WorldWideScience

Sample records for ca 3075ma ocelli-hosting

  1. Field and geochemical characterisitics of the Mesoarchean (~3075 ma) Ivisaartoq greenstone belt, southern West Greenland: Evidence for seafloor hydrothermal alteration in a supra-subduction oceanic crust

    DEFF Research Database (Denmark)

    Polat, A.; Appel, P.W.U.; Frei, Robert

    2006-01-01

    The Mesoarchean (ca. 3075 Ma) Ivisaartoq greenstone belt in southern West Greenland includes variably deformed and metamorphosed pillow basalts, ultramafic flows (picrites), serpentinized ultramafic rocks, gabbros, sulphide-rich siliceous layers, and minor siliciclastic sedimentary rocks. Primary...... magmatic features such as concentric cooling-cracks and drainage cavities in pillows, volcanic breccia, ocelli interpreted as liquid immiscibility textures in pillows and gabbros, magmatic layering in gabbros, and clinopyroxene cumulates in ultramafic flows are well preserved in low-strain domains....... The belt underwent at least two stages of calc-silicate metasomatic alteration and polyphase deformation between 2963 and 3075 Ma. The stage I metasomatic assemblage is composed predominantly of epidote (now mostly diopside) + quartz + plagioclase ± hornblende ± scapolite, and occurs mainly in pillow cores...

  2. INTRACELLULAR Ca2+ HOMEOSTASIS

    Directory of Open Access Journals (Sweden)

    Shahdevi Nandar Kurniawan

    2015-01-01

    Full Text Available Ca2+ signaling functions to regulate many cellular processes. Dynamics of Ca2+ signaling or homeostasis is regulated by the interaction between ON and OFF reactions that control Ca2+ flux in both the plasma membrane and internal organelles such as the endoplasmic reticulum (ER and mitochondria. External stimuli activate the ON reactions, which include Ca2+ into the cytoplasm either through channels in the plasma membrane or from internal storage like in ER. Most of the cells utilize both channels/sources, butthere area few cells using an external or internal source to control certain processes. Most of the Ca2+ entering the cytoplasm adsorbed to the buffer, while a smaller part activate effect or to stimulate cellular processes. Reaction OFF is pumping of cytoplasmic Ca2+ using a combination mechanism of mitochondrial and others. Changes in Ca2+ signal has been detected in various tissues isolated from animals induced into diabetes as well as patients with diabetes. Ca2+ signal interference is also found in sensory neurons of experimental animals with diabetes. Ca2+ signaling is one of the main signaling systems in the cell.

  3. Desulfurizing Ability of the CaOsatd.-CaCl2-CaF2 Slags

    Science.gov (United States)

    Liu, Jiazhan; Kobayashi, Yoshinao

    2017-04-01

    Desulfurizing ability of the CaO-CaCl2-CaF2 slags saturated with CaO has been investigated from the viewpoint of the sulfide capacity and CaO solubility. The CaO-CaCl2-CaF2 slags containing small amounts of Cu2O and CaS were inserted in a CaO crucible with metallic copper. The CaO crucible was sealed in a nickel holder to prevent the evaporation of CaCl2, then heated up and kept at temperatures from 1573 K (1300 °C) to 1673 K (1400 °C) for 24 hours, which enabled the system inside the CaO crucible to reach the equilibrium. As expected, the sulfide capacity derived from the data obtained as well as CaO solubility of the slag increase with an increase in temperature at a constant ratio of CaCl2/CaF2. The solubility of CaO increases by the replacement of CaF2 with CaCl2, whereas the sulfide capacity slightly decreases and the activity coefficient of CaS ( γ CaS) increases. This suggests that CaF2 has stronger interaction with CaS than CaCl2. The sulfur distribution ratio between carbon-saturated iron melts and the CaO-CaCl2 slag has been calculated to be about 10 000 at 1573 K (1300 °C) using the sulfide capacity obtained, which value is still large enough even with the replacement of CaF2 by CaCl2.

  4. Teale CA. Counties

    Data.gov (United States)

    California Department of Resources — California Spatial Information System (CaSIL) is a project designed to improve access to geo-spatial and geo-spatial related data information throughout the state of...

  5. Biomarker CA125

    DEFF Research Database (Denmark)

    Kargo, Anette Stolberg

    Background: The majority of patients with ovarian cancer (OC) are diagnosed with advanced disease (70-80 %) and will experience disease relapse with only limited curative potential. Early initiation of relapse treatment based on rising CA125 alone does not improve survival. Increasing CA125 can...... be detected months before symptoms arise and recurrence is visible on imaging. Therefore, biochemical detection of potential relapse by CA125 assessment can cause significant distress. A decision aid (DA) is a tool that provides information and describes advantages and disadvantages of a specific intervention...... patient organisations and cancer societies. First, a focus group of seven former OC patients was performed followed by a quantitative rating of the DA pilot version. The DA was adapted accordingly and then tested in 14 OC patients with recurrence using a structured interview guide (alpha testing). A final...

  6. Topological organization of CA3-to-CA1 excitation.

    Science.gov (United States)

    Hongo, Yoshie; Ogawa, Koichi; Takahara, Yuji; Takasu, Keiko; Royer, Sebastien; Hasegawa, Minoru; Sakaguchi, Gaku; Ikegaya, Yuji

    2015-09-01

    The CA1-projecting axons of CA3 pyramidal cells, called Schaffer collaterals, constitute one of the major information flow routes in the hippocampal formation. Recent anatomical studies have revealed the non-random structural connectivity between CA3 and CA1, but little is known regarding the functional connectivity (i.e. how CA3 network activity is functionally transmitted downstream to the CA1 network). Using functional multi-neuron calcium imaging of rat hippocampal slices, we monitored the spatiotemporal patterns of spontaneous CA3 and CA1 burst activity under pharmacological GABAergic blockade. We found that spatially clustered CA3 activity patterns were transformed into layered CA1 activity sequences. Specifically, synchronized bursts initiated from multiple hot spots in CA3 ensembles, and CA1 neurons located deeper in the pyramidal cell layer were recruited during earlier phases of the burst events. The order of these sequential activations was maintained across the bursts, but the sequence velocity varied depending on the inter-burst intervals. Thus, CA3 axons innervate CA1 neurons in a highly topographical fashion. © 2015 Federation of European Neuroscience Societies and John Wiley & Sons Ltd.

  7. Ground-state correlations in 40Ca and 48Ca

    Science.gov (United States)

    Takayanagi, K.; Lipparini, E.

    1992-01-01

    Second-order perturbation theory with a G-matrix is adopted to examine from a unified point of view the effects of two-particle-two-hole correlations on the matter and momentum distributions and the occupation numbers in 40Ca and 48Ca. Polarization effects induced by the neutron excess in 48Ca are investigated in detail.

  8. Divergence of Ca(2+) selectivity and equilibrium Ca(2+) blockade in a Ca(2+) release-activated Ca(2+) channel.

    Science.gov (United States)

    Yamashita, Megumi; Prakriya, Murali

    2014-03-01

    Prevailing models postulate that high Ca(2+) selectivity of Ca(2+) release-activated Ca(2+) (CRAC) channels arises from tight Ca(2+) binding to a high affinity site within the pore, thereby blocking monovalent ion flux. Here, we examined the contribution of high affinity Ca(2+) binding for Ca(2+) selectivity in recombinant Orai3 channels, which function as highly Ca(2+)-selective channels when gated by the endoplasmic reticulum Ca(2+) sensor STIM1 or as poorly Ca(2+)-selective channels when activated by the small molecule 2-aminoethoxydiphenyl borate (2-APB). Extracellular Ca(2+) blocked Na(+) currents in both gating modes with a similar inhibition constant (Ki; ~25 µM). Thus, equilibrium binding as set by the Ki of Ca(2+) blockade cannot explain the differing Ca(2+) selectivity of the two gating modes. Unlike STIM1-gated channels, Ca(2+) blockade in 2-APB-gated channels depended on the extracellular Na(+) concentration and exhibited an anomalously steep voltage dependence, consistent with enhanced Na(+) pore occupancy. Moreover, the second-order rate constants of Ca(2+) blockade were eightfold faster in 2-APB-gated channels than in STIM1-gated channels. A four-barrier, three-binding site Eyring model indicated that lowering the entry and exit energy barriers for Ca(2+) and Na(+) to simulate the faster rate constants of 2-APB-gated channels qualitatively reproduces their low Ca(2+) selectivity, suggesting that ion entry and exit rates strongly affect Ca(2+) selectivity. Noise analysis indicated that the unitary Na(+) conductance of 2-APB-gated channels is fourfold larger than that of STIM1-gated channels, but both modes of gating show a high open probability (Po; ~0.7). The increase in current noise during channel activation was consistent with stepwise recruitment of closed channels to a high Po state in both cases, suggesting that the underlying gating mechanisms are operationally similar in the two gating modes. These results suggest that both high affinity Ca

  9. /sup 40/Ca-/sup 48/Ca isotope shift

    Energy Technology Data Exchange (ETDEWEB)

    Khodel, V.A.; Platonov, A.P.; Saperstein, E.E. (Gosudarstvennyj Komitet po Ispol' zovaniyu Atomnoj Ehnergii SSSR, Moscow. Inst. Atomnoj Ehnergii)

    1982-07-01

    Contributions of the virtual low-lying collective excitations to the nuclear density are calculated within the framework of the theory of self-consistent finite Fermi systems. It is shown that this effect is responsible for the /sup 40/Ca-/sup 48/Ca isotope shift.

  10. Mitochondrial Ca2+ homeostasis during Ca2+ influx and Ca2+ release in gastric myocytes from Bufo marinus

    Science.gov (United States)

    Drummond, Robert M; Mix, T Christian H; Tuft, Richard A; Walsh, John V; Fay, Fredric S

    2000-01-01

    The Ca2+-sensitive fluorescent indicator rhod-2 was used to monitor mitochondrial Ca2+ concentration ([Ca2+]m) in gastric smooth muscle cells from Bufo marinus. In some studies, fura-2 was used in combination with rhod-2, allowing simultaneous measurement of cytoplasmic Ca2+ concentration ([Ca2+]i) and [Ca2+]m, respectively. During a short train of depolarizations, which causes Ca2+ influx from the extracellular medium, there was an increase in both [Ca2+]i and [Ca2+]m. The half-time (t½) to peak for the increase in [Ca2+]m was considerably longer than the t½ to peak for the increase in [Ca2+]i. [Ca2+]m remained elevated for tens of seconds after [Ca2+]i had returned to its resting value. Stimulation with caffeine, which causes release of Ca2+ from the sarcoplasmic reticulum (SR), also produced increases in both [Ca2+]i and [Ca2+]m. The values of t½ to peak for the increase in [Ca2+] in both cytoplasm and mitochondria were similar; however, [Ca2+]i returned to baseline values much faster than [Ca2+]m. Using a wide-field digital imaging microscope, changes in [Ca2+]m were monitored within individual mitochondria in situ, during stimulation of Ca2+ influx or Ca2+ release from the SR. Mitochondrial Ca2+ uptake during depolarizing stimulation caused depolarization of the mitochondrial membrane potential. The mitochondrial membrane potential recovered considerably faster than the recovery of [Ca2+]m. This study shows that Ca2+ influx from the extracellular medium and Ca2+ release from the SR are capable of increasing [Ca2+]m in smooth muscle cells. The efflux of Ca2+ from the mitochondria is a slow process and appears to be dependent upon the amount of Ca2+ in the SR. PMID:10713963

  11. CA125 in ovarian cancer

    DEFF Research Database (Denmark)

    Duffy, M J; Bonfrer, J M; Kulpa, J

    2005-01-01

    CA125 is currently the most widely used tumor marker for ovarian epithelial cancer. The aim of this article is to provide guidelines for the routine clinical use of CA125 in patients with ovarian cancer. Due to lack of sensitivity for stage I disease and lack of specificity, CA125 is of little...... value in the detection of early ovarian cancer. At present, therefore, CA125, either alone or in combination with other modalities, cannot be recommended for screening for ovarian cancer in asymptomatic women outside the context of a randomized controlled trial. Preoperative levels in postmenopausal...... women, however, may aid the differentiation of benign and malignant pelvic masses. Serial levels during chemotherapy for ovarian cancer are useful for assessing response to treatment. Although serial monitoring following initial chemotherapy can lead to the early detection of recurrent disease...

  12. Sonoma County, CA, 2013 Lidar

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Sonoma County Vegetation Mapping and LiDAR Consortium retained WSI to provide lidar and Orthophoto data and derived products in Sonoma County, CA. A classified LAS...

  13. Clinical Significance of Serum HE4, CA125, CA724, and CA19-9 in Patients With Endometrial Cancer.

    Science.gov (United States)

    Bian, Jing; Sun, Xiaoxu; Li, Bo; Ming, Liang

    2017-08-01

    Serum markers with increased sensitivity and specificity for endometrial cancer are required. To date, no good marker has met this standard. The aims of our study were to evaluate the utility of tumor markers HE4, CA125, CA724, and CA19-9 as potential markers in patients diagnosed with endometrial cancer. Blood samples from 105 patients with endometrial cancer and 87 healthy women were analyzed by Roche electrochemiluminescent immunoassay, and serum values were measured for the following biomarkers: HE4, CA125, CA724, and CA19-9. Serum HE4, CA125, CA724, and CA19-9 concentrations were significantly higher in patients with endometrial cancer, compared with controls ( P endometrial cancer, HE4 had higher sensitivity (58%), positive predictive value (60%), and negative predictive value (67%) than any other single tumor marker, and in the combination of HE4, CA125, CA724, and CA19-9, the sensitivity and positive predictive values reached 59.1% and 88%, respectively. Meanwhile, the receiver operating characteristic area under the curve of the combination of the 4 markers was significantly increased than any other group, either in stage I or in stage II to IV cases. HE4 and CA125 both correlate with advanced age; in addition, HE4 was related to pathology subtypes and positive adnexal involvement, CA125 was related to International Federation of Gynecology and Obstetrics stage, CA19-9 was related to International Federation of Gynecology and Obstetrics stage, and CA724 was correlated with positive lymph node. Combination of HE4, CA125, CA724, and CA19-9 has the highest value in diagnosing endometrial cancer, and they can be a useful tissue immune marker for patients with endometrial cancer.

  14. Solid State compatibilities in CaO-CaO∙Al2O3-CaF2 system

    Directory of Open Access Journals (Sweden)

    Jiménez Molina, S.

    1998-03-01

    Full Text Available In open atmosphere the two phases containing fluorine, C11A7∙CaF2 and 3CA∙CaF2, laying in the CaO-CaO∙Al2O3-CaF2 were synthesized. The synthesis of the 3CA∙CaF2 at 1.100°C was possible without loss of F, when the stoichiometric mixture of CA and CaF2 was pressed into tablets and was applied vacuum, avoiding in such a way the presence of moisture. According to TGA studies, the vapour pressure of phases containing fluorine, at 1.100°C is very low and follows this sequence: CaF2 2 11A7∙CaF2. At 1.000°C the system behaves as condensated. Verification of some compatibilities in solid state in the system CaO-CaO∙Al2O3-CaF2 at 1000°C has been done. Compatibility triangles found are the same described by Chaterjee, and different from the compatibilities given by Brisi and Rolando.Se han sintetizado en atmósfera abierta las dos fases fluoradas del sistema CaO-CaO∙Al2O3-CaF2: C11A7∙CaF2 y 3CA∙CaF2. La síntesis del 3CACaF2 a 1.100°C ha sido posible sin pérdida de F, cuando la mezcla estequiométrica de CA y CaF2 se empastilló a presión y aplicando vacío, como modo de evitar la presencia de humedad. De acuerdo con los resultados de Análisis Termogravimétrico, la presión de vapor de las fases fluoradas, a 1.100°C, es muy baja y sigue el orden: CaF2 2 11A7∙CaF2. A 1.000°C, el sistema se comporta como condensado. Se han verificado algunas relaciones de fases compatibles en estado sólido, en el sistema CaO-CaO∙Al2O3-CaF2, a 1.000°C. Las relaciones de fases compatibles que se han encontrado coinciden con aquéllas descritas por Chaterjee, y son diferentes a las encontradas por Brisi y Rolando.

  15. KWU-werkersklasdramas in Afrikaans (ca. 1930 - ca. 1950

    Directory of Open Access Journals (Sweden)

    J. L. Coetser

    1999-05-01

    Full Text Available GWU working class theatre in Afrikaans (ca. 1930 - ca. 1950In 1984 Elsabé Brink drew attention to plays, prose and poetry written between 1930 and 1950 in Afrikaans by members of the Garment Workers’ Union (GWU. Scholars such as Stander and Willemse (1992, Van Niekerk (1996 and Van Wyk (1995, 1997 have also referred to GWU plays. Apart from these overviews, GWU plays as such have not yet received the attention they deserve. This article presents a revaluation, initially by providing an overview of their contents, followed by an examination of cultural, economic and political influences. It is argued that - retrospectively - the GWU plays reflected a unique cultural specificity from the framework established by Sitas (1986 for more contemporary working class theatre.

  16. Continuously Tunable Ca2+ Regulation of RNA-Edited CaV1.3 Channels

    Directory of Open Access Journals (Sweden)

    Hojjat Bazzazi

    2013-10-01

    Full Text Available CaV1.3 ion channels are dominant Ca2+ portals into pacemaking neurons, residing at the epicenter of brain rhythmicity and neurodegeneration. Negative Ca2+ feedback regulation of CaV1.3 channels (CDI is therefore critical for Ca2+ homeostasis. Intriguingly, nearly half the CaV1.3 transcripts in the brain are RNA edited to reduce CDI and influence oscillatory activity. It is then mechanistically remarkable that this editing occurs precisely within an IQ domain, whose interaction with Ca2+-bound calmodulin (Ca2+/CaM is believed to induce CDI. Here, we sought the mechanism underlying the altered CDI of edited channels. Unexpectedly, editing failed to attenuate Ca2+/CaM binding. Instead, editing weakened the prebinding of Ca2+-free CaM (apoCaM to channels, which proves essential for CDI. Thus, editing might render CDI continuously tunable by fluctuations in ambient CaM, a prominent effect we substantiate in substantia nigral neurons. This adjustability of Ca2+ regulation by CaM now looms as a key element of CNS Ca2+ homeostasis.

  17. Imaging Ca2+ with a Fluorescent Rhodol.

    Science.gov (United States)

    Contractor, Alisha A; Miller, Evan W

    2018-01-16

    Ca2+ mediates a host of biochemical and biophysical signaling processes in cells. The development of synthetic, Ca2+-sensitive fluorophores has played an instrumental role in our understanding of the temporal and spatial dynamics of Ca2+. Coupling Ca2+-selective ligands to fluorescent reporters has provided a wealth of excellent indicators that span the visible excitation and emission spectrum and possess Ca2+ affinities suited to a variety of cellular contexts. One underdeveloped area is the use of hybrid rhodamine/fluorescein fluorophores, or rhodols, in the context of Ca2+ sensing. Rhodols are bright and photostable and have good two-photon absorption cross sections (σTPA), making them excellent candidates for incorporation into Ca2+-sensing scaffolds. Here, we present the design, synthesis, and application of rhodol Ca2+ sensor 1 (RCS-1), a chlorinated pyrrolidine-based rhodol. RCS-1 possesses a Ca2+ binding constant of 240 nM and a 10-fold turn response to Ca2+. RCS-1 effectively absorbs infrared light and has a σTPA of 76 GM at 840 nm, 3-fold greater than that of its fluorescein-based counterpart. The acetoxy-methyl ester of RCS-1 stains the cytosol of live cells, enabling observation of Ca2+ fluctuations and cultured neurons using both one- and two-photon illumination. Together, these results demonstrate the utility of rhodol-based scaffolds for Ca2+ sensing using two-photon illumination in neurons.

  18. Ca2+ Dependence of Synaptic Vesicle Endocytosis.

    Science.gov (United States)

    Leitz, Jeremy; Kavalali, Ege T

    2016-10-01

    Ca(2+)-dependent synaptic vesicle recycling is essential for structural homeostasis of synapses and maintenance of neurotransmission. Although, the executive role of intrasynaptic Ca(2+) transients in synaptic vesicle exocytosis is well established, identifying the exact role of Ca(2+) in endocytosis has been difficult. In some studies, Ca(2+) has been suggested as an essential trigger required to initiate synaptic vesicle retrieval, whereas others manipulating synaptic Ca(2+) concentrations reported a modulatory role for Ca(2+) leading to inhibition or acceleration of endocytosis. Molecular studies of synaptic vesicle endocytosis, on the other hand, have consistently focused on the roles of Ca(2+)-calmodulin dependent phosphatase calcineurin and synaptic vesicle protein synaptotagmin as potential Ca(2+) sensors for endocytosis. Most studies probing the role of Ca(2+) in endocytosis have relied on measurements of synaptic vesicle retrieval after strong stimulation. Strong stimulation paradigms elicit fusion and retrieval of multiple synaptic vesicles and therefore can be affected by several factors besides the kinetics and duration of Ca(2+) signals that include the number of exocytosed vesicles and accumulation of released neurotransmitters thus altering fusion and retrieval processes indirectly via retrograde signaling. Studies monitoring single synaptic vesicle endocytosis may help resolve this conundrum as in these settings the impact of Ca(2+) on synaptic fusion probability can be uncoupled from its putative role on synaptic vesicle retrieval. Future experiments using these single vesicle approaches will help dissect the specific role(s) of Ca(2+) and its sensors in synaptic vesicle endocytosis. © The Author(s) 2015.

