEFF Research Database (Denmark)

    Sand, Andreas; Holt, Morten Kragelund; Johansen, Jens

    2013-01-01

    Distance measures between trees are useful for comparing trees in a systematic manner, and several different distance measures have been proposed. The triplet and quartet distances, for rooted and unrooted trees, respectively, are defined as the number of subsets of three or four leaves, respecti...... on coloring leaves in one tree and updating a hierarchical decomposition of the other....

  16. Maternal and Fetal Outcomes of Triplet Gestation in a Tertiary Hospital in Oman

    Directory of Open Access Journals (Sweden)

    Maryam Al-Shukri

    2014-05-01

    Full Text Available Objectives: The aim of this study was to describe the fetal and maternal outcomes of triplet gestation and to report on the maternal characteristics of those pregnancies in a tertiary care centre in Oman. Methods: A retrospective study was undertaken of all triplet pregnancies delivered at Sultan Qaboos University Hospital, Muscat, Oman, between January 2009 and December 2011. Results: Over the three-year study period, there were 9,140 deliveries. Of these, there were 18 triplet pregnancies, giving a frequency of 0.2%. The mean gestational age at delivery was 31.0 ± 3.0 weeks, and the mean birth weight was 1,594 ± 460 g. The most common maternal complications were preterm labour in 13 pregnancies (72.2%, gestational diabetes in 7 (39% and gestational hypertension in 5 (28%. Of the total deliveries, there were 54 neonates. Neonatal complications among these included hyaline membrane disease in 25 neonates (46%, hyperbilirubinaemia in 24 (43%, sepsis in 18 (33% and anaemia in 8 (15%. The perinatal mortality rate was 55 per 1,000 births. Conclusion: The maternal and neonatal outcomes of triplet pregnancies were similar to those reported in other studies.

  17. The triplet state of chlorophyll-a in whole algal cells

    NARCIS (Netherlands)

    Brakel, van G.H.

    1982-01-01

    The triplet state of chlorophyll-a (Chl-a) can be observed at 4K in intact algal cells using optically detected magnetic resonance (ODMR).

    In this Thesis experiments are described, to determine, to which kind of physically distinguishable Chl-a molecules, involved in the process of

  18. Three-Dimensional Triplet Tracking for LHC and Future High Rate Experiments

    CERN Document Server

    Schöning, Andre

    2014-10-20

    The hit combinatorial problem is a main challenge for track reconstruction and triggering at high rate experiments. At hadron colliders the dominant fraction of hits is due to low momentum tracks for which multiple scattering (MS) effects dominate the hit resolution. MS is also the dominating source for hit confusion and track uncertainties in low energy precision experiments. In all such environments, where MS dominates, track reconstruction and fitting can be largely simplified by using three-dimensional (3D) hit-triplets as provided by pixel detectors. This simplification is possible since track uncertainties are solely determined by MS if high precision spatial information is provided. Fitting of hit-triplets is especially simple for tracking detectors in solenoidal magnetic fields. The over-constrained 3D-triplet method provides a complete set of track parameters and is robust against fake hit combinations. The triplet method is ideally suited for pixel detectors where hits can be treated as 3D-space poi...

  19. Efficient algorithms for computing the triplet and quartet distance between trees of arbitrary degree

    DEFF Research Database (Denmark)

    Brodal, G. S.; Fagerberg, R.; Mailund, T.

    2013-01-01

    degree of any node in the two trees. Within the same time bounds, our framework also allows us to compute the parameterized triplet and quartet distances, where a parameter is introduced to weight resolved (binary) topologies against unresolved (non-binary) topologies. The previous best algorithm...

  20. Efficient Algorithms for Computing the Triplet and Quartet Distance Between Trees of Arbitrary Degree

    DEFF Research Database (Denmark)

    Brodal, Gerth Stølting; Fagerberg, Rolf; Mailund, Thomas

    2013-01-01

    degree of any node in the two trees. Within the same time bounds, our framework also allows us to compute the parameterized triplet and quartet distances, where a parameter is introduced to weight resolved (binary) topologies against unresolved (non-binary) topologies. The previous best algorithm...

  1. Development of a triplet magnetic lens system to focus a pulsed neutron beam

    Energy Technology Data Exchange (ETDEWEB)

    Oku, Takayuki; Kira, Hiroshi; Shinohara, Takenao; Takata, Shin-ichi; Arai, Masatoshi; Suzuki, Jun-ichi; Shimizu, Hirohiko M, E-mail: oku.takayuki@jaea.go.jp

    2010-11-01

    A triplet magnetic lens system composed of three sextupole-magnets and two spin flippers was constructed to focus pulsed neutrons in a wide wavelength range with same focal lengths. In this study, we performed a pulsed neutron beam focusing experiment with the system. The design of the system and the experimental results are shown and discussed.

  2. Laser-induced photochemical gas-phase reactions of vibrationally excited triplet molecules

    Science.gov (United States)

    Zalesskaya, G. A.; Yakovlev, D. L.; Sambor, E. G.

    2002-05-01

    Mechanisms and rates of laser-induced gas-phase reactions of vibrationally excited triplet ketones were studied after adding electron and hydrogen donors using time-resolved delayed fluorescence. The influence of various bimolecular competing processes on DF quenching was analyzed.

  3. Quenching of Triplet State Fluorophores for Studying Diffusion-Mediated Reactions in Lipid Membranes

    Science.gov (United States)

    Strömqvist, Johan; Chmyrov, Andriy; Johansson, Sofia; Andersson, August; Mäler, Lena; Widengren, Jerker

    2010-01-01

    An approach to study bimolecular interactions in model lipid bilayers and biological membranes is introduced, exploiting the influence of membrane-associated electron spin resonance labels on the triplet state kinetics of membrane-bound fluorophores. Singlet-triplet state transitions within the dye Lissamine Rhodamine B (LRB) were studied, when free in aqueous solutions, with LRB bound to a lipid in a liposome, and in the presence of different local concentrations of the electron spin resonance label TEMPO. By monitoring the triplet state kinetics via variations in the fluorescence signal, in this study using fluorescence correlation spectroscopy, a strong fluorescence signal can be combined with the ability to monitor low-frequency molecular interactions, at timescales much longer than the fluorescence lifetimes. Both in solution and in membranes, the measured relative changes in the singlet-triplet transitions rates were found to well reflect the expected collisional frequencies between the LRB and TEMPO molecules. These collisional rates could also be monitored at local TEMPO concentrations where practically no quenching of the excited state of the fluorophores can be detected. The proposed strategy is broadly applicable, in terms of possible read-out means, types of molecular interactions that can be followed, and in what environments these interactions can be measured. PMID:21112307

  4. A Chemical Confirmation of the Faint Boötes II Dwarf Spheroidal Galaxy

    Science.gov (United States)

    Koch, Andreas; Rich, R. Michael

    2014-10-01

    We present a chemical abundance study of the brightest confirmed member star of the ultra-faint dwarf galaxy Boötes II from Keck/HIRES high-resolution spectroscopy at moderate signal-to-noise ratios. At [Fe/H] = -2.93 ± 0.03(stat.) ± 0.17(sys.), this star chemically resembles metal-poor halo field stars and the signatures of other faint dwarf spheroidal galaxies at the same metallicities in that it shows enhanced [α/Fe] ratios, Solar Fe-peak element abundances, and low upper limits on the neutron-capture element Ba. Moreover, this star shows no chemical peculiarities in any of the eight elements we were able to measure. This implies that the chemical outliers found in other systems remain outliers pertaining to the unusual enrichment histories of the respective environments, while Boo II appears to have experienced an enrichment history typical of its very low mass. We also re-calibrated previous measurements of the galaxy's metallicity from the calcium triplet (CaT) and find a much lower value than reported before. The resulting broad metallicity spread, in excess of one dex, the very metal-poor mean, and the chemical abundance patterns of the present star imply that Boötes II is a low-mass, old, metal-poor dwarf galaxy and not an overdensity associated with the Sagittarius Stream as has been previously suggested based on its sky position and kinematics. The low, mean CaT metallicity of -2.7 dex falls right on the luminosity-metallicity relation delineated over four orders of magnitude from the more luminous to the faintest galaxies. Thus Boötes II's chemical enrichment appears representative of the galaxy's original mass, while tidal stripping and other mass loss mechanisms were probably not significant as for other low-mass satellites.

  5. Precision spectroscopy with ultracold {sup 87}Rb{sub 2} triplet molecules

    Energy Technology Data Exchange (ETDEWEB)

    Strauss, Christoph

    2011-10-19

    In this thesis I report precision spectroscopy with ultracold {sup 87}Rb{sub 2} triplet molecules where we use lasers to couple the states in different molecular potentials. We study in detail states of the a {sup 3} sum {sup +}{sub u} and (1) {sup 3} sum {sup +}{sub g} potentials. These states are of great importance for transferring weakly bound molecules to the ro-vibrational triplet ground state via states of the excited potential. As most experiments start from molecules in their X {sup 1} sum {sup +}{sub g} ground state, the triplet states were hard to access via dipole transitions and remained largely unexplored. The measurements presented in this thesis are the first detailed study of diatomic {sup 87}Rb{sub 2} molecules in these states. Our experiments start with an ultracold cloud of {sup 87}Rb atoms. We then load this cloud into an optical lattice where we use a magnetic Feshbach resonance at 1007.4 G to perform a Feshbach association. After we have removed all unbound atoms, we end up with a pure sample of weakly bound Feshbach molecules inside the optical lattice. The optical lattice prevents these molecules from colliding with each other which results in molecular lifetimes on the order of a few hundred milliseconds. In the first set of experiments, we use a laser coupling the Feshbach state to the excited (1) {sup 3} sum {sup +}{sub g} triplet state to map out its low-lying vibrational (v = 0.. 15), rotational, hyperfine, and Zeeman structure. The experimental results are in good agreement with calculations done by Marius Lysebo and Prof. Leif Veseth. We then map out in detail the vibrational, rotational, hyperfine, and Zeeman structure of the a {sup 3} sum {sup +}{sub u} triplet ground state using dark state spectroscopy with levels in the (1) {sup 3} sum {sup +}{sub g} potential as an intermediate state. In this scheme we are able to access molecules in triplet states because our Feshbach state has strong triplet character. Interestingly, it

  6. Sequence coevolution between RNA and protein characterized by mutual information between residue triplets.

    Directory of Open Access Journals (Sweden)

    Relly Brandman

    Full Text Available Coevolving residues in a multiple sequence alignment provide evolutionary clues of biophysical interactions in 3D structure. Despite a rich literature describing amino acid coevolution within or between proteins and nucleic acid coevolution within RNA, to date there has been no direct evidence of coevolution between protein and RNA. The ribosome, a structurally conserved macromolecular machine composed of over 50 interacting protein and RNA chains, provides a natural example of RNA/protein interactions that likely coevolved. We provide the first direct evidence of RNA/protein coevolution by characterizing the mutual information in residue triplets from a multiple sequence alignment of ribosomal protein L22 and neighboring 23S RNA. We define residue triplets as three positions in the multiple sequence alignment, where one position is from the 23S RNA and two positions are from the L22 protein. We show that residue triplets with high mutual information are more likely than residue doublets to be proximal in 3D space. Some high mutual information residue triplets cluster in a connected series across the L22 protein structure, similar to patterns seen in protein coevolution. We also describe RNA nucleotides for which switching from one nucleotide to another (or between purines and pyrimidines results in a change in amino acid distribution for proximal amino acid positions. Multiple crystal structures for evolutionarily distinct ribosome species can provide structural evidence for these differences. For one residue triplet, a pyrimidine in one species is a purine in another, and RNA/protein hydrogen bonds are present in one species but not the other. The results provide the first direct evidence of RNA/protein coevolution by using higher order mutual information, suggesting that biophysical constraints on interacting RNA and protein chains are indeed a driving force in their evolution.

  7. Triplet Pregnancy in a Diabetic Mother With Kidney Transplant: Case Report and Review of the Literature.

    Science.gov (United States)

    Mahmoud, Tarek; Mujaibel, Khalida; Attia, Hosam; Zakaria, Zakaria; Yagan, Jude; Gheith, Osama; Halim, Medhat Abdel; Nair, Prasad; Al-Otaibi, Torki

    2017-02-01

    Triplet and higher-order multiple pregnancies can carry increased fetal and maternal complications. Reports of triplet pregnancies after kidney transplant are scarce and have been associated with perinatal complications. Presence of diabetes in such cases worsens both fetal and maternal outcomes. Here, we present a triplet pregnancy in a kidney transplant recipient with diabetes. We also reviewed the literature for causes, prevalence, and outcomes in association with chronic kidney disease, kidney transplant, and diabetes mellitus. The patient, a 31-year-female who received a living-donor kidney transplant, had a first-time pregnancy 6 years after transplant. Pregnancy was complicated by gestational diabetes, preeclampsia, and miscarriage. She continued to have postpartum-impaired glucose tolerance. She became pregnant again after 6 months but required insulin therapy during her third trimester. Pregnancy was terminated by cesarean section for a viable small boy. Two years later, she had triplet pregnancy after ovulation induction with clomiphene. Glycemic control was maintained using intensive insulin therapy guided by frequent home blood glucose monitoring (HbA1c was 5.8% at 22 wk). Both gynecologic care and nephrologic care were carried out through outpatient follow-up. Pregnancy was complicated by hypertension and mild renal dysfunction without proteinuria and ended in elective premature cesarean section at 32 weeks of gestation. She had 3 male babies with low birth weights (1320, 1380, 1275 g), with the largest baby developing sepsis and requiring an intensive care unit stay and then incubator for 49 days. The other 2 required incubators for 36 days. Their weights after 22 months were 9, 16, and 11 kg. The mother is now normotensive with normal renal function and impaired glucose tolerance. Care of diabetic kidney recipients with triplet pregnancy constitutes a special challenge requiring a multispecialty skilled team to ensure the best outcome.

  8. Monochorionic-triamniotic triplet pregnancy after intracytoplasmic sperm injection, assisted hatching, and two-embryo transfer: first reported case following IVF

    Directory of Open Access Journals (Sweden)

    Eller Daniel P

    2003-08-01

    Full Text Available Abstract Background We present a case of monochorionic-triamniotic pregnancy that developed after embryo transfer following in vitro fertilization (IVF. Methods After controlled ovarian hyperstimulation and transvaginal retrieval of 22 metaphase II oocytes, fertilization was accomplished with intracytoplasmic sperm injection (ICSI. Assisted embryo hatching was performed, and two embryos were transferred in utero. One non-transferred blastocyst was cryopreserved. Results Fourteen days post-transfer, serum hCG level was 423 mIU/ml and subsequent transvaginal ultrasound revealed a single intrauterine gestational sac with three separate amnion compartments. Three distinct foci of cardiac motion were detected and the diagnosis was revised to monochorionic-triamniotic triplet pregnancy. Antenatal management included cerclage placement at 19 weeks gestation and hospital admission at 28 weeks gestation due to mild preeclampsia. Three viable female infants were delivered via cesarean at 30 5/7 weeks gestation. Conclusions The incidence of triplet delivery in humans is approximately 1:6400, and such pregnancies are classified as high-risk for reasons described in this report. We also outline an obstetric management strategy designed to optimize outcomes. The roles of IVF, ICSI, assisted embryo hatching and associated laboratory culture conditions on the subsequent development of monozygotic/monochorionic pregnancy remain controversial. As demonstrated here, even when two-embryo transfer is employed after IVF the statistical probability of monozygotic multiple gestation cannot be reduced to zero. We encourage discussion of this possibility during informed consent for the advanced reproductive technologies.

  9. Sensing mechanisms involved in Ca2+ and Mg2+ homeostasis

    NARCIS (Netherlands)

    Ferre, S.; Hoenderop, J.G.J.; Bindels, R.J.M.

    2012-01-01

    Calcium (Ca(2+)) and magnesium (Mg(2+)) ions are involved in many vital physiological functions. In the human body, Ca(2+) and Mg(2+) homeostatic systems rely on three components: (i) tissues (re)absorbing or storing Ca(2+) and Mg(2+), mainly kidney, intestine, and bone; (ii) hormones that modulate

  10. Temporal changes in rates of stillbirth, neonatal and infant mortality among triplet gestations in the United States.

    Science.gov (United States)

    Getahun, Darios; Amre, Devendra K; Ananth, Cande V; Demissie, Kitaw; Rhoads, George G

    2006-12-01

    The purpose of this study was to examine temporal changes in stillbirth, neonatal and infant mortality rates among triplet births in the US, and to assess the contributions of triplet delivery at infant deaths (1990-2002) delivered at > or = 22 weeks and fetuses weighing > or = 500 g (n = 66,986) were derived from the US linked birth/infant death data files. Relative risk (RR), quantifying changes in triplet stillbirth, neonatal (death within the first 28 days) and infant mortality (death within the first year) rates between 1990 and 1991 and 2001 and 2002, were derived. Temporal changes in triplet births at infant mortality rates were examined through logistic regression models before and after adjusting for confounders. Triplet births at infant mortality rates declined by 52% (RR 0.48, 95% confidence interval [CI] 0.36-0.63), 32% (RR 0.68, 95% CI 0.58-0.80), and 38% (RR 0.62, 95% CI 0.53-0.71), respectively, between 1990 and 1991 and 2001 and 2002. The increase in triplet births at infant deaths, respectively. Our findings suggest that the increase in triplet births at infant mortality.

  11. Synthesis, potentiometric, kinetic, and NMR Studies of 1,4,7,10-tetraazacyclododecane-1,7-bis(acetic acid)-4,10-bis(methylenephosphonic acid) (DO2A2P) and its complexes with Ca(II), Cu(II), Zn(II) and lanthanide(III) ions.