  19. An Inhibitory Effect of Extracellular Ca2+ on Ca2+-Dependent Exocytosis

    Science.gov (United States)

    Wang, Yeshi; Chen, Xiaowei; Sun, Lei; Guo, Ning; Zheng, Hui; Zheng, Lianghong; Ruat, Martial; Han, Weiping; Zhang, Claire Xi; Zhou, Zhuan

    2011-01-01

    Aim Neurotransmitter release is elicited by an elevation of intracellular Ca2+ concentration ([Ca2+]i). The action potential triggers Ca2+ influx through Ca2+ channels which causes local changes of [Ca2+]i for vesicle release. However, any direct role of extracellular Ca2+ (besides Ca2+ influx) on Ca2+-dependent exocytosis remains elusive. Here we set out to investigate this possibility on rat dorsal root ganglion (DRG) neurons and chromaffin cells, widely used models for studying vesicle exocytosis. Results Using photolysis of caged Ca2+ and caffeine-induced release of stored Ca2+, we found that extracellular Ca2+ inhibited exocytosis following moderate [Ca2+]i rises (2–3 µM). The IC50 for extracellular Ca2+ inhibition of exocytosis (ECIE) was 1.38 mM and a physiological reduction (∼30%) of extracellular Ca2+ concentration ([Ca2+]o) significantly increased the evoked exocytosis. At the single vesicle level, quantal size and release frequency were also altered by physiological [Ca2+]o. The calcimimetics Mg2+, Cd2+, G418, and neomycin all inhibited exocytosis. The extracellular Ca2+-sensing receptor (CaSR) was not involved because specific drugs and knockdown of CaSR in DRG neurons did not affect ECIE. Conclusion/Significance As an extension of the classic Ca2+ hypothesis of synaptic release, physiological levels of extracellular Ca2+ play dual roles in evoked exocytosis by providing a source of Ca2+ influx, and by directly regulating quantal size and release probability in neuronal cells. PMID:22028769

  20. Puente Cañas

    OpenAIRE

    Luis Sáenz

    2017-01-01

    En la carretera de Trinidad a Cienfuegos, provincia de Las Villas (Cuba), se ha construido un puente isostático sobre el río Cañas, de hormigón pretensado, de tres tramos, cuya sección transversal es celular de tres tabiques formando un doble cajón. Los dos tramos laterales o accesos al central, de 15,5 m de luz cada uno, se han construido en voladizo respecto a los dos apoyos centrales. El tramo central salva un vano de 76 m.

  1. Puente Cañas

    Directory of Open Access Journals (Sweden)

    Luis Sáenz

    2017-05-01

    Full Text Available En la carretera de Trinidad a Cienfuegos, provincia de Las Villas (Cuba, se ha construido un puente isostático sobre el río Cañas, de hormigón pretensado, de tres tramos, cuya sección transversal es celular de tres tabiques formando un doble cajón. Los dos tramos laterales o accesos al central, de 15,5 m de luz cada uno, se han construido en voladizo respecto a los dos apoyos centrales. El tramo central salva un vano de 76 m.

  2. Multiple Ca2+ sensors in secretion

    DEFF Research Database (Denmark)

    Walter, Alexander M; Groffen, Alexander J; Sørensen, Jakob Balslev

    2011-01-01

    Regulated neurotransmitter secretion depends on Ca(2+) sensors, C2 domain proteins that associate with phospholipids and soluble N-ethylmaleimide-sensitive fusion attachment protein receptor (SNARE) complexes to trigger release upon Ca(2+) binding. Ca(2+) sensors are thought to prevent spontaneous...... fusion at rest (clamping) and to promote fusion upon Ca(2+) activation. At least eight, often coexpressed, Ca(2+) sensors have been identified in mammals. Accumulating evidence suggests that multiple Ca(2+) sensors interact, rather than work autonomously, to produce the complex secretory response...... observed in neurons and secretory cells. In this review, we present several working models to describe how different sensors might be arranged to mediate synchronous, asynchronous and spontaneous neurotransmitter release. We discuss the scenario that different Ca(2+) sensors typically act on one shared...

  3. Non–Ca2+-conducting Ca2+ channels in fish skeletal muscle excitation-contraction coupling

    Science.gov (United States)

    Schredelseker, Johann; Shrivastav, Manisha; Dayal, Anamika; Grabner, Manfred

    2010-01-01

    During skeletal muscle excitation-contraction (EC) coupling, membrane depolarizations activate the sarcolemmal voltage-gated L-type Ca2+ channel (CaV1.1). CaV1.1 in turn triggers opening of the sarcoplasmic Ca2+ release channel (RyR1) via interchannel protein–protein interaction to release Ca2+ for myofibril contraction. Simultaneously to this EC coupling process, a small and slowly activating Ca2+ inward current through CaV1.1 is found in mammalian skeletal myotubes. The role of this Ca2+ influx, which is not immediately required for EC coupling, is still enigmatic. Interestingly, whole-cell patch clamp experiments on freshly dissociated skeletal muscle myotubes from zebrafish larvae revealed the lack of such Ca2+ currents. We identified two distinct isoforms of the pore-forming CaV1.1α1S subunit in zebrafish that are differentially expressed in superficial slow and deep fast musculature. Both do not conduct Ca2+ but merely act as voltage sensors to trigger opening of two likewise tissue-specific isoforms of RyR1. We further show that non-Ca2+ conductivity of both CaV1.1α1S isoforms is a common trait of all higher teleosts. This non-Ca2+ conductivity of CaV1.1 positions teleosts at the most-derived position of an evolutionary trajectory. Though EC coupling in early chordate muscles is activated by the influx of extracellular Ca2+, it evolved toward CaV1.1-RyR1 protein–protein interaction with a relatively small and slow influx of external Ca2+ in tetrapods. Finally, the CaV1.1 Ca2+ influx was completely eliminated in higher teleost fishes. PMID:20212109

  4. Temporal monitoring of intracellular Ca2+ signaling and origins of Ca2+ oscillations

    OpenAIRE

    Webb, Dominic-Luc

    2006-01-01

    This thesis examined parameters influencing stimulated cytoplasmic free Ca2+ concentration ([Ca2+]i) oscillations in hepatocytes and pancreatic beta-cells. Hepatic glucose output is regulated in part by hormones such as vasopressin that act through [Ca 2+]i oscillations. Pulsatile [Ca2+]i in beta-cells parallels insulin secretion and this results in potently controlled blood glucose homeostasis. Employing temporal [Ca2+]i measurements and related biochemical assays, efforts ...

  5. CaMKIIdelta Subtypes: Localization and Function

    Directory of Open Access Journals (Sweden)

    Charles Burdis Burns Gray

    2014-02-01

    Full Text Available In this review we will discuss the localization and function of the known subtypes of calcium/calmodulin dependent protein kinase IIδ (CaMKIIδ and their role in cardiac physiology and pathophysiology. The CaMKII holoenzyme is comprised of multiple subunits that are encoded by four different genes called CaMKIIα, β, γ, and δ. While these four genes have a high degree of sequence homology, they are expressed in different tissues. CaMKIIα and β are expressed in neuronal tissue while γ and δ are present throughout the body, including in the heart. Both CaMKIIγ and δ are alternatively spliced in the heart to generate multiple subtypes. CaMKIIδ is the predominant cardiac isoform and is alternatively spliced in the heart to generate the CaMKIIδB subtype or the slightly less abundant δC subtype. The CaMKIIδB mRNA sequence contains a 33bp insert not present in δC that codes for an 11-amino acid nuclear localization sequence (NLS. This review will focus on the localization and function of the CaMKIIδ subtypes δB and δC and the role of these subtypes in arrhythmias, contractile dysfunction, gene transcription, and the regulation of Ca2+ handling.

  6. Ca2+ homeostasis regulates Xenopus oocyte maturation.

    Science.gov (United States)

    Sun, Lu; Hodeify, Rawad; Haun, Shirley; Charlesworth, Amanda; MacNicol, Angus M; Ponnappan, Subramaniam; Ponnappan, Usha; Prigent, Claude; Machaca, Khaled

    2008-04-01

    In contrast to the well-defined role of Ca2+ signals during mitosis, the contribution of Ca2+ signaling to meiosis progression is controversial, despite several decades of investigating the role of Ca2+ and its effectors in vertebrate oocyte maturation. We have previously shown that during Xenopus oocyte maturation, Ca2+ signals are dispensable for entry into meiosis and for germinal vesicle breakdown. However, normal Ca2+ homeostasis is essential for completion of meiosis I and extrusion of the first polar body. In this study, we test the contribution of several downstream effectors in mediating the Ca2+ effects during oocyte maturation. We show that calmodulin and calcium-calmodulin-dependent protein kinase II (CAMK2) are not critical downstream Ca2+ effectors during meiotic maturation. In contrast, accumulation of Aurora kinase A (AURKA) protein is disrupted in cells deprived of Ca2+ signals. Since AURKA is required for bipolar spindle formation, failure to accumulate AURKA may contribute to the defective spindle phenotype following Ca2+ deprivation. These findings argue that Ca2+ homeostasis is important in establishing the oocyte's competence to undergo maturation in preparation for fertilization and embryonic development.

  7. Ca2+ cycling in heart cells from ground squirrels: adaptive strategies for intracellular Ca2+ homeostasis.

    Directory of Open Access Journals (Sweden)

    Xiao-Chen Li

    Full Text Available Heart tissues from hibernating mammals, such as ground squirrels, are able to endure hypothermia, hypoxia and other extreme insulting factors that are fatal for human and nonhibernating mammals. This study was designed to understand adaptive mechanisms involved in intracellular Ca(2+ homeostasis in cardiomyocytes from the mammalian hibernator, ground squirrel, compared to rat. Electrophysiological and confocal imaging experiments showed that the voltage-dependence of L-type Ca(2+ current (I(Ca was shifted to higher potentials in ventricular myocytes from ground squirrels vs. rats. The elevated threshold of I(Ca did not compromise the Ca(2+-induced Ca(2+ release, because a higher depolarization rate and a longer duration of action potential compensated the voltage shift of I(Ca. Both the caffeine-sensitive and caffeine-resistant components of cytosolic Ca(2+ removal were more rapid in ground squirrels. Ca(2+ sparks in ground squirrels exhibited larger amplitude/size and much lower frequency than in rats. Due to the high I(Ca threshold, low SR Ca(2+ leak and rapid cytosolic Ca(2+ clearance, heart cells from ground squirrels exhibited better capability in maintaining intracellular Ca(2+ homeostasis than those from rats and other nonhibernating mammals. These findings not only reveal adaptive mechanisms of hibernation, but also provide novel strategies against Ca(2+ overload-related heart diseases.

  8. Ca isotope fractionation on the moon

    Science.gov (United States)

    Russell, W. A.; Papanastassiou, D. A.; Tombrello, T. A.; Epstein, S.

    1977-01-01

    Ca has been measured in a lunar soil in order to establish the presence of isotopically mass-fractionated components. Ca was extracted by a series of water leaches after the soils were 'activated' by brief exposures to fluorine gas. The O2 obtained by this fluorination is found to have delta (O-18) of +21 per mil and to be, therefore, significantly mass-fractionated. Ca obtained in the leaches was analyzed using the double-spike technique. Very small Ca isotope fractionation is found in the leaches of this soil of up to 1 per mil per mass unit difference. The small Ca effects are in marked contrast to the measured delta (O-18) for the same sample and to large effects observed in many soils for oxygen, silicon, sulfur, and potassium. The data on Ca provide stringent constraints on models which attempt to explain the isotope mass-fractionation effects in lunar soils.

  9. Cell Biology of Ca2+-Triggered Exocytosis

    OpenAIRE

    Pang, Zhiping P.; Südhof, Thomas C.

    2010-01-01

    Ca2+ triggers many forms of exocytosis in different types of eukaryotic cells, for example synaptic vesicle exocytosis in neurons, granule exocytosis in mast cells, and hormone exocytosis in endocrine cells. Work over the last two decades has shown that synaptotagmins function as the primary Ca2+-sensors for most of these forms of exocytosis, and that synaptotagmins act via Ca2+-dependent interactions with both the fusing phospholipid membranes and the membrane fusion machinery. However, some...

  10. SR-targeted CaMKII inhibition improves SR Ca2+ handling, but accelerates cardiac remodeling in mice overexpressing CaMKIIδC

    Science.gov (United States)

    Huke, Sabine; DeSantiago, Jaime; Kaetzel, Marcia A.; Mishra, Shikha; Brown, Joan H.; Dedman, John R.; Bers, Donald M.

    2010-01-01

    Cardiac myocyte overexpression of CaMKIIδC leads to cardiac hypertrophy and heart failure (HF) possibly caused by altered myocyte Ca2+ handling. A central defect might be the marked CaMKII-induced increase in diastolic sarcoplasmic reticulum (SR) Ca2+ leak which decreases SR Ca2+ load and Ca2+ transient amplitude. We hypothesized that inhibition of CaMKII near the SR membrane would decrease the leak, improve Ca2+ handling and prevent the development of contractile dysfunction and HF. To test this hypothesis we crossbred CaMKIIδC overexpressing mice (CaMK) with mice expressing the CaMKII-inhibitor AIP targeted to the SR via a modified phospholamban (PLB)-transmembrane-domain (SR-AIP). There was a selective decrease in the amount of activated CaMKII in the microsomal (SR/membrane) fraction prepared from these double-transgenic mice (CaMK/SR-AIP) mice. In ventricular cardiomyocytes from CaMK/SR-AIP mice, SR Ca2+ leak, assessed both as diastolic Ca2+ shift into SR upon tetracaine in intact myocytes or integrated Ca2+ spark release in permeabilized myocytes, was significantly reduced. The reduced leak was accompanied by enhanced SR Ca2+ load and twitch amplitude in double-transgenic mice (vs. CaMK), without changes in SERCA expression or NCX function. However, despite the improved myocyte Ca2+ handling, cardiac hypertrophy and remodeling was accelerated in CaMK/SR-AIP and cardiac function worsened. We conclude that while inhibition of SR localized CaMKII in CaMK mice improves Ca2+ handling, it does not necessarily rescue the HF phenotype. This implies that a non-SR CaMKIIδC exerts SR-independent effects that contribute to hypertrophy and HF, and this CaMKII pathway may be exacerbated by the global enhancement of Ca transients. PMID:20971119

  11. Protein Phosphatase 2A Dephosphorylates CaBP4 and Regulates CaBP4 Function

    Science.gov (United States)

    Haeseleer, Françoise; Sokal, Izabela; Gregory, Frederick D.; Lee, Amy

    2013-01-01

    Purpose. CaBP4 is a neuronal Ca2+-binding protein that is expressed in the retina and in the cochlea, and is essential for normal photoreceptor synaptic function. CaBP4 is phosphorylated by protein kinase C zeta (PKCζ) in the retina at serine 37, which affects its interaction with and modulation of voltage-gated Cav1 Ca2+ channels. In this study, we investigated the potential role and functional significance of protein phosphatase 2A (PP2A) in CaBP4 dephosphorylation. Methods. The effect of protein phosphatase inhibitors, light, and overexpression of PP2A subunits on CaBP4 dephosphorylation was measured in in vitro assays. Pull-down experiments using retinal or transfected HEK293 cell lysates were used to investigate the association between CaBP4 and PP2A subunits. Electrophysiologic recordings of cotransfected HEK293 cells were performed to analyze the effect of CaBP4 dephosphorylation in modulating Cav1.3 currents. Results. PP2A inhibitors, okadaic acid (OA), and fostriecin, but not PP1 selective inhibitors, NIPP-1, and inhibitor 2, block CaBP4 dephosphorylation in retinal lysates. Increased phosphatase activity in light-dependent conditions reverses phosphorylation of CaBP4 by PKCζ. In HEK293 cells, overexpression of PP2A enhances the rate of dephosphorylation of CaBP4. In addition, inhibition of protein phosphatase activity by OA increases CaBP4 phosphorylation and potentiates the modulatory effect of CaBP4 on Cav1.3 Ca2+ channels in HEK293T cells. Conclusions. This study provides evidence that CaBP4 is dephosphorylated by PP2A in the retina. Our findings reveal a novel role for protein phosphatases in regulating CaBP4 function in the retina, which may fine tune presynaptic Ca2+ signals at the photoreceptor synapse. PMID:23341017

  12. Supralinear dendritic Ca2+ signalling in young developing CA1 pyramidal cells

    Science.gov (United States)

    Pohle, Jörg; Bischofberger, Josef

    2014-01-01

    Although Ca2+ is critically important in activity-dependent neuronal development, not much is known about the regulation of dendritic Ca2+ signals in developing neurons. Here, we used ratiometric Ca2+ imaging to investigate dendritic Ca2+ signalling in rat hippocampal pyramidal cells during the first 1–4 weeks of postnatal development. We show that active dendritic backpropagation of Nav channel-dependent action potentials (APs) evoked already large dendritic Ca2+ transients in animals aged 1 week with amplitudes of ∼150 nm, similar to the amplitudes of ∼160 nM seen in animals aged 4 weeks. Although the AP-evoked dendritic Ca2+ load increased about four times during the first 4 weeks, the peak amplitude of free Ca2+ concentration was balanced by a four-fold increase in Ca2+ buffer capacity κs (∼70 vs. ∼280). Furthermore, Ca2+ extrusion rates increased with postnatal development, leading to a slower decay time course (∼0.2 s vs. ∼0.1 s) and more effective temporal summation of Ca2+ signals in young cells. Most importantly, during prolonged theta-burst stimulation dendritic Ca2+ signals were up to three times larger in cells at 1 week than at 4 weeks of age and much larger than predicted by linear summation, which is attributable to an activity-dependent slow-down of Ca2+ extrusion. As Ca2+ influx is four-fold smaller in young cells, the larger Ca2+ signals are generated using four times less ATP consumption. Taken together, the data suggest that active backpropagations regulate dendritic Ca2+ signals during early postnatal development. Remarkably, during prolonged AP firing, Ca2+ signals are several times larger in young than in mature cells as a result of activity-dependent regulation of Ca2+ extrusion rates. PMID:25239458

  13. Ca(2+) signalling in the Golgi apparatus.

    Science.gov (United States)

    Pizzo, Paola; Lissandron, Valentina; Capitanio, Paola; Pozzan, Tullio

    2011-08-01

    The Golgi apparatus plays a central role in lipid and protein post-translational modification and sorting. Morphologically the organelle is heterogeneous and it is possible to distinguish stacks of flat cysternae (cis- and medial Golgi), tubular-reticular networks and vesicles (trans-Golgi). These morphological differences parallel a distinct functionality with a selective distribution and complementary roles of the enzymes found in the different compartments. The Golgi apparatus has been also shown to be involved in Ca(2+) signalling: it is indeed endowed with Ca(2+) pumps, Ca(2+) release channels and Ca(2+) binding proteins and is thought to participate in determining the spatio-temporal complexity of the Ca(2+) signal within the cell, though this role is still poorly understood. Recently, it has been demonstrated that the organelle is heterogeneous in terms of Ca(2+) handling and selective reduction of Ca(2+) concentration, both in vitro and in a genetic human disease, within one of its sub-compartment results in alterations of protein trafficking within the secretory pathway and of the entire Golgi morphology. In this paper we review the available information on the Ca(2+) toolkit within the Golgi, its heterogeneous distribution in the organelle sub-compartments and discuss the implications of these characteristics for the physiopathology of the Golgi apparatus. 2011 Elsevier Ltd. All rights reserved.

  14. Cuento: Sangre de caña

    Directory of Open Access Journals (Sweden)

    Segundo Benjamín Corredor

    1967-09-01

    Full Text Available El viento se convertía en murmullo contra las hojas de los cañaverales y contra los techos semipelados del rancho. También menguaba el calor que maduraba los plantíos de caña y que hacía más efusiva la sangre de los moradores.

  15. The delicate bistability of CaMKII.

    Science.gov (United States)

    Michalski, P J

    2013-08-06

    Calcium/calmodulin-dependent protein kinase II (CaMKII) is a synaptic, autophosphorylating kinase that is essential for learning and memory. Previous models have suggested that CaMKII functions as a bistable switch that could be the molecular correlate of long-term memory, but experiments have failed to validate these predictions. These models involved significant approximations to overcome the combinatorial complexity inherent in a multisubunit, multistate system. Here, we develop a stochastic particle-based model of CaMKII activation and dynamics that overcomes combinatorial complexity without significant approximations. We report four major findings. First, the CaMKII model system is never bistable at resting calcium concentrations, which suggests that CaMKII activity does not function as the biochemical switch underlying long-term memory. Second, the steady-state activation curves are either laserlike or steplike. Both are characterized by a well-defined threshold for activation, which suggests that thresholding is a robust feature of this system. Third, transiently activated CaMKII can maintain its activity over the time course of many experiments, and such slow deactivation may account for the few reports of bistability in the literature. And fourth, under in vivo conditions, increases in phosphatase activity can increase CaMKII activity. This is a surprising and counterintuitive effect, as dephosphorylation is generally associated with CaMKII deactivation. Copyright © 2013 Biophysical Society. Published by Elsevier Inc. All rights reserved.

  16. Ground-state correlations in sup 40 Ca and sup 48 Ca

    Energy Technology Data Exchange (ETDEWEB)

    Takayanagi, K. (Tokyo Denki Univ., Dept. of Mathematical Sciences, Saitama (Japan)); Lipparini, E. (Dipt. di Fisica, Univ. di Trento, Povo (Italy))

    1992-01-13

    Second-order perturbation theory with a G-matrix is adopted to examine from a unified point of view the effects of two-particle-two-hole correlations on the matter and momentum distributions and the occupation numbers in {sup 40}Ca and {sup 48}Ca. Polarization effects induced by the neutron excess in {sup 48}Ca are investigated in detail. (orig.).

  17. Mechanical Strain Regulates Osteoblast Proliferation Through Ca(2+)-CaMK-CREB Signal Pathway.

    Science.gov (United States)

    Guo, Yong; Lv, Qi; Zou, Xian-Qiong; Yan, Zhi-Xiong; Yan, Yu-Xian

    2016-06-20

    Objective To investigate the effects of mechanical strain on Ca(2+)-calmodulin dependent kinase (CaMK)-cAMP response element binding protein (CREB) signal pathway and proliferation of osteoblasts.Methods Using a four-point bending device, MC3T3-E1 cells were exposed to mechanical tensile strains of 2500 µs and 5000 µs at 0.5 Hz respectively. The intracellular free Ca(2+) ([Ca(2+)]i) concentration and calmodulin activity were assayed by fluorospectrophotometry, CaMK II β, CREB, and phosphorylated (activated) CREB (p-CREB) were assessed by Western blot, and cells proliferation was assayed with MTT. Pretreatment with verapamil was carried out to block Ca(2+) channel, and inhibitor U73122 was used to inhibit phospholipase C (PLC).Results Mechanical strains of 2500 µs and 5000 µs for 1 to 10 minutes both increased [Ca(2+)]i level of the cells. The 2500 µs strain, a periodicity of 1 h/d for 3 days, activated calmodulin, elevated protein levels of CaMK II β and p-CREB, and promoted cells proliferation, which were attenuated by pretreatment of verapamil or U73122. The effects of 5000 µs strain on calmodulin, CaMK II β, p-CREB and proliferation were contrary to 2500 µs strain.Conclusion The mechanical strain regulates osteoblasts proliferation through Ca(2+)-CaMK-CREB signal pathway via Ca(2+) channel and PLC/IP3 transduction cascades.