    Science.gov (United States)

    Kálmán, Ferenc K; Baranyai, Zsolt; Tóth, Imre; Bányai, István; Király, Róbert; Brücher, Ernö; Aime, Silvio; Sun, Xiankai; Sherry, A Dean; Kovács, Zoltán

    2008-05-05

    A cyclen-based ligand containing trans-acetate and trans-methylenephosphonate pendant groups, H 6DO2A2P, was synthesized and its protonation constants (12.6, 11.43, 5.95, 6.15, 2.88, and 2.77) were determined by pH-potentiometry and (1)H NMR spectroscopy. The first two protonations were shown to occur at the two macrocyclic ring N-CH 2-PO 3 (2-) nitrogens while the third and fourth protonations occur at the two phosphonate groups. In parallel with protonation of the two -PO 3 (2-) groups, the protons from the NH (+)-CH 2-PO 3 (2-) are transferred to the N-CH 2-COO (-) nitrogens. The stability constants of the Ca (2+), Cu (2+), and Zn (2+) (ML, MHL, MH 2L, and M 2L) complexes were determined by direct pH-potentiometry. Lanthanide(III) ions (Ln (3+)) form similar species, but the formation of complexes is slow; so, "out-of-cell" pH-potentiometry (La (3+), Eu (3+), Gd (3+), Y (3+)) and competitive spectrophotometry with Cu(II) ion (Lu (3+)) were used to determine the stability constants. By comparing the log K ML values with those of the corresponding DOTA (H 4DOTA = 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid) and DOTP (H 8DOTP = 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetramethylenephosphonic acid) complexes, the order DOTA studies of the Ce (3+) and Gd (3+) complexes with DO2A2P showed that complex formation is slow and involves a high stability diprotonated intermediate Ln(H 2DO2A2P)*. Rearrangement of the diprotonated intermediate into the final complex is an OH (-) assisted process but, unlike formation of Ln(DOTA) complexes, rearrangement of Ln(H 2DO2A2P)* also takes place spontaneously likely as a result of transfer of one of the protons from a ring nitrogen to a phosphonate group. The order of the OH (-) assisted formation rates of complexes is DOTA > DO2A2P > DOTP while the order of the proton assisted dissociation rates of the Gd (3+) complexes is reversed, DOTP > DO2A2P > DOTA. (1)H and (13)C NMR spectra of Eu(DO2A2P) and Lu(DO2A2P) were

  12. Ca2+ homeostasis regulates Xenopus oocyte maturation.

    Science.gov (United States)

    Sun, Lu; Hodeify, Rawad; Haun, Shirley; Charlesworth, Amanda; MacNicol, Angus M; Ponnappan, Subramaniam; Ponnappan, Usha; Prigent, Claude; Machaca, Khaled

    2008-04-01

    In contrast to the well-defined role of Ca2+ signals during mitosis, the contribution of Ca2+ signaling to meiosis progression is controversial, despite several decades of investigating the role of Ca2+ and its effectors in vertebrate oocyte maturation. We have previously shown that during Xenopus oocyte maturation, Ca2+ signals are dispensable for entry into meiosis and for germinal vesicle breakdown. However, normal Ca2+ homeostasis is essential for completion of meiosis I and extrusion of the first polar body. In this study, we test the contribution of several downstream effectors in mediating the Ca2+ effects during oocyte maturation. We show that calmodulin and calcium-calmodulin-dependent protein kinase II (CAMK2) are not critical downstream Ca2+ effectors during meiotic maturation. In contrast, accumulation of Aurora kinase A (AURKA) protein is disrupted in cells deprived of Ca2+ signals. Since AURKA is required for bipolar spindle formation, failure to accumulate AURKA may contribute to the defective spindle phenotype following Ca2+ deprivation. These findings argue that Ca2+ homeostasis is important in establishing the oocyte's competence to undergo maturation in preparation for fertilization and embryonic development.

  13. Rabi oscillation and electron-spin-echo envelope modulation of the photoexcited triplet spin system in silicon

    Science.gov (United States)

    Akhtar, Waseem; Sekiguchi, Takeharu; Itahashi, Tatsumasa; Filidou, Vasileia; Morton, John J. L.; Vlasenko, Leonid; Itoh, Kohei M.

    2012-09-01

    We report on a pulsed electron paramagnetic resonance (EPR) study of the photoexcited triplet state (S=1) of oxygen-vacancy centers in silicon. Rabi oscillations between the triplet sublevels are observed using coherent manipulation with a resonant microwave pulse. The Hahn echo and stimulated echo decay profiles are superimposed with strong modulations known as electron-spin-echo envelope modulation (ESEEM). The ESEEM spectra reveal a weak but anisotropic hyperfine coupling between the triplet electron spin and a 29Si nuclear spin (I=1/2) residing at a nearby lattice site, that cannot be resolved in conventional field-swept EPR spectra.

  14. Minima of multi-Higgs potentials with triplets of Δ(3n2) and Δ(6n2)

    Science.gov (United States)

    de Medeiros Varzielas, Ivo; King, Stephen F.; Luhn, Christoph; Neder, Thomas

    2017-12-01

    We analyse the minima of scalar potentials for multi-Higgs models where the scalars are arranged as either one triplet or two triplets of the discrete symmetries A4, S4, Δ (27), Δ (54), as well as Δ (3n2) and Δ (6n2) with n > 3. The results should be useful for both multi-Higgs models involving electroweak doublets and multi-flavon models involving electroweak singlets, where in both cases the fields transform as triplets under some non-Abelian discrete symmetry.

  15. Late INa increases diastolic SR-Ca2+-leak in atrial myocardium by activating PKA and CaMKII

    Science.gov (United States)

    Fischer, Thomas H.; Herting, Jonas; Mason, Fleur E.; Hartmann, Nico; Watanabe, Saera; Nikolaev, Viacheslav O.; Sprenger, Julia U.; Fan, Peidong; Yao, Lina; Popov, Aron-Frederik; Danner, Bernhard C.; Schöndube, Friedrich; Belardinelli, Luiz; Hasenfuss, Gerd; Maier, Lars S.; Sossalla, Samuel

    2015-01-01

    Aims Enhanced cardiac late Na current (late INa) and increased sarcoplasmic reticulum (SR)-Ca2+-leak are both highly arrhythmogenic. This study seeks to identify signalling pathways interconnecting late INa and SR-Ca2+-leak in atrial cardiomyocytes (CMs). Methods and results In murine atrial CMs, SR-Ca2+-leak was increased by the late INa enhancer Anemonia sulcata toxin II (ATX-II). An inhibition of Ca2+/calmodulin-dependent protein kinase II (Autocamide-2-related inhibitory peptide), protein kinase A (H89), or late INa (Ranolazine or Tetrodotoxin) all prevented ATX-II-dependent SR-Ca2+-leak. The SR-Ca2+-leak induction by ATX-II was not detected when either the Na+/Ca2+ exchanger was inhibited (KBR) or in CaMKIIδc-knockout mice. FRET measurements revealed increased cAMP levels upon ATX-II stimulation, which could be prevented by inhibition of adenylyl cyclases (ACs) 5 and 6 (NKY 80) but not by inhibition of phosphodiesterases (IBMX), suggesting PKA activation via an AC-dependent increase of cAMP levels. Western blots showed late INa-dependent hyperphosphorylation of CaMKII as well as PKA target sites at ryanodine receptor type-2 (-S2814 and -S2808) and phospholamban (-Thr17, -S16). Enhancement of late INa did not alter Ca2+-transient amplitude or SR-Ca2+-load. However, upon late INa activation and simultaneous CaMKII inhibition, Ca2+-transient amplitude and SR-Ca2+-load were increased, whereas PKA inhibition reduced Ca2+-transient amplitude and load and additionally slowed Ca2+ elimination. In atrial CMs from patients with atrial fibrillation, inhibition of late INa, CaMKII, or PKA reduced the SR-Ca2+-leak. Conclusion Late INa exerts distinct effects on Ca2+ homeostasis in atrial myocardium through activation of CaMKII and PKA. Inhibition of late INa represents a potential approach to attenuate CaMKII activation and decreases SR-Ca2+-leak in atrial rhythm disorders. The interconnection with the cAMP/PKA system further increases the antiarrhythmic potential of late

  16. Influence of the ionic strength and solid/solution ratio on Ca(II)-for-Na+ exchange on montmorillonite. Part 2: Understanding the effect of the m/V ratio. Implications for pore water composition and element transport in natural media.

    Science.gov (United States)

    Tertre, E; Ferrage, E; Bihannic, I; Michot, L J; Prêt, D

    2011-11-01

    The aim of the present paper is to clarify previous results showing that selectivity coefficients determined for the exchange of Na(+) for Ca(2+) in montmorillonite were dependent on the solid/solution ratio. The organization of montmorillonite suspensions upon Na(+)/Ca(II) exchange was analyzed by combining optical microscopy, small-angle X-ray scattering and X-ray diffraction. All samples displayed flocculated characteristics, eliminating the possibility of contrasting accessibility of sorption sites with the solid/solution ratio. Modeling of experimental X-ray diffraction patterns was used to quantify the relative proportions of interlayer Ca(2+) and Na(+) cations along the exchange isotherm. The results further confirmed the influence of the solid/solution ratio on the degree of interlayer Ca(II)-for-Na(+) exchange, and specific selectivity coefficients for interlayer sites were determined. The effect of the solid/solution ratio was finally interpreted by the resulting local changes in the solution chemistry. We demonstrated that by accounting for the Donnan effect, the different data can be interpreted using a single selectivity coefficient. The obtained Kc constant was successfully applied to interpret existing hydrogeochemical data on a natural aquitard. This most likely represents a more constrained and valid approach for the modeling of reactive element transport in natural media than does the poorly defined Kd parameter. Copyright © 2011 Elsevier Inc. All rights reserved.

  17. Thickness dependence of the triplet spin-valve effect in superconductor-ferromagnet-ferromagnet heterostructures.

    Science.gov (United States)

    Lenk, Daniel; Zdravkov, Vladimir I; Kehrle, Jan-Michael; Obermeier, Günter; Ullrich, Aladin; Morari, Roman; Krug von Nidda, Hans-Albrecht; Müller, Claus; Kupriyanov, Mikhail Yu; Sidorenko, Anatolie S; Horn, Siegfried; Deminov, Rafael G; Tagirov, Lenar R; Tidecks, Reinhard

    2016-01-01

    In nanoscale layered S/F1/N/F2/AF heterostructures, the generation of a long-range, odd-in-frequency spin-projection one triplet component of superconductivity, arising at non-collinear alignment of the magnetizations of F1 and F2, exhausts the singlet state. This yields the possibility of a global minimum of the superconducting transition temperature T c, i.e., a superconducting triplet spin-valve effect, around mutually perpendicular alignment. The superconducting triplet spin valve is realized with S = Nb a singlet superconductor, F1 = Cu41Ni59 and F2 = Co ferromagnetic metals, AF = CoO x an antiferromagnetic oxide, and N = nc-Nb a normal conducting (nc) non-magnetic metal, which serves to decouple F1 and F2. The non-collinear alignment of the magnetizations is obtained by applying an external magnetic field parallel to the layers of the heterostructure and exploiting the intrinsic perpendicular easy-axis of the magnetization of the Cu41Ni59 thin film in conjunction with the exchange bias between CoO x and Co. The magnetic configurations are confirmed by superconducting quantum interference device (SQUID) magnetic moment measurements. The triplet spin-valve effect has been investigated for different layer thicknesses, d F1, of F1 and was found to decay with increasing d F1. The data is described by an empirical model and, moreover, by calculations using the microscopic theory. The long-range triplet component of superconducting pairing is generated from the singlet component mainly at the N/F2 interface, where the amplitude of the singlet component is suppressed exponentially with increasing distance d F1. The decay length of the empirical model is found to be comparable to twice the electron mean free path of F1 and, thus, to the decay length of the singlet component in F1. Moreover, the obtained data is in qualitative agreement with the microscopic theory, which, however, predicts a (not investigated) breakdown of the triplet spin-valve effect for d F1 smaller

  18. Thickness dependence of the triplet spin-valve effect in superconductor–ferromagnet–ferromagnet heterostructures

    Directory of Open Access Journals (Sweden)

    Daniel Lenk

    2016-07-01

    Full Text Available Background: In nanoscale layered S/F1/N/F2/AF heterostructures, the generation of a long-range, odd-in-frequency spin-projection one triplet component of superconductivity, arising at non-collinear alignment of the magnetizations of F1 and F2, exhausts the singlet state. This yields the possibility of a global minimum of the superconducting transition temperature Tc, i.e., a superconducting triplet spin-valve effect, around mutually perpendicular alignment.Results: The superconducting triplet spin valve is realized with S = Nb a singlet superconductor, F1 = Cu41Ni59 and F2 = Co ferromagnetic metals, AF = CoOx an antiferromagnetic oxide, and N = nc-Nb a normal conducting (nc non-magnetic metal, which serves to decouple F1 and F2. The non-collinear alignment of the magnetizations is obtained by applying an external magnetic field parallel to the layers of the heterostructure and exploiting the intrinsic perpendicular easy-axis of the magnetization of the Cu41Ni59 thin film in conjunction with the exchange bias between CoOx and Co. The magnetic configurations are confirmed by superconducting quantum interference device (SQUID magnetic moment measurements. The triplet spin-valve effect has been investigated for different layer thicknesses, dF1, of F1 and was found to decay with increasing dF1. The data is described by an empirical model and, moreover, by calculations using the microscopic theory.Conclusion: The long-range triplet component of superconducting pairing is generated from the singlet component mainly at the N/F2 interface, where the amplitude of the singlet component is suppressed exponentially with increasing distance dF1. The decay length of the empirical model is found to be comparable to twice the electron mean free path of F1 and, thus, to the decay length of the singlet component in F1. Moreover, the obtained data is in qualitative agreement with the microscopic theory, which, however, predicts a (not investigated breakdown of the

  19. Selective Preference of Parallel DNA Triplexes Is Due to the Disruption of Hoogsteen Hydrogen Bonds Caused by the Severe Nonisostericity between the G*GC and T*AT Triplets.

    Directory of Open Access Journals (Sweden)

    Gunaseelan Goldsmith

    Full Text Available Implications of DNA, RNA and RNA.DNA hybrid triplexes in diverse biological functions, diseases and therapeutic applications call for a thorough understanding of their structure-function relationships. Despite exhaustive studies mechanistic rationale for the discriminatory preference of parallel DNA triplexes with G*GC & T*AT triplets still remains elusive. Here, we show that the highest nonisostericity between the G*GC & T*AT triplets imposes extensive stereochemical rearrangements contributing to context dependent triplex destabilisation through selective disruption of Hoogsteen scheme of hydrogen bonds. MD simulations of nineteen DNA triplexes with an assortment of sequence milieu reveal for the first time fresh insights into the nature and extent of destabilization from a single (non-overlapping, double (overlapping and multiple pairs of nonisosteric base triplets (NIBTs. It is found that a solitary pair of NIBTs, feasible either at a G*GC/T*AT or T*AT/G*GC triplex junction, does not impinge significantly on triplex stability. But two overlapping pairs of NIBTs resulting from either a T*AT or a G*GC interruption disrupt Hoogsteen pair to a noncanonical mismatch destabilizing the triplex by ~10 to 14 kcal/mol, implying that their frequent incidence in multiples, especially, in short sequences could even hinder triplex formation. The results provide (i an unambiguous and generalised mechanistic rationale for the discriminatory trait of parallel triplexes, including those studied experimentally (ii clarity for the prevalence of antiparallel triplexes and (iii comprehensive perspectives on the sequence dependent influence of nonisosteric base triplets useful in the rational design of TFO's against potential triplex target sites.

  20. Excitation of the W triplet Delta (U), W singlet Delta (U), B prime triplet Sigma (U) (minus), and A prime singlet Epsison (U) (minus) states of N2 by electron impact

    Science.gov (United States)

    Cartwright, D. C.; Chutjian, A.; Trajmar, S.

    1973-01-01

    Electron energy-loss spectra have been obtained for N2 at 20.6 eV impact energy, and scattering angles of 10-138 deg. The differential cross section for excitation of the W triplet Delta(U) state is the largest triplet-state cross section at all scattering angles, and is the largest inelastic cross section at angles greater than 70 degrees. (Author Modified Abstract)

  1. Triplet fraction buildup effect of the DNA-YOYO complex studied with fluorescence correlation spectroscopy.

    Science.gov (United States)

    Shimizu, Masafumi; Sasaki, Satoshi; Kinjo, Masataka

    2007-07-01

    DNA fragments of various lengths and YOYO-1 iodide (YOYO) were mixed at various ratios, and fluorescence was measured using fluorescence correlation spectroscopy. The number of substantially emitting YOYO molecules binding to the DNA and the binding intervals between the YOYO molecules were estimated for DNA-YOYO complexes of various lengths. In the present study, we found an interesting phenomenon: triplet buildup. Because fluorophores that fall into the triplet state do not emit fluorescence, a part of the dark period can be recovered by emitting photons from other excited YOYO molecules in the same DNA strings in the confocal elements. The remaining dark period can be considered to be the total miss-emission rate. Estimates of the total miss-emission rate are important for calculation of the length and amount of DNA.

  2. The vector resonance triplet with the direct coupling to the third quark generation

    Energy Technology Data Exchange (ETDEWEB)

    Gintner, Mikulas [University of Zilina, Physics Department, Zilina (Slovakia); Czech Technical University in Prague, Institute of Experimental and Applied Physics, Prague (Czech Republic); Juran, Josef [Czech Technical University in Prague, Institute of Experimental and Applied Physics, Prague (Czech Republic); Silesian University in Opava, Institute of Physics, Opava (Czech Republic)

    2013-10-15

    The effective Lagrangian with scalar and vector resonances that might result from new strong physics beyond the SM is formulated and studied. In particular, the scalar resonance representing the recently discovered 125-GeV boson is complemented with the SU(2){sub L+R} triplet of hypothetical vector resonances. Motivated by experimental and theoretical considerations, the vector resonance is allowed to couple directly to the third quark generation only. The coupling is chiral-dependent and the interaction of the right top quark can differ from that of the right bottom quark. To estimate the applicability range of the effective Lagrangian the unitarity of the gauge boson scattering amplitudes is analyzed. The experimental fits and limits on the free parameters of the vector resonance triplet are investigated. (orig.)