  18. AMP-activated protein kinase-mediated feedback phosphorylation controls the Ca(2+)/calmodulin (CaM) dependence of Ca(2+)/CaM-dependent protein kinase kinase β.

    Science.gov (United States)

    Nakanishi, Akihiro; Hatano, Naoya; Fujiwara, Yuya; Bin Shari, Arian; Takabatake, Shota; Akano, Hiroki; Kanayama, Naoki; Magari, Masaki; Nozaki, Naohito; Tokumitsu, Hiroshi

    2017-10-03

    The Ca(2+)/calmodulin-dependent protein kinase kinase β(CaMKKβ)/5'AMP-activated protein kinase (AMPK) phosphorylation cascade affects various Ca(2+)-dependent metabolic pathways and cancer growth. Unlike recombinant CaMKKβ that exhibits higher basal activity (autonomous activity), activation of the CaMKKβ/AMPK signaling pathway requires increased intracellular Ca(2+) concentrations. Moreover, the Ca(2+)/CaM dependence of CaMKKβ appears to arise from multiple phosphorylation events, including autophosphorylation and activities furnished by other protein kinases. However, the effects of proximal downstream kinases on CaMKKβ activity have not yet been evaluated. Here, we demonstrate feedback phosphorylation of CaMKKβ at multiple residues by CaMKKβ-activated AMPK in addition to autophosphorylation in vitro, leading to reduced autonomous, but not Ca(2+)/CaM-activated, CaMKKβ activity. MS analysis and site-directed mutagenesis of AMPK phosphorylation sites in CaMKKβ indicated that Thr144 phosphorylation by activated AMPK converts CaMKKβ into a Ca(2+)/CaM-dependent enzyme, as shown by completely Ca(2+)/CaM-dependent CaMKK activity of a phosphomimetic Thr144Glu CaMKKβ mutant. CaMKKβ mutant analysis indicated that the C-terminal domain (residues 471-587) including the autoinhibitory region plays an important role in stabilizing an inactive conformation in a Thr144 phosphorylation-dependent manner. Furthermore, immunoblot analysis with antiphospho-Thr144 antibody revealed phosphorylation of Thr144 in CaMKKβ in transfected COS-7 cells that was further enhanced by exogenous expression of AMPKα. These results indicate that AMPK-mediated feedback phosphorylation of CaMKKβ regulates the CaMKKβ/AMPK signaling cascade and may be physiologically important for intracellular maintenance of Ca(2+)-dependent AMPK activation by CaMKKβ. Copyright © 2017, The American Society for Biochemistry and Molecular Biology.

  19. Ca-Dependent Folding of Human Calumenin

    Science.gov (United States)

    Mazzorana, Marco; Hussain, Rohanah; Sorensen, Thomas

    2016-01-01

    Human calumenin (hCALU) is a six EF-hand protein belonging to the CREC family. As other members of the family, it is localized in the secretory pathway and regulates the activity of SERCA2a and of the ryanodine receptor in the endoplasmic reticulum (ER). We have studied the effects of Ca2+ binding to the protein and found it to attain a more compact structure upon ion binding. Circular Dichroism (CD) measurements suggest a major rearrangement of the protein secondary structure, which reversibly switches from disordered at low Ca2+ concentrations to predominantly alpha-helical when Ca2+ is added. SAXS experiments confirm the transition from an unfolded to a compact structure, which matches the structural prediction of a trilobal fold. Overall our experiments suggest that calumenin is a Ca2+ sensor, which folds into a compact structure, capable of interacting with its molecular partners, when Ca2+ concentration within the ER reaches the millimolar range. PMID:26991433

  20. CaMKII in the Cardiovascular System: Sensing Redox States

    Science.gov (United States)

    Erickson, Jeffrey R.; He, B. Julie; Grumbach, Isabella M.; Anderson, Mark E

    2013-01-01

    The multifunctional Ca2+ and calmodulin-dependent protein kinase II (CaMKII) is now recognized to play a central role in pathological events in the cardiovascular system. CaMKII has diverse downstream targets that promote vascular disease, heart failure and arrhythmias, so improved understanding of CaMKII signaling has the potential to lead to new therapies for cardiovascular disease. CaMKII is a multimeric serine-threonine kinase that is initially activated by binding calcified calmodulin (Ca2+/CaM). Under conditions of sustained exposure to elevated Ca2+/CaM CaMKII transitions into a Ca2+/CaM-autonomous enzyme by two distinct but parallel processes. Autophosphorylation of threonine 287 in the CaMKII regulatory domain ‘traps’ CaMKII into an open configuration even after Ca2+/CaM unbinding. More recently, our group identified a pair of methionines (281/282) in the CaMKII regulatory domain that undergo a partially reversible oxidation which, like autophosphorylation, prevents CaMKII from inactivating after Ca2+/CaM unbinding. Here we review roles of CaMKII in cardiovascular disease with an eye to understanding how CaMKII may act as a transduction signal to connect pro-oxidant conditions into specific downstream pathological effects that are relevant to rare and common forms of cardiovascular disease. PMID:21742790

  1. Sporadic Ca and Ca+ layers at mid-latitudes: Simultaneous observations and implications for their formation

    Directory of Open Access Journals (Sweden)

    M. Gerding

    2001-01-01

    Full Text Available We report on the observations of 188 sporadic layers of either Ca atoms and/or Ca ions that we have observed during 112 nights of lidar soundings of Ca, and 58 nights of Ca+ soundings, at Kühlungsborn, Germany (54° N, 12° E. The Ca+ soundings have been performed simultaneously and in a common volume with the Ca soundings by two separate lidars. Correlations between sporadic neutral and ionized metal layers are demonstrated through four case studies. A systematic study of the variations of occurrence of sporadic Ca and Ca+ layers reveals that neutral and ionized Ca layers are not as closely correlated as expected earlier: (a The altitude distribution shows the simultaneous occurrence of both sporadic Ca and Ca+ layers to be most likely only in the narrow altitude range between 90 and 95 km. Above that region, in the lower thermosphere, the sporadic ion layers are much more frequent than atom layers. Below 90 km only very few sporadic layers have been observed; (b The seasonal variation of sporadic Ca layers exhibits a minimum of occurrence in summer, while sporadic Ca+ layers do not show a significant seasonal variation (only the dense Ca+ layers appear to have a maximum in summer. At mid-latitudes sporadic Ca layers are more frequent than sporadic layers of other atmospheric metals like Na or K. For the explanation of our observations new formation mechanisms are discussed.Key words. Ionosphere (ion chemistry and composition; ionosphere-atmosphere interactions; mid-latitude ionosphere

  2. Results of measuring internal Ca absorption and Ca kinetics with /sup 47/Ca in patients suffering from chronically recurrent urolithiasis

    Energy Technology Data Exchange (ETDEWEB)

    Hoffmann, L.; Esther, G.; Serfling, D.; Bast, R. (Rostock Univ. (German Democratic Republic). Radiologische Klinik)

    1983-07-01

    47 patients with chronically recurrent calcium lithiasis (with between 3 and over 100 stone episodes) and an average age of 43.2 years have been examined. The Ca absorption lay between 42.7% and 90.0% of the dose, the average was 59.3% with a standard deviation of +- 12.9. This is higher than in persons with healthy kidneys. The Ca absorption is significantly lower in patients with renal insufficiency. Studies on Ca kinetics revealed turnover rates and pool sizes within the normal range.

  3. Ischemic damage in hippocampal CA1 is dependent on glutamate release and intact innervation from CA3

    DEFF Research Database (Denmark)

    Benveniste, H; Jørgensen, M B; Sandberg, M

    1989-01-01

    The removal of glutamatergic afferents to CA1 by destruction of the CA3 region is known to protect CA1 pyramidal cells against 10 min of transient global ischemia. To investigate further the pathogenetic significance of glutamate, we measured the release of glutamate in intact and CA3-lesioned CA1...... hippocampal tissue. In intact CA1 hippocampal tissue, glutamate increased sixfold during ischemia; in the CA3-lesioned CA1 region, however, glutamate only increased 1.4-fold during ischemia. To assess the neurotoxic potential of the ischemia-induced release of glutamate, we injected the same concentration...... of glutamate into the CA1 region as is released during ischemia in normal, CA3-lesioned, and ischemic CA1 tissue. We found that this particular concentration of glutamate was sufficient to destroy CA1 pyramids in the vicinity of the injection site in intact and CA3-lesioned CA1 tissue when administered during...

  4. Superconductivity in Ca-intercalated bilayer graphene

    Science.gov (United States)

    Mazin, I. I.; Balatsky, A. V.

    2010-10-01

    Recent observation of proximity effect [H.B. Heersche, P. Jarillo-Herrero, J.B. Oostinga, L.M.K. Vandersypen, and A.F. Morpurgo, Nature, bf 446 (2007) p. 05555.] has ignited interest in superconductivity in graphene and its derivatives. We consider Ca-intercalated graphene bilayer and argue that it is a superconductor, and likely with a sizeable T c . We find substantial and suggestive similarities between Ca-intercalated bilayer (C6CaC6), and CaC6, an established superconductor with T c = 11.5 K. In particular, the nearly free electron band, proven to be instrumental for superconductivity in intercalated graphites, does cross the chemical potential in (C6CaC6), despite the twice smaller doping level, satisfying the so-called "Cambridge criterion". Calculated properties of zone-center phonons are very similar to those of CaC6. This suggests that the critical temperature would probably be on the same scale as in CaC6.

  5. Juvenile Hippocampal CA2 Region Expresses Aggrecan

    Directory of Open Access Journals (Sweden)

    Asako Noguchi

    2017-05-01

    Full Text Available Perineuronal nets (PNNs are distributed primarily around inhibitory interneurons in the hippocampus, such as parvalbumin-positive interneurons. PNNs are also present around excitatory neurons in some brain regions and prevent plasticity in these neurons. A recent study demonstrated that PNNs also exist around mouse hippocampal pyramidal cells, which are the principle type of excitatory neurons, in the CA2 subregion and modulate the excitability and plasticity of these neurons. However, the development of PNNs in the CA2 region during postnatal maturation was not fully investigated. This study found that a main component of PNNs, aggrecan, existed in the pyramidal cell layer of the putative CA2 subarea prior to the appearance of the CA2 region, which was defined by the CA2 marker protein regulator of G protein signaling 14 (RGS14. We also found that aggrecan immunoreactivity was more evident in the anterior sections of the CA2 area than the posterior sections, which suggests that the function of CA2 PNNs varies along the anterior-posterior axis.

  6. Inhibition of CaMKK β and CaMK IV is detrimental in cerebral ischemia

    Science.gov (United States)

    McCullough, Louise D.; Tarabishy, Sami; Benashski, Sharon; Xu, Yan; Ribar, Thomas; Means, Anthony; Li, Jun

    2013-01-01

    Background and Purpose Elevation of intracellular calcium was traditionally thought to be detrimental in stroke pathology. However, clinical trials testing treatments which block calcium signaling have failed to improve outcomes in ischemic stroke. Emerging data suggest that calcium may also trigger endogenous protective pathways following stroke. CaMKK (calcium/calmodulin-dependent protein kinase kinase) is a major kinase activated by rising intracellular calcium. Compelling evidence has suggested that CaMKK and its downstream kinase CaMK IV are critical in neuronal survival when cells are under ischemic stress. We examined the functional role of CaMKK/CaMK IV signaling in stroke. Methods We utilized middle cerebral artery occlusion model in mice. Results Our data demonstrated that pharmacological and genetic inhibition of CaMKK aggravated stroke injury. Additionally, deletion of CaMKK β, one of the two CaMKK isoforms, reduced CaMK IV activation and CaMK IV deletion in mice worsened stroke outcome. Finally, CaMKK β or CaMK IV KO mice had exacerbated BBB (blood brain barrier) disruption evidenced by increased hemorrhagic transformation rates and activation of matrix metalloproteinase. We observed transcriptional inactivation including reduced levels of BCL2 (B-cell lymphoma 2) and HDAC4 (histone deacetylase 4) phosphorylation in those KO mice after stroke. Conclusions Our data has established that the CaMKK/CaMK IV pathway is a key endogenous protective mechanism in ischemia. Our results suggest that this pathway serves as important regulator of BBB integrity and transcriptional activation of neuroprotective molecules in stroke. PMID:23868268

  7. Isoflurane inhibits synaptic vesicle exocytosis through reduced Ca2+ influx, not Ca2+-exocytosis coupling.

    Science.gov (United States)

    Baumgart, Joel P; Zhou, Zhen-Yu; Hara, Masato; Cook, Daniel C; Hoppa, Michael B; Ryan, Timothy A; Hemmings, Hugh C

    2015-09-22

    Identifying presynaptic mechanisms of general anesthetics is critical to understanding their effects on synaptic transmission. We show that the volatile anesthetic isoflurane inhibits synaptic vesicle (SV) exocytosis at nerve terminals in dissociated rat hippocampal neurons through inhibition of presynaptic Ca(2+) influx without significantly altering the Ca(2+) sensitivity of SV exocytosis. A clinically relevant concentration of isoflurane (0.7 mM) inhibited changes in [Ca(2+)]i driven by single action potentials (APs) by 25 ± 3%, which in turn led to 62 ± 3% inhibition of single AP-triggered exocytosis at 4 mM extracellular Ca(2+) ([Ca(2+)]e). Lowering external Ca(2+) to match the isoflurane-induced reduction in Ca(2+) entry led to an equivalent reduction in exocytosis. These data thus indicate that anesthetic inhibition of neurotransmitter release from small SVs occurs primarily through reduced axon terminal Ca(2+) entry without significant direct effects on Ca(2+)-exocytosis coupling or on the SV fusion machinery. Isoflurane inhibition of exocytosis and Ca(2+) influx was greater in glutamatergic compared with GABAergic nerve terminals, consistent with selective inhibition of excitatory synaptic transmission. Such alteration in the balance of excitatory to inhibitory transmission could mediate reduced neuronal interactions and network-selective effects observed in the anesthetized central nervous system.

  8. A Model-Independent Algorithm to Derive Ca2+ Fluxes Underlying Local Cytosolic Ca2+ Transients

    Science.gov (United States)

    Ventura, Alejandra C.; Bruno, Luciana; Demuro, Angelo; Parker, Ian; Ponce Dawson, Silvina

    2005-01-01

    Local intracellular Ca2+ signals result from Ca2+ flux into the cytosol through individual channels or clusters of channels. To gain a mechanistic understanding of these events we need to know the magnitude and spatial distribution of the underlying Ca2+ flux. However, this is difficult to infer from fluorescence Ca2+ images because the distribution of Ca2+-bound dye is affected by poorly characterized processes including diffusion of Ca2+ ions, their binding to mobile and immobile buffers, and sequestration by Ca2+ pumps. Several methods have previously been proposed to derive Ca2+ flux from fluorescence images, but all require explicit knowledge or assumptions regarding these processes. We now present a novel algorithm that requires few assumptions and is largely model-independent. By testing the algorithm with both numerically generated image data and experimental images of sparklets resulting from Ca2+ flux through individual voltage-gated channels, we show that it satisfactorily reconstructs the magnitude and time course of the underlying Ca2+ currents. PMID:15681645

  9. Role of Ca++ in Shoot Gravitropism. [avena

    Science.gov (United States)

    Rayle, D. L.

    1985-01-01

    A cornerstone in the argument that Ca(2+) levels may regulate growth is the finding the EGTA promotes straight growth. The usual explanation for these results is that Ca(2+) chelation from cell walls results in wall loosening and thus accelerated straight growth. The ability of frozen-thawed Avena coleoptile tissue (subjected to 15g tension) to extend in response to EGTA and Quin II was examined. The EGTA when applied in weakly buffered (i.e., 0.1mM) neutral solutions initiates rapid extension. When the buffer strength is increased, similar concentrations of EGTA produce no growth response. This implies when EGTA liberated protons are released upon Ca(2+) chelation they can either initiate acid growth (low buffer conditions) or if consumed (high buffer conditions) have no effect. Thus Ca(2+) chelation in itself apparently does not result in straight growth.

  10. Pygmy dipole resonance in stable Ca isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Tertychny, G. [Institut fuer Kernphysik, Forschungszentrum Juelich, 52425 Juelich (Germany); Institute of Physics and Power Engineering, 249020 Obninsk (Russian Federation); Tselyaev, V. [Institut fuer Kernphysik, Forschungszentrum Juelich, 52425 Juelich (Germany); Institute of Physics S.Petersburg University (Russian Federation); Kamerdzhiev, S. [Institut fuer Kernphysik, Forschungszentrum Juelich, 52425 Juelich (Germany); Institute of Physics and Power Engineering, 249020 Obninsk (Russian Federation); Gruemmer, F. [Institut fuer Kernphysik, Forschungszentrum Juelich, 52425 Juelich (Germany); Krewald, S. [Institut fuer Kernphysik, Forschungszentrum Juelich, 52425 Juelich (Germany); Speth, J. [Institut fuer Kernphysik, Forschungszentrum Juelich, 52425 Juelich (Germany); Litvinova, E. [Institute of Physics and Power Engineering, 249020 Obninsk (Russian Federation); Avdeenkov, A. [Institute of Physics and Power Engineering, 249020 Obninsk (Russian Federation); Institut fuer Kernphysik, Forschungszentrum Juelich, 52425 Juelich (Germany)

    2007-05-15

    The properties of the low-lying electric dipole strength in the stable {sup 40}Ca,{sup 44}Ca and {sup 48}Ca isotopes have been calculated within the Extended Theory of Finite Fermi Systems (ETFFS). This approach is based on the random phase approximation (RPA) and includes the single-particle continuum as well as the coupling to low-lying collective states which are considered in a consistent microscopic way. For {sup 44}Ca we also include pairing correlations. A good agreement with the existing experimental data for the gross properties of the low-lying strength has been obtained. We conclude that for the detailed understanding of the low-lying dipole strength an approach like the present one is absolutely necessary.

  11. YouthCaN 2001 / Sirje Janikson

    Index Scriptorium Estoniae

    Janikson, Sirje

    2001-01-01

    Aprillis 2001 toimus keskkonnateemaline õpilaskonverents YouthCaN 2001 Ameerika Loodusajaloo Muuseumis New Yorkìs. 35 seminarist ühe viis läbi Tartu Noorte Loodusmaja geoloogia ja keskkonnaringi esindus, tutvustati loodusmaja keskkonnaprojekte ja räägiti keskkonnaalaste veebilehtede koostamise kogemustest. YouthCaN (Youth Communicating and Networking) on rahvusvaheline noorte organisatsioon, mis vahendab kogemusi ja uusi ideid elukeskkonnast huvitatud noorte hulgas

  12. Study on the isospin equilibration phenomenon in nuclear reactions 40Ca + 40Ca , 40Ca + 46Ti , 40Ca + 48Ca , 48Ca + 48Ca at 25 MeV/nucleon by using the CHIMERA multidetector

    Science.gov (United States)

    Martorana, N. S.; Auditore, L.; Berceanu, I.; Cardella, G.; Chatterjee, M. B.; De Luca, S.; De Filippo, E.; Dell'Aquila, D.; Gnoffo, B.; Lanzalone, G.; Lombardo, I.; Maiolino, C.; Norella, S.; Pagano, A.; Pagano, E. V.; Papa, M.; Pirrone, S.; Politi, G.; Porto, F.; Quattrocchi, L.; Rizzo, F.; Russotto, P.; Trifirò, A.; Trimarchi, M.; Verde, G.; Vigilante, M.

    2017-11-01

    We report on the results obtained by studying nuclear reactions between isotopes of Ca and Ti at 25 MeV/nucleon. We used the multidetector CHIMERA to detect charged reaction products. In particular, we studied two main effects: the isospin diffusion and the isospin drift. In order to study these processes we performed a moving-source analysis on kinetic energy spectra of the isobar nuclei ^{3H} and ^{3He} . This method allows to isolate the emission from the typical sources produced in reactions at Fermi energy: projectile like fragment (PLF), target like fragment (TLF), and mid-velocity (MV) emission. The obtained results are compared to previous experimental investigations and to simulations obtained with CoMD-II model.

  13. Mitochondrial Ca2+ uptake in skeletal muscle health and disease

    CERN Document Server

    Zhou, Jingsong; Yi, Jianxun

    2016-01-01

    Muscle uses Ca2+ as a messenger to control contraction and relies on ATP to maintain the intracellular Ca2+ homeostasis. Mitochondria are the major sub-cellular organelle of ATP production. With a negative inner membrane potential, mitochondria take up Ca2+ from their surroundings, a process called mitochondrial Ca2+ uptake. Under physiological conditions, Ca2+ uptake into mitochondria promotes ATP production. Excessive uptake causes mitochondrial Ca2+ overload, which activates downstream adverse responses leading to cell dysfunction. Moreover, mitochondrial Ca2+ uptake could shape spatio-temporal patterns of intracellular Ca2+ signaling. Malfunction of mitochondrial Ca2+ uptake is implicated in muscle degeneration. Unlike non-excitable cells, mitochondria in muscle cells experience dramatic changes of intracellular Ca2+ levels. Besides the sudden elevation of Ca2+ level induced by action potentials, Ca2+ transients in muscle cells can be as short as a few milliseconds during a single twitch or as long as min...

  14. Preparation and characterization of Eu 3 activated CaSiO3,(CaA ...

    Indian Academy of Sciences (India)

    Eu3+ activated CaSiO3, (Ca, Ba) SiO3 and (Ca, Sr) SiO3 have been prepared by sol–gel technique. Residual solvent and organic contents in the gel were removed by firing at 100°C for 3–4 h at 300 and 600°C for 2 h. Small exothermic shoulder around 850 to 875°C, as observed in DTA curve, corresponds to crystallization ...

  15. Ca(2+-dependent regulation of the Ca(2+ concentration in the myometrium mitochondria. II. Ca(2+ effects on mitochondria membranes polarization and [Ca(2+](m

    Directory of Open Access Journals (Sweden)

    L. G. Babich

    2017-06-01

    Full Text Available It is known that Ca2+ accumulation in the mitochondria undergoes complex regulation by Ca2+ itself. But the mechanisms of such regulation are still discussed. In this paper we have shown that Ca ions directly or indirectly regulate the level of myometrium mitochondria membranes polarization. The additions of 100 µM Ca2+ were accompanied by depolarization of the mitochondria membranes. The following experiments were designed to study the impact of Ca2+ on the myometrium mitochondria [Ca2+]m. Isolated myometrium mitochondria were preincubated without or with 10 μM Са2+ followed by 100 μM Са2+ addition. Experiments were conducted in three mediums: without ATP and Mg2+ (0-medium, in the presence of 3 mM Mg2+ (Mg-medium and 3 mM Mg2+ + 3 mM ATP (Mg,ATP-medium. It was shown that the effects of 10 μM Са2+ addition were different in different mediums, namely in 0- and Mg-medium the [Ca2+]m values increased, whereas in Mg,ATP-medium statistically reliable changes were not registered. Preincubation of mitochondria with 10 μM Са2+ did not affect the [Ca2+]m value after the addition of 100 μM Са2+. The [Ca2+]m values after 100 μM Са2+ addition were the same in 0- and Mg,ATP-mediums and somewhat lower in Mg-medium. Preliminary incubation of mitochondria with 10 μM Са2+ in 0- and Mg-mediums reduced changes of Fluo 4 normalized fluorescence values that were induced by 100 μM Са2+ additions, but in Mg,ATP-medium such differences were not recorded. It is concluded that Са2+ exchange in myometrium mitochondria is regulated by the concentration of Ca ions as in the external medium, so in the matrix of mitochondria. The medium composition had a significant impact on the [Са2+]m values in the absence of exogenous cation. It is suggested that light increase of [Са2+]m before the addition of 100 μM Са2+ may have a positive effect on the functional activity of the mitochondria.

  16. Hippocampal epileptiform activity induced by magnesium-free medium: differences between areas CA1 and CA2-3.

    Science.gov (United States)

    Lewis, D V; Jones, L S; Mott, D D

    1990-07-01

    Hippocampal slices, from which the entorhinal cortex had been removed, were exposed to artificial cerebrospinal fluid containing no magnesium (0-Mg ACSF) to elicit interictal bursts (IIBs) and electrographic seizures (EGSs). In 0-Mg ACSF, IIBs and EGSs occurred in both area CA1 and area CA3. The IIBs in CA3 led the IIBs in CA1 by several milliseconds. The epileptiform bursts occurring during the EGSs seemed to have the opposite relationship, with bursts in CA1 leading those in CA3 by several milliseconds. When the connections between CA1 and CA2-3 were cut, the IIBs ceased in CA1 and continued in CA3. To further characterize the local differences in epileptiform activity, totally separate minislices of area CA1 and area CA2-3 were prepared. In the CA2-3 minislices, a few EGSs occurred and thereafter only persistent IIBs prevailed. Conversely, in the CA1 minislices, many spontaneous EGSs occurred for long periods of time and no IIBs were seen. Periodic stimulation of the CA1 minislices triggered IIBs that suppressed the recurrent EGSs. In the hippocampal slice exposed to low magnesium, IIBs originate in CA2-3 and are propagated to CA1, where they can have a suppressant effect on EGSs. Furthermore, unlike IIBs, the bursts making up the EGSs seem to start in CA1 and invade CA2-3.

  17. Mg/Ca of Continental Ostracode Shells

    Science.gov (United States)

    Ito, E.; Forester, R. M.; Marco-Barba, J.; Mezquita, F.

    2007-12-01

    Marine ionic chemistry is thought to remain constant. This, together with the belief that marine calcifiers partition Mg/Ca in a systematic manner as functions of temperature (and Mg/Ca) of water forms the basis of the Mg/Ca thermometer. In continental settings both of these assumptions are usually not true. Continental waters contain a wide variety of solutes in absolute and relative ion concentrations. Hence, waters with identical Mg/Ca may have very different concentrations of Mg and Ca and very different anions. Here we use two examples to focus on the effects of ion chemistry on Mg/Ca partitioning in continental ostracode shells and we ignore the complexities of solute evolution, which can change Mg/Ca over timescales of minutes to millennia. Palacios-Fest and Dettman (2001) conducted a monthly study of ,Cypridopsis vidua at El Yeso Lake in Sonora, Mexico. They established a relation between temperature and average shell Mg/Ca using regression analyses on averaged data. When their Mg/Ca-temperature relation is applied to monthly ,C. vidua data from Page Pond near Cleveland, Ohio, water temperatures of -8 to -1°C are obtained. The observed Mg/Ca ranges for El Yeso Lake (0.31 to 0.46) and Page Pond (0.33 to 0.46) are similar, as are their specific conductivities (700 to 850μS for El Yeso Lake; 400 to 600μS for Page Pond). However, [Ca] is 140-260 mg/L for El Yeso, but only 70-90 mg/L for Page Pond. Page Pond data, in fact, shows a good temperature shell Mg/Ca relation for .C. vidua, but the relation is different from that at El Yeso. Hence, shell Mg/Ca is a multi-valued, family of curves function of temperature and Mg/Ca of water that depends on the [Mg] and [Ca] values in water and perhaps other factors. Our second example comes from sites near Valencia, Spain and involves shell data for ,Cyprideis torosa, an estuarine ostracode that is tolerant of a wide range of salinity and can live in continental waters as long as the carbonate alkalinity to Ca ratio is

  18. Radioisotope tracer studies of inorganic carbon and Ca in microbially derived CaCO3

    Science.gov (United States)

    Yates, Kimberly K.; Robbins, Lisa L.

    1999-01-01

    Microbial calcification significantly impacts the cycling and deposition of inorganic carbon. This research employs 45Ca and 14C techniques as radioisotopic tracers to examine the role of cellular cycling of Ca2+ and inorganic carbon in CaCO3 precipitation by the unicellular green alga Nannochloris atomus. Implications of the effects of these physiological aspects on CaCO3 precipitation and the effects of microbial calcification on CaCO3 δ13C ratios are discussed. Results from pulse/chase experiments indicate that intracellular Ca2+ is incorporated into extracellular CaCO3. Intracellular inorganic carbon leaks from cells within 10 to 12 s after injection of unlabelled NaHCO3, providing a source of inorganic carbon for extracellular CaCO3. Cellular expulsion of calcium plays a key role in increasing the CaCO3 saturation state at the site of calcification. The δ13C ratios of microbial carbonates may vary depending on the amount of photorespiratory CO2 incorporated.

  19. Negative feedback from CaSR signaling to aquaporin-2 sensitizes vasopressin to extracellular Ca2.

    Science.gov (United States)

    Ranieri, Marianna; Tamma, Grazia; Di Mise, Annarita; Russo, Annamaria; Centrone, Mariangela; Svelto, Maria; Calamita, Giuseppe; Valenti, Giovanna

    2015-07-01

    We previously described that high luminal Ca(2+) in the renal collecting duct attenuates short-term vasopressin-induced aquaporin-2 (AQP2) trafficking through activation of the Ca(2+)-sensing receptor (CaSR). Here, we evaluated AQP2 phosphorylation and permeability, in both renal HEK-293 cells and in the dissected inner medullary collecting duct, in response to specific activation of CaSR with NPS-R568. In CaSR-transfected cells, CaSR activation drastically reduced the basal levels of AQP2 phosphorylation at S256 (AQP2-pS256), thus having an opposite effect to vasopressin action. When forskolin stimulation was performed in the presence of NPS-R568, the increase in AQP2-pS256 and in the osmotic water permeability were prevented. In the freshly isolated inner mouse medullar collecting duct, stimulation with forskolin in the presence of NPS-R568 prevented the increase in AQP2-pS256 and osmotic water permeability. Our data demonstrate that the activation of CaSR in the collecting duct prevents the cAMP-dependent increase in AQP2-pS256 and water permeability, counteracting the short-term vasopressin response. By extension, our results suggest the attractive concept that CaSR expressed in distinct nephron segments exerts a negative feedback on hormones acting through cAMP, conferring high sensitivity of hormone to extracellular Ca(2+). © 2015. Published by The Company of Biologists Ltd.

  20. Effect of Ca content on equilibrium Ca isotope fractionation between orthopyroxene and clinopyroxene

    Science.gov (United States)

    Wang, Wenzhong; Zhou, Chen; Qin, Tian; Kang, Jin-Ting; Huang, Shichun; Wu, Zhongqing; Huang, Fang

    2017-12-01

    Concentration effect on equilibrium inter-mineral isotope fractionation is ubiquitous in solid solution systems, but it is not clear in which concentration range such effect is prominent. Using first-principles calculations, we examine the effect of Ca and Fe contents in orthopyroxene (opx) on its average Casbnd O bond length and the equilibrium Ca isotope fractionation factor (103lnα) between opx and clinopyroxene (cpx). Our results reveal that the average Casbnd O bond length in opx is much smaller than that in cpx and it does not change with variable Ca content x (x and y are mole ratios in CaxFeyMg1-x-ySiO3 thereafter here) when x ≤ 1/48. Incorporation of Fe (y ≥ 1/32) into opx with a fixed Ca content can only slightly increase the average Casbnd O bond length. 103lnαopx-cpx of 44Ca/40Ca is linearly correlated with the average Casbnd O bond length in opx, suggesting that 103lnαopx-cpx of 44Ca/40Ca is controlled by opx Casbnd O bond strength. Our calculations indicate that the Ca concentration effect on 103lnαopx-cpx is significant when x in opx ranges from 2/16 to 1/48, while Fe in natural opx only causes a slight decrease in 103lnαopx-cpx. Our results provide insights into Ca isotope fractionation in high-temperature geochemical processes. Given that Ca content x in opx from natural peridotites is usually lower than 1/32 and Fe content y is generally ∼10 mol%, Ca and Fe concentration effects on 103lnαopx-cpx in natural samples are negligible. Rather, 103lnαopx-cpx is mainly controlled by temperature. 103lnαopx-cpx of 44Ca/40Ca decreases from 0.50‰ to 0.26‰ when temperature increases from 1000 K to 1400 K if the Fe effect is taken into account. Therefore, if Ca isotope fractionation between opx and cpx (Δ44/40Caopx-cpx) in natural peridotites is greater than 0.50‰ or lower than 0.26‰, it may indicate disequilibrium of Ca isotopes. Finally, the large 103lnαopx-cpx relative to our current analytical precision suggests that Δ44/40Caopx

  1. Physical conditions in CaFe interstellar clouds

    OpenAIRE

    Gnacinski, P.; Krogulec, M.

    2007-01-01

    Interstellar clouds that exhibit strong Ca I and Fe I lines were called CaFe clouds. The ionisation equilibrium equations were used to model the column densities of Ca II, Ca I, K I, Na I, Fe I and Ti II in CaFe clouds. The chemical composition of CaFe clouds is that of the Solar System and no depletion of elements onto dust grains is seen. The CaFe clouds have high electron densities n=1 cm^-3 that leads to high column densities of neutral Ca and Fe.

  2. Absolute Ca Isotopic Measurement Using an Improved Double Spike Technique

    Directory of Open Access Journals (Sweden)

    Jason Jiun-San Shen

    2009-01-01

    Full Text Available A new vector analytical method has been developed in order to obtain the true isotopic composition of the 42Ca-48Ca double spike. This is achieved by using two different sample-spike mixtures combined with the double spike and natural Ca data. Be cause the natural sample (two mixtures and the spike should all lie on a single mixing line, we are able to con strain the true isotopic composition of our double spike using this new approach. Once the isotopic composition of the Ca double spike is established, we are able to obtain the true Ca isotopic composition of the NIST Ca standard SRM915a, 40Ca/44Ca = 46.537 ± 2 (2sm, n = 55, 42Ca/44Ca = 0.31031 ± 1, 43Ca/44Ca = 0.06474 ± 1, and 48Ca/44Ca = 0.08956 ± 1. De spite an off set of 1.3% in 40Ca/44Ca between our result and the previously re ported value (Russell et al. 1978, our data indicate an off set of 1.89__in 40Ca/44Ca between SRM915a and seawater, entirely consistent with the published results.

  3. Swelling-activated Ca2+ channels trigger Ca2+ signals in Merkel cells.

    Directory of Open Access Journals (Sweden)

    Henry Haeberle

    2008-03-01

    Full Text Available Merkel cell-neurite complexes are highly sensitive touch receptors comprising epidermal Merkel cells and sensory afferents. Based on morphological and molecular studies, Merkel cells are proposed to be mechanosensory cells that signal afferents via neurotransmission; however, functional studies testing this hypothesis in intact skin have produced conflicting results. To test this model in a simplified system, we asked whether purified Merkel cells are directly activated by mechanical stimulation. Cell shape was manipulated with anisotonic solution changes and responses were monitored by Ca2+ imaging with fura-2. We found that hypotonic-induced cell swelling, but not hypertonic solutions, triggered cytoplasmic Ca2+ transients. Several lines of evidence indicate that these signals arise from swelling-activated Ca2+-permeable ion channels. First, transients were reversibly abolished by chelating extracellular Ca2+, demonstrating a requirement for Ca2+ influx across the plasma membrane. Second, Ca2+ transients were initially observed near the plasma membrane in cytoplasmic processes. Third, voltage-activated Ca2+ channel (VACC antagonists reduced transients by half, suggesting that swelling-activated channels depolarize plasma membranes to activate VACCs. Finally, emptying internal Ca2+ stores attenuated transients by 80%, suggesting Ca2+ release from stores augments swelling-activated Ca2+ signals. To identify candidate mechanotransduction channels, we used RT-PCR to amplify ion-channel transcripts whose pharmacological profiles matched those of hypotonic-evoked Ca2+ signals in Merkel cells. We found 11 amplicons, including PKD1, PKD2, and TRPC1, channels previously implicated in mechanotransduction in other cells. Collectively, these results directly demonstrate that Merkel cells are activated by hypotonic-evoked swelling, identify cellular signaling mechanisms that mediate these responses, and support the hypothesis that Merkel cells contribute

  4. Analysing force-pCa curves.

    Science.gov (United States)

    Walker, John S; Li, Xiaotao; Buttrick, Peter M

    2010-07-01

    We investigated three forms of the Hill equation used to fit force-calcium data from skinned muscle experiments; Two hyperbolic forms that relate force to calcium concentration directly, and a sigmoid form that relates force to the -log(10) of the calcium concentration (pCa). The equations were fit to force-calcium data from 39 cardiac myocytes (up to five myocytes from each of nine mice) and the Hill coefficient and the calcium required for half maximal activation, expressed as a concentration (EC(50)) and as a pCa value (pCa(50)) were obtained. The pCa(50) values were normally distributed and the EC(50) values were found to approximate a log-normal distribution. Monte Carlo simulations confirmed that these distributions were intrinsic to the Hill equation. Statistical tests such as the t-test are robust to moderate levels of departure from normality as seen here, and either EC(50) or pCa(50) may be used to test for significant differences so long as it is kept in mind that ΔEC₅₀ is an additive measure of change and that ΔpCa₅₀ is a ratiometric measure of change. The Hill coefficient was found to be sufficiently log-normally distributed that log-transformed values should be used to test for statistically significant differences.

  5. Diffusion of Ca and Mg in Calcite

    Energy Technology Data Exchange (ETDEWEB)

    Cygan, R.T.; Fisler, D.K.

    1999-02-10

    The self-diffusion of Ca and the tracer diffusion of Mg in calcite have been experimentally measured using isotopic tracers of {sup 25}Mg and {sup 44}Ca. Natural single crystals of calcite were coated with a thermally-sputtered oxide thin film and then annealed in a CO{sub 2} gas at one atmosphere total pressure and temperatures from 550 to 800 C. Diffusion coefficient values were derived from the depth profiles obtained by ion microprobe analysis. The resultant activation energies for Mg tracer diffusion and Ca self-diffusion are respectively: E{sub a}(Mg) = 284 {+-} 74 kJ/mol and E{sub a}(Ca) = 271 {+-} 80 kJ/mol. For the temperature ranges in these experiments, the diffusion of Mg is faster than Ca. The results are generally consistent in magnitude with divalent cation diffusion rates obtained in previous studies and provide a means of interpreting the thermal histories of carbonate minerals, the mechanism of dolomitization, and other diffusion-controlled processes. The results indicate that cation diffusion in calcite is relatively slow and cations are the rate-limiting diffusing species for the deformation of calcite and carbonate rocks. Application of the calcite-dolomite geothermometer to metamorphic assemblages will be constrained by cation diffusion and cooling rates. The direct measurement of Mg tracer diffusion in calcite indicates that dolomitization is unlikely to be accomplished by Mg diffusion in the solid state but by a recrystallization process.

  6. Treatment of Ruptured Ovarian Endometrioma with Extremely High CA 125, Moderately High CA 19-9 and CA 15-3 Level

    Directory of Open Access Journals (Sweden)

    Muzeyyen Duran

    2013-06-01

    Full Text Available In this case report, a ruptured ovarian endometrioma with a very high CA-125 level, moderately elevated CA 19-9, and CA 15-3 levels is presented. A 20 years old patient, complaining from pelvic pain, 5 cm adnexial mass was detected on left side. Biochemical examination was revealed very high CA-125 value (2556IU/ml, moderately elevated CA 19-9 (134IU/ml, and CA 15-3 (65IU/ml values. Laparoscopy was done and a ruptured ovarian endometrioma of 5 cm was seen during operation. After the total excision of the cyst, tumor markers fell rapidly. Very high CA-125 value, moderately elevated CA19-9, and CA 15-3 values can be seen in cases with ruptured endometrioma. In young patients, endometrioma must be considered firstly and laparoscopy should be applied instead of more invasive methods unless there was any finding or strong suspicion about malignancy.

  7. Modeling the contributions of Ca2+ flows to spontaneous Ca2+ oscillations and cortical spreading depression-triggered Ca2+ waves in astrocyte networks.

    Directory of Open Access Journals (Sweden)

    Bing Li

    Full Text Available Astrocytes participate in brain functions through Ca(2+ signals, including Ca(2+ waves and Ca(2+ oscillations. Currently the mechanisms of Ca(2+ signals in astrocytes are not fully clear. Here, we present a computational model to specify the relative contributions of different Ca(2+ flows between the extracellular space, the cytoplasm and the endoplasmic reticulum of astrocytes to the generation of spontaneous Ca(2+ oscillations (CASs and cortical spreading depression (CSD-triggered Ca(2+ waves (CSDCWs in a one-dimensional astrocyte network. This model shows that CASs depend primarily on Ca(2+ released from internal stores of astrocytes, and CSDCWs depend mainly on voltage-gated Ca(2+ influx. It predicts that voltage-gated Ca(2+ influx is able to generate Ca(2+ waves during the process of CSD even after depleting internal Ca(2+ stores. Furthermore, the model investigates the interactions between CASs and CSDCWs and shows that the pass of CSDCWs suppresses CASs, whereas CASs do not prevent the generation of CSDCWs. This work quantitatively analyzes the generation of astrocytic Ca(2+ signals and indicates different mechanisms underlying CSDCWs and non-CSDCWs. Research on the different types of Ca(2+ signals might help to understand the ways by which astrocytes participate in information processing in brain functions.

  8. Intercellular Ca2+ Waves: Mechanisms and Function

    Science.gov (United States)

    Sanderson, Michael J.

    2012-01-01

    Intercellular calcium (Ca2+) waves (ICWs) represent the propagation of increases in intracellular Ca2+ through a syncytium of cells and appear to be a fundamental mechanism for coordinating multicellular responses. ICWs occur in a wide diversity of cells and have been extensively studied in vitro. More recent studies focus on ICWs in vivo. ICWs are triggered by a variety of stimuli and involve the release of Ca2+ from internal stores. The propagation of ICWs predominately involves cell communication with internal messengers moving via gap junctions or extracellular messengers mediating paracrine signaling. ICWs appear to be important in both normal physiology as well as pathophysiological processes in a variety of organs and tissues including brain, liver, retina, cochlea, and vascular tissue. We review here the mechanisms of initiation and propagation of ICWs, the key intra- and extracellular messengers (inositol 1,4,5-trisphosphate and ATP) mediating ICWs, and the proposed physiological functions of ICWs. PMID:22811430

  9. Binding of Ca Ions by Paramecium caudatum

    Science.gov (United States)

    Naitoh, Yutaka; Yasumasu, Ikuo

    1967-01-01

    Binding of 45Ca by live Paramecium caudatum was determined under various external ionic conditions. It was found that calcium uptake was separable into at least two components, a rapid and a slow one. The rapid component was influenced by the presence of certain other ions in a manner which agrees with the law of mass action. It appears that an ion exchange system may be involved in a binding equilibrium established between Paramecium, Ca++, and certain other ions. K+, Rb+, and Ba++ in the equilibrium medium are among those ions which inhibit calcium uptake. It is proposed that liberation of Ca++ from binding sites on Paramecium by an exchange reaction with competing ions is the first step in the mechanism of ciliary reversal in the response to external application of these ions. PMID:6033587

  10. Ca2+ extrusion via Na+-Ca2+ exchangers in rat odontoblasts.

    Science.gov (United States)

    Tsumura, Maki; Okumura, Reijiro; Tatsuyama, Shoko; Ichikawa, Hideki; Muramatsu, Takashi; Matsuda, Toshio; Baba, Akemichi; Suzuki, Keiko; Kajiya, Hiroshi; Sahara, Yoshinori; Tokuda, Masayuki; Momose, Yasunori; Tazaki, Masakazu; Shimono, Masaki; Shibukawa, Yoshiyuki

    2010-04-01

    Intracellular Ca(2+) is essential to many signal transduction pathways, and its level is tightly regulated by the Ca(2+) extrusion system in the plasma membrane, which includes the Na(+)-Ca(2+) exchanger (NCX). Although expression of NCX1 isoforms has been demonstrated in odontoblasts, the detailed properties of NCX remain to be clarified. In this study, we investigated localization and ion-transporting/pharmacologic properties of NCX isoforms in rat odontoblasts. We characterized both the reverse and forward modes of NCX activity in odontoblasts in a dental pulp slice preparation. Ca(2+) influx by reverse NCX activity was measured by fura-2 fluorescence. Ca(2+) efflux by forward NCX activity elicited inward Na(+) current as measured by perforated-patch clamp recording. For immunohistochemical analysis, cryostat sections of incisors were incubated with antibodies against NCX. Immunohistochemical observation revealed localization of NCX1 and NCX3 in the distal membrane of odontoblasts. Inward currents by forward NCX activity showed dependence on external Na(+). Fura-2 fluorescence measurement revealed that Ca(2+) influx by reverse NCX activity depended on extracellular Ca(2+) concentration, and that this influx was blocked by NCX inhibitor KB-R7943 in a concentration-dependent manner. However, Ca(2+) influx by NCX showed a slight sensitivity to SEA0400 (a potent NCX1 inhibitor), indicating that expression potencies in odontoblasts were NCX3 > NCX1. These results suggest that odontoblasts express NCX1 and NCX3 at the distal membrane, and that these isoforms play an important role in the Ca(2+) extrusion system as well as in the directional Ca(2+) transport pathway from the circulation to the dentin-mineralizing front. Copyright (c) 2010 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.