  3. Photo-CIDNP of amino acids and proteins: effects of competition for flavin triplets

    Science.gov (United States)

    Winder, S. L.; Broadhurst, R. W.; Hore, P. J.

    1995-09-01

    The photo-CIDNP intensities of amino acid residues in proteins depend on the competition of the various exposed aromatic sidechains for photo-excited flavin triplets. The effects of this process on CIDNP enhancements are investigated using mixtures of the N-acetyl derivatives of histidine, tryptophan and tyrosine. Measurements for binary mixtures of the three amino acids are used to extract values for the relative rates of formation of radical pairs from triplet flavin mononucleotide (FMN). The concentration dependence of the CIDNP intensities of the three amino acids is interpreted by including the competition between degenerate hydrogen atom exchange and nuclear spin lattice relaxation in the free radicals derived from the amino acids. Finally, short peptides containing both tryptophan and tyrosine are investigated, to monitor possible proximity effects.

  4. Experimental triplet and quadruplet fluctuation densities and spatial distribution function integrals for liquid mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Ploetz, Elizabeth A.; Smith, Paul E. [Department of Chemistry, Kansas State University, 213 CBC Building, Manhattan, Kansas 66506 (United States)

    2015-03-07

    Kirkwood-Buff or Fluctuation Solution Theory can be used to provide experimental pair fluctuations, and/or integrals over the pair distribution functions, from experimental thermodynamic data on liquid mixtures. Here, this type of approach is used to provide triplet and quadruplet fluctuations, and the corresponding integrals over the triplet and quadruplet distribution functions, in a purely thermodynamic manner that avoids the use of structure factors. The approach is then applied to binary mixtures of water + methanol and benzene + methanol over the full composition range under ambient conditions. The observed correlations between the different species vary significantly with composition. The magnitude of the fluctuations and integrals appears to increase as the number of the most polar molecule involved in the fluctuation or integral also increases. A simple physical picture of the fluctuations is provided to help rationalize some of these variations.

  5. A solid state source of photon triplets based on quantum dot molecules.

    Science.gov (United States)

    Khoshnegar, Milad; Huber, Tobias; Predojević, Ana; Dalacu, Dan; Prilmüller, Maximilian; Lapointe, Jean; Wu, Xiaohua; Tamarat, Philippe; Lounis, Brahim; Poole, Philip; Weihs, Gregor; Majedi, Hamed

    2017-06-12

    Producing advanced quantum states of light is a priority in quantum information technologies. In this context, experimental realizations of multipartite photon states would enable improved tests of the foundations of quantum mechanics as well as implementations of complex quantum optical networks and protocols. It is favourable to directly generate these states using solid state systems, for simpler handling and the promise of reversible transfer of quantum information between stationary and flying qubits. Here we use the ground states of two optically active coupled quantum dots to directly produce photon triplets. The formation of a triexciton in these ground states leads to a triple cascade recombination and sequential emission of three photons with strong correlations. We record 65.62 photon triplets per minute under continuous-wave pumping, surpassing rates of earlier reported sources. Our structure and data pave the way towards implementing multipartite photon entanglement and multi-qubit readout schemes in solid state devices.

  6. A solid state source of photon triplets based on quantum dot molecules

    Science.gov (United States)

    Khoshnegar, Milad; Huber, Tobias; Predojević, Ana; Dalacu, Dan; Prilmüller, Maximilian; Lapointe, Jean; Wu, Xiaohua; Tamarat, Philippe; Lounis, Brahim; Poole, Philip; Weihs, Gregor; Majedi, Hamed

    2017-01-01

    Producing advanced quantum states of light is a priority in quantum information technologies. In this context, experimental realizations of multipartite photon states would enable improved tests of the foundations of quantum mechanics as well as implementations of complex quantum optical networks and protocols. It is favourable to directly generate these states using solid state systems, for simpler handling and the promise of reversible transfer of quantum information between stationary and flying qubits. Here we use the ground states of two optically active coupled quantum dots to directly produce photon triplets. The formation of a triexciton in these ground states leads to a triple cascade recombination and sequential emission of three photons with strong correlations. We record 65.62 photon triplets per minute under continuous-wave pumping, surpassing rates of earlier reported sources. Our structure and data pave the way towards implementing multipartite photon entanglement and multi-qubit readout schemes in solid state devices. PMID:28604705

  7. Spin-controlled superconductivity and tunable triplet correlations in graphene nanostructures.

    Science.gov (United States)

    Halterman, Klaus; Valls, Oriol T; Alidoust, Mohammad

    2013-07-26

    We study graphene ferromagnet/superconductor/ferromagnet (F/S/F) nanostructures via a microscopic self-consistent Dirac Bogoliubov-de Gennes formalism. We show that as a result of proximity effects, experimentally accessible spin switching phenomena can occur as one tunes the Fermi level μF of the F regions or varies the angle θ between exchange field orientations. Superconductivity can then be switched on and off by varying either θ or μF (a spin-controlled superconducting graphene switch). The induced equal-spin triplet correlations in S can be controlled by tuning μF, effectively making a graphene based two-dimensional spin-triplet valve.

  8. Triplet p-wave pairing correlation in low-doped zigzag graphene nanoribbons

    Science.gov (United States)

    Ma, Tianxing; Yang, Fan; Huang, Zhongbing; Lin, Hai-Qing

    2017-02-01

    We reveal an edge spin triplet p-wave superconducting pairing correlation in slightly doped zigzag graphene nanoribbons. By employing a method that combines random-phase approximation, the finite-temperature determinant quantum Monte Carlo approach, and the ground-state constrained-path quantum Monte Carlo method, it is shown that such a spin-triplet pairing is mediated by the ferromagnetic fluctuations caused by the flat band at the edge. The spin susceptibility and effective pairing interactions at the edge strongly increase as the on-site Coulomb interaction increases, indicating the importance of electron-electron correlations. It is also found that the doping-dependent ground-state p-wave pairing correlation bears some similarity to the famous superconducting dome in the phase diagram of a high-temperature superconductor, while the spin correlation at the edge is weakened as the system is doped away from half filling.

  9. Superfluid phases of triplet pairing and rapid cooling of the neutron star in Cassiopeia A

    Directory of Open Access Journals (Sweden)

    Lev B. Leinson

    2015-02-01

    Full Text Available In a simple model it is demonstrated that the neutron star surface temperature evolution is sensitive to the phase state of the triplet superfluid condensate. A multicomponent triplet pairing of superfluid neutrons in the core of a neutron star with participation of several magnetic quantum numbers leads to neutrino energy losses exceeding the losses from the unicomponent pairing. A phase transition of the neutron condensate into the multicomponent state triggers more rapid cooling of superfluid core in neutron stars. This makes it possible to simulate an anomalously rapid cooling of neutron stars within the minimal cooling paradigm without employing any exotic scenarios suggested earlier for rapid cooling of isolated neutron star in Cassiopeia A.

  10. Triplet Vortex Lattice Solutions of the Bogoliubov-de Gennes Equation in a Square Lattice

    Science.gov (United States)

    Hori, Yoshiki; Goto, Akira; Ozaki, Masa-aki

    2006-09-01

    Various self-consistent triplet vortex lattice states are obtained for a two-dimensional extended Hubbard model with nearest-neighbor ferromagnetic exchange interaction in a uniform magnetic field. There are four types of triplet superconducting classes, axial, up-spin, planar, and bipolar state, with maximal magnetic translational symmetry for the magnetic flux φ = φ0/p2 in a square crystal lattice, where φ0 = hc/2e is the flux quantum and p is an integer. We diagonalize the mean-field Hamiltonian numerically with self-consistency conditions for each symmetry class, and obtain various meta-stable vortex lattice states. The temperature dependence of the free energy of these meta-stable states is compared.

  11. Does interchain stacking morphology contribute to the singlet-triplet interconversion dynamics in polymer heterojunctions?

    Energy Technology Data Exchange (ETDEWEB)

    Bittner, Eric R. [Department of Chemistry and Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States)], E-mail: bittner@uh.edu; Burghardt, Irene [Departement de Chimie, Ecole Normale Superieure, 24 rue Lhomond, F-75231 Paris cedex 05 (France); Friend, Richard H. [Cavendish Laboratory, Madingley Road, Cambridge CB3 0HE (United Kingdom)

    2009-02-23

    Time-dependent density functional theory (TD-DFT) is used to examine the effect of stacking in a model semiconducting polymer hetrojunction system consisting of two co-facially stacked oligomers. We find that the excited electronic states are highly sensitive to the alignment of the monomer units of the two chains. In the system we examined, the exchange energy is nearly identical to both the and band off-set at the heterojunction and to the exciton binding energy. Our results indicate that the triplet excitonic states are nearly degenerate with the singlet exciplex states opening the possibility for the interconversion of singlet and triplet electronic states at the heterojunction interface via spin-orbit coupling localized on the heteroatoms. Using Russell-Saunders theory, we estimate this interconversion rate to be approximately 700-800 ps, roughly a 5-10-fold increase compared to isolated organic polymer chains.

  12. A solid state source of photon triplets based on quantum dot molecules

    Science.gov (United States)

    Khoshnegar, Milad; Huber, Tobias; Predojević, Ana; Dalacu, Dan; Prilmüller, Maximilian; Lapointe, Jean; Wu, Xiaohua; Tamarat, Philippe; Lounis, Brahim; Poole, Philip; Weihs, Gregor; Majedi, Hamed

    2017-06-01

    Producing advanced quantum states of light is a priority in quantum information technologies. In this context, experimental realizations of multipartite photon states would enable improved tests of the foundations of quantum mechanics as well as implementations of complex quantum optical networks and protocols. It is favourable to directly generate these states using solid state systems, for simpler handling and the promise of reversible transfer of quantum information between stationary and flying qubits. Here we use the ground states of two optically active coupled quantum dots to directly produce photon triplets. The formation of a triexciton in these ground states leads to a triple cascade recombination and sequential emission of three photons with strong correlations. We record 65.62 photon triplets per minute under continuous-wave pumping, surpassing rates of earlier reported sources. Our structure and data pave the way towards implementing multipartite photon entanglement and multi-qubit readout schemes in solid state devices.

  13. Singlet-triplet annihilation limits exciton yield in poly(3-hexylthiophene)

    CERN Document Server

    Steiner, Florian; Lupton, John M

    2014-01-01

    Control of chain length and morphology in combination with single-molecule spectroscopy techniques provide a comprehensive photophysical picture of excited-state losses in the prototypical conjugated polymer poly(3-hexylthiophene) (P3HT). A universal self-quenching mechanism is revealed, based on singlet-triplet exciton annihilation, which accounts for the dramatic loss in fluorescence quantum yield of a single P3HT chain between its solution (unfolded) and bulk-like (folded) state. Triplet excitons fundamentally limit the fluorescence of organic photovoltaic materials, which impacts on the conversion of singlet excitons to separated charge carriers, decreasing the efficiency of energy harvesting at high excitation densities. Interexcitonic interactions are so effective that a single P3HT chain of >100 kDa weight behaves like a two-level system, exhibiting perfect photon-antibunching.

  14. Tunable odd-frequency triplet pairing states and skyrmion modes in chiral p-wave superconductor.

    Science.gov (United States)

    Lou, Yu-Feng; Wen, Lin; Zha, Guo-Qiao; Zhou, Shi-Ping

    2017-08-29

    Bogliubov-de Gennes equations are solved self-consistently to investigate the properties of bound states in chiral p-wave superconductive disks. It shows that either an s-wave or the mixed d- and s-wave state with odd-frequency and spin-triplet symmetry is induced at the vortex core, depending both on the chirality of the pairing states and on the vortex topology. It is also found that the odd-frequency triplet even parity (OTE) bound state can be manipulated with a local non-magnetic potential. Interestingly, with an appropriate potential amplitude, the zero-energy OTE bound state can be stabilized at a distance from the vortex core and from the local potential. Possible existences of the Majorana fermion modes are expected if the particle-hole symmetry property is applied to the zero-energy OTE bound state. Moreover, skyrmion modes with an integer topological charge have been found to exist.

  15. Red Light-Triggered CO Release from Mn2(CO)10Using Triplet Sensitization in Polymer Nonwoven Fabrics.

    Science.gov (United States)

    Askes, Sven H C; Reddy, G Upendar; Wyrwa, Ralf; Bonnet, Sylvestre; Schiller, Alexander

    2017-11-01

    Applicability of phototherapeutic CO-releasing molecules (photoCORMs) is limited because they are activated by harmful and poorly tissue-penetrating near-ultraviolet light. Here, a strategy is demonstrated to activate classical photoCORM Mn 2 (CO) 10 using red light (635 nm). By mixing in solution a triplet photosensitizer (PS) with the photoCORM and shining red light, energy transfer occurs from triplet excited-state 3 PS* to a photolabile triplet state of Mn 2 (CO) 10 , which, like under near-UV irradiation, led to complete release of carbonyls. Crucially, such "triplet-sensitized CO-release" occurred in solid-state materials: when PS and Mn 2 (CO) 10 were embedded in electrospun nonwoven fabrics, CO was liberated upon irradiation with low-intensity red light (≤36 mW 635 nm).

  16. Red Light-Triggered CO Release from Mn2(CO)10 Using Triplet Sensitization in Polymer Nonwoven Fabrics

    Science.gov (United States)

    2017-01-01

    Applicability of phototherapeutic CO-releasing molecules (photoCORMs) is limited because they are activated by harmful and poorly tissue-penetrating near-ultraviolet light. Here, a strategy is demonstrated to activate classical photoCORM Mn2(CO)10 using red light (635 nm). By mixing in solution a triplet photosensitizer (PS) with the photoCORM and shining red light, energy transfer occurs from triplet excited-state 3PS* to a photolabile triplet state of Mn2(CO)10, which, like under near-UV irradiation, led to complete release of carbonyls. Crucially, such “triplet-sensitized CO-release” occurred in solid-state materials: when PS and Mn2(CO)10 were embedded in electrospun nonwoven fabrics, CO was liberated upon irradiation with low-intensity red light (≤36 mW 635 nm). PMID:28969423

  17. The gut microbiota composition in dichorionic triplet sets suggests a role for host genetic factors.

    Science.gov (United States)

    Murphy, Kiera; O' Shea, Carol Anne; Ryan, C Anthony; Dempsey, Eugene M; O' Toole, Paul W; Stanton, Catherine; Ross, R Paul

    2015-01-01

    Monozygotic and dizygotic twin studies investigating the relative roles of host genetics and environmental factors in shaping gut microbiota composition have produced conflicting results. In this study, we investigated the gut microbiota composition of a healthy dichorionic triplet set. The dichorionic triplet set contained a pair of monozygotic twins and a fraternal sibling, with similar pre- and post-natal environmental conditions including feeding regime. V4 16S rRNA and rpoB amplicon pyrosequencing was employed to investigate microbiota composition, and the species and strain diversity of the culturable bifidobacterial population was also examined. At month 1, the monozygotic pair shared a similar microbiota distinct to the fraternal sibling. By month 12 however, the profile was more uniform between the three infants. Principal coordinate analysis (PCoA) of the microbiota composition revealed strong clustering of the monozygotic pair at month 1 and a separation of the fraternal infant. At months 2 and 3 the phylogenetic distance between the monozygotic pair and the fraternal sibling has greatly reduced and by month 12 the monozygotic pair no longer clustered separately from the fraternal infant. Pulse field gel electrophoresis (PFGE) analysis of the bifidobacterial population revealed a lack of strain diversity, with identical strains identified in all three infants at month 1 and 12. The microbiota of two antibiotic-treated dichorionic triplet sets was also investigated. Not surprisingly, in both triplet sets early life antibiotic administration appeared to be a major determinant of microbiota composition at month 1, irrespective of zygosity. By month 12, early antibiotic administration appeared to no longer exert such a strong influence on gut microbiota composition. We hypothesize that initially host genetics play a significant role in the composition of an individual's gut microbiota, unless an antibiotic intervention is given, but by month 12 environmental

  18. Complex bilateral polysyndactyly featuring a triplet of delta phalanges in a syndactylised digit

    Energy Technology Data Exchange (ETDEWEB)

    Calif, Edward [Department of Orthopaedics A, Rambam Medical Center, P.O.B. 9602, 31096 Haifa (Israel); Stahl, Shalom [Hand Surgery Unit, Rambam Medical Center, P.O.B. 9602, 31096 Haifa (Israel)

    2002-07-01

    The delta phalanx is a rare congenital skeletal anomaly. An abnormal C-shaped epiphysis is usually responsible for a progressive angular digital deformity observed either in hands or feet. Solitary delta phalanges are usually described. We report a case of bilateral congenital hand malformations featuring a triplet of delta phalanges affecting a single digit on one hand, together with a concealed central polydactyly on the other. (orig.)

  19. Inhibition of endogenous heat shock protein 70 attenuates inducible nitric oxide synthase induction via disruption of heat shock protein 70/Na(+) /H(+) exchanger 1-Ca(2+) -calcium-calmodulin-dependent protein kinase II/transforming growth factor β-activated kinase 1-nuclear factor-κB signals in BV-2 microglia.