  11. Growth rate effects on Mg/Ca and Sr/Ca ratios constrained by belemnite calcite

    Science.gov (United States)

    Vinzenz Ullmann, Clemens

    2016-04-01

    Multiple temperature proxies from single species are important to achieve robust palaeotemperature estimates. Besides the commonly employed oxygen isotope thermometer, also Mg/Ca and Sr/Ca ratios perform well as proxies for calcification temperature in the shells of some species. While salinity changes affect the ratios of earth alkaline elements much less than the δ18O thermometer, metabolic effects may exert a strong control on the expression of element ratios. Such effects are hard to study because biomineralization experiments have to overcome large intraspecific variability and can hardly ever isolate the controls of a single parameter on shell geochemistry. The unique geometry of the belemnite rostrum constitutes an exception to this rule. Its shape, large size, and the visibility of growth increments as bands enable the analysis of multiple, correlatable, high resolution geochemical profiles in a single fossil. The effects of the growth rate variability amongst these profiles on Mg/Ca and Sr/Ca ratios has been tested here. Within a specimen of Passaloteuthis bisulcata (Early Toarcian, Cleveland Basin, UK), Mg/Ca and Sr/Ca data were obtained from four profiles. With respect to growth rate in the first profile, which was taken as a reference, the relative growth rates in the remaining three profiles varied by a factor of 0.9 to 2.7. Results suggest that relative growth rate is linearly correlated with Mg/Ca and Sr/Ca, with a decrease of Mg/Ca by 8 % and increase of Sr/Ca by 6 % per 100 % increase in relative growth rate. The observed trends are consistent with abiogenic precipitation experiments and suggest that crystal precipitation rate exerts a significant, predictable control on the element distribution in biogenic calcite.

  12. Double pion photoproduction off Ca-40

    NARCIS (Netherlands)

    Bloch, F.; Ahrens, J.; Annand, J.R.M.; Beck, R.; Fog, L.S.; Hornidge, D.; Janssen, S.; Kotulla, M.; Krusche, B.; McGeorge, J.C.; MacGregor, I.J.D.; Messchendorp, J.G.; Metag, V.; Novotny, R.; Owens, R.; Pfeiffer, M.; Rost, M.; Sanderson, R.; Schadmand, S.; Thomas, A.; Watts, D.P.

    The pbotoproduction of pi(0)pi(0) and pi(0)pi(+/-) pairs off Ca-40 has been investigated with the TAPS detector using the Glasgow photon tagging spectrometer at the Mainz MAMI accelerator. Data have been taken for incident photon energies in the energy range from 200-820MeV. Total cross-sections

  13. Numerical model of Ca(OH)

    NARCIS (Netherlands)

    Koster, T.; Peelen, W.; Larbi, J.; Rooij, M. de; Polder, R.

    2010-01-01

    A mathematical model is being developed to describe a repair method in concrete, called cathodic protection (CP). The model is in principle also useful to describe electrodeposition in concrete, e.g. the process of re-precipitation of Ca(OH)2 invoked by an electrical current. In CP, the

  14. Hippocampal CA1 Ripples as Inhibitory Transients.

    Directory of Open Access Journals (Sweden)

    Paola Malerba

    2016-04-01

    Full Text Available Memories are stored and consolidated as a result of a dialogue between the hippocampus and cortex during sleep. Neurons active during behavior reactivate in both structures during sleep, in conjunction with characteristic brain oscillations that may form the neural substrate of memory consolidation. In the hippocampus, replay occurs within sharp wave-ripples: short bouts of high-frequency activity in area CA1 caused by excitatory activation from area CA3. In this work, we develop a computational model of ripple generation, motivated by in vivo rat data showing that ripples have a broad frequency distribution, exponential inter-arrival times and yet highly non-variable durations. Our study predicts that ripples are not persistent oscillations but result from a transient network behavior, induced by input from CA3, in which the high frequency synchronous firing of perisomatic interneurons does not depend on the time scale of synaptic inhibition. We found that noise-induced loss of synchrony among CA1 interneurons dynamically constrains individual ripple duration. Our study proposes a novel mechanism of hippocampal ripple generation consistent with a broad range of experimental data, and highlights the role of noise in regulating the duration of input-driven oscillatory spiking in an inhibitory network.

  15. literacy.ca EXPRESS. April 2010

    Science.gov (United States)

    Movement for Canadian Literacy, 2010

    2010-01-01

    This issue of "literacy.ca EXPRESS" focuses on poverty. The articles included in this issue are: (1) Poverty Overview; (2) Tony's Story; (3) LAN (Learner Advisory Network) Member's Story (Dianne Smith); (4) Linking Adult Literacy to Poverty Reduction; (5) MCL (Movement for Canadian Literacy) Update; (6) Highlights from the LAN; (7) Good…

  16. Ca2+ signalling in the myocardium by (redox regulation of PKA/CaMKII

    Directory of Open Access Journals (Sweden)

    Alex S Johnston

    2015-08-01

    Full Text Available Homeostatic cardiac function is maintained by a complex network of interdependent signaling pathways which become compromised during disease progression. Excitation-contraction-coupling, the translation of an electrical signal to a contractile response is critically dependent on a tightly controlled sequence of events culminating in a rise in intracellular Ca2+ and subsequent contraction of the myocardium. Dysregulation of this Ca2+ handling system as well as increases in the production of reactive oxygen species (ROS are two major contributing factors to myocardial disease progression. ROS, generated by cellular oxidases and by-products of cellular metabolism, are highly reactive oxygen derivatives that function as key secondary messengers within the heart and contribute to normal homeostatic function. However, excessive production of ROS, as in disease, can directly interact with kinases critical for Ca2+ regulation. This post-translational oxidative modification therefore links changes in the redox status of the myocardium to phospho-regulated pathways essential for its function. This review aims to describe the oxidative regulation of the Ca2+/calmodulin-dependent kinase II (CaMKII and cAMP-dependent protein kinase A (PKA, and the subsequent impact this has on Ca2+ handling within the myocardium. Elucidating the impact of alterations in intracellular ROS production on Ca2+ dynamics through oxidative modification of key ROS sensing kinases, may provide novel therapeutic targets for preventing myocardial disease progression.

  17. Ca2+ ionophores trigger membrane remodeling without a need for store-operated Ca2+ entry.

    Science.gov (United States)

    Galitzine, Marie; Capiod, Thierry; Le Deist, Françoise; Meyer, Dominique; Freyssinet, Jean-Marie; Kerbiriou-Nabias, Danièle

    2005-02-04

    Calcium (Ca2+) ionophores are the most effective agents able to elicit rapid membrane remodeling in vitro. This process exposes aminophospholipids at the surface of platelets and blood cells, thus providing a catalytic surface for coagulation. To explore the underlying mechanism, we examined if cytosolic Ca2+ ([Ca2+]i) increase through store-operated Ca2+ entry (SOCE) was necessary for the potent effect of ionophores. Recent studies have demonstrated that the Ca2+-ATPase inhibitor thapsigargin, although able to elevate [Ca2+]i through SOCE, does not trigger the rapid membrane remodeling. However, it was not known if the additional effect of ionophores to promote the process required SOCE or could it occur independently. We took advantage of two mutant B lymphoblast cell lines, characterized either by defective SOCE or altered membrane remodeling, to simultaneously assess [Ca2+]i increase and membrane remodeling in the presence of ionophores or thapsigargin. Results imply that ionophores trigger membrane remodeling without the requirement for a functional SOCE.

  18. Mg-Ca Alloys Produced by Reduction of CaO: Understanding of ECO-Mg Alloy Production

    Science.gov (United States)

    Jung, In-Ho; Lee, Jin Kyu; Kim, Shae K.

    2017-04-01

    There have been long debates about the environment conscious (ECO) Mg technology which utilizes CaO to produce Ca-containing Mg alloys. Two key process technologies of the ECO-Mg process are the chemical reduction of CaO by liquid Mg and the maintenance of melt cleanliness during the alloying of Ca. Thermodynamic calculations using FactSage software were performed to explain these two key issues. In addition, an experimental study was performed to compare the melt cleanliness of the Ca-containing Mg alloys produced by the conventional route with metallic Ca and the ECO-Mg route with CaO.

  19. Ultrastructural and Immunohistochemical Localization of the Plasma Membrane Ca2+-ATPase 4 (PMCA4) in Ca2+-Transporting Epithelia

    DEFF Research Database (Denmark)

    Alexander, R Todd; Beggs, Megan R; Zamani, Reza

    2015-01-01

    Plasma Membrane Ca(2+)-ATPase's (PMCA) participate in epithelial Ca(2+) transport and intracellular Ca(2+) signaling. The Pmca4 isoform is enriched in distal nephron isolates and decreased in mice lacking the epithelial Ca(2+) channel, Trpv5. We therefore hypothesized that Pmca4 plays a significa...... to a housekeeping function of the pump in Ca(2+) transporting epithelia. In conclusion, Pmca4 shows a divergent expression pattern in Ca(2+) transporting epithelia, inferring diverse roles for this isoform not limited to transepithelial Ca(2+) transport....

  20. Reassigning the CaH+ 11Σ → 21Σ vibronic transition with CaD+

    Science.gov (United States)

    Condoluci, J.; Janardan, S.; Calvin, A. T.; Rugango, R.; Shu, G.; Sherrill, C. D.; Brown, K. R.

    2017-12-01

    We observe vibronic transitions in CaD+ between the 11Σ and 21Σ electronic states by resonance enhanced multiphoton photodissociation spectroscopy in a Coulomb crystal. The vibronic transitions are compared with previous measurements on CaH+. The result is a revised assignment of the CaH+ vibronic levels and a disagreement with multi-state-complete-active-space second-order perturbation theory theoretical calculations by approximately 700 cm-1. Updated high-level coupled-cluster calculations that include core-valence correlations reduce the disagreement between theory and experiment to 300 cm-1.

  1. Serum concentrations of the biomarkers CA125, CA15-3, CA72-4, tPSA and PAPP-A in natural and stimulated ovarian cycles

    Directory of Open Access Journals (Sweden)

    Melissa Stemp

    2014-06-01

    Conclusion: Ovarian stimulation reduced serum PAPP‐A levels, CA125 and CA15‐3 levels were generally unaffected by ovarian stimulation but displayed cyclical changes throughout both natural and stimulated cycles, whilst tPSA and CA72-4 were not affected by the stage of the cycle or ovarian stimulation.

  2. Precise half-life measurements for $^{38}$Ca and $^{39}$Ca

    CERN Document Server

    Blank, B; Demonchy, C-E; Borge, M J G; Matea, I; Munoz, F; Huikari, J; Dominguez-Reyes, R; Plaisir, C; Sturm, S; Canchel, G; Delahaye, P; Audirac, L; Fraile, L M; Serani, L; Lunney, D; Pedroza, J-L; Bey, A; Souin, J; Hui, Tran Trong; Delalee, F; Tengblad, O; Wenander, F

    2010-01-01

    The half-lives of Ca-38 and Ca-39 have been measured at ISOLDE of CERN. The REXTRAP facility was used to prepare ultra-clean samples of radioactive nuclei for precision decay spectroscopy. Ca-38 is one of the T-z = -1, 0(+). 0(+) beta-emitting nuclides used to determine the vector coupling constant of the weak interaction and the V-ud quark-mixing matrix element. The result obtained, T-1/2 = 443.8(19) ms, is four times more precise than the average of previous measurements. For Ca-39, a half-life of T-1/2 = 860.7(10) ms is obtained, a result in agreement with the average value from the literature.

  3. Precise half-life measurements for {sup 38}Ca and {sup 39}Ca

    Energy Technology Data Exchange (ETDEWEB)

    Blank, B.; Bey, A.; Matea, I.; Souin, J.; Audirac, L.; Canchel, G.; Delalee, F.; Demonchy, C.E.; Giovinazzo, J.; Trong Hui, Tran; Huikari, J.; Munoz, F.; Pedroza, J.L.; Plaisir, C.; Serani, L. [Universite Bordeaux 1 - UMR 5797 CNRS/IN2P3, Centre d' etudes nucleaires de Bordeaux Gradignan, Gradignan (France); Borge, M.J.G.; Dominguez-Reyes, R.; Tengblad, O. [CSIC, Instituto de Estructura de la Materia, Madrid (Spain); Delahaye, P.; Wenander, F. [CERN, Geneva (Switzerland); Fraile, L.M. [Universidad Complutense, Grupo de Fisica Nuclear, Facultad CC. Fisicas, Madrid (Spain); Lunney, D. [Universite de Paris Sud, Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse, (CNRS/IN2P3), Orsay (France); Sturm, S. [Johannes Gutenberg University, Department of Physics, Mainz (Germany)

    2010-06-15

    The half-lives of {sup 38}Ca and {sup 39}Ca have been measured at ISOLDE of CERN. The REXTRAP facility was used to prepare ultra-clean samples of radioactive nuclei for precision decay spectroscopy. {sup 38}Ca is one of the T{sub z}=-1,0{sup +} {yields}0{sup +}{beta} -emitting nuclides used to determine the vector coupling constant of the weak interaction and the V{sub ud} quark-mixing matrix element. The result obtained, T{sub 1/2}=443.8(19) ms, is four times more precise than the average of previous measurements. For {sup 39}Ca, a half-life of T{sub 1/2}=860.7(10) ms is obtained, a result in agreement with the average value from the literature. (orig.)

  4. Generation and behavior characterization of CaMKIIβ knockout mice.

    Directory of Open Access Journals (Sweden)

    Adam D Bachstetter

    Full Text Available The calcium/calmodulin-dependent protein kinase II (CaMKII is abundant in the brain, where it makes important contributions to synaptic organization and homeostasis, including playing an essential role in synaptic plasticity and memory. Four genes encode isoforms of CaMKII (α, β, δ, γ, with CaMKIIα and CaMKIIβ highly expressed in the brain. Decades of molecular and cellular research, as well as the use of a large number of CaMKIIα mutant mouse lines, have provided insight into the pivotal roles of CaMKIIα in brain plasticity and cognition. However, less is known about the CaMKIIβ isoform. We report the development and extensive behavioral and phenotypic characterization of a CaMKIIβ knockout (KO mouse. The CaMKIIβ KO mouse was found to be smaller at weaning, with an altered body mass composition. The CaMKIIβ KO mouse showed ataxia, impaired forelimb grip strength, and deficits in the rotorod, balance beam and running wheel tasks. Interestingly, the CaMKIIβ KO mouse exhibited reduced anxiety in the elevated plus maze and open field tests. The CaMKIIβ KO mouse also showed cognitive impairment in the novel object recognition task. Our results provide a comprehensive behavioral characterization of mice deficient in the β isoform of CaMKII. The neurologic phenotypes and the construction of the genotype suggest the utility of this KO mouse strain for future studies of CaMKIIβ in brain structure, function and development.

  5. Glutamate receptor activation in cultured cerebellar granule cells increases cytosolic free Ca2+ by mobilization of cellular Ca2+ and activation of Ca2+ influx

    DEFF Research Database (Denmark)

    Bouchelouche, P; Belhage, B; Frandsen, A

    1989-01-01

    The Ca2+ sensitive fluorescent probe, fura-2 has been used to monitor cytosolic free calcium levels in mature primary cultures of cerebellar granule cells during exposure to L-glutamate and other excitatory amino acids: quisqualate (QA) kainate (KA) and N-methyl-D-aspartate (NMDA). Glutamate...... at micromolar concentrations produced a prompt and dose-related increase in the intracellular concentration of free Ca2+, ([Ca2+]i), whereas QA, KA and NMDA had no effect. This increase was also seen in the absence of extracellular Ca2+, suggesting that L-glutamate promotes mobilization of Ca2+ from...

  6. Ca2+-binding protein-1 facilitates and forms a postsynaptic complex with Cav1.2 (L-type) Ca2+ channels.

    Science.gov (United States)

    Zhou, Hong; Kim, Seong-Ah; Kirk, Elizabeth A; Tippens, Alyssa L; Sun, Hong; Haeseleer, Françoise; Lee, Amy

    2004-05-12

    Ca2+-binding protein-1 (CaBP1) is a Ca2+-binding protein that is closely related to calmodulin (CaM) and localized in somatodendritic regions of principal neurons throughout the brain, but how CaBP1 participates in postsynaptic Ca2+ signaling is not known. Here, we describe a novel role for CaBP1 in the regulation of Ca2+ influx through Ca(v)1.2 (L-type) Ca2+ channels. CaBP1 interacts directly with the alpha1 subunit of Ca(v)1.2 at sites that also bind CaM. CaBP1 binding to one of these sites, the IQ domain, is Ca2+ dependent and competitive with CaM binding. The physiological significance of this interaction is supported by the association of Ca(v)1.2 and CaBP1 in postsynaptic density fractions purified from rat brain. Moreover, in double-label immunofluorescence experiments, CaBP1 and Ca(v)1.2 colocalize in numerous cell bodies and dendrites of neurons, particularly in pyramidal cells in the CA3 region of the hippocampus and in the dorsal cortex. In electrophysiological recordings of cells transfected with Ca(v)1.2, CaBP1 greatly prolonged Ca2+ currents, prevented Ca2+-dependent inactivation, and caused Ca2+-dependent facilitation of currents evoked by step depolarizations and repetitive stimuli. These effects contrast with those of CaM, which promoted strong Ca2+-dependent inactivation of Ca(v)1.2 with these same voltage protocols. Our findings reveal how Ca2+-binding proteins, such as CaM and CaBP1, differentially adjust Ca2+ influx through Ca(v)1.2 channels, which may specify diverse modes of Ca2+ signaling in neurons.

  7. Ca2+/calmodulin-dependent protein kinase II-dependent remodeling of Ca2+ current in pressure overload heart failure.

    Science.gov (United States)

    Wang, Yanggan; Tandan, Samvit; Cheng, Jun; Yang, Chunmei; Nguyen, Lan; Sugianto, Jessica; Johnstone, Janet L; Sun, Yuyang; Hill, Joseph A

    2008-09-12

    Ca(2+)/calmodulin-dependent protein kinase II (CaMKII) activity is increased in heart failure (HF), a syndrome characterized by markedly increased risk of arrhythmia. Activation of CaMKII increases peak L-type Ca(2+) current (I(Ca)) and slows I(Ca) inactivation. Whether these events are linked mechanistically is unknown. I(Ca) was recorded in acutely dissociated subepicardial and subendocardial murine left ventricular (LV) myocytes using the whole cell patch clamp method. Pressure overload heart failure was induced by surgical constriction of the thoracic aorta. I(Ca) density was significantly larger in subepicardial myocytes than in subendocardial/myocytes. Similar patterns were observed in the cell surface expression of alpha1c, the channel pore-forming subunit. In failing LV, I(Ca) density was increased proportionately in both cell types, and the time course of I(Ca) inactivation was slowed. This typical pattern of changes suggested a role of CaMKII. Consistent with this, measurements of CaMKII activity revealed a 2-3-fold increase (p process could not be induced, suggesting already maximal activation. Internal application of active CaMKII in failing myocytes did not elicit changes in I(Ca). Finally, CaMKII inhibition by internal diffusion of a specific peptide inhibitor reduced I(Ca) density and inactivation time course to similar levels in control and HF myocytes. I(Ca) density manifests a significant transmural gradient, and this gradient is preserved in heart failure. Activation of CaMKII, a known pro-arrhythmic molecule, is a major contributor to I(Ca) remodeling in load-induced heart failure.

  8. Role of Ca++, CaATPase and alkaline protease in cardiac contraction band formation.

    Science.gov (United States)

    Smith, A N; Marquet, E; Sobel, H J

    1982-07-01

    Cardiac cells' total homogenates and subcellular components Ca++, CaATPase and alkaline protease levels were matched with their respective microscopic samples in order to ascertain their role in the formation of contraction bands. It was seen that those samples having contraction bands also had a high incidence of intracellular Ca++, low CaATPase and high alkaline protease levels. This study confirms reports that contraction bands are not limited to pathological hearts (Adomian et al., 1977), but neither are they limited to artifacts related to autopsy procedures. They were seen in varying degrees of severity in hearts of healthy rats sacrificed by decapitation and less frequently with only sarcomeric involvement to absence of in animals sacrificed by diethyl ether overdose. It is postulated that the elevated Ca++ activated alkaline protease (pH 8.5) by inhibiting its inhibitor (Waxman and Krebs, 1978). It may have inhibited total CaATPase activity (Hasselbach, 1974) as well. We believe that the activated alkaline protease produced irreversible contraction bands by lysing the microhinge between light and heavy meromyosin.

  9. Ca-α1T, a fly T-type Ca2+ channel, negatively modulates sleep.

    Science.gov (United States)

    Jeong, Kyunghwa; Lee, Soyoung; Seo, Haengsoo; Oh, Yangkyun; Jang, Donghoon; Choe, Joonho; Kim, Daesoo; Lee, Jung-Ha; Jones, Walton D

    2015-12-09

    Mammalian T-type Ca(2+) channels are encoded by three separate genes (Cav3.1, 3.2, 3.3). These channels are reported to be sleep stabilizers important in the generation of the delta rhythms of deep sleep, but controversy remains. The identification of precise physiological functions for the T-type channels has been hindered, at least in part, by the potential for compensation between the products of these three genes and a lack of specific pharmacological inhibitors. Invertebrates have only one T-type channel gene, but its functions are even less well-studied. We cloned Ca-α1T, the only Cav3 channel gene in Drosophila melanogaster, expressed it in Xenopus oocytes and HEK-293 cells, and confirmed it passes typical T-type currents. Voltage-clamp analysis revealed the biophysical properties of Ca-α1T show mixed similarity, sometimes falling closer to Cav3.1, sometimes to Cav3.2, and sometimes to Cav3.3. We found Ca-α1T is broadly expressed across the adult fly brain in a pattern vaguely reminiscent of mammalian T-type channels. In addition, flies lacking Ca-α1T show an abnormal increase in sleep duration most pronounced during subjective day under continuous dark conditions despite normal oscillations of the circadian clock. Thus, our study suggests invertebrate T-type Ca(2+) channels promote wakefulness rather than stabilizing sleep.

  10. Anode process on platinum in CaCl2-CaO-based melt

    Directory of Open Access Journals (Sweden)

    K. V. Tatarenko

    2014-12-01

    Full Text Available Methods potentiostatic polarization and cyclic voltammetry obtained new data on the mechanism and kinetics of anodic processes on platinum in the molten CaCl2-KCl-CaO when 725–775 °C. Given thermodynamic values of potential difference probable total reactions in the range of the studied temperature. Using potentiostatic polarization and cyclic voltammetry obtained new data on the mechanism and kinetics of anodic process on platinum in the molten CaCl2-KCl-CaO when 725–775 °C thermodynamic assessment of the probability of occurrence total reactions during electrolysis melt on the basis of CaCl2-CaO using non-carbon anode. It is shown that at high current densities anodic process takes place mainly in the conditions of slow diffusion of electrically active particles to the anode, and at low densities (up to 10 mA/cm2 to their discharge to the atomic and lecular oxygen is preceded by a stage, which can be associated with adsorption of atoms of oxygen or with the formation of an oxide film on the surface of platinum. To detect the nature of this stage, further research is needed.

  11. Somatic PIK3CA mutations in seven patients with PIK3CA-related overgrowth spectrum.

    Science.gov (United States)

    Yeung, Kit San; Ip, Janice Jing Kun; Chow, Chin Pang; Kuong, Evelyn Yue Ling; Tam, Paul Kwong-Hang; Chan, Godfrey Chi-Fung; Chung, Brian Hon-Yin

    2017-04-01

    Somatic mutations in PIK3CA cause many overgrowth syndromes that have been recently coined the "PIK3CA-Related Overgrowth Spectrum." Here, we present seven molecularly confirmed patients with PIK3CA-Related Overgrowth Spectrum, including patients with Congenital Lipomatous Overgrowth, Vascular Malformations, Epidermal Nevi, Scoliosis/Skeletal and Spinal syndrome, Klippel-Trenaunay syndrome, lymphatic malformation and two with atypical phenotypes that cannot be classified into existing disease categories. The literature on PIK3CA-Related Overgrowth Spectrum, suggests that PIK3CA c.1258T>C; p.(Cys420Arg), c.1624G>A; p.(Glu542Lys), c.1633G>A; p.(Glu545Lys), c.3140A>G; p.(His1047Arg), and c.3140A>T; p.(His1047Leu) can be identified in approximately 90% of patients without brain overgrowth. Therefore, droplet digital polymerase chain reaction targeting these mutation hotspots could be used as the first-tier genetic test on patients with PIK3CA-Related Overgrowth Spectrum who do not have signs of overgrowth in their central nervous system. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  12. Neuronal Ca(2+) dyshomeostasis in Huntington disease.

    Science.gov (United States)

    Giacomello, Marta; Oliveros, Juan C; Naranjo, Jose R; Carafoli, Ernesto

    2013-01-01

    The expansion of the N-terminal poly-glutamine tract of the huntingtin (Htt) protein is responsible for Huntington disease (HD). A large number of studies have explored the neuronal phenotype of HD, but the molecular aethiology of the disease is still very poorly understood. This has hampered the development of an appropriate therapeutical strategy to at least alleviate its symptoms. In this short review, we have focused our attention on the alteration of a specific cellular mechanism common to all HD models, either genetic or induced by treatment with 3-NPA, i.e. the cellular dyshomeostasis of Ca(2+). We have highlighted the direct and indirect (i.e. transcriptionally mediated) effects of mutated Htt on the maintenance of the intracellular Ca(2+) balance, the correct modulation of which is fundamental to cell survival and the disturbance of which plays a key role in the death of the cell.

  13. Conversation Analysis (CA in Primary School Classrooms

    Directory of Open Access Journals (Sweden)

    Alberto Fajardo

    2008-12-01

    Full Text Available Although CA deals with all kinds of talk produced in natural contexts, this study focuses its interest on the talk produced in some primary school classrooms. It attempts to develop the construct that CA should move significantly ahead to more practical grounds where its detailed and isolated description causes some effect in improving foreign language teaching, for example. It might be used, for instance, to promote professional development in Colombia. It plans to involve pre-service teachers initially and in-service ones later. The kind of interaction promoted by trainee teachers shows a very restricted possibility for young learners to use the language meaningfully in the classroom. Four stages are defined and suggested as a path to follow with pre-service teachers at Universidad Pedagógica y Tecnológica de Colombia –UPTC– in the Foreign Language Programme - FLP.

  14. Evolution of acidic Ca²⁺ stores and their resident Ca²⁺-permeable channels.

    Science.gov (United States)

    Patel, Sandip; Cai, Xinjiang

    2015-03-01

    Acidic Ca(2+) stores refer to a collection of H(+)- and Ca(2+)-rich organelles involved in Ca(2+) signalling across taxonomic kingdoms. They include lysosomes, lysosome-related organelles, secretory vesicles, vacuoles and acidocalcisomes. Acidic Ca(2+) stores express several types of Ca(2+)-permeable channels belonging to the TRP, TPC, P2X and IP3/ryanodine receptor families. The channels have distinct phylogenomic profiles, and each acidic Ca(2+) store possesses a distinct Ca(2+) channel portfolio. The functions of acidic Ca(2+) stores appear to be conserved in processes such as signalling, membrane traffic and "auto-secretion". Thus, despite substantial variation in form, acidic Ca(2+) stores may function similarly across the natural world. Copyright © 2014 Elsevier Ltd. All rights reserved.

  15. Superconductivity in Ca-doped graphene laminates.

    Science.gov (United States)

    Chapman, J; Su, Y; Howard, C A; Kundys, D; Grigorenko, A N; Guinea, F; Geim, A K; Grigorieva, I V; Nair, R R

    2016-03-16

    Despite graphene's long list of exceptional electronic properties and many theoretical predictions regarding the possibility of superconductivity in graphene, its direct and unambiguous experimental observation has not been achieved. We searched for superconductivity in weakly interacting, metal decorated graphene crystals assembled into so-called graphene laminates, consisting of well separated and electronically decoupled graphene crystallites. We report robust superconductivity in all Ca-doped graphene laminates. They become superconducting at temperatures (Tc) between ≈4 and ≈6 K, with Tc's strongly dependent on the confinement of the Ca layer and the induced charge carrier concentration in graphene. We find that Ca is the only dopant that induces superconductivity in graphene laminates above 1.8 K among several dopants used in our experiments, such as potassium, caesium and lithium. By revealing the tunability of the superconducting response through doping and confinement of the metal layer, our work shows that achieving superconductivity in free-standing, metal decorated monolayer graphene is conditional on an optimum confinement of the metal layer and sufficient doping, thereby bringing its experimental realization within grasp.

  16. CaMKII in sinoatrial node physiology and dysfunction

    Science.gov (United States)

    Wu, Yuejin; Anderson, Mark E.

    2014-01-01

    The calcium and calmodulin-dependent protein kinase II (CaMKII) is present in sinoatrial node (SAN) pacemaker cells and is required for physiological “fight or flight” SAN beating rate responses. Inhibition of CaMKII in SAN does not affect baseline heart rate, but reduces heart rate increases in response to physiological stress. CaMKII senses intracellular calcium (Ca2+) changes, oxidation status, and hyperglycemia to phosphorylate substrates that regulate Ca2+-sensitive proteins, such as L-type Ca2+ channels, phospholamban, and cardiac ryanodine receptors (RyR2). All of these substrates are involved in the SAN pacemaking mechanism. Excessive CaMKII activity, as occurs under pathological conditions such as heart failure, ischemia, and diabetes, can promote intracellular Ca2+ overload and reactive oxygen species production. Oxidation of CaMKII (ox-CaMKII) locks CaMKII into a constitutively active configuration that contributes to SAN cell apoptosis and fibrosis. This ox-CaMKII-mediated loss of functional SAN cells contributes to SAN dysfunction (SND) and sudden death. Thus, CaMKII has emerged as a central regulator of physiological SAN responses and a key determinant of SND. PMID:24672485

  17. CaMKII in sinoatrial node physiology and dysfunction

    Directory of Open Access Journals (Sweden)

    Yuejin eWu

    2014-03-01

    Full Text Available The calcium and calmodulin dependent protein kinase II (CaMKII is present in sinoatrial node (SAN pacemaker cells and is required for physiological fight or flight SAN beating rate responses. Inhibition of CaMKII in SAN does not affect baseline heart rate, but reduces heart rate increases in response to physiological stress. CaMKII senses intracellular calcium (Ca2+ changes, oxidation status and hyperglycemia to phosphorylate substrates that regulate Ca2+-sensitive proteins, such as L-type Ca2+ channels, phospholamban (PLN, and cardiac ryanodine receptors (RyR2. All of these substrates are involved in the SAN pacemaking mechanism. Excessive CaMKII activity, as occurs under pathological conditions such as heart failure, ischemia and diabetes, can promote intracellular Ca2+ overload and reactive oxygen species (ROS production. Oxidation of CaMKII (ox-CaMKII locks CaMKII into a constitutively active configuration that contributes to SAN cell apoptosis and fibrosis. This ox-CaMKII-mediated loss of functional SAN cells contributes to sinoatrial node dysfunction (SND and sudden death. Thus, CaMKII has emerged as a central regulator of physiological SAN responses and a key determinant of SND.

  18. Selective reinnervation of hippocampal area CA1 and the fascia dentata after destruction of CA3-CA4 afferents with kainic acid.

    Science.gov (United States)

    Nadler, J V; Perry, B W; Cotman, C W

    1980-01-20

    Intraventricular injections of kainic acid were used to destroy the hippocampal CA3-CA4 cells, thus denervating the inner third of the molecular layer of the fascia dentata and stratum radiatum and stratum oriens of area CA1. The responses of intact afferents to such lesions were then examined histologically. The hippocampal mossy fibers densely reinnervated the inner portion of the dentate molecular layer after bilateral destruction of CA4 neurons and to a lesser extent after unilateral destruction. Septohippocampal fibers replaced CA4-derived fibers in the dentate molecular layer only after particularly extensive bilateral CA4 lesions. Medial perforant path fibers showed no anatomical response to any of these lesions. Neither septohippocampal, temporoammonic nor mossy fibers proliferated in or grew into the denervated laminae of area CA1. These results show a preferential ordering in the reinnervation of dentate granule cells which is not readily explained by proximity to the degenerating fibers and also that removal of CA3-CA4-derived innervation more readily elicits translaminar growth in the fascia dentata than in area CA1. These results may be relevant to clinical situations in which neurons of the hippocampal end-blade are lost.

  19. Determination of the calcium species in coal chars by Ca K-edge XANES analysis

    Science.gov (United States)

    Liu, Li-Juan; Liu, Hui-Jun; Cui, Ming-Qi; Hu, Yong-Feng; Zheng, Lei; Zhao, Yi-Dong; Ma, Chen-Yan; Xi, Shi-Bo; Yang, Dong-Liang; Guo, Zhi-Ying; Wang, Jie

    2013-02-01

    Ca-based additives have been widely used as a sulfur adsorbent during coal pyrolysis and gasification. The Ca speciation and evolution during the pyrolysis of coal with Ca additives have attracted great attention. In this paper, Ca species in the coal chars prepared from the pyrolysis of Ca(OH)2 or CaCO3-added coals are studied by using Ca K-edge X-ray absorption near-edge structural spectroscopy. The results demonstrate that Ca(OH)2, CaSO4, CaS and CaO coexist in the Ca(OH)2-added chars, while Ca(OH)2 and CaSO4 are the main species in the Ca(OH)2-added chars. Besides, a carboxyl-bound Ca is also formed during both the pyrolysis for the Ca(OH)2-added and the CaCO3-added coals. A detailed discussion about the Ca speciation is given.

  20. Constitutive activity of inwardly rectifying K+ channel at physiological [Ca]i is mediated by Ca2+/CaMK II pathway in opossum kidney proximal tubule cells.

    Science.gov (United States)

    Mori, Yoshiaki; Yoshida, Hideyo; Miyamoto, Manabu; Sohma, Yoshiro; Kubota, Takahiro

    2008-06-01

    Using patch-clamp technique, we studied the role of the Ca2+/calmodulin kinase II (CaMK II)-mediated phosphorylation process on the K+ channel with an inward conductance of 90 pS in opossum kidney proximal tubule cells (OKPCs). The intracellular Ca2+ concentration ([Ca]i) was measured by use of the fluorescent dye fura 2. The following results were obtained: (i) In cell-attached patches, the channel activity was inhibited by a decrease in [Ca]i induced by perfusion with low Ca2+ (10(-8) M), La3+ (100 microM), or EGTA/AM (100 microM) contained in the bath solution. The application of KN-62 (10 microM) or KN-93 (5 microM), inhibitors of CaMK II, also inhibited the channel activity. (ii) The membrane potential measured with nystatin-perforated patches was significantly decreased by the fall in [Ca]i induced by the perfusion with EGTA- or La(3+)-containing solution. Also, the application of KN-62 (10 microM) or KN-93 (5 microM) to the bath significantly decreased the membrane potential. (iii) In inside-out patches, the channel activity was significantly stimulated by the application of CaMK II (300 pM) at 10(-7) M Ca2+ in the bath. Furthermore, the application of KN-62 (10 microM) to the bath significantly decreased the channel activity. Our findings show that the constitutive activity of inwardly rectifying K+ channel at physiological [Ca]i is mediated by the Ca2+/CaMK II pathway in OKPCs.

  1. MicroRNA-145 suppresses ROS-induced Ca{sup 2+} overload of cardiomyocytes by targeting CaMKIIδ

    Energy Technology Data Exchange (ETDEWEB)

    Cha, Min-Ji [Cardiovascular Research Institute, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Brain Korea 21 Project for Medical Science, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Jang, Jin-Kyung [College of Pharmacy, Sookmyung Women’s University, 52 HyoChangWon-Gil, Yongsan-ku, Seoul 140-742 (Korea, Republic of); Ham, Onju; Song, Byeong-Wook; Lee, Se-Yeon [Cardiovascular Research Institute, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Brain Korea 21 Project for Medical Science, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Lee, Chang Yeon; Park, Jun-Hee [Department of Integrated Omics for Biomedical Sciences, Graduate School, Yonsei University, 50 Yonsei-ro, Seodamun-gu, Seoul 120-759 (Korea, Republic of); Lee, Jiyun; Seo, Hyang-Hee [Cardiovascular Research Institute, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Brain Korea 21 Project for Medical Science, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Choi, Eunhyun [Severance Integrative Research Institute for Cerebral and Cardiovascular Disease, Yonsei University Health System, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Jeon, Woo-min [Department of Animal Resource, Sahmyook University, Seoul 139-742 (Korea, Republic of); Hwang, Hye Jin [Cardiovascular Research Institute, Yonsei University College of Medicine, 250 Seongsanno, Seodamun-gu, Seoul 120-752 (Korea, Republic of); Shin, Hyun-Taek [College of Pharmacy, Sookmyung Women’s University, 52 HyoChangWon-Gil, Yongsan-ku, Seoul 140-742 (Korea, Republic of); and others

    2013-06-14

    Highlights: •CaMKIIδ mediates H{sub 2}O{sub 2}-induced Ca{sup 2+} overload in cardiomyocytes. •miR-145 can inhibit Ca{sup 2+} overload. •A luciferase assay confirms that miR-145 functions as a CaMKIIδ-targeting miRNA. •Overexpression of miR-145 regulates CaMKIIδ-related genes and ameliorates apoptosis. -- Abstract: A change in intracellular free calcium (Ca{sup 2+}) is a common signaling mechanism of reperfusion-induced cardiomyocyte death. Calcium/calmodulin dependent protein kinase II (CaMKII) is a critical regulator of Ca{sup 2+} signaling and mediates signaling pathways responsible for functions in the heart including hypertrophy, apoptosis, arrhythmia, and heart disease. MicroRNAs (miRNA) are involved in the regulation of cell response, including survival, proliferation, apoptosis, and development. However, the roles of miRNAs in Ca{sup 2+}-mediated apoptosis of cardiomyocytes are uncertain. Here, we determined the potential role of miRNA in the regulation of CaMKII dependent apoptosis and explored its underlying mechanism. To determine the potential roles of miRNAs in H{sub 2}O{sub 2}-mediated Ca{sup 2+} overload, we selected and tested 6 putative miRNAs that targeted CaMKIIδ, and showed that miR-145 represses CaMKIIδ protein expression and Ca{sup 2+} overload. We confirmed CaMKIIδ as a direct downstream target of miR-145. Furthermore, miR-145 regulates Ca{sup 2+}-related signals and ameliorates apoptosis. This study demonstrates that miR-145 regulates reactive oxygen species (ROS)-induced Ca{sup 2+} overload in cardiomyocytes. Thus, miR-145 affects ROS-mediated gene regulation and cellular injury responses.

  2. Modeling CaMKII-mediated regulation of L-type Ca2+ channels and ryanodine receptors in the heart

    Directory of Open Access Journals (Sweden)

    Joseph L Greenstein

    2014-04-01

    Full Text Available Excitation-contraction coupling (ECC in the cardiac myocyte is mediated by a number of highly integrated mechanisms of intracellular Ca2+ transport. Voltage- and Ca2+-dependent L-type Ca2+ channels (LCCs allow for Ca2+ entry into the myocyte, which then binds to nearby ryanodine receptors (RyRs and triggers Ca2+ release from the sarcoplasmic reticulum in a process known as Ca2+-induced Ca2+ release. The highly coordinated Ca2+-mediated interaction between LCCs and RyRs is further regulated by the cardiac isoform of the Ca2+/calmodulin-dependent protein kinase (CaMKII. Because CaMKII targets and modulates the function of many ECC proteins, elucidation of its role in ECC and integrative cellular function is challenging and much insight has been gained through the use of detailed computational models. Multiscale models that can both reconstruct the detailed nature of local signaling events within the cardiac dyad and predict their functional consequences at the level of the whole cell have played an important role in advancing our understanding of CaMKII function in ECC. Here, we review experimentally based models of CaMKII function with a focus on LCC and RyR regulation, and the mechanistic insights that have been gained through their application.

  3. Role of Ca2+/calmodulin-dependent protein kinase (CaMK) in excitation-contraction coupling in the heart.

    Science.gov (United States)

    Maier, Lars S; Bers, Donald M

    2007-03-01

    Calcium (Ca(2+)) is the central second messenger in the translation of electrical signals into mechanical activity of the heart. This highly coordinated process, termed excitation-contraction coupling or ECC, is based on Ca(2+)-induced Ca(2+) release from the sarcoplasmic reticulum (SR). In recent years it has become increasingly clear that several Ca(2+)-dependent proteins contribute to the fine tuning of ECC. One of these is the Ca(2+)/calmodulin-dependent protein kinase (CaMK) of which CaMKII is the predominant cardiac isoform. During ECC CaMKII phosphorylates several Ca(2+) handling proteins with multiple functional consequences. CaMKII may also be co-localized to distinct target proteins. CaMKII expression as well as activity are reported to be increased in heart failure and CaMKII overexpression can exert distinct and novel effects on ECC in the heart and in isolated myocytes of animals. In the present review we summarize important aspects of the role of CaMKII in ECC with an emphasis on recent novel findings.

  4. Localization of CaSR antagonists in CaSR-expressing medullary thyroid cancer.

    Science.gov (United States)

    Ding, Haiming; Yusof, Adlina Mohd; Kothandaraman, Shankaran; Saji, Motoyasu; Wang, Chaojie; Kumar, Krishan; Milum, Keisha; Carleton, Michelle; Pan, Xueliang; Ringel, Matthew D; Tweedle, Michael F; Phay, John E

    2013-11-01

    Image-based localization of medullary thyroid cancer (MTC) and parathyroid glands would improve the surgical outcomes of these diseases. MTC and parathyroid glands express high levels of calcium-sensing receptor (CaSR). The aim of this study was to prove the concept that CaSR antagonists specifically localize to CaSR-expressing tumors in vivo. We synthesized two isomers of a known CaSR calcilytic, Calhex 231, and four new analogs, which have a favorable structure for labeling. Their antagonistic activity was determined using immunoblots demonstrating decreased ERK1/2 phosphorylation after calcium stimulation in human embryonic kidney cells overexpressing CaSR. Compound 9 was further radiolabeled with (125)I and evaluated in nude mice with and without heterotransplanted xenografts of MTC cell lines, TT and MZ-CRC-1, that do and do not express CaSR, respectively. Two newly synthesized compounds, 9 and 11, exhibited better antagonistic activity than Calhex 231. The half-life of (125)I-compound 9 in nude mice without xenografts was 9.9 hours. A biodistribution study in nude mice bearing both tumors demonstrated that the uptake of radioactivity in TT tumors was higher than in MZ-CRC-1 tumors at 24 hours: 0.39 ± 0.24 vs 0.18 ± 0.12 percentage of injected dose per gram of tissue (%ID/g) (P = .002), with a ratio of 2.25 ± 0.62. Tumor-to-background ratios for TT tumors, but not MZ-CRC-1 tumors, increased with time. Tumor-to-blood values increased from 2.02 ± 0.52 at 1 hour to 3.29 ± 0.98 at 24 hour (P = .015) for TT tumors, and 1.7 ± 0.56 at 1 hour to 1.48 ± 0.33 at 24 hour (P = .36) for MZ-CRC-1 tumors. Our new CaSR antagonists specifically inhibit CaSR function in vitro, preferentially localize to CaSR-expressing tumors in vivo, and therefore have the potential to serve as scaffolds for further development as imaging pharmaceuticals.