    Science.gov (United States)

    Huang, Chao; Lu, Xu; Wang, Jia; Tong, Lijuan; Jiang, Bo; Zhang, Wei

    2015-08-01

    Inducible nitric oxide synthase (iNOS) critically contributes to inflammation and host defense. The inhibition of heat shock protein 70 (Hsp70) prevents iNOS induction in lipopolysaccharide (LPS)-stimulated macrophages. However, the role and mechanism of endogenous Hsp70 in iNOS induction in microglia remains unclear. This study addresses this issue in BV-2 microglia, showing that Hsp70 inhibition or knockdown prevents LPS-induced iNOS protein expression and nitric oxide production. Real-time PCR experiments showed that LPS-induced iNOS mRNA transcription was blocked by Hsp70 inhibition. Further studies revealed that the inhibition of Hsp70 attenuated LPS-stimulated nuclear translocation and phosphorylation of nuclear factor (NF)-κB as well as the degradation of inhibitor of κB (IκB)-α and phosphorylation of IκB kinase β (IKKβ). This prevention effect of Hsp70 inhibition on IKKβ-NF-κB activation was found to be dependent on the Ca(2+) /calcium-calmodulin-dependent protein kinase II (CaMKII)/transforming growth factor β-activated kinase 1 (TAK1) signals based on the following observations: 1) chelation of intracellular Ca(2+) or inhibition of CaMKII reduced LPS-induced increases in TAK1 phosphorylation and 2) Hsp70 inhibition reduced LPS-induced increases in CaMKII/TAK1 phosphorylation, intracellular pH value, [Ca(2+) ]i , and CaMKII/TAK1 association. Mechanistic studies showed that Hsp70 inhibition disrupted the association between Hsp70 and Na(+) /H(+) exchanger 1 (NHE1), which is an important exchanger responsible for Ca(2+) influx in LPS-stimulated cells. These studies demonstrate that the inhibition of endogenous Hsp70 attenuates the induction of iNOS, which likely occurs through the disruption of NHE1/Hsp70-Ca(2+) -CaMKII/TAK1-NF-κB signals in BV-2 microglia, providing further insight into the functions of Hsp70 in the CNS. © 2015 Wiley Periodicals, Inc.

  20. Feasibility analysis of searching for the Slichter triplet in superconducting gravimeter records

    Directory of Open Access Journals (Sweden)

    Wenbin Shen

    2015-09-01

    Full Text Available The search for the elusive Slichter triplet requires elaborate analysis of the elastic-gravitational mode characters and the non-stationary behavior of noisy time-series. A typical question is that it is difficult to characterize the excitations with attenuation by diffusion when their intensity is low compared to noise. Thus the theory for deriving the modes' frequencies is still controversial, and various scholars tried to search for the Slichter triplet in superconducting gravimeter (SG records, but failed. One of the main causes might be due to the inappropriate use of datasets. We present in this paper synthetic experiments on the selection of record length, sampling rate and number of SG records under the Global Geodynamics Project (GGP to detect the damped harmonic signals hidden in noises based on the optimal sequence estimation (OSE method. Moreover, our results show that the existing observation conditions arouse restrictions and it might be impossible to detect the Slichter triplet excited by single excitation source based on Fourier spectrum analysis. Thus we suggest a stacking way of combining several seismic events in the case that the excitation mechanism has so far been unclear.

  1. Strictly localised triplet dimers on one- and two-dimensional lattices

    Energy Technology Data Exchange (ETDEWEB)

    Jackson, S; Samson, J H, E-mail: s.jackson3@lboro.ac.uk, E-mail: j.h.samson@lboro.ac.uk [Department of Physics, Loughborough University, Loughborough, LE11 3TU (United Kingdom)

    2011-03-01

    Electrons may form inter-site pairs (dimers) by a number of mechanisms. For example, long-range (Froehlich) electron-phonon interactions and strong on-site Hubbard U allow formation of small light bipolarons in some lattices. We identify circumstances under which triplet dimers are strictly localised by interference in certain one- and two-dimensional lattices. We assume a U-V Hamiltonian with nearest- and next-nearest-neighbour hopping integrals t and t', large positive U and attractive nearest- and next-nearest-neighbour interactions V and V'. In the square ladder and some two-dimensional bilayers, if the dimer Hilbert space is restricted to nearest- and next-nearest-neighbour dimers, triplet dimers become strictly localised for certain values of these parameters. For example, in a square ladder with t' t and V' = V, all triplet bands become flat due to exact cancellation of hopping paths. We identify the localised eigenstates for all flat bands in each lattice. We show that many of the flat bands persist for arbitrary t/t' so long as other restrictions still apply.

  2. Weak three-dimensional mediators of two-dimensional triplet pairing

    Science.gov (United States)

    Kelly, Shane; Tsai, S.-W.

    2018-01-01

    Recent experiments demonstrate the ability to construct cold-atom mixtures with species-selective optical lattices. This allows for the possibility of a mixed-dimension system, where one fermionic atomic species is confined to a two-dimensional lattice, while another species is confined to a three-dimensional lattice that contains the two-dimensional one. We show that by tuning the density of an arbitrary number of three-dimensional atomic species, we can engineer an arbitrary, rotationally symmetric, density-density, effective interaction for the two-dimensional particles. This possibility allows for an effective interaction that favors triplet pairing for two-dimensional, SU(2 ) symmetric particles. Using a functional renormalization-group analysis for the two-dimensional particles, we derive and numerically confirm that the critical temperature for triplet pairing depends exponentially on the effective interaction strength. We then analyze how the stability of this phase is affected by the particle densities and the fine tuning of interaction parameters. We conclude by briefly discussing experimental considerations and the potential to study triplet-pairing physics, including Majorana fermions and spin textures, with cold atoms on optical lattices.

  3. Dichorionic triamniotic triplet pregnancy complicated by twin anemia polycythemia sequence: the place of fetal therapy.

    Science.gov (United States)

    Griersmith, Thérèse H; Fung, Alison M; Walker, Susan P

    2014-12-01

    Monochorionic twins as part of a high order multiple pregnancy can be an unintended consequence of the increasingly common practice of blastocyst transfer for couples requiring in vitro fertilisation (IVF) for infertility. Dichorionic triamniotic (DCTA) triplets is the most common presentation, and these pregnancies are particularly high risk because of the additional risks associated with monochorionicity. Surveillance for twin-to-twin transfusion syndrome, including twin anemia polycythemia sequence, may be more difficult, and any intervention to treat the monochorionic pair needs to balance the proposed benefits against the risks posed to the unaffected singleton. Counseling of families with DCTA triplets is therefore complex. Here, we report a case of DCTA triplets, where the pregnancy was complicated by threatened preterm labour, and twin anemia polycythemia sequence (TAPS) was later diagnosed at 28 weeks. The TAPS was managed with a single intraperitoneal transfusion, enabling safe prolongation of the pregnancy for over 2 weeks until recurrence of TAPS and preterm labour supervened. Postnatal TAPS was confirmed, and all three infants were later discharged home at term corrected age, and were normal at follow-up. This case highlights that in utero therapy has an important role in multiple pregnancies of mixed chorionicity, and can achieve safe prolongation of pregnancy at critical gestations.

  4. Energy deposition studies for the high-luminosity Large Hadron Collider inner triplet magnets

    Directory of Open Access Journals (Sweden)

    N. V. Mokhov

    2015-05-01

    Full Text Available A detailed model of the high-luminosity LHC inner triplet region with new large-aperture Nb_{3}Sn magnets, field maps, corrector packages, and segmented tungsten inner absorbers was built and implemented into the fluka and mars15 codes. Detailed simulations have been performed coherently with the codes on the impact of particle debris from the 14-TeV center-of-mass pp-collisions on the short- and long-term stability of the inner triplet magnets. After optimizing the absorber configuration, the peak power density averaged over the magnet inner cable width is found to be safely below the quench limit at the luminosity of 5×10^{34}  cm^{−2} s^{−1}. For the anticipated lifetime integrated luminosity of 3000  fb^{−1}, the peak dose calculated for the innermost magnet insulator ranges from 20 to 35 MGy, a figure close to the commonly accepted limit. Dynamic heat loads to the triplet magnet cold mass are calculated to evaluate the cryogenic capability. fluka and mars results on energy deposition are in very good agreement.

  5. Triplet excited fluoroquinolones as mediators for thymine cyclobutane dimer formation in DNA.

    Science.gov (United States)

    Lhiaubet-Vallet, Virginie; Cuquerella, M Consuelo; Castell, Jose V; Bosca, Francisco; Miranda, Miguel A

    2007-06-28

    A series of fluoroquinolones (FQs), including enoxacin (ENX), pefloxacin (PFX), norfloxacin (NFX), its N(4')-acetyl derivative (ANFX), ofloxacin (OFX), and rufloxacin (RFX) have been investigated to determine their potential as DNA photosensitizers via thymine cyclobutane dimer (TT) formation in DNA. At fluoroquinolone concentrations and light doses insufficient to produce direct single strand breaks, ENX, PFX, and NFX were able to produce TT dimers in DNA, revealed by enzymatic treatment with T4 endonuclease V. By contrast, ANFX, OFX, and RFX were inefficient in this assay. The absolute values of the triplet energies of ENX, PFX, NFX, ANFX, OFX, and RFX were estimated by means of laser flash photolysis, using flurbiprofen, 4-biphenylcarboxylic acid, and naproxen as energy acceptors. They were found to be 273, 269, 269, 265, 262, and 253 kJ/mol, respectively. Other triplet excited state properties of the FQs, including quantum yields and lifetimes, were also studied. All the results indicate that the threshold ET value required for a given compound to become a potential DNA photosensitizer via TT formation is in the range defined by the triplet energies of NFX and ANFX (265-269 kJ/mol). This provides the basis for an alert rule: any chemical (drugs, cosmetics, pesticides, etc.) with higher ET has to be considered with regard to its potential photogenotoxicity.

  6. Length-dependent CTG·CAG triplet-repeat expansion in myotonic dystrophy patient-derived induced pluripotent stem cells.

    Science.gov (United States)

    Du, Jintang; Campau, Erica; Soragni, Elisabetta; Jespersen, Christine; Gottesfeld, Joel M

    2013-12-20

    Myotonic dystrophy type 1 (DM1) is an inherited dominant muscular dystrophy caused by expanded CTG·CAG triplet repeats in the 3' untranslated region of the DMPK1 gene, which produces a toxic gain-of-function CUG RNA. It has been shown that the severity of disease symptoms, age of onset and progression are related to the length of the triplet repeats. However, the mechanism(s) of CTG·CAG triplet-repeat instability is not fully understood. Herein, induced pluripotent stem cells (iPSCs) were generated from DM1 and Huntington's disease patient fibroblasts. We isolated 41 iPSC clones from DM1 fibroblasts, all showing different CTG·CAG repeat lengths, thus demonstrating somatic instability within the initial fibroblast population. During propagation of the iPSCs, the repeats expanded in a manner analogous to the expansion seen in somatic cells from DM1 patients. The correlation between repeat length and expansion rate identified the interval between 57 and 126 repeats as being an important length threshold where expansion rates dramatically increased. Moreover, longer repeats showed faster triplet-repeat expansion. However, the overall tendency of triplet repeats to expand ceased on differentiation into differentiated embryoid body or neurospheres. The mismatch repair components MSH2, MSH3 and MSH6 were highly expressed in iPSCs compared with fibroblasts, and only occupied the DMPK1 gene harboring longer CTG·CAG triplet repeats. In addition, shRNA silencing of MSH2 impeded CTG·CAG triplet-repeat expansion. The information gained from these studies provides new insight into a general mechanism of triplet-repeat expansion in iPSCs.

  7. Prediction of plant promoters based on hexamers and random triplet pair analysis

    Directory of Open Access Journals (Sweden)

    Noman Nasimul

    2011-06-01

    Full Text Available Abstract Background With an increasing number of plant genome sequences, it has become important to develop a robust computational method for detecting plant promoters. Although a wide variety of programs are currently available, prediction accuracy of these still requires further improvement. The limitations of these methods can be addressed by selecting appropriate features for distinguishing promoters and non-promoters. Methods In this study, we proposed two feature selection approaches based on hexamer sequences: the Frequency Distribution Analyzed Feature Selection Algorithm (FDAFSA and the Random Triplet Pair Feature Selecting Genetic Algorithm (RTPFSGA. In FDAFSA, adjacent triplet-pairs (hexamer sequences were selected based on the difference in the frequency of hexamers between promoters and non-promoters. In RTPFSGA, random triplet-pairs (RTPs were selected by exploiting a genetic algorithm that distinguishes frequencies of non-adjacent triplet pairs between promoters and non-promoters. Then, a support vector machine (SVM, a nonlinear machine-learning algorithm, was used to classify promoters and non-promoters by combining these two feature selection approaches. We referred to this novel algorithm as PromoBot. Results Promoter sequences were collected from the PlantProm database. Non-promoter sequences were collected from plant mRNA, rRNA, and tRNA of PlantGDB and plant miRNA of miRBase. Then, in order to validate the proposed algorithm, we applied a 5-fold cross validation test. Training data sets were used to select features based on FDAFSA and RTPFSGA, and these features were used to train the SVM. We achieved 89% sensitivity and 86% specificity. Conclusions We compared our PromoBot algorithm to five other algorithms. It was found that the sensitivity and specificity of PromoBot performed well (or even better with the algorithms tested. These results show that the two proposed feature selection methods based on hexamer frequencies

  8. Breast-feeding and bottle-feeding of twins, triplets and higher order multiple births.

    Science.gov (United States)

    Yokoyama, Yoshie; Ooki, Syuichi

    2004-11-01

    This study was performed to determine the rates of breast-feeding and/or bottle-feeding in mothers of twins, triplets and higher order multiple births compared to those in mothers of singletons, and identify factors associated with decision as to breast-feed or bottle-feed. The subjects were 1,529 mothers of twins aged 6 months-6 years and 258 mothers of triplets and higher order multiple births (higher multiples) aged 6 months-6 years (234 mothers of triplets, 20 mothers of quadruplets, 4 mothers of quintuplets). Also, 1,300 subjects were recruited as a control group from mothers of singletons aged 6 months-6 years. Information regarding feeding methods, including exclusive breast-feeding, mixed-feeding and bottle-feeding with formula milk only, and duration of breast-feeding (in months) was collected. There were significantly higher rates of bottle-feeding in mothers of twins and higher multiples than in mothers of singletons. Duration of breast-feeding in mothers who chose exclusive breast-feeding or mixed-feeding for twins and higher multiples was significantly shorter than those for the singletons. The feeding methods for the twins or higher multiples were not associated with prematurity or low birth weight. However, after adjusting for each associated factor using logistic regression analysis, the decision to bottle-feed was significantly associated with non-cooperation of the husband in childrearing and degree of anxiety that mothers felt when informed of a multiple pregnancy. The odds ratio indicated that mothers who received no cooperation from the husband for childrearing were 1.83 times more likely to choose bottle-feeding as those who received cooperation. Further, the odds ratio indicated that mothers who felt greater anxiety when informed of a multiple pregnancy were 1.73 times more likely to choose bottle-feeding as those who did not feel much anxiety. This study found that establishment and continuation of breast-feeding for twins, triplets and

  9. Charge Carrier Generation Followed by Triplet State Formation, Annihilation, and Carrier Recreation in PBDTTT-C:PC 60 BM Photovoltaic Blends

    KAUST Repository

    Gehrig, Dominik W.

    2015-05-22

    Triplet state formation after photoexcitation of low-bandgap polymer:fullerene blends has recently been demonstrated, however, the precise mechanism and its impact on solar cell performance is still under debate. Here, we study exciton dissociation, charge carrier generation and triplet state formation in low-bandgap polymer PBDTTT-C:PC60BM bulk heterojunction photovoltaic blends by a combination of fs-µs broadband Vis-NIR transient absorption (TA) pump-probe spectroscopy and multivariate curve resolution (MCR) data analysis. We found sub-ps exciton dissociation and charge generation followed by sub-ns triplet state creation. The carrier dynamics and triplet state dynamics exhibited a very pronounced intensity dependence indicating non-geminate recombination of free carriers is the origin of triplet formation in these blends. Triplets were found to be the dominant state present on the nanosecond timescale. Surprisingly, the carrier population increased again on the ns-µs timescale. We attribute this to triplet-triplet annihilation and the formation of higher energy excited states that subsequently underwent charge transfer. This unique dip and recovery of the charge population is a clear indication that triplets are formed by non-geminate recombination, as such a kinetic is incompatible with a monomolecular triplet state formation process.

  10. The delicate bistability of CaMKII.

    Science.gov (United States)

    Michalski, P J

    2013-08-06

    Calcium/calmodulin-dependent protein kinase II (CaMKII) is a synaptic, autophosphorylating kinase that is essential for learning and memory. Previous models have suggested that CaMKII functions as a bistable switch that could be the molecular correlate of long-term memory, but experiments have failed to validate these predictions. These models involved significant approximations to overcome the combinatorial complexity inherent in a multisubunit, multistate system. Here, we develop a stochastic particle-based model of CaMKII activation and dynamics that overcomes combinatorial complexity without significant approximations. We report four major findings. First, the CaMKII model system is never bistable at resting calcium concentrations, which suggests that CaMKII activity does not function as the biochemical switch underlying long-term memory. Second, the steady-state activation curves are either laserlike or steplike. Both are characterized by a well-defined threshold for activation, which suggests that thresholding is a robust feature of this system. Third, transiently activated CaMKII can maintain its activity over the time course of many experiments, and such slow deactivation may account for the few reports of bistability in the literature. And fourth, under in vivo conditions, increases in phosphatase activity can increase CaMKII activity. This is a surprising and counterintuitive effect, as dephosphorylation is generally associated with CaMKII deactivation. Copyright © 2013 Biophysical Society. Published by Elsevier Inc. All rights reserved.