  5. Cannabinoids disrupt memory encoding by functionally isolating hippocampal CA1 from CA3.

    Directory of Open Access Journals (Sweden)

    Roman A Sandler

    2017-07-01

    Full Text Available Much of the research on cannabinoids (CBs has focused on their effects at the molecular and synaptic level. However, the effects of CBs on the dynamics of neural circuits remains poorly understood. This study aims to disentangle the effects of CBs on the functional dynamics of the hippocampal Schaffer collateral synapse by using data-driven nonparametric modeling. Multi-unit activity was recorded from rats doing an working memory task in control sessions and under the influence of exogenously administered tetrahydrocannabinol (THC, the primary CB found in marijuana. It was found that THC left firing rate unaltered and only slightly reduced theta oscillations. Multivariate autoregressive models, estimated from spontaneous spiking activity, were then used to describe the dynamical transformation from CA3 to CA1. They revealed that THC served to functionally isolate CA1 from CA3 by reducing feedforward excitation and theta information flow. The functional isolation was compensated by increased feedback excitation within CA1, thus leading to unaltered firing rates. Finally, both of these effects were shown to be correlated with memory impairments in the working memory task. By elucidating the circuit mechanisms of CBs, these results help close the gap in knowledge between the cellular and behavioral effects of CBs.

  6. Integrated Mechanisms of CaMKII-dependent ventricular remodeling

    Directory of Open Access Journals (Sweden)

    Michael M Kreusser

    2014-03-01

    Full Text Available CaMKII has been shown to be activated during different cardiac pathological processes, and CaMKII-dependent mechanisms contribute to pathological cardiac remodeling, cardiac arrhythmias and contractile dysfunction during heart failure. Activation of CaMKII during cardiac stress results in a broad number of biological effects such as, on the one hand, acute effects due to phosphorylation of distinct cellular proteins as ion channels and calcium handling proteins and, on the other hand, integrative mechanisms by changing gene expression. This review focuses on transcriptional and epigenetic effects of CaMKII activation during chronic cardiac remodeling. Multiple mechanisms have been described how CaMKII mediates changes in cardiac gene expression. CaMKII has been shown to directly phosphorylate components of the cardiac gene regulation machinery. CaMKII phosphorylates several transcription factors such as CREB that induces the activation of specific gene programs. CaMKII activates transcriptional regulators also indirectly by phosphorylating histone deacetylases, especially HDAC4, which in turn inhibits transcription factors that drive cardiac hypertrophy, fibrosis and dysfunction. Recent studies demonstrate that CaMKII also phosphorylate directly histones, which may contribute to changes in gene expression. These findings of CaMKII-dependent gene regulation during cardiac remodeling processes suggest novel strategies for CaMKII-dependent transcriptional or epigenetic therapies to control cardiac gene expression and function. Manipulation of CaMKII-dependent signaling pathways in the settings of pathological cardiac growth, remodeling, and heart failure represents an auspicious therapeutic approach.

  7. Sensing mechanisms involved in Ca2+ and Mg2+ homeostasis

    NARCIS (Netherlands)

    Ferre, S.; Hoenderop, J.G.J.; Bindels, R.J.M.

    2012-01-01

    Calcium (Ca(2+)) and magnesium (Mg(2+)) ions are involved in many vital physiological functions. In the human body, Ca(2+) and Mg(2+) homeostatic systems rely on three components: (i) tissues (re)absorbing or storing Ca(2+) and Mg(2+), mainly kidney, intestine, and bone; (ii) hormones that modulate

  8. Longitudinal follow-up of CA125 in peritoneal effluent

    NARCIS (Netherlands)

    Ho-Dac-Pannekeet, M. M.; Hiralall, J. K.; Struijk, D. G.; Krediet, R. T.

    1997-01-01

    Mesothelial changes occur during peritoneal dialysis. CA125 provides a way to study the mesothelial cells in the in vivo situation. In the present study longitudinal changes of CA125 were analyzed. In addition, the appearance of CA125 in peritoneal effluent and day-to-day variability were studied.

  9. Enhanced sarcoplasmic reticulum Ca(2+) release following intermittent sprint training

    DEFF Research Database (Denmark)

    Ørtenblad, Niels; Lunde, Per; Levin, Kasper

    2000-01-01

    -977) arbitrary units Ca(2+). g protein(-1). min(-1) (after). The relative SR density of functional ryanodine receptors (RyR) remained unchanged after training; there was, however, a 48% (P RyR. No significant differences in Ca(2+) uptake rate and Ca(2+)-ATPase capacity were...

  10. Registration of CA0469C025C chickpea germplasm

    Science.gov (United States)

    Chickpea (Cicer arientinum L.) germplasm CA0469C025C (Reg. No. XXX; PI XXX), was released by the USDA-ARS in 2010. CA0469C025C was released based on its improved yield and reaction to Ascochyta blight relative to the popular commercial cultivars ‘Dwelley’, ‘Sierra’, and ‘Sawyer’. CA0490C025C is deri...

  11. Solid state interactions in the systems CaO(CaCO3-Fe2O3 and CuFe2O4-CaO

    Directory of Open Access Journals (Sweden)

    Boyanov B.S.

    2005-01-01

    Full Text Available The solid state interactions in the systems CaO(CaCO3-Fe2O3 and CuFe2O4-CaO have been studied using X-ray diffraction analysis. The influence of the temperature on the ferrite formation process has been investigated in the range of 900-1200 oC and duration up to 360 min. It has been shown that a mixture of ferrites forms at 1000 oC and interaction of 240 min. The exchange reactions in the systems CuFe2O4-CaO and Cu0.5Zn0.5Fe2O4-CaO have been studied, too. It has been established that Ca2+ ions exchange Cu2+ and Zn2 partially and the solubility of copper and zinc in a 7 % sulfuric acid solution increases 10-15 times.

  12. Chemical purification of CaCO{sub 3} and CaWO{sub 4} powders used for CaWO{sub 4} crystal production for the CRESST experiment

    Energy Technology Data Exchange (ETDEWEB)

    Trinh Thi, H.H.; Defay, X.; Erb, A.; Hampf, R.; Lanfranchi, J.C.; Langenkaemper, A.; Morgalyuk, V.; Muenster, A.; Mondragon, E.; Oppenheimer, C.; Potzel, W.; Schoenert, S.; Steiger, H.; Ulrich, A.; Wawoczny, S.; Willers, M.; Zoeller, A. [Physik-Department and Excellence Cluster Universe, Technische Universitaet Muenchen, Garching (Germany)

    2016-07-01

    CRESST (Cryogenic Rare Event Search with Superconducting Thermometers) uses CaWO{sub 4} single crystals as targets for the direct search for dark matter particles. Since several years these CaWO{sub 4} crystals are grown at the Technische Universitaet Muenchen. Thereby, commercially available CaCO{sub 3} and WO{sub 3} powders are used for the synthesis of CaWO{sub 4} powder. For the experiment low intrinsic contaminations of the crystals play a crucial role. In order to improve the radiopurity of the crystals it is necessary to reduce potential sources for radioactive backgrounds such as U and Th. In this poster we will present our studies of the chemical purification of the CaCO{sub 3} and CaWO{sub 4} powders.

  13. Late INa increases diastolic SR-Ca2+-leak in atrial myocardium by activating PKA and CaMKII

    Science.gov (United States)

    Fischer, Thomas H.; Herting, Jonas; Mason, Fleur E.; Hartmann, Nico; Watanabe, Saera; Nikolaev, Viacheslav O.; Sprenger, Julia U.; Fan, Peidong; Yao, Lina; Popov, Aron-Frederik; Danner, Bernhard C.; Schöndube, Friedrich; Belardinelli, Luiz; Hasenfuss, Gerd; Maier, Lars S.; Sossalla, Samuel

    2015-01-01

    Aims Enhanced cardiac late Na current (late INa) and increased sarcoplasmic reticulum (SR)-Ca2+-leak are both highly arrhythmogenic. This study seeks to identify signalling pathways interconnecting late INa and SR-Ca2+-leak in atrial cardiomyocytes (CMs). Methods and results In murine atrial CMs, SR-Ca2+-leak was increased by the late INa enhancer Anemonia sulcata toxin II (ATX-II). An inhibition of Ca2+/calmodulin-dependent protein kinase II (Autocamide-2-related inhibitory peptide), protein kinase A (H89), or late INa (Ranolazine or Tetrodotoxin) all prevented ATX-II-dependent SR-Ca2+-leak. The SR-Ca2+-leak induction by ATX-II was not detected when either the Na+/Ca2+ exchanger was inhibited (KBR) or in CaMKIIδc-knockout mice. FRET measurements revealed increased cAMP levels upon ATX-II stimulation, which could be prevented by inhibition of adenylyl cyclases (ACs) 5 and 6 (NKY 80) but not by inhibition of phosphodiesterases (IBMX), suggesting PKA activation via an AC-dependent increase of cAMP levels. Western blots showed late INa-dependent hyperphosphorylation of CaMKII as well as PKA target sites at ryanodine receptor type-2 (-S2814 and -S2808) and phospholamban (-Thr17, -S16). Enhancement of late INa did not alter Ca2+-transient amplitude or SR-Ca2+-load. However, upon late INa activation and simultaneous CaMKII inhibition, Ca2+-transient amplitude and SR-Ca2+-load were increased, whereas PKA inhibition reduced Ca2+-transient amplitude and load and additionally slowed Ca2+ elimination. In atrial CMs from patients with atrial fibrillation, inhibition of late INa, CaMKII, or PKA reduced the SR-Ca2+-leak. Conclusion Late INa exerts distinct effects on Ca2+ homeostasis in atrial myocardium through activation of CaMKII and PKA. Inhibition of late INa represents a potential approach to attenuate CaMKII activation and decreases SR-Ca2+-leak in atrial rhythm disorders. The interconnection with the cAMP/PKA system further increases the antiarrhythmic potential of late

  14. Mechanics of Old Faithful Geyser, Calistoga, CA

    Science.gov (United States)

    Rudolph, M.L.; Manga, M.; Hurwitz, Shaul; Johnston, Malcolm J.; Karlstrom, L.; Wang, Chun-Yong

    2012-01-01

    In order to probe the subsurface dynamics associated with geyser eruptions, we measured ground deformation at Old Faithful Geyser of Calistoga, CA. We present a physical model in which recharge during the period preceding an eruption is driven by pressure differences relative to the aquifer supplying the geyser. The model predicts that pressure and ground deformation are characterized by an exponential function of time, consistent with our observations. The geyser's conduit is connected to a reservoir at a depth of at least 42 m, and pressure changes in the reservoir can produce the observed ground deformations through either a poroelastic or elastic mechanical model.

  15. Studies of Ca2+ ATPase (SERCA) inhibition.

    Science.gov (United States)

    Inesi, Giuseppe; Hua, Suming; Xu, Cheng; Ma, Hailun; Seth, Malini; Prasad, Anand M; Sumbilla, Carlota

    2005-12-01

    The Ca(2+) transport ATPase of intracellular membranes (SERCA) can be inhibited by a series of chemical compounds such as Thapsigargin (TG), 2,5-di(tert-butyl)hydroquinone (DBHQ) and 1,3-dibromo-2,4,6-tris (methyl-isothio-uronium) benzene (Br(2)-TITU). These compounds have specific binding sites in the ATPase protein, and different mechanisms of inhibition. On the other hand, SERCA gene silencing offers a convenient and specific method for suppression of SERCA activity in cells. The physiological and pharmacological implications of SERCA inhibition are discussed.

  16. Functional differences in the backward shifts of CA1 and CA3 place fields in novel and familiar environments.

    Directory of Open Access Journals (Sweden)

    Eric D Roth

    Full Text Available Insight into the processing dynamics and other neurophysiological properties of different hippocampal subfields is critically important for understanding hippocampal function. In this study, we compared shifts in the center of mass (COM of CA3 and CA1 place fields in a familiar and completely novel environment. Place fields in CA1 and CA3 were simultaneously recorded as rats ran along a closed loop track in a familiar room followed by a session in a completely novel room. This process was repeated each day over a 4-day period. CA3 place fields shifted backward (opposite to the direction of motion of the rat only in novel environments. This backward shift gradually diminished across days, as the novel environment became more familiar with repeated exposures. Conversely, CA1 place fields shifted backward across all days in both familiar and novel environments. Prior studies demonstrated that CA1 place fields on average do not exhibit a backward shift during the first exposure to an environment in which the familiar cues are rearranged into a novel configuration, although CA3 place fields showed a strong backward shift. Under the completely novel conditions of the present study, no dissociation was observed between CA3 and CA1 during the first novel session (although a strong dissociation was observed in the familiar sessions and the later novel sessions. In summary, this is the first study to use simultaneous recordings in CA1 and CA3 to compare place field COM shift and other associated properties in truly novel and familiar environments. This study further demonstrates functional differentiation between CA1 and CA3 as the plasticity of CA1 place fields is affected differently by exposure to a completely novel environment in comparison to an altered, familiar environment, whereas the plasticity of CA3 place fields is affected similarly during both types of environmental novelty.

  17. Functional Differences in the Backward Shifts of CA1 and CA3 Place Fields in Novel and Familiar Environments

    OpenAIRE

    Roth, Eric D.; Yu, Xintian; Rao, Geeta; Knierim, James J.

    2012-01-01

    Insight into the processing dynamics and other neurophysiological properties of different hippocampal subfields is critically important for understanding hippocampal function. In this study, we compared shifts in the center of mass (COM) of CA3 and CA1 place fields in a familiar and completely novel environment. Place fields in CA1 and CA3 were simultaneously recorded as rats ran along a closed loop track in a familiar room followed by a session in a completely novel room. This process was re...

  18. Chloroquine Inhibits Ca2+ Signaling in Murine CD4+ Thymocytes

    Directory of Open Access Journals (Sweden)

    Jin-Chao Xu

    2015-04-01

    Full Text Available Background/Aims: Bitter-tasting chloroquine can suppress T cell activation by inhibiting Ca2+ signaling. However, the mechanism of inhibition remains largely unclear. Methods: In this study, CD4+ T cells were isolated from the thymus, and the calcium content of CD4+ thymocytes was measured using fura-2 AM and a TILL imaging system. Pyrazole-3 (Pyr3, thapsigargin (TG, and caffeine were used to assess the effects of chloroquine on the intracellular Ca2+ content of CD4+ T cells. Results: In murine CD4+ thymocytes, chloroquine decreased the TG-triggered intracellular Ca2+ increase in a dose-dependent manner. In the absence of chloroquine under Ca2+-free conditions (0 mM Ca2+ and 0.5 mM EGTA, TG induced a transient Ca2+ increase. After restoration of the extracellular Ca2+ concentration to 2 mM, a dramatic Ca2+ increase occurred. This elevation was completely blocked by chloroquine and was markedly inhibited by Pyr3, a selective antagonist of transient receptor potential C3 (TRPC3 channel and stromal interaction molecule (STIM/Orai channel. Furthermore, the TG-induced transient Ca2+ increase under Ca2+-free conditions was eliminated in the presence of chloroquine. Chloroquine also blocked the dialyzed inositol-1,4,5-trisphosphate (IP3-induced intracellular Ca2+ increase. However, chloroquine was not able to decrease the caffeine-induced Ca2+ increase. Conclusion: These data indicate that chloroquine inhibits the elevation of intracellular Ca2+ in thymic CD4+ T cells by inhibiting IP3 receptor-mediated Ca2+ release from intracellular stores and TRPC3 channel-mediated and/or STIM/Orai channel-mediated Ca2+ influx.

  19. Li/Ca, B/Ca, and Mg/Ca Composition of Cultured Sea Urchin Spines and Paleo-Echinoderms Measured Using a Secondary Ion Mass Spectrometer

    OpenAIRE

    Nguyen, Trung Timothy Do

    2013-01-01

    Element-to-calcium (X/Ca) ratios within biogenic calcium carbonate minerals are used as proxies to reconstruct past seawater temperature and composition. This study focuses on examining Li/Ca, B/Ca, and Mg/Ca ratios in sea urchins cultured at different temperatures and pCO2 levels.In situ secondary ion mass spectrometry (SIMS) analyses were conducted on two species of sea urchins cultured under controlled conditions and several species of paleo-echinoderms. A temperate species, Arbacia punctu...

  20. The diagnostic value of serum tumor markers CEA, CA19-9, CA125, CA15-3, and TPS in metastatic breast cancer.

    Science.gov (United States)

    Wang, Weigang; Xu, Xiaoqin; Tian, Baoguo; Wang, Yan; Du, Lili; Sun, Ting; Shi, Yanchun; Zhao, Xianwen; Jing, Jiexian

    2017-07-01

    This study aims to understand the diagnostic value of serum tumor markers carcinoembryonic antigen (CEA), cancer antigen 19-9 (CA19-9), cancer antigen 125 (CA125), cancer antigen 15-3 (CA15-3), and tissue polypeptide-specific antigen (TPS) in metastatic breast cancer (MBC). A total of 164 metastatic breast cancer patients in Shanxi Cancer Hospital were recruited between February 2016 and July 2016. 200 breast cancer patients without metastasis in the same period were randomly selected as the control group. The general characteristics, immunohistochemical, and pathological results were investigated between the two groups, and tumor markers were determined. There were statistical differences in the concentration and the positive rates of CEA, CA19-9, CA125, CA15-3, and TPS between the MBC and control group (Pspecificity was in CA125 for the diagnosis of MBC when using a single tumor marker at 56.7% and 97.0%, respectively. In addition, two tumor markers were used for the diagnosis of MBC and the CEA and TPS combination had the highest diagnostic sensitivity with 78.7%, while the CA15-3 and CA125 combination had the highest specificity of 91.5%. Analysis of tumor markers of 164 MBC found that there were statistical differences in the positive rates of CEA and CA15-3 between bone metastases and other metastases (χ 2 =6.00, P=0.014; χ 2 =7.32, P=0.007, respectively). The sensitivity and specificity values of the CEA and CA15-3 combination in the diagnosis of bone metastases were 77.1% and 45.8%, respectively. The positive rate of TPS in the lung metastases group was lower than in other metastases (χ 2 =8.06, P=0.005).There were significant differences in the positive rates of CA15-3 and TPS between liver metastases and other metastases (χ 2 =15.42, Pspecificity of the CA15-3 and TPS combination in the diagnosis of liver metastases were 92.3% and 45.6%, respectively, and the positive rate of CEA in triple-negative metastatic breast cancer is lower than in other

  1. Anti-tumor activity of self-charged (Eu, Ca): WO3 and Eu: CaWO4 ...

    Indian Academy of Sciences (India)

    ... nanoparticles with anti-tumor activity are synthesized in a sol–gel method by adding excessive Eu3+ and Ca2+ ions to tungsten oxide crystal structure. Colorimetric assay shows that 10 nm (Eu,Ca):WO3 and Eu:CaWO4 nanoparticles can effectively inhibit growth of mammary cancer cells without any harm to normal cells.

  2. Variability of Mg/Ca and Sr/Ca between and within the planktonic foraminifers Globigerina bulloides and Globorotalia truncatulinoides

    NARCIS (Netherlands)

    Anand-Jha, P.; Elderfield, H.

    2005-01-01

    The variability in Mg/Ca and Sr/Ca within individual tests and chambers of tests, and samples consisting of differing numbers of individuals, was determined for Globigerina bulloides and Globorotalia truncatulinoides in a North Atlantic core top sample (52.918°N 16.917°W'). The variability in Mg/Ca

  3. Intracellular alkalinization induces cytosolic Ca2+ increases by inhibiting sarco/endoplasmic reticulum Ca2+-ATPase (SERCA.

    Directory of Open Access Journals (Sweden)

    Sen Li

    Full Text Available Intracellular pH (pHi and Ca(2+ regulate essentially all aspects of cellular activities. Their inter-relationship has not been mechanistically explored. In this study, we used bases and acetic acid to manipulate the pHi. We found that transient pHi rise induced by both organic and inorganic bases, but not acidification induced by acid, produced elevation of cytosolic Ca(2+. The sources of the Ca(2+ increase are from the endoplasmic reticulum (ER Ca(2+ pools as well as from Ca(2+ influx. The store-mobilization component of the Ca(2+ increase induced by the pHi rise was not sensitive to antagonists for either IP(3-receptors or ryanodine receptors, but was due to inhibition of the sarco/endoplasmic reticulum Ca(2+-ATPase (SERCA, leading to depletion of the ER Ca(2+ store. We further showed that the physiological consequence of depletion of the ER Ca(2+ store by pHi rise is the activation of store-operated channels (SOCs of Orai1 and Stim1, leading to increased Ca(2+ influx. Taken together, our results indicate that intracellular alkalinization inhibits SERCA activity, similar to thapsigargin, thereby resulting in Ca(2+ leak from ER pools followed by Ca(2+ influx via SOCs.