  11. Generation and behavior characterization of CaMKIIβ knockout mice.

    Directory of Open Access Journals (Sweden)

    Adam D Bachstetter

    Full Text Available The calcium/calmodulin-dependent protein kinase II (CaMKII is abundant in the brain, where it makes important contributions to synaptic organization and homeostasis, including playing an essential role in synaptic plasticity and memory. Four genes encode isoforms of CaMKII (α, β, δ, γ, with CaMKIIα and CaMKIIβ highly expressed in the brain. Decades of molecular and cellular research, as well as the use of a large number of CaMKIIα mutant mouse lines, have provided insight into the pivotal roles of CaMKIIα in brain plasticity and cognition. However, less is known about the CaMKIIβ isoform. We report the development and extensive behavioral and phenotypic characterization of a CaMKIIβ knockout (KO mouse. The CaMKIIβ KO mouse was found to be smaller at weaning, with an altered body mass composition. The CaMKIIβ KO mouse showed ataxia, impaired forelimb grip strength, and deficits in the rotorod, balance beam and running wheel tasks. Interestingly, the CaMKIIβ KO mouse exhibited reduced anxiety in the elevated plus maze and open field tests. The CaMKIIβ KO mouse also showed cognitive impairment in the novel object recognition task. Our results provide a comprehensive behavioral characterization of mice deficient in the β isoform of CaMKII. The neurologic phenotypes and the construction of the genotype suggest the utility of this KO mouse strain for future studies of CaMKIIβ in brain structure, function and development.

  12. An optical-near-IR study of a triplet of super star clusters in the starburst core of M82

    Energy Technology Data Exchange (ETDEWEB)

    Westmoquette, M. S. [European Southern Observatory, Karl-Schwarzschild-Str. 2, D-85748 Garching bei München (Germany); Bastian, N. [Excellence Cluster Universe, Boltzmannstrasse 2, D-85748 Garching bei München (Germany); Smith, L. J. [Space Telescope Science Institute and European Space Agency, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Seth, A. C. [University of Utah, Salt Lake City, UT 84112 (United States); Gallagher III, J. S.; Ryon, J. E. [Department of Astronomy, University of Wisconsin-Madison, 5534 Sterling, 475 North Charter Street, Madison, WI 53706 (United States); O' Connell, R. W. [Department of Astronomy, University of Virginia, P.O. Box 3818, Charlottesville, VA 22903 (United States); Silich, S.; Mayya, Y. D.; González, D. Rosa [Instituto Nacional de Astrofísica, Optica y Electronica, Luis Enrique Erro 1, Tonantzintla, C.P. 72840, Puebla (Mexico); Muñoz-Tuñón, C., E-mail: westmoquette@gmail.com [Instituto de Astrofísica de Canarias, C/vía Láctea s/n, E-38200 La Laguna, Tenerife (Spain)

    2014-07-10

    We present HST/STIS optical and Gemini/NIFS near-IR IFU spectroscopy and archival Hubble Space Telescope (HST) imaging of the triplet of super star clusters (A1, A2, and A3) in the core of the M82 starburst. Using model fits to the Space Telescope Imaging Spectrograph (STIS) spectra and the weakness of red supergiant CO absorption features (appearing at ∼6 Myr) in the NIFS H-band spectra, the ages of A2 and A3 are 4.5 ± 1.0 Myr. A1 has strong CO bands, consistent with our previously determined age of 6.4 ± 0.5 Myr. The photometric masses of the three clusters are 4-7 × 10{sup 5} M{sub ☉}, and their sizes are R{sub eff} = 159, 104, 59 mas (∼2.8, 1.8, 1.0 pc) for A1, A2, and A3. The STIS spectra yielded radial velocities of 320 ± 2, 330 ± 6, and 336 ± 5 km s{sup –1} for A1, A2, and A3, placing them at the eastern end of the x{sub 2} orbits of M82's bar. Clusters A2 and A3 are in high-density (800-1000 cm{sup –3}) environments, and like A1, are surrounded by compact H II regions. We suggest the winds from A2 and A3 have stalled, as in A1, due to the high ISM ambient pressure. We propose that the three clusters were formed in situ on the outer x{sub 2} orbits in regions of dense molecular gas subsequently ionized by the rapidly evolving starburst. The similar radial velocities of the three clusters and their small projected separation of ∼25 pc suggest that they may merge in the near future unless this is prevented by velocity shearing.

  13. Benchmarking singlet and triplet excitation energies of molecular semiconductors for singlet fission: Tuning the amount of HF exchange and adjusting local correlation to obtain accurate functionals for singlet-triplet gaps

    Science.gov (United States)

    Brückner, Charlotte; Engels, Bernd

    2017-01-01

    Vertical and adiabatic singlet and triplet excitation energies of molecular p-type semiconductors calculated with various DFT functionals and wave-function based approaches are benchmarked against MS-CASPT2/cc-pVTZ reference values. A special focus lies on the singlet-triplet gaps that are very important in the process of singlet fission. Singlet fission has the potential to boost device efficiencies of organic solar cells, but the scope of existing singlet-fission compounds is still limited. A computational prescreening of candidate molecules could enlarge it; yet it requires efficient methods accurately predicting singlet and triplet excitation energies. Different DFT formulations (Tamm-Dancoff approximation, linear response time-dependent DFT, Δ-SCF) and spin scaling schemes along with several ab initio methods (CC2, ADC(2)/MP2, CIS(D), CIS) are evaluated. While wave-function based methods yield rather reliable singlet-triplet gaps, many DFT functionals are shown to systematically underestimate triplet excitation energies. To gain insight, the impact of exact exchange and correlation is in detail addressed.

  14. Ultrafast Charge and Triplet State Formation in Diketopyrrolopyrrole Low Band Gap Polymer/Fullerene Blends: Influence of Nanoscale Morphology of Organic Photovoltaic Materials on Charge Recombination to the Triplet State

    Directory of Open Access Journals (Sweden)

    René M. Williams

    2017-01-01

    Full Text Available Femtosecond transient absorption spectroscopy of thin films of two types of morphologies of diketopyrrolopyrrole low band gap polymer/fullerene-adduct blends is presented and indicates triplet state formation by charge recombination, an important loss channel in organic photovoltaic materials. At low laser fluence (approaching solar intensity charge formation characterized by a 1350 nm band (in ~250 fs dominates in the two PDPP-PCBM blends with different nanoscale morphologies and these charges recombine to form a local polymer-based triplet state on the sub-ns timescale (in ~300 and ~900 ps indicated by an 1100 nm absorption band. The rate of triplet state formation is influenced by the morphology. The slower rate of charge recombination to the triplet state (in ~900 ps belongs to a morphology that results in a higher power conversion efficiency in the corresponding device. Nanoscale morphology not only influences interfacial area and conduction of holes and electrons but also influences the mechanism of intersystem crossing (ISC. We present a model that correlates morphology to the exchange integral and fast and slow mechanisms for ISC (SOCT-ISC and H-HFI-ISC. For the pristine polymer, a flat and unstructured singlet-singlet absorption spectrum (between 900 and 1400 nm and a very minor triplet state formation (5% are observed at low laser fluence.

  15. High-velocity blueshifted Fe II absorption in the dwarf star-forming galaxy PHL 293B: evidence for a wind driven supershell?

    Science.gov (United States)

    Terlevich, Roberto; Terlevich, Elena; Bosch, Guillermo; Díaz, Ángeles; Hägele, Guillermo; Cardaci, Mónica; Firpo, Verónica

    2014-12-01

    X-shooter and WHT-ISIS spectra of the star-forming galaxy PHL 293B also known as A2228-00 and SDSS J223036.79-000636.9 are presented in this paper. We find broad (FWHM = 1000 km s-1) and very broad (FWZI = 4000 km s-1) components in the Balmer lines, narrow absorption components in the Balmer series blueshifted by 800 km s-1, previously undetected Fe II multiplet (42) absorptions also blueshifted by 800 km s-1, IR Ca II triplet stellar absorptions consistent with [Fe/H] historical records, we found no optical variability at the 5σ level of 0.02 mag between 2005 and 2013 and no optical variability at the level of 0.1 mag for the past 24 yr. The lack of variability rules out transient phenomena like luminous blue variables or Type IIn supernovae as the origin of the blueshifted absorptions of H I and Fe II. The evidence points to either a young and dense expanding supershell or a stationary cooling wind, in both cases driven by the young cluster wind.

  16. Hybrid spin and valley quantum computing with singlet-triplet qubits.

    Science.gov (United States)

    Rohling, Niklas; Russ, Maximilian; Burkard, Guido

    2014-10-24

    The valley degree of freedom in the electronic band structure of silicon, graphene, and other materials is often considered to be an obstacle for quantum computing (QC) based on electron spins in quantum dots. Here we show that control over the valley state opens new possibilities for quantum information processing. Combining qubits encoded in the singlet-triplet subspace of spin and valley states allows for universal QC using a universal two-qubit gate directly provided by the exchange interaction. We show how spin and valley qubits can be separated in order to allow for single-qubit rotations.

  17. Detection of forbidden Singlet-Triplet Transitions of 12C16O

    CSIR Research Space (South Africa)

    Steenkamp, CM

    2010-09-01

    Full Text Available -Triplet Transitions of 12C16O C.M. Steenkamp1, G.D. Dickenson1,2, A.C. Nortje1, E.G. Rohwer1, A. du Plessis1,3 1 Laser Research Institute, University of Stellenbosch, Stellenbosch, South Africa 2 Currently at Laser Centre Vrije Universiteit, Amsterdam....G. and Steenkamp, C.M. 2007, J. Mol. Spec. 243, 124. [4] Dickenson, G.D., Nortje, A., Steenkamp, C.M., Rohwer, E.G. and du Plessis, A. 2010, Astrophys. J. 714, L268. ...

  18. Benchmark calculations of low-lying triplet states of Be atom

    Science.gov (United States)

    Bubin, Sergiy

    Benchmark variational calculations of several lowest triplet states of the beryllium atom are reported. The wave functions of the states were expanded in terms of highly optimized explicitly correlated Gaussian basis sets and accurate energies are deterimed assuming finite nuclear mass of the atom. These wave functions were used to compute various expectation values, including those that appear in the leading relativistic and QED corrections. Density distributions and pair correlation functions are analyzed for both electrons an nucleus. This work has been supported by the Ministry of Education and Science of Kazakhstan.

  19. Desempenho comunicativo em trigêmeos prematuros Acquisition and development language in premature triplets

    Directory of Open Access Journals (Sweden)

    Amanda Tragueta Ferreira

    2008-03-01

    Full Text Available OBJETIVO: descrever habilidades do desenvolvimento de trigêmeos aos 18 meses e aos 29 meses de vida, enfocando a comunicação. MÉTODOS: irmãos trigêmeos dizigóticos do sexo masculino. Os procedimentos de avaliação englobaram: Anamnese, Observação do Comportamento Comunicativo e Escala de Desenvolvimento de Gesell e Amatruda (2000. As avaliações foram realizadas aos 18 e aos 29 meses. As crianças apresentaram atraso do desenvolvimento neuropsicomotor e eram expostas a multilingüismo. RESULTADOS: foi verificada alteração nos comportamentos comunicativos nas três crianças, tanto na primeira quanto na segunda avaliação, embora tenha sido observada melhora do desempenho, após as orientações recebidas pela família. Na segunda avaliação foi observada criptofasia. Dos comportamentos motor grosseiro, delicado, adaptativo, pessoal-social e de linguagem, o último foi o mais afetado para as três crianças, apesar de todos estarem alterados considerando a idade cronológica dos trigêmeos. CONCLUSÃO: as habilidades do desenvolvimento dos trigêmeos avaliados neste estudo estavam alteradas, acometendo todas as áreas. Ressalta-se maior comprometimento da linguagem tanto aos 18 como aos 29 meses.PURPOSE: to describe abilities of triplets' development by 18 months and the 29 months of life, focusing on communication. METHODS: dizygotic male sibling triplets. The evaluation procedures included history of disease, observing the communicative behavior and Escala de Desenvolvimento de Gesell e Amatruda (2000. The evaluations were accomplished by the 18 months and the 29 months. The children showed delay in the neuropshycomotor development and were exposed to multilingualism. RESULTS: alteration was verified in the communicative behaviors in the three children, both in the first as well as in the second evaluation, although an amelioration was shown in the performance, after the orientations received by the family. Cryptophasia was

  20. Quenching behaviour of quadrupole model magnets for the LHC inner triplets at Fermilab

    CERN Document Server

    Andreev, N; Bauer, P; Bossert, R; Brandt, J; Chichili, D R; Carson, J; Di Marco, J; Fehér, S; Glass, H; Kerby, J S; Lamm, M J; Makarov, A A; Nobrega, A; Novitski, I; Ogitsu, T; Orris, D; Ozelis, J P; Rabehl, Roger Jon; Robotham, W; Sabbi, G L; Schlabach, P; Sylvester, C D; Strait, J B; Tartaglia, M; Tompkins, J C; Yadav, S; Zlobin, A V; Caspi, S; McInturff, A D; Scanlan, R M; Ghosh, A

    2000-01-01

    The US-LHC Accelerator Project is responsible for the design and production of inner triplet high gradient quadrupoles for installation in the LHC Interaction Region. The quadrupoles are required to deliver a nominal field gradient of 215 T/m in a 70 mm bore, and operate in superfluid helium. As part of the magnet development program, a series of 2 m model magnets have been built and tested at Fermilab, with each magnet being tested over several thermal cycles. This paper summarizes the quench performance and analysis of the model magnets tested, including quench training, and the ramp rate and temperature of the magnet quench current. (7 refs).

  1. Fundamental fermion masses from deformed SU{sub q}(2) triplets

    Energy Technology Data Exchange (ETDEWEB)

    Palladino, B.E.; Ferreira, P.L. [Instituto de Fisica Teorica (IFT), Sao Paulo, SP (Brazil)

    1996-10-01

    A spectrum generating q-algebra, within the framework of SU{sub q}(2), is studied in order to describe the mass spectrum of three generations of quarks and leptons. The SU{sub q}(2) quantum group is a q-deformed extension of SU(2), where q=exp{alpha} (with {alpha} real) is the deformation parameter. In this letter, the essential use of inequivalent representations of SU{sub q}(2) is introduced. A formula for the fermion masses is derived. As an example, a possible scheme which corresponds to two triplets associated to up and down quarks is presented here in some detail. 19 refs., 3 tabs.

  2. Twin fetuses papyraeci in a spontaneous triplet pregnancy presenting with unexplained preterm contractions.

    Science.gov (United States)

    Bukar, M; Chama, Cm; Bako, Bg; Jonathan, Bi

    2013-11-01

    Fetus papyracie in a triplet pregnancy is indeed rare and can pose serious management challenges. These challenges are more pronounced where facilities for monitoring are either inadequate or nonexistent. A 39-year-old, grand multipara multipara was referred to the University of Maiduguri Teaching Hospital at 27 weeks gestation with preterm contractions. Materno fetal monitoring did not reveal the cause of the preterm contractions. She was delivered via caesarean section, at 36 weeks of gestation, on account of decreased fetal movement and the products were a live female fetus weighing 2.3 kg and two male papyraceous fetuses weighing 150 g and 130 g, respectively.

  3. Heavy Higgs boson production at colliders in the singlet-triplet scotogenic dark matter model

    Science.gov (United States)

    Díaz, Marco Aurelio; Rojas, Nicolás; Urrutia-Quiroga, Sebastián; Valle, José W. F.

    2017-08-01

    We consider the possibility that the dark matter particle is a scalar WIMP messenger associated to neutrino mass generation, made stable by the same symmetry responsible for the radiative origin of neutrino mass. We focus on some of the implications of this proposal as realized within the singlet-triplet scotogenic dark matter model. We identify parameter sets consistent both with neutrino mass and the observed dark matter abundance. Finally we characterize the expected phenomenological profile of heavy Higgs boson physics at the LHC as well as at future linear Colliders.

  4. Finite-bias conductance anomalies at a singlet-triplet crossing

    DEFF Research Database (Denmark)

    Stevanato, Chiara; Leijnse, Martin Christian; Flensberg, Karsten

    2012-01-01

    Quantum dots and single-molecule transistors may exhibit level crossings induced by tuning external parameters such as magnetic eld or gate voltage. For Coulomb blockaded devices, this shows up as an inelastic cotunneling threshold in the dierential conductance, which can be tuned to zero...... at the crossing. Here we show that, in addition, level crossings can give rise to a nearly vertical step-edge, ridge or even a Fano-like ridge-valley feature in the dierential conductance inside the relevant Coulomb diamond. We study a gate-tunable quasidegeneracy between singlet and triplet ground states...

  5. Electron impact induced allowed transitions between triplet states of H2

    OpenAIRE

    Laricciuta, A.; Celiberto, R.; Janev, R. K.

    2004-01-01

    Electron-impact-induced excitation and dissociation processes between the excited triplet states a (3)Sigma(g)(+)-->d (3)Pi(u), c (3)Pi(u)-->h (3)Sigma(g)(+), and c (3)Pi(u)-->g (3)Sigma(g)(+) of molecular hydrogen are studied by using the impact-parameter method. The cross sections for nu(i)-nu(f) resolved vibronic transitions between states have been calculated in the energy range from threshold to 100 eV; their maxima being located in the region of 5-10 eV. A special treatment was required...

  6. Discovery of an extremely gas rich dwarf triplet near the centre of the Lynx-Cancer void

    Science.gov (United States)

    Chengalur, J. N.; Pustilnik, S. A.

    2013-01-01

    The Giant Metrewave Radio Telescope (GMRT) H i observations, done as part of an ongoing study of dwarf galaxies in the Lynx-Cancer void, resulted in the discovery of a triplet of extremely gas rich galaxies located near the centre of the void. The triplet members SDSS J0723+3621, SDSS J0723+3622 and SDSS J0723+3624 have absolute magnitudes MB of -14.2, -11.9 and -9.7 and M(H i)/LB of ˜2.9, ˜10 and ˜25, respectively. The gas mass fractions, as derived from the Sloan Digital Sky Survey (SDSS) photometry and the GMRT data, are 0.93, 0.997 and 0.997, respectively. The faintest member of this triplet, SDSS J0723+3624, is one of the most gas rich galaxies known. We find that all three galaxies deviate significantly from the Tully-Fisher relation, but follow the baryonic Tully-Fisher relation. All three galaxies also have a baryon fraction that is significantly smaller than the cosmic baryon fraction. For the largest galaxy in the triplet, this is in contradiction to numerical simulations. The discovery of this very unique dwarf triplet lends further support to the idea that the void environment is conducive to the formation of galaxies with unusual properties. These observations provide further motivation to do deep searches of voids for a `hidden' very gas rich galaxy population with MB ≳ -11.

  7. An electron spin polarization study of the interaction of photoexcited triplet molecules with mono- and polynitroxyl stable free radicals

    Energy Technology Data Exchange (ETDEWEB)

    Turro, N.J.; Khudyakov, I.V.; Bossmann, S.H. (Columbia Univ., New York, NY (United States)); Dwyer, D.W. (State Univ. of New York, Brockport (United States))

    1993-02-11

    Time-resolved electron spin resonance (TR ESR) has been used to investigate the chemically induced dynamic electron polarization (CIDEP) generated by the interaction of stable free radicals with the triplet states of benzophenone, benzil, and 2-acetylnaphthalene. The stable radicals were mono-, di-, tri-, and tetranitroxyl free radicals possessing the 2,2,6,6-tetramethylpiperidine-N-oxyl moiety. All of the stable radical systems investigated were found to be emissively polarized by interaction with the triplet states, and the phase of polarization was independent of the sign of zero-field splitting (D) of the interacting triple molecule. Possible and likely mechanisms of polarization transfer (creation) resulting from the interaction of photoexcited triplet molecules with nitroxyls in the strong electron exchange are discussed. The emissive CIDEP of nitroxyls observed in the interactions with triplet benzil, which has D > 0, provides strong support for the operation of the radical-triplet pair mechanism. Within the time scale of TR ESR experiments ([approximately]10[sup [minus]7]--10[sup [minus]6] s) no significant variation in the shape of the CIDEP spectra of the nitroxyls was observed, either in viscous media or in micelles. It is concluded that intramolecular spin exchange (or conformational change) of polynitroyls occurs much faster than the time resolution of the experiment. 24 refs., 6 figs., 1 tab.

  8. Time-Resolved Electron Paramagnetic Resonance and Theoretical Investigations of Metal-Free Room-Temperature Triplet Emitters.

    Science.gov (United States)

    Matsuoka, Hideto; Retegan, Marius; Schmitt, Lisa; Höger, Sigurd; Neese, Frank; Schiemann, Olav

    2017-09-20

    Utilization of triplets is important for preparing organic light-emitting diodes with high efficiency. Very recently, both electrophosphorescence and electrofluorescence could be observed at room temperature for thienyl-substituted phenazines without any heavy metals ( Ratzke et al. J. Phys. Chem. Lett. , 2016 , 7 , 4802 ). It was found that the phosphorescence efficiency depends on the orientation of fused thiophenes. In this work, the thienyl-substituted phenazines are investigated in more detail by time-resolved electron paramagnetic resonance (EPR) and quantum chemical calculations. Spin dynamics, zero-field splitting constants, and electron-spin structures of the excited triplet states for the metal-free room-temperature triplet emitters are correlated with phosphorescence efficiency. Complete active space self-consistent field (CASSCF) calculations clearly show that the electron spin density distributions of the first excited triplet states are strongly affected by the molecular geometry. For the phosphorescent molecules, the electron spins are localized on the phenazine unit, in which the sulfur atom of the fused thiophene points upward. The electron spins are delocalized onto the thiophene unit just by changing the orientation of the fused thiophenes from upward to downward, resulting in the suppression of phosphorescence. Time-resolved EPR measurements and time-dependent density functional theory (TD-DFT) calculations demonstrate that the electron spins delocalized onto the thiophene unit lead to the acceleration of nonradiative decays, in conjunction with the narrowing of the singlet-triplet energy gap.

  9. Study of self-compensation of random field errors in low-/β insertion triplets of hadron colliders

    Science.gov (United States)

    Shi, Jicong

    1999-06-01

    The presence of unavoidable field errors in superconducting low-β insertion triplets is one of the major causes for limiting the dynamic aperture of colliders during collisions. Sorting of quadrupoles of the triplets, in which the quadrupoles are installed in the ring according to a certain sequence based on the measured multipole errors, is a way to reduce the adverse effects of random field errors without an increase in the cost. Because of a very small phase advance within each triplet, significant self-compensation of random field errors of the triplet can be achieved even with sorting of a small number of quadrupoles. A study on low-β insertion triplets of the LHC interaction regions show that sorting of the quadrupoles with the vector sorting scheme is quite effective in enlargement of the dynamic aperture and improvement of the linearity of the phase-space region occupied by beams. Since the sorting scheme is based entirely on the local compensation of random errors, the effectiveness of the sorting is independent of the operational condition of the collider.

  10. Triplet-State Dissolved Organic Matter Quantum Yields and Lifetimes from Direct Observation of Aromatic Amine Oxidation.

    Science.gov (United States)

    Schmitt, Markus; Erickson, Paul R; McNeill, Kristopher

    2017-11-21

    Excited triplet state chromophoric dissolved organic matter (3CDOM*) is a short-lived mixture of excited-state species that plays important roles in aquatic photochemical processes. Unlike the study of the triplet states of well-defined molecules, which are amenable to transient absorbance spectroscopy, the study of 3CDOM* is hampered by it being a complex mixture and its low average intersystem crossing quantum yield (ΦISC). This study is an alternative approach to investigating 3CDOM* using transient absorption laser spectroscopy. The radical cation of N,N,N',N'-tetramethyl-p-phenylenediamine (TMPD), formed through oxidation by 3CDOM*, was directly observable by transient absorption spectroscopy and was used to probe basic photophysical properties of 3CDOM*. Quenching and control experiments verified that TMPD•+ was formed from 3CDOM* under anoxic conditions. Model triplet sensitizers with a wide range of excited triplet state reduction potentials and CDOM oxidized TMPD at near diffusion-controlled rates. This gives support to the idea that a large cross-section of 3CDOM* moieties are able to oxidize TMPD and that the complex mixture of 3CDOM* can be simplified to a single signal. Using the TMPD•+ transient, the natural triplet lifetime and ΦISC for different DOM isolates and natural waters were quantified; values ranged from 12 to 26 μs and 4.1-7.8%, respectively.

  11. Field-induced transition from chiral spin-triplet to mixed-parity Fulde-Ferrell-Larkin-Ovchinnikov superconductivity

    Science.gov (United States)

    Romano, Alfonso; Cuoco, Mario; Noce, Canio; Gentile, Paola; Annunziata, Gaetano

    2010-02-01

    We analyze the response to a magnetic field of a two-dimensional spin-triplet superconductor with chiral order parameter when triplet pairing is closely competing with the singlet one. The study is performed via numerical solution of the Bogoliubov-de Gennes equations, assuming that the translational symmetry is broken in one direction by the presence of an interface beyond which superconducting pairing is not effective. We show that as the intensity of the magnetic field is increased above a threshold value, the system undergoes a transition to a spatially inhomogeneous state of the Fulde-Ferrell-Larkin-Ovchinnikov (FFLO) type where chirality disappears and a singlet-triplet mixing takes place along the direction perpendicular to the interface. Subdominant singlet components are found to accompany the triplet dominant ones in both phases. They develop close to the interface at low fields, then turning continuously into oscillating long-range ones as the field is increased. A similar behavior is found for the magnetization. It nucleates at the interface in the chiral phase, then acquiring in the FFLO phase an oscillatory behavior reaching its maximum amplitude at the sites where the dominant triplet component has a node. At these sites, the local spin-resolved density of states exhibits strong resonances, associated with the formation of Andreev bound states, which tend to broaden and decay in intensity as increasingly high magnetic fields are considered.

  12. [Two-year follow-up cohort studies on triplets: development of children and mother-child relationship].

    Science.gov (United States)

    Garel, M; Chavanne, E; Blondel, B

    1994-09-01

    The number of triplets births has increased during the last 15 years. The psychomotor development of triplets, problems concerning long-term relationships between the mother and her children and between the children themselves are still incompletely studied. Eleven families with triplets, consecutively born at the Clinique Baudelocque, were assessed at home for 2 years by the same psychologist. IQ was measured in each child at the age of 2 years using the Brunet-Lezine test. At this age, all mothers completed the Symptom-Check List allowing to assess eventual relationship difficulties between the mother and their children. The psychomotor development of the children (IQ = 100) was similar to the mean score in the general population. The mother reported great physical fatigue during the first year after birth and psychological difficulties during the second year. They mentioned behavioral problems and difficult relationships among the triplets. They complained of not being able to fulfill the children's demands. In four families, more severe difficulties, potentially damaging the psychological well-being of the children, required an intervention during the survey. Improved and prolonged help to families with triplets is necessary, requiring the participation of pediatricians, nurses, psychologists, social workers and specialized people.

  13. Quasi-Chemical Viscosity Model for Fully Liquid Slag in the Al2O3-CaO-MgO-SiO2 System. Part II: Evaluation of Slag Viscosities

    Science.gov (United States)

    Suzuki, Masanori; Jak, Evgueni

    2013-12-01

    A model is presented that enables viscosities to be predicted reliably over the whole range of compositions and temperatures in the Al2O3-CaO-MgO-SiO2 slag system above liquidus in the temperature range from 1543 K to 2643 K (1270 °C to 2370 °C). Experimental procedures and data from the studies reported in the literature have been collected and critically reviewed with particular attention to the viscometry methods and possible contamination of slag samples to select reliable data points for further model development. Relevant revised formalism to describe the complex viscosity trends including charge-compensation effect of the Ca2+ and Mg2+ cations on the formation of tetrahedrally coordinated Al3+ was introduced. Parameters of the quasi-chemical viscosity model have been optimized to reproduce within experimental uncertainties most of the selected experimental data in the Al2O3-CaO-MgO-SiO2 system and all subsystems. This study is part of the overall development of the self-consistent viscosity model of the Al2O3-CaO-FeO-Fe2O3- MgO-Na2O-SiO2 multicomponent slag system.

  14. Contribution of NMDA, GABAA and GABAB receptors and l-arginine-NO-cGMP, MEK1/2 and CaMK-II pathways in the antidepressant-like effect of 7-fluoro-1,3-diphenylisoquinoline-1-amine in mice.

    Science.gov (United States)

    Pesarico, Ana Paula; Stangherlin, Eluza Curte; Rosa, Suzan Gonçalves; Mantovani, Anderson C; Zeni, Gilson; Nogueira, Cristina Wayne

    2016-07-05

    It has been reported that the antidepressant-like effect of 7-fluoro-1,3-diphenylisoquinoline-1-amine (FDPI) may result from the modulation of brain monoaminergic systems. However, the mechanisms of FDPI action are not fully understood. The aim of this study was to investigate the contribution of N-methyl-d-aspartate (NMDA) and gamma-aminobutyric acid (GABA) systems as well as l-arginine-nitric oxide-(NO)-cyclic guanosine monophosphate-(cGMP), mitogen-activated protein/extracellular signal-regulated kinase (MEK1/2) and Ca(2+)/calmodulin-dependent protein kinase II (CaMK-II) signaling pathways in the antidepressant-like effect of FDPI in the mouse forced swimming test (FST). The levels of NO and uptake of [(3)H]glutamate and [(3)H]GABA were determined in prefrontal cortices of Swiss mice. Pretreatments with NMDA (0.1 pmol/site, i.c.v., a NMDA receptor agonist), bicuculline (1mg/kg, i.p., a GABAA receptor antagonist), phaclofen (2mg/kg, i.p., a GABAB receptor antagonist) and l-arginine (750mg/kg, i.p., a NO precursor), KN-62 (1μg/site, a CaMK-II inhibitor), U0126 (5μg/site, a MEK1/2 inhibitor) and PD09058 (5μg/site, a MEK1/2 inhibitor) blocked the antidepressant-like effect of FDPI, at a dose of 1mg/kg, in the FST. ODQ (30 pmol/site, i.c.v., a soluble guanylate cyclase (sGC) inhibitor) in combination with a sub-effective dose of FDPI (0.1mg/kg, i.g.) reduced the immobility time in the FST. The administration of FDPI (50mg/kg) to mice increased the glutamate uptake and reduced NO levels in the prefrontal cortex of mice. The results suggest a contribution of NMDA, GABAA and GABAB receptors and l-arginine-NO-cGMP pathway in the antidepressant-like action of FDPI in mice, and this effect is related to CaMK-II and MEK 1/2 activation. Copyright © 2016 Elsevier B.V. All rights reserved.

  15. Role of Ca++ in Shoot Gravitropism. [avena

    Science.gov (United States)

    Rayle, D. L.

    1985-01-01

    A cornerstone in the argument that Ca(2+) levels may regulate growth is the finding the EGTA promotes straight growth. The usual explanation for these results is that Ca(2+) chelation from cell walls results in wall loosening and thus accelerated straight growth. The ability of frozen-thawed Avena coleoptile tissue (subjected to 15g tension) to extend in response to EGTA and Quin II was examined. The EGTA when applied in weakly buffered (i.e., 0.1mM) neutral solutions initiates rapid extension. When the buffer strength is increased, similar concentrations of EGTA produce no growth response. This implies when EGTA liberated protons are released upon Ca(2+) chelation they can either initiate acid growth (low buffer conditions) or if consumed (high buffer conditions) have no effect. Thus Ca(2+) chelation in itself apparently does not result in straight growth.

  16. INTRACELLULAR Ca2+ HOMEOSTASIS

    Directory of Open Access Journals (Sweden)

    Shahdevi Nandar Kurniawan

    2015-01-01

    Full Text Available Ca2+ signaling functions to regulate many cellular processes. Dynamics of Ca2+ signaling or homeostasis is regulated by the interaction between ON and OFF reactions that control Ca2+ flux in both the plasma membrane and internal organelles such as the endoplasmic reticulum (ER and mitochondria. External stimuli activate the ON reactions, which include Ca2+ into the cytoplasm either through channels in the plasma membrane or from internal storage like in ER. Most of the cells utilize both channels/sources, butthere area few cells using an external or internal source to control certain processes. Most of the Ca2+ entering the cytoplasm adsorbed to the buffer, while a smaller part activate effect or to stimulate cellular processes. Reaction OFF is pumping of cytoplasmic Ca2+ using a combination mechanism of mitochondrial and others. Changes in Ca2+ signal has been detected in various tissues isolated from animals induced into diabetes as well as patients with diabetes. Ca2+ signal interference is also found in sensory neurons of experimental animals with diabetes. Ca2+ signaling is one of the main signaling systems in the cell.

  17. CaMKII in sinoatrial node physiology and dysfunction

    Science.gov (United States)

    Wu, Yuejin; Anderson, Mark E.

    2014-01-01

    The calcium and calmodulin-dependent protein kinase II (CaMKII) is present in sinoatrial node (SAN) pacemaker cells and is required for physiological “fight or flight” SAN beating rate responses. Inhibition of CaMKII in SAN does not affect baseline heart rate, but reduces heart rate increases in response to physiological stress. CaMKII senses intracellular calcium (Ca2+) changes, oxidation status, and hyperglycemia to phosphorylate substrates that regulate Ca2+-sensitive proteins, such as L-type Ca2+ channels, phospholamban, and cardiac ryanodine receptors (RyR2). All of these substrates are involved in the SAN pacemaking mechanism. Excessive CaMKII activity, as occurs under pathological conditions such as heart failure, ischemia, and diabetes, can promote intracellular Ca2+ overload and reactive oxygen species production. Oxidation of CaMKII (ox-CaMKII) locks CaMKII into a constitutively active configuration that contributes to SAN cell apoptosis and fibrosis. This ox-CaMKII-mediated loss of functional SAN cells contributes to SAN dysfunction (SND) and sudden death. Thus, CaMKII has emerged as a central regulator of physiological SAN responses and a key determinant of SND. PMID:24672485

  18. CaMKII in sinoatrial node physiology and dysfunction

    Directory of Open Access Journals (Sweden)

    Yuejin eWu

    2014-03-01

    Full Text Available The calcium and calmodulin dependent protein kinase II (CaMKII is present in sinoatrial node (SAN pacemaker cells and is required for physiological fight or flight SAN beating rate responses. Inhibition of CaMKII in SAN does not affect baseline heart rate, but reduces heart rate increases in response to physiological stress. CaMKII senses intracellular calcium (Ca2+ changes, oxidation status and hyperglycemia to phosphorylate substrates that regulate Ca2+-sensitive proteins, such as L-type Ca2+ channels, phospholamban (PLN, and cardiac ryanodine receptors (RyR2. All of these substrates are involved in the SAN pacemaking mechanism. Excessive CaMKII activity, as occurs under pathological conditions such as heart failure, ischemia and diabetes, can promote intracellular Ca2+ overload and reactive oxygen species (ROS production. Oxidation of CaMKII (ox-CaMKII locks CaMKII into a constitutively active configuration that contributes to SAN cell apoptosis and fibrosis. This ox-CaMKII-mediated loss of functional SAN cells contributes to sinoatrial node dysfunction (SND and sudden death. Thus, CaMKII has emerged as a central regulator of physiological SAN responses and a key determinant of SND.

  19. Vacuum stability and naturalness in type-II seesaw

    Energy Technology Data Exchange (ETDEWEB)

    Haba, Naoyuki; Ishida, Hiroyuki [Shimane University, Graduate School of Science and Engineering, Matsue (Japan); Okada, Nobuchika [University of Alabama, Department of Physics and Astronomy, Tuscaloosa, AL (United States); Yamaguchi, Yuya [Shimane University, Graduate School of Science and Engineering, Matsue (Japan); Hokkaido University, Department of Physics, Faculty of Science, Sapporo (Japan)

    2016-06-15

    We study the vacuum stability and perturbativity conditions in the minimal type-II seesaw model. These conditions give characteristic constraints to the model parameters. In the model, there is a SU(2){sub L} triplet scalar field, which could cause a large Higgs mass correction. From the naturalness point of view, heavy Higgs masses should be lower than 350 GeV, which may be testable by the LHC Run-II results. Due to the effects of the triplet scalar field, the branching ratios of the Higgs decay (h → γγ, Zγ) deviate from the standard model, and a large parameter region is excluded by the recent ATLAS and CMS combined analysis of h → γγ. Our result of the signal strength for h → γγ is R{sub γγ}

  20. Implications of a electroweak triplet scalar leptoquark on the ultra-high energy neutrino events at IceCube

    Energy Technology Data Exchange (ETDEWEB)

    Mileo, Nicolas [IFLP, CONICET - Departamento de Física, Universidad Nacional de La Plata,C.C. 67, 1900 La Plata (Argentina); Puente, Alejandro de la [Ottawa-Carleton Institute for Physics, Carleton University,1125 Colonel By Drive, Ottawa, Ontario K1S 5B6 (Canada); Szynkman, Alejandro [IFLP, CONICET - Departamento de Física, Universidad Nacional de La Plata,C.C. 67, 1900 La Plata (Argentina)

    2016-11-22

    We study the production of scalar leptoquarks at IceCube, in particular, a particle transforming as a triplet under the weak interaction. The existence of electroweak-triplet scalars is highly motivated by models of grand unification and also within radiative seesaw models for neutrino mass generation. In our framework, we extend the Standard Model by a single colored electroweak-triplet scalar leptoquark and analyze its implications on the excess of ultra-high energy neutrino events observed by the IceCube collaboration. We consider only couplings between the leptoquark to first generation of quarks and first and second generations of leptons, and carry out a statistical analysis to determine the parameters that best describe the IceCube data as well as set 95% CL upper bounds. We analyze whether this study is still consistent with most up-to-date LHC data and various low energy observables.

  1. TiO{2} rutile : un cristal prometteur pour la génération de triplets de photons

    Science.gov (United States)

    Gravier, F.; Boulanger, B.

    2006-10-01

    La génération de triplets de photons est une étape importante de la production de nouveaux états intriqués. La première génération de triplets de photons a été réalisée dans notre groupe en 2004 dans un cristal de KTP et l'étude des corrélations de ces photons devrait prochainement confirmer les études théoriques. Afin d'augmenter encore l'efficacité du processus de production de triplets, nous considérons actuellement le dioxyde de titane, TiO{2} dans sa phase rutile.

  2. A practical O(n log2 n) time algorithm for computing the triplet distance on binary trees

    DEFF Research Database (Denmark)

    Sand, Andreas; Pedersen, Christian Nørgaard Storm; Mailund, Thomas

    2013-01-01

    rooted binary trees in time O (n log2 n). The algorithm is related to an algorithm for computing the quartet distance between two unrooted binary trees in time O (n log n). While the quartet distance algorithm has a very severe overhead in the asymptotic time complexity that makes it impractical compared...... to O (n2) time algorithms, we show through experiments that the triplet distance algorithm can be implemented to give a competitive wall-time running time.......The triplet distance is a distance measure that compares two rooted trees on the same set of leaves by enumerating all sub-sets of three leaves and counting how often the induced topologies of the tree are equal or different. We present an algorithm that computes the triplet distance between two...

  3. Triplet formation in fullerene multi-adduct blends for organic solar cells and its influence on device performance

    Energy Technology Data Exchange (ETDEWEB)

    Dyer-Smith, Clare [Department of Physics, Imperial College London, Blackett Laboratory, Prince Consort Road, London SW7 2AZ (United Kingdom); Department of Chemistry, Imperial College London, South Kensington Campus, London, SW7 2AZ (United Kingdom); Grantham Institute for Climate Change, Imperial College London, South Kensington Campus, London, SW7 2AZ (United Kingdom); Reynolds, Luke X. [Department of Chemistry, Imperial College London, South Kensington Campus, London, SW7 2AZ (United Kingdom); Grantham Institute for Climate Change, Imperial College London, South Kensington Campus, London, SW7 2AZ (United Kingdom); Bruno, Annalisa; Haque, Saif A. [Department of Chemistry, Imperial College London, South Kensington Campus, London, SW7 2AZ (United Kingdom); Bradley, Donal D.C.; Nelson, Jenny [Department of Physics, Imperial College London, Blackett Laboratory, Prince Consort Road, London SW7 2AZ (United Kingdom)

    2010-08-23

    In organic solar cells, high open circuit voltages may be obtained by choosing materials with a high offset between the donor highest occupied molecular orbital (HOMO) and acceptor lowest unoccupied molecular orbital (LUMO). However, increasing this energy offset can also lead to photophysical processes that compete with charge separation. In this paper the formation of triplet states is addressed in blends of polyfluorene polymers with a series of PCBM multi-adducts. Specifically, it is demonstrated that the formation of such triplets occurs when the offset energy between donor ionization potential and acceptor electron affinity is {proportional_to}1.6 eV or greater. Spectroscopic measurements support a mechanism of resonance energy transfer for triplet formation, influenced by the energy levels of the materials, but also demonstrate that the competition between processes at the donor-acceptor interface is strongly influenced by morphology. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  4. Commissioning and First Operation of the Low-Beta Triplets and Their Electrical Feed Boxes at the Large Hadron Collider

    CERN Document Server

    Darve, C; Casas-Cubillos, J; Claudet, S; Feher, S; Ferlin, G; Kerby, J; Metral, L; Perin, A; Peterson, T; Prin, H; Rabehl, R; Vauthier, N; Wagner, U; van Weelderen, R

    2010-01-01

    The insertion regions located around the four interaction points of the Large Hadron Collider (LHC) are mainly composed of the low-b triplets, the separation dipoles and their respective electrical feed-boxes (DFBX). The low-b triplets are Nb-Ti superconductor quadrupole magnets, which operate at 215 T/m in superfluid helium at a temperature of 1.9 K. The commissioning and the first operation of these components have been performed. The thermo-mechanical behavior of the low-b triplets and DFBX were studied. Cooling and control systems were tuned to optimize the cryogenic operation of the insertion regions. Hardware commissioning also permitted to test the system response. This paper summarizes the performance results and the lessons learned.

  5. Third-order spontaneous parametric down-conversion in thin optical fibers as a photon-triplet source

    Energy Technology Data Exchange (ETDEWEB)

    Corona, Maria [Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, apdo. postal 70-543, DF 04510 Mexico City (Mexico); Departamento de Optica, Centro de Investigacion Cientifica y de Educacion Superior de Ensenada, Apartado Postal 2732, BC 22860 Ensenada (Mexico); Garay-Palmett, Karina; U' Ren, Alfred B. [Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, apdo. postal 70-543, DF 04510 Mexico City (Mexico)

    2011-09-15

    We study the third-order spontaneous parametric down-conversion (TOSPDC) process, as a means to generate entangled photon triplets. Specifically, we consider thin optical fibers as the nonlinear medium to be used as the basis for TOSPDC in configurations where phase matching is attained through the use of more than one fiber transverse modes. Our analysis in this paper, which follows from our earlier paper [Opt. Lett. 36, 190-192 (2011)], aims to supply experimentalists with the details required in order to design a TOSPDC photon-triplet source. Specifically, our analysis focuses on the photon triplet state, on the rate of emission, and on the TOSPDC phase-matching characteristics for the cases of frequency-degenerate and frequency nondegenerate TOSPDC.

  6. An alternative method for the calculation of joint probability distributions. Application to the expectation of the triplet invariant.

    Science.gov (United States)

    Brosius, J

    2015-01-01

    This paper presents a completely new method for the calculation of expectations (and thus joint probability distributions) of structure factors or phase invariants. As an example, a first approximation of the expectation of the triplet invariant (up to a constant) is given and a complex number is obtained. Instead of considering the atomic vector positions or reciprocal vectors as the fundamental random variables, the method samples over all functions (distributions) with a given number of atoms and given Patterson function. The aim of this paper was to explore the feasibility of the method, so the easiest problem was chosen: the calculation of the expectation value of the triplet invariant in P1. Calculation of the joint probability distribution of the triplet is not performed here but will be done in the future.

  7. Transport and noise properties of a normal metal-superconductor-normal metal junction with mixed singlet and chiral triplet pairings.

    Science.gov (United States)

    Paul, Ganesh C; Dutta, Paramita; Saha, Arijit

    2017-01-11

    We study transport and zero frequency shot noise properties of a normal metal-superconductor-normal metal (NSN) junction, with the superconductor having mixed singlet and chiral triplet pairings. We show that in the subgapped regime when the chiral triplet pairing amplitude dominates over that of the singlet, a resonance phenomena emerges out at zero energy where all the quantum mechanical scattering probabilities acquire a value of 0.25. At the resonance, crossed Andreev reflection mediating through such junction, acquires a zero energy peak. This reflects as a zero energy peak in the conductance as well depending on the doping concentration. We also investigate shot noise for this system and show that shot noise cross-correlation is negative in the subgapped regime when the triplet pairing dominates over the singlet one. The latter is in sharp contrast to the positive shot noise obtained when the singlet pairing is the dominating one.

  8. Dissociative dynamics of spin-triplet and spin-singlet O2 on Ag(100).

    Science.gov (United States)

    Alducin, M; Busnengo, H F; Díez Muiño, R

    2008-12-14

    We study the dissociative dynamics of O(2) molecules on the Ag(100) surface. Initially, the impinging molecules are either in the spin-triplet ground state or in the spin-singlet excited state. The molecule-surface interaction is obtained in each case by constructing the six-dimensional potential energy surface (PES) from the interpolation of the energies calculated with spin-polarized and non-spin-polarized density functional theories, respectively. Classical trajectory calculations performed in both PESs show that O(2) molecules initially in the spin-triplet ground state only dissociate for incidence energies above 1.05 eV. This result is consistent with molecular beam experiments performed in this system. Interestingly, our results also suggest that for the spin-singlet O(2) dissociation occurs even for incidence energies as low as 50 meV. We propose the use of spin-singlet excited O(2) molecules to improve the otherwise low dissociative reactivity of O(2) at clean Ag(100).

  9. Preliminary Design of the HiLumi-LHC Triplet Area Beam Screen

    CERN Document Server

    Kersevan, R; Kos, N

    2014-01-01

    The so-called beam screen (BS) is a proven solution for intercepting the thermal loads caused by the circulating beams in the cryogenically-cooled sections of the LHC and minimizing dynamic vacuum effects [1]. The new triplet area foreseen for the HiLumi-LHC (HL-LHC) machine upgrade [2] has the additional feature of needing internal tungsten shields to reduce the amount of collision debris which is deflected by the high-gradient triplet magnets towards the superconducting magnets' cold masses and coils. The very aggressive optics design, based on large beam separations, calls for a maximum of physical space to remain available to the counter rotating beams in the common BS. This places severe constraints to the fabrication and installation tolerances of the BS itself, in addition to affecting the design and routing of the cryogenic lines in the area. The latest version of the BS design will be shown and discussed, together with future plans for testing materials, fabrication procedures, and installation.

  10. DNA CTG triplet repeats involved in dynamic mutations of neurologically related gene sequences form stable duplexes

    Science.gov (United States)

    Smith, G. K.; Jie, J.; Fox, G. E.; Gao, X.

    1995-01-01

    DNA triplet repeats, 5'-d(CTG)n and 5'-d(CAG)n, are present in genes which have been implicated in several neurodegenerative disorders. To investigate possible stable structures formed by these repeating sequences, we have examined d(CTG)n, d(CAG)n and d(CTG).d(CAG)n (n = 2 and 3) using NMR and UV optical spectroscopy. These studies reveal that single stranded (CTG)n (n > 2) forms stable, antiparallel helical duplexes, while the single stranded (CAG)n requires at least three repeating units to form a duplex. NMR and UV melting experiments show that the Tm increases in the order of [(CAG)3]2 CTG)3]2 CTG)3. The (CTG)3 duplex is stable and exhibits similar NMR spectra in solutions containing 0.1-4 M NaCl and at a pH range from 4.6 to 8.8. The (CTG)3 duplex, which contains multiple-T.T mismatches, displays many NMR spectral characteristics similar to those of B-form DNA. However, unique NOE and 1H-31P coupling patterns associated with the repetitive T.T mismatches in the CTG repeats are discerned. These results, in conjunction with recent in vitro studies suggest that longer CTG repeats may form hairpin structures, which can potentially cause interruption in replication, leading to dynamic expansion or deletion of triplet repeats.

  11. Tuning between singlet, triplet, and mixed pairing states in an extended Hubbard chain

    Science.gov (United States)

    Sun, Kuei; Chiu, Ching-Kai; Hung, Hsiang-Hsuan; Wu, Jiansheng

    2014-03-01

    We study spin-half fermions in a one-dimensional extended Hubbard chain at low filling. We identify three triplet and one singlet pairing channels in the system, which are independently tunable as a function of nearest-neighbor charge and spin interactions. In a large-size system with translational invariance, we derive gap equations for the corresponding pairing gaps and obtain a Bogoliubov-de Gennes Hamiltonian with its nontrivial topology determined by the interplay of these gaps. In an open-end system with a fixed number of particles, we compute the exact many-body ground state and identify the dominant pairing revealed by the pair density matrix. Both cases show competition between the four pairing states, resulting in broad regions for each of them and relatively narrow regions for mixed-pairing states in the parameter space. Our results enable the possibility of tuning a nanowire between singlet and triplet pairing states without breaking time-reversal or SU(2) symmetry, accompanied by a change in the system's topology.

  12. Enhanced efficiency in single-host white organic light-emitting diode by triplet exciton conversion

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Qingyang, E-mail: wqy1527@163.com [State Key laboratory on Integrated Optoelectronics, College of Electronic Science and Engineering, Jilin University, Changchun 130012 (China); Zhang, Shiming [State Key laboratory on Integrated Optoelectronics, College of Electronic Science and Engineering, Jilin University, Changchun 130012 (China); Département of Chemical Engineering, École Polytechnique de Montréal, Montréal, Québec, Canada H3C3J7 (Canada); Yue, Shouzhen; Zhang, Zhensong [State Key laboratory on Integrated Optoelectronics, College of Electronic Science and Engineering, Jilin University, Changchun 130012 (China); Xie, Guohua [Institut für Angewandte Photophysik, Technische Universtität Dresden, Dresden 01062 (Germany); Zhao, Yi; Liu, Shiyong [State Key laboratory on Integrated Optoelectronics, College of Electronic Science and Engineering, Jilin University, Changchun 130012 (China)

    2013-11-15

    The authors observe that the external quantum efficiency (EQE) of the Iridium (III) bis(4-phenylthieno [3,2-c]pyridinato-N,C{sup 2′})acetylacetonate (PO-01) based yellow organic light-emitting diode (OLED) is significantly increased by uniformly co-doping Iridium (III)bis[(4,6-difluorophenyl)-pyridinato-N,C{sup 2−}] (FIrpic) and PO-01 into the same wide band-gap host of N,N{sup ′}-dicarbazolyl-3, 5-benzene (mCP). Detailed investigation indicates that the efficiency enhancement is ascribed to effective triplet exciton gathering by FIrpic, followed by energy transfer to PO-01. Compared to the control device, which has maximum EQE of 10.5%, an improved maximum EQE of 13.2% is obtained in the optimization white device based on FIrpic and PO-01 emission according to this principle. This work makes it easier for a single host white OLED to simultaneously harvest high efficiency in both blue and yellow units. Comprehensive experimental results show that this phenomenon can also be found and utilized in other popular hosts to realize more efficient white devices. -- Highlights: • This work makes easier for a single host white OLED to harvest high efficiency in both blue and yellow units. • Efficiency enhancement is ascribed to effective triplet exciton gathering by FIrpic, followed by energy transfer to PO-01. • This phenomenon can also be found and utilized in other popular hosts to realize more efficient white devices.

  13. Efficient phosphorescent polymer light-emitting diodes by suppressing triplet energy back transfer.

    Science.gov (United States)

    Gong, Shaolong; Yang, Chuluo; Qin, Jingui

    2012-07-21

    Phosphorescent polymer light-emitting diodes (PhPLEDs) are promising devices in flat panel displays and solid state lighting sources since they can combine the advantages of the high efficiency of electrophosphorescence and low-cost, large-scale manufacture by using a solution process. However, their efficiencies are generally much lower than those of small-molecule-based devices fabricated by using a thermal deposition approach. One of the major reasons for their low efficiency is that energy is lost by back transfer to a polymer host. This tutorial review gives a brief introduction to the fundamentals of PhPLEDs, and then highlights recent progress in the main approaches to suppress triplet energy back transfer from the phosphor to the polymer host towards realizing highly efficient PhPLEDs. The suppressing mechanisms are discussed, and the achievement of high device efficiencies are demonstrated. Emphasis is placed on the relationships between molecular structure, the extent of suppressing triplet energy back transfer, and device performance.

  14. First light - II. Emission line extinction, population III stars, and X-ray binaries

    Science.gov (United States)

    Barrow, Kirk S. S.; Wise, John H.; Aykutalp, Aycin; O'Shea, Brian W.; Norman, Michael L.; Xu, Hao

    2018-02-01

    We produce synthetic spectra and observations for metal-free stellar populations and high-mass X-ray binaries in the Renaissance Simulations at a redshift of 15. We extend our methodology from the first paper in the series by modelling the production and extinction of emission lines throughout a dusty and metal-enriched interstellar and circum-galactic media extracted from the simulation, using a Monte Carlo calculation. To capture the impact of high-energy photons, we include all frequencies from hard X-ray to far-infrared with enough frequency resolution to discern line emission and absorption profiles. The most common lines in our sample in order of their rate of occurrence are Ly α, the C IV λλ1548, 1551 doublet, H α, and the Ca II λλλ8498, 8542, 8662 triplet. The best scenario for a direct observation of a metal-free stellar population is a merger between two Population III Galaxies. In mergers between metal-enriched and metal-free stellar populations, some characteristics may be inferred indirectly. Single Population III galaxies are too dim to be observed photometrically at z = 15. Ly α emission is discernible by JWST as an increase in J200w - J277w colour off the intrinsic stellar tracks. Observations of metal-free stars will be difficult, though not impossible, with the next generation of space telescopes.

  15. Experimental confirmation of photon-induced spin-flip transitions in helium via triplet metastable yield spectra

    Science.gov (United States)

    Rubensson, Jan-Erik; Moise, Angelica; Mihelič, Andrej; Bučar, Klemen; Žitnik, Matjaž; Richter, Robert

    2010-06-01

    Doubly excited states below the N=2 ionization threshold are populated by exciting helium atoms in a supersonic beam with monochromatized synchrotron radiation. The fluorescence decay of these states triggers a radiative cascade back to the ground state with large probability to populate long lived singlet and triplet helium metastable states. The yield of metastables is measured using a multichannel plate detector after the beam has passed a singlet-quenching discharge lamp. The variation of the yield observed with the lamp switched on or off is related to the triplet-singlet mixing of the doubly excited states.

  16. Induced spin-triplet pairing in the coexistence state of antiferromagnetism and singlet superconductivity: Collective modes and microscopic properties

    Science.gov (United States)

    Almeida, D. E.; Fernandes, R. M.; Miranda, E.

    2017-07-01

    The close interplay between superconductivity and antiferromagnetism in several quantum materials can lead to the appearance of an unusual thermodynamic state in which both orders coexist microscopically, despite their competing nature. A hallmark of this coexistence state is the emergence of a spin-triplet superconducting gap component, called a π triplet, which is spatially modulated by the antiferromagnetic wave vector, reminiscent of a pair density wave. In this paper, we investigate the impact of these π -triplet degrees of freedom on the phase diagram of a system with competing antiferromagnetic and superconducting orders. Although we focus on a microscopic two-band model that has been widely employed in studies of iron pnictides, most of our results follow from a Ginzburg-Landau analysis, and as such should be applicable to other systems of interest, such as cuprates and heavy fermion materials. The Ginzburg-Landau functional reveals not only that the π -triplet gap amplitude couples trilinearly with the singlet gap amplitude and the staggered magnetization magnitude but also that the π -triplet d -vector couples linearly with the magnetization direction. While in the mean-field level this coupling forces the d -vector to align parallel or antiparallel to the magnetization, in the fluctuation regime it promotes two additional collective modes—a Goldstone mode related to the precession of the d -vector around the magnetization and a massive mode, related to the relative angle between the two vectors, which is nearly degenerate with a Leggett-like mode associated with the phase difference between the singlet and triplet gaps. We also investigate the impact of magnetic fluctuations on the superconducting-antiferromagnetic phase diagram, showing that due to their coupling with the π -triplet order parameter the coexistence region is enhanced. This effect stems from the fact that the π -triplet degrees of freedom promote an effective attraction between

  17. Outcome of Multifetal Pregnancy Reduction in Women with a Dichorionic Triamniotic Triplet Pregnancy to a Singleton Pregnancy: A Retrospective Nationwide Cohort Study

    NARCIS (Netherlands)

    van de Mheen, L.; Everwijn, S. M. P.; Haak, M. C.; Manten, G. T. R.; Zondervan, H. A.; Knapen, M. F. C. M.; Engels, M. A. J.; Erwich, J. J. H. M.; Coumans, A. B.; van Vugt, J. M. G.; Bilardo, C. M.; van Pampus, M. G.; de Groot, C. J. M.; Mol, B. W. J.; Pajkrt, E.

    2016-01-01

    To study the pregnancy outcomes of women with a dichorionic triamniotic triplet pregnancy that was reduced to a singleton pregnancy and to review the literature. We performed a nationwide retrospective cohort study. We compared time to delivery and perinatal mortality in dichorionic triplet

  18. MicroRNA-145 suppresses ROS-induced Ca{sup 2+} overload of cardiomyocytes by targeting CaMKIIδ

    Energy Technology Data Exchange (ETDEWEB)

    Cha, Min-Ji [Cardiovascular Research Institute, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Brain Korea 21 Project for Medical Science, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Jang, Jin-Kyung [College of Pharmacy, Sookmyung Women’s University, 52 HyoChangWon-Gil, Yongsan-ku, Seoul 140-742 (Korea, Republic of); Ham, Onju; Song, Byeong-Wook; Lee, Se-Yeon [Cardiovascular Research Institute, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Brain Korea 21 Project for Medical Science, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Lee, Chang Yeon; Park, Jun-Hee [Department of Integrated Omics for Biomedical Sciences, Graduate School, Yonsei University, 50 Yonsei-ro, Seodamun-gu, Seoul 120-759 (Korea, Republic of); Lee, Jiyun; Seo, Hyang-Hee [Cardiovascular Research Institute, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Brain Korea 21 Project for Medical Science, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Choi, Eunhyun [Severance Integrative Research Institute for Cerebral and Cardiovascular Disease, Yonsei University Health System, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Jeon, Woo-min [Department of Animal Resource, Sahmyook University, Seoul 139-742 (Korea, Republic of); Hwang, Hye Jin [Cardiovascular Research Institute, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Shin, Hyun-Taek [College of Pharmacy, Sookmyung Women’s University, 52 HyoChangWon-Gil, Yongsan-ku, Seoul 140-742 (Korea, Republic of); and others

    2013-06-14

    Highlights: •CaMKIIδ mediates H{sub 2}O{sub 2}-induced Ca{sup 2+} overload in cardiomyocytes. •miR-145 can inhibit Ca{sup 2+} overload. •A luciferase assay confirms that miR-145 functions as a CaMKIIδ-targeting miRNA. •Overexpression of miR-145 regulates CaMKIIδ-related genes and ameliorates apoptosis. -- Abstract: A change in intracellular free calcium (Ca{sup 2+}) is a common signaling mechanism of reperfusion-induced cardiomyocyte death. Calcium/calmodulin dependent protein kinase II (CaMKII) is a critical regulator of Ca{sup 2+} signaling and mediates signaling pathways responsible for functions in the heart including hypertrophy, apoptosis, arrhythmia, and heart disease. MicroRNAs (miRNA) are involved in the regulation of cell response, including survival, proliferation, apoptosis, and development. However, the roles of miRNAs in Ca{sup 2+}-mediated apoptosis of cardiomyocytes are uncertain. Here, we determined the potential role of miRNA in the regulation of CaMKII dependent apoptosis and explored its underlying mechanism. To determine the potential roles of miRNAs in H{sub 2}O{sub 2}-mediated Ca{sup 2+} overload, we selected and tested 6 putative miRNAs that targeted CaMKIIδ, and showed that miR-145 represses CaMKIIδ protein expression and Ca{sup 2+} overload. We confirmed CaMKIIδ as a direct downstream target of miR-145. Furthermore, miR-145 regulates Ca{sup 2+}-related signals and ameliorates apoptosis. This study demonstrates that miR-145 regulates reactive oxygen species (ROS)-induced Ca{sup 2+} overload in cardiomyocytes. Thus, miR-145 affects ROS-mediated gene regulation and cellular injury responses.

  19. Raman spectroscopy of DNA-metal complexes. II. The thermal denaturation of DNA in the presence of Sr2+, Ba2+, Mg2+, Ca2+, Mn2+, Co2+, Ni2+, and Cd2+.

    OpenAIRE

    Duguid, J G; Bloomfield, V A; Benevides, J M; Thomas, G J

    1995-01-01

    Differential scanning calorimetry, laser Raman spectroscopy, optical densitometry, and pH potentiometry have been used to investigate DNA melting profiles in the presence of the chloride salts of Ba2+, Sr2+, Mg2+, Ca2+, Mn2+, Co2+, Ni2+, and Cd2+. Metal-DNA interactions have been observed for the molar ratio [M2+]/[PO2-] = 0.6 in aqueous solutions containing 5% by weight of 160 bp mononucleosomal calf thymus DNA. All of the alkaline earth metals, plus Mn2+, elevate the melting temperature of ...

  20. Desulfurizing Ability of the CaOsatd.-CaCl2-CaF2 Slags

    Science.gov (United States)

    Liu, Jiazhan; Kobayashi, Yoshinao

    2017-04-01

    Desulfurizing ability of the CaO-CaCl2-CaF2 slags saturated with CaO has been investigated from the viewpoint of the sulfide capacity and CaO solubility. The CaO-CaCl2-CaF2 slags containing small amounts of Cu2O and CaS were inserted in a CaO crucible with metallic copper. The CaO crucible was sealed in a nickel holder to prevent the evaporation of CaCl2, then heated up and kept at temperatures from 1573 K (1300 °C) to 1673 K (1400 °C) for 24 hours, which enabled the system inside the CaO crucible to reach the equilibrium. As expected, the sulfide capacity derived from the data obtained as well as CaO solubility of the slag increase with an increase in temperature at a constant ratio of CaCl2/CaF2. The solubility of CaO increases by the replacement of CaF2 with CaCl2, whereas the sulfide capacity slightly decreases and the activity coefficient of CaS ( γ CaS) increases. This suggests that CaF2 has stronger interaction with CaS than CaCl2. The sulfur distribution ratio between carbon-saturated iron melts and the CaO-CaCl2 slag has been calculated to be about 10 000 at 1573 K (1300 °C) using the sulfide capacity obtained, which value is still large enough even with the replacement of CaF2 by CaCl2.

  1. Studies of synoptic solar activity using Kodaikanal Ca K data

    Science.gov (United States)

    Raju, K. P.

    2017-10-01

    The chromospheric network, the bright emission network seen in the chromospheric lines such as Ca ii K and Hα, outline the supergranulation cells. The Ca images are dominated by the chromospheric network and plages which are good indicators of solar activity. Further, the Ca line is a good proxy to the UV irradiance which is particularly useful in the pre-satellite era where UV measurements are not available. The Ca spectroheliograms of the Sun from Kodaikanal have a data span of about 100 years and covers over 9 solar cycles. The archival data is now available in the digitized form. Programs have been developed to obtain the activity indices and the length scales of the chromospheric network from the data. The preliminary results from the analysis are reported here. It is shown that the Ca ii K intensity and the network boundary width are dependent on the solar cycle.

  2. Triplet repeat sequences in human DNA can be detected by hybridization to a synthetic (5'-CGG-3')17 oligodeoxyribonucleotide

    DEFF Research Database (Denmark)

    Behn-Krappa, A; Mollenhauer, J; Doerfler, W

    1993-01-01

    The seemingly autonomous amplification of naturally occurring triplet repeat sequences in the human genome has been implicated in the causation of human genetic disease, such as the fragile X (Martin-Bell) syndrome, myotonic dystrophy (Curshmann-Steinert), spinal and bulbar muscular atrophy...

  3. Singlet and Triplet Excitation Management in a Bichromophoric Near-Infrared-Phosphorescent BODIPY-Benzoporphyrin Platinum Complex

    KAUST Repository

    Whited, Matthew T.

    2011-01-12

    Multichromophoric arrays provide one strategy for assembling molecules with intense absorptions across the visible spectrum but are generally focused on systems that efficiently produce and manipulate singlet excitations and therefore are burdened by the restrictions of (a) unidirectional energy transfer and (b) limited tunability of the lowest molecular excited state. In contrast, we present here a multichromophoric array based on four boron dipyrrins (BODIPY) bound to a platinum benzoporphyrin scaffold that exhibits intense panchromatic absorption and efficiently generates triplets. The spectral complementarity of the BODIPY and porphryin units allows the direct observation of fast bidirectional singlet and triplet energy transfer processes (k ST(1BDP→1Por) = 7.8×1011 s-1, kTT(3Por→3BDP) = 1.0×1010 s-1, kTT(3BDP→ 3Por) = 1.6×1010 s-1), leading to a long-lived equilibrated [3BDP][Por]=[BDP][3Por] state. This equilibrated state contains approximately isoenergetic porphyrin and BODIPY triplets and exhibits efficient near-infrared phosphorescence (λem = 772 nm, φ = 0.26). Taken together, these studies show that appropriately designed triplet-utilizing arrays may overcome fundamental limitations typically associated with core-shell chromophores by tunable redistribution of energy from the core back onto the antennae. © 2010 American Chemical Society.

  4. Singlet and triplet state transitions of carotenoids in the antenna complexes of higher-plant photosystem I

    NARCIS (Netherlands)

    Croce, Roberta; Mozzo, Milena; Morosinotto, Tomas; Romeo, Alessandro; Hienerwadel, Rainer; Bassi, Roberta

    2007-01-01

    In this work, the spectroscopic characteristics of carotenoids associated with the antenna complexes of Photosystem I have been studied. Pigment composition, absorption spectra, and laser-induced triplet-minus-singlet (T-S) spectra were determined for native LHCI from the wild type (WT) and lut2

  5. Triplet Pregnancy Complicated with One Hydatidiform Mole and Preeclampsia in a 46, XY Female with Gonadal Dysgenesis

    Directory of Open Access Journals (Sweden)

    Po-Chun Ko

    2007-09-01

    Conclusion: This is the first report of triplet pregnancy complicated with one complete hydatidiform mole and preeclampsia in a 46, XY female with gonadal dysgenesis. Our case demonstrated that prolonged gestation with both surviving fetuses was possible by applying intensive monitoring of the whole pregnancy.

  6. On the doublet/triplet splitting and intermediate mass scales in locally supersymmetric SO(10)

    Science.gov (United States)

    Pulido, João

    1985-01-01

    In the light of the doublet/triplet splitting, the possibilities for an intermediate mass scale in locally supersymmetric SO(10) are analysed. It is found that the subgroup SU(4)c × SU(2)L × SU(2)R and more generally left-right symmetric models are unlikely to survive as intermediate symmetries since they imply too large values of the weak mixing angle. An alternative model using the subgroup SU(3)c × U(1)L × U(1)R is discussed. Requirements from global SUSY preservation impose an extra constraint and predictions for the grand unification and the intermediate masses are obtained at MX ~ 6 × 1015 GeV and MI ~ 1012 GeV. Address after March 1984: Centro de Fisica da Materia Condensada, Av. Prof. Gama Pinto, 2, 1699 Lisbon Codex, Portugal.

  7. Sky light polarization detection with linear polarizer triplet in light field camera inspired by insect vision.

    Science.gov (United States)

    Zhang, Wenjing; Cao, Yu; Zhang, Xuanzhe; Liu, Zejin

    2015-10-20

    Stable information of a sky light polarization pattern can be used for navigation with various advantages such as better performance of anti-interference, no "error cumulative effect," and so on. But the existing method of sky light polarization measurement is weak in real-time performance or with a complex system. Inspired by the navigational capability of a Cataglyphis with its compound eyes, we introduce a new approach to acquire the all-sky image under different polarization directions with one camera and without a rotating polarizer, so as to detect the polarization pattern across the full sky in a single snapshot. Our system is based on a handheld light field camera with a wide-angle lens and a triplet linear polarizer placed over its aperture stop. Experimental results agree with the theoretical predictions. Not only real-time detection but simple and costless architecture demonstrates the superiority of the approach proposed in this paper.

  8. Mechanical design and analysis of LHC inner triplet quadrupole magnets at Fermilab

    CERN Document Server

    Andreev, N; Bossert, R; Chichili, D R; Fehér, S; Kerby, J S; Lamm, M J; Makarov, A A; Nobrega, A; Novitski, I; Orris, D; Ozelis, J P; Tartaglia, M; Tompkins, J C; Yadav, S; Zlobin, A V

    2000-01-01

    A series of model magnets is being constructed and tested at Fermilab in order to verify the design of high gradient quadrupole magnets for the LHC interaction region inner triplets. The 2 m models are being built in order to refine the mechanical and magnetic design, optimize fabrication and assembly tooling, and ensure adequate quench performance. This has been carried out using a complementary combination of analytical and FEA modeling, empirical tests on 0.4 m mechanical assemblies and testing of model magnets during fabrication and under cryogenic conditions. The results of these tests and studies have led to improvements in the design of the magnet end restraints, to a preferred choice in coil end part material, and to a better understanding of factors affecting coil stress throughout the fabrication and operational stages. (8 refs).

  9. Study of Kapton insulated superconducting coils manufactured for the LHC inner triplet model magnets at Fermilab

    CERN Document Server

    Andreev, N; Bossert, R; Brandt, J; Chichili, D R; Kerby, J S; Nobrega, A; Novitski, I; Ozelis, J P; Yadav, S; Zlobin, A V

    2000-01-01

    Fermilab has constructed a number of 2 m model quadrupoles as part of an ongoing program to develop and optimize the design of quadrupoles for the LHC Interaction Region inner triplets. The quadrupole design is based upon a two layer shell type coil of multi-filament NbTi strands in Rutherford cable, insulated with Kapton film. As such, the coil size and mechanical properties are critical in achieving the desired prestress and field quality targets for the agent. Throughout the model magnet program, different design and manufacturing techniques have been studied to obtain coils with the required mechanical properties. This paper summarizes the structural material and coil mechanical properties, coil design optimization results and production experience accumulated in the model R&D program. (5 refs).

  10. Recent results from the LHC inner triplet quadrupole development program at Fermilab

    CERN Document Server

    Andreev, N; Bauer, P; Bossert, R; Brandt, J; Chichili, D R; Carson, J; Di Marco, J; Fehér, S; Kerby, J S; Lamm, M J; Limon, P J; Makarov, A A; Nobrega, A; Novit