  4. Ca(2+) homeostasis in the budding yeast Saccharomyces cerevisiae: Impact of ER/Golgi Ca(2+) storage.

    Science.gov (United States)

    D'hooge, Petra; Coun, Catherina; Van Eyck, Vincent; Faes, Liesbeth; Ghillebert, Ruben; Mariën, Lore; Winderickx, Joris; Callewaert, Geert

    2015-08-01

    Yeast has proven to be a powerful tool to elucidate the molecular aspects of several biological processes in higher eukaryotes. As in mammalian cells, yeast intracellular Ca(2+) signalling is crucial for a myriad of biological processes. Yeast cells also bear homologs of the major components of the Ca(2+) signalling toolkit in mammalian cells, including channels, co-transporters and pumps. Using yeast single- and multiple-gene deletion strains of various plasma membrane and organellar Ca(2+) transporters, combined with manipulations to estimate intracellular Ca(2+) storage, we evaluated the contribution of individual transport systems to intracellular Ca(2+) homeostasis. Yeast strains lacking Pmr1 and/or Cod1, two ion pumps implicated in ER/Golgi Ca(2+) homeostasis, displayed a fragmented vacuolar phenotype and showed increased vacuolar Ca(2+) uptake and Ca(2+) influx across the plasma membrane. In the pmr1Δ strain, these effects were insensitive to calcineurin activity, independent of Cch1/Mid1 Ca(2+) channels and Pmc1 but required Vcx1. By contrast, in the cod1Δ strain increased vacuolar Ca(2+) uptake was not affected by Vcx1 deletion but was largely dependent on Pmc1 activity. Our analysis further corroborates the distinct roles of Vcx1 and Pmc1 in vacuolar Ca(2+) uptake and point to the existence of not-yet identified Ca(2+) influx pathways. Copyright © 2015 Elsevier Ltd. All rights reserved.

  5. Is tissue CA125 expression in epithelial ovarian adenocarcinoma heterogenic?

    DEFF Research Database (Denmark)

    Sparholt, Morten H; Høgdall, Claus K; Nedergaard, Lotte

    2013-01-01

    diagnosed with serous ovarian adenocarcinomas were included. Preoperative blood samples were collected to determine serum CA125 levels. Tumor tissue from primary surgery was collected and processed for immunohistochemical analyses. CA125 was expressed in varying degrees in tumor tissues from all patients...... of CA125 is heterogenic. Although most patients had a high mean expression, it covers a large intrapatient variation in expression. This suggests that if using CA125 as a tissue marker and anti-CA125 (oregovomab) as immunotherapy treatment in future studies, it will be necessary to take heterogeneity...

  6. Common barrel and forward CA tracking algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Mykhailo, Pugach [Goethe-Universitaet, Frankfurt (Germany); Frankfurt Institute for Advanced Studies, Frankfurt (Germany); KINR, Kyiv (Ukraine); Gorbunov, Sergey; Kisel, Ivan [Goethe-Universitaet, Frankfurt (Germany); Frankfurt Institute for Advanced Studies, Frankfurt (Germany); Collaboration: PANDA-Collaboration

    2016-07-01

    There are complex detector setups which consist of barrel (cylindrical) and forward parts, and such systems require a special approach in the registered charged particles track finding procedure. Currently the tracking procedure might be performed in both parts of such detector independently from each other, but the final goal on this direction is a creation of a combined tracking, which will work in both parts of the detector simultaneously. The basic algorithm is based on Kalman Filter (KF) and Cellular Automata (CA). And the tracking procedure in such a complex system is rather extraordinary as far as it requires 2 different models to describe the state vector of segments of the reconstructed track in the mathematical apparatus of the KF-algorithm. To overcome this specifics a mathematical apparatus of transition matrices must be developed and implemented, so that one can transfer from one track model to another. Afterwards the work of the CA is performed, which reduces to segments sorting, their union into track-candidates and selection of the best candidates by the chi-square criteria after fitting of the track-candidate by the KF. In this report the algorithm, status and perspectives of such combined tracking are described.

  7. Klotho regulates CA1 hippocampal synaptic plasticity.

    Science.gov (United States)

    Li, Qin; Vo, Hai T; Wang, Jing; Fox-Quick, Stephanie; Dobrunz, Lynn E; King, Gwendalyn D

    2017-04-07

    Global klotho overexpression extends lifespan while global klotho-deficiency shortens it. As well, klotho protein manipulations inversely regulate cognitive function. Mice without klotho develop rapid onset cognitive impairment before they are 2months old. Meanwhile, adult mice overexpressing klotho show enhanced cognitive function, particularly in hippocampal-dependent tasks. The cognitive enhancing effects of klotho extend to humans with a klotho polymorphism that increases circulating klotho and executive function. To affect cognitive function, klotho could act in or on the synapse to modulate synaptic transmission or plasticity. However, it is not yet known if klotho is located at synapses, and little is known about its effects on synaptic function. To test this, we fractionated hippocampi and detected klotho expression in both pre and post-synaptic compartments. We find that loss of klotho enhances both pre and post-synaptic measures of CA1 hippocampal synaptic plasticity at 5weeks of age. However, a rapid loss of synaptic enhancement occurs such that by 7weeks, when mice are cognitively impaired, there is no difference from wild-type controls. Klotho overexpressing mice show no early life effects on synaptic plasticity, but decreased CA1 hippocampal long-term potentiation was measured at 6months of age. Together these data suggest that klotho affects cognition, at least in part, by regulating hippocampal synaptic plasticity. Copyright © 2017 IBRO. Published by Elsevier Ltd. All rights reserved.

  8. Leptin triggers Ca(2+) imbalance in monocytes of overweight subjects.

    Science.gov (United States)

    Padra, János Tamás; Seres, Ildikó; Fóris, Gabriella; Paragh, György; Kónya, Gabriella; Paragh, György

    2012-10-01

    Obesity is a major risk factor in numerous diseases, in which elevated intracellular Ca(2+) plays a major role in increased adiposity. We examined the difference between Ca(2+) signals in monocytes of lean and overweight subjects and the relationship between leptin induced NADPH oxidase activation and intracellular calcium concentration [Ca(2+)](i) homeostasis. Our results are as follows: (1) The basal level of [Ca(2+)](i) in resting monocytes of overweight subjects (OW monocytes) was higher than that in control cells, whereas the leptin-induced peak of the Ca(2+) signal was lower and the return to basal level was delayed. (2) Ca(2+) signals were more pronounced in OW monocytes than in control cells. (3) Using different inhibitors of cellular signaling, we found that in control cells the Ca(2+) signals originated from intracellular pools, whereas in OW cells they were generated predominantly by Ca(2+)-influx from medium. Finally, we found correlation between leptin induced superoxide anion generation and Ca(2+) signals. The disturbed [Ca(2+)](i) homeostasis in OW monocytes was fully restored in the presence of fluvastatin. Statins have pleiotropic effects involving the inhibition of free radical generation that may account for its beneficial effect on elevated [Ca(2+)](i) and consequently on the pathomechanism of obesity. Copyright © 2012 Elsevier Ltd. All rights reserved.

  9. Predictors of pretreatment CA125 at ovarian cancer diagnosis

    DEFF Research Database (Denmark)

    Babic, Ana; Cramer, Daniel W; Kelemen, Linda E

    2017-01-01

    in CA125 between studies and linear regression to estimate the association between epidemiologic factors and tumor characteristics and pretreatment CA125 levels. RESULTS: In age-adjusted models, older age, history of pregnancy, history of tubal ligation, family history of breast cancer, and family......PURPOSE: Cancer antigen 125 (CA125) is a glycoprotein expressed by epithelial cells of several normal tissue types and overexpressed by several epithelial cancers. Serum CA125 levels are mostly used as an aid in the diagnosis of ovarian cancer patients, to monitor response to treatment and detect...... cancer recurrence. Besides tumor characteristics, CA125 levels are also influenced by several epidemiologic factors, such as age, parity, and oral contraceptive use. Identifying factors that influence CA125 levels in ovarian cancer patients could aid in the interpretation of CA125 values for individuals...

  10. Preparation of Heterogeneous CaO Catalysts for Biodiesel Production

    Science.gov (United States)

    Widayat, W.; Darmawan, T.; Hadiyanto, H.; Rosyid, R. Ar

    2017-07-01

    The objective of this research was to develop heterogeneous catalysts from three CaO sources for biodiesel synthesis. The CaO catalyst were prepared from limestone, calcium hydroxide and calciun carbonate with thermal processing in a muffle furnace at 900°C.. The results showed that CaO catalyst from limestone has better characteristic than catalyst from Calcium Hydroxide and Calcium Carbonate. From morphology testing, the CaO catalyst derived from limestone formed a crystal, while The X-ray difraction analysis showed that the amount of CaO contained in limestone was the highest among the others. The yield of biodiesel obtained from the experiment was 89.98% for the catalyst from limestone; 85.15% for the catalyst Ca (OH)2; and 78.71% for CaCO3 catalyst.

  11. Structure of the CaMKIIdelta/calmodulin complex reveals the molecular mechanism of CaMKII kinase activation.

    Directory of Open Access Journals (Sweden)

    Peter Rellos

    Full Text Available UNLABELLED: Long-term potentiation (LTP, a long-lasting enhancement in communication between neurons, is considered to be the major cellular mechanism underlying learning and memory. LTP triggers high-frequency calcium pulses that result in the activation of Calcium/Calmodulin (CaM-dependent kinase II (CaMKII. CaMKII acts as a molecular switch because it remains active for a long time after the return to basal calcium levels, which is a unique property required for CaMKII function. Here we describe the crystal structure of the human CaMKIIdelta/Ca2+/CaM complex, structures of all four human CaMKII catalytic domains in their autoinhibited states, as well as structures of human CaMKII oligomerization domains in their tetradecameric and physiological dodecameric states. All four autoinhibited human CaMKIIs were monomeric in the determined crystal structures but associated weakly in solution. In the CaMKIIdelta/Ca2+/CaM complex, the inhibitory region adopted an extended conformation and interacted with an adjacent catalytic domain positioning T287 into the active site of the interacting protomer. Comparisons with autoinhibited CaMKII structures showed that binding of calmodulin leads to the rearrangement of residues in the active site to a conformation suitable for ATP binding and to the closure of the binding groove for the autoinhibitory helix by helix alphaD. The structural data, together with biophysical interaction studies, reveals the mechanism of CaMKII activation by calmodulin and explains many of the unique regulatory properties of these two essential signaling molecules. ENHANCED VERSION: This article can also be viewed as an enhanced version in which the text of the article is integrated with interactive 3-D representations and animated transitions. Please note that a web plugin is required to access this enhanced functionality. Instructions for the installation and use of the Web plugin are available in Text S1.

  12. Simulation of Ca2+-activated Cl- current of cardiomyocytes in rabbit pulmonary vein: implications of subsarcolemmal Ca2+ dynamics.

    Science.gov (United States)

    Leem, Chae Hun; Kim, Won Tae; Ha, Jeong Mi; Lee, Yoon Jin; Seong, Hyeon Chan; Choe, Han; Jang, Yeon Jin; Youm, Jae Boum; Earm, Yung E

    2006-05-15

    In recent studies, we recorded transiently activated outward currents by the application of three-step voltage pulses to induce a reverse mode of Na+-Ca2+ exchange (NCX). We found that these currents were mediated by a Ca2+-activated Cl- current. Based on the recent reports describing the atrial Ca2+ transients, the Ca2+ transient at the subsarcolemmal space was initiated and then diffused into the cytosolic space. Because the myocardium in the pulmonary vein is an extension of the atrium, the Ca2+-activated Cl- current may reflect the subsarcolemmal Ca2+ dynamics. We tried to predict the subsarcolemmal Ca2+ dynamics by simulating these current traces. According to recent reports on the geometry of atrial myocytes, we assumed that there were three compartments of sarcoplasmic reticulum (SR): a network SR, a junctional SR and a central SR. Based on these structures, we also divided the cytosolic space into three compartments: the junctional, subsarcolemmal and cytosolic spaces. Geometry information and cellular capacitance suggested that there were essentially no T-tubules in these cells. The basic physical data, such as the compartmental volumes, the diffusion coefficients and the stability coefficients of the Ca2+ buffers, were obtained from the literature. In the simulation, we incorporated the NCX, the L-type Ca2+ channel, the rapid activating outward rectifier K+ channel, the Na+-K+ pump, the SR Ca2+-pump, the ryanodine receptor, the Ca2+-activated Cl- channel and the dynamics of Na+, K+, Ca2+ and Cl-. In these conditions, we could successfully reconstruct the Ca2+-activated Cl- currents. The simulation allowed estimation of the Ca2+ dynamics of each compartment and the distribution of the Ca2+-activated Cl- channel and the NCX in the sarcolemma on the junctional or subsarcolemmal space.

  13. Mitochondria Maintain Distinct Ca2+Pools in Cone Photoreceptors.

    Science.gov (United States)

    Giarmarco, Michelle M; Cleghorn, Whitney M; Sloat, Stephanie R; Hurley, James B; Brockerhoff, Susan E

    2017-02-22

    Ca 2+ ions have distinct roles in the outer segment, cell body, and synaptic terminal of photoreceptors. We tested the hypothesis that distinct Ca 2+ domains are maintained by Ca 2+ uptake into mitochondria. Serial block face scanning electron microscopy of zebrafish cones revealed that nearly 100 mitochondria cluster at the apical side of the inner segment, directly below the outer segment. The endoplasmic reticulum surrounds the basal and lateral surfaces of this cluster, but does not reach the apical surface or penetrate into the cluster. Using genetically encoded Ca 2+ sensors, we found that mitochondria take up Ca 2+ when it accumulates either in the cone cell body or outer segment. Blocking mitochondrial Ca 2+ uniporter activity compromises the ability of mitochondria to maintain distinct Ca 2+ domains. Together, our findings indicate that mitochondria can modulate subcellular functional specialization in photoreceptors. SIGNIFICANCE STATEMENT Ca 2+ homeostasis is essential for the survival and function of retinal photoreceptors. Separate pools of Ca 2+ regulate phototransduction in the outer segment, metabolism in the cell body, and neurotransmitter release at the synaptic terminal. We investigated the role of mitochondria in compartmentalization of Ca 2+ We found that mitochondria form a dense cluster that acts as a diffusion barrier between the outer segment and cell body. The cluster is surprisingly only partially surrounded by the endoplasmic reticulum, a key mediator of mitochondrial Ca 2+ uptake. Blocking the uptake of Ca 2+ by mitochondria causes redistribution of Ca 2+ throughout the cell. Our results show that mitochondrial Ca 2+ uptake in photoreceptors is complex and plays an essential role in normal function. Copyright © 2017 the authors 0270-6474/17/372061-12$15.00/0.

  14. Synaptotagmin-7 is a principal Ca2+ sensor for Ca2+ -induced glucagon exocytosis in pancreas

    DEFF Research Database (Denmark)

    Gustavsson, Natalia; Wei, Shun-Hui; Hoang, Dong Nhut

    2009-01-01

    secretion from beta-cells, even though insulin and glucagon together regulate blood glucose levels. To address these issues, we analysed the role of synaptotagmins in Ca(2+)-triggered glucagon exocytosis. Surprisingly, we find that deletion of a single synaptotagmin isoform, synaptotagmin-7, nearly...

  15. Differential effect of transpiration and Ca supply on growth and Ca concentration of tomato plants

    NARCIS (Netherlands)

    Amor, del F.M.; Marcelis, L.F.M.

    2006-01-01

    To determine the extent to which transpiration and Ca concentration in the nutrient solution affect the regulation of growth, two independent experiments with young tomato plants were carried out under fully controlled climate conditions and grown hydroponically. The first experiment consisted of

  16. Over-expression of the DCLK gene transcript CARP decreases CA3/CA1 network excitability

    NARCIS (Netherlands)

    Schenk, G.J.; Werkman, T.; Wadman, W.; Veldhuisen, B.; Dijkmans, T.F.; Blaas, E.; Kegel, L.; de Kloet, E.R.; Vreugdenhil, E.

    2010-01-01

    Products of the Doublecortin Like Kinase (DCLK) gene are implicated in cortical migration and hippocampal maturation during embryogenesis. However, one of its splice variants, called CaMK Related Peptide (CARP), is expressed during adulthood in response to neurological stimuli, such as kainic

  17. Pycnogenol protects CA3-CA1 synaptic function in a rat model of traumatic brain injury.

    Science.gov (United States)

    Norris, Christopher M; Sompol, Pradoldej; Roberts, Kelly N; Ansari, Mubeen; Scheff, Stephen W

    2016-02-01

    Pycnogenol (PYC) is a patented mix of bioflavonoids with potent anti-oxidant and anti-inflammatory properties. Previously, we showed that PYC administration to rats within hours after a controlled cortical impact (CCI) injury significantly protects against the loss of several synaptic proteins in the hippocampus. Here, we investigated the effects of PYC on CA3-CA1 synaptic function following CCI. Adult Sprague-Dawley rats received an ipsilateral CCI injury followed 15 min later by intravenous injection of saline vehicle or PYC (10 mg/kg). Hippocampal slices from the injured (ipsilateral) and uninjured (contralateral) hemispheres were prepared at seven and fourteen days post-CCI for electrophysiological analyses of CA3-CA1 synaptic function and induction of long-term depression (LTD). Basal synaptic strength was impaired in slices from the ipsilateral, relative to the contralateral, hemisphere at seven days post-CCI and susceptibility to LTD was enhanced in the ipsilateral hemisphere at both post-injury timepoints. No interhemispheric differences in basal synaptic strength or LTD induction were observed in rats treated with PYC. The results show that PYC preserves synaptic function after CCI and provides further rationale for investigating the use of PYC as a therapeutic in humans suffering from neurotrauma. Copyright © 2015 Elsevier Inc. All rights reserved.

  18. Synthesis of Al₂Ca Dispersoids by Powder Metallurgy Using a Mg-Al Alloy and CaO Particles.

    Science.gov (United States)

    Fujita, Junji; Umeda, Junko; Kondoh, Katsuyoshi

    2017-06-28

    The elemental mixture of Mg-6 wt %Al-1 wt %Zn-0.3 wt %Mn (AZ61B) alloy powder and CaO particles was consolidated by an equal-channel angular bulk mechanical alloying (ECABMA) process to form a composite precursor. Subsequently, the precursor was subjected to a heat treatment to synthesize fine Al₂Ca particles via a solid-state reaction between the Mg-Al matrix and CaO additives. Scanning electron microscopy-energy-dispersive spectroscopy (SEM-EDS) and electron probe micro-analysis on the precursor indicated that 4.7-at % Al atoms formed a supersaturated solid solution in the α-Mg matrix. Transmission electron microscopy-EDS and X-ray diffraction analyses on the AZ61B composite precursor with 10-vol % CaO particles obtained by heat treatment confirmed that CaO additives were thermally decomposed in the Mg-Al alloy, and the solid-soluted Ca atoms diffused along the α-Mg grain boundaries. Al atoms also diffused to the grain boundaries because of attraction to the Ca atoms resulting from a strong reactivity between Al and Ca. As a result, needle-like (Mg,Al)₂Ca intermetallics were formed as intermediate precipitates in the initial reaction stage during the heat treatment. Finally, the precipitates were transformed into spherical Al₂Ca particles by the substitution of Al atoms for Mg atoms in (Mg,Al)₂Ca after a long heat treatment.

  19. The mitochondrial Na+/Ca2+ exchanger upregulates glucose dependent Ca2+ signalling linked to insulin secretion.

    Directory of Open Access Journals (Sweden)

    Iulia I Nita

    Full Text Available Mitochondria mediate dual metabolic and Ca(2+ shuttling activities. While the former is required for Ca(2+ signalling linked to insulin secretion, the role of the latter in β cell function has not been well understood, primarily because the molecular identity of the mitochondrial Ca(2+ transporters were elusive and the selectivity of their inhibitors was questionable. This study focuses on NCLX, the recently discovered mitochondrial Na(+/Ca(2+ exchanger that is linked to Ca(2+ signalling in MIN6 and primary β cells. Suppression either of NCLX expression, using a siRNA construct (siNCLX or of its activity, by a dominant negative construct (dnNCLX, enhanced mitochondrial Ca(2+ influx and blocked efflux induced by glucose or by cell depolarization. In addition, NCLX regulated basal, but not glucose-dependent changes, in metabolic rate, mitochondrial membrane potential and mitochondrial resting Ca(2+. Importantly, NCLX controlled the rate and amplitude of cytosolic Ca(2+ changes induced by depolarization or high glucose, indicating that NCLX is a critical and rate limiting component in the cross talk between mitochondrial and plasma membrane Ca(2+ signalling. Finally, knockdown of NCLX expression was followed by a delay in glucose-dependent insulin secretion. These findings suggest that the mitochondrial Na(+/Ca(2+ exchanger, NCLX, shapes glucose-dependent mitochondrial and cytosolic Ca(2+ signals thereby regulating the temporal pattern of insulin secretion in β cells.

  20. PGC-1{alpha} accelerates cytosolic Ca{sup 2+} clearance without disturbing Ca{sup 2+} homeostasis in cardiac myocytes

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Min, E-mail: chenminyx@gmail.com [Institute of Molecular Medicine, State Key Laboratory of Biomembrane and Membrane Biotechnology, Peking University, Beijing 100871 (China); Yunnan Centers for Diseases Prevention and Control, Kunming 650022 (China); Wang, Yanru [Institute of Molecular Medicine, State Key Laboratory of Biomembrane and Membrane Biotechnology, Peking University, Beijing 100871 (China); Qu, Aijuan [Laboratory of Metabolism, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States)

    2010-06-11

    Energy metabolism and Ca{sup 2+} handling serve critical roles in cardiac physiology and pathophysiology. Peroxisome proliferator-activated receptor gamma coactivator 1 alpha (PGC-1{alpha}) is a multi-functional coactivator that is involved in the regulation of cardiac mitochondrial functional capacity and cellular energy metabolism. However, the regulation of PGC-1{alpha} in cardiac Ca{sup 2+} signaling has not been fully elucidated. To address this issue, we combined confocal line-scan imaging with off-line imaging processing to characterize calcium signaling in cultured adult rat ventricular myocytes expressing PGC-1{alpha} via adenoviral transduction. Our data shows that overexpressing PGC-1{alpha} improved myocyte contractility without increasing the amplitude of Ca{sup 2+} transients, suggesting that myofilament sensitivity to Ca{sup 2+} increased. Interestingly, the decay kinetics of global Ca{sup 2+} transients and Ca{sup 2+} waves accelerated in PGC-1{alpha}-expressing cells, but the decay rate of caffeine-elicited Ca{sup 2+} transients showed no significant change. This suggests that sarcoplasmic reticulum (SR) Ca{sup 2+}-ATPase (SERCA2a), but not Na{sup +}/Ca{sup 2+} exchange (NCX) contribute to PGC-1{alpha}-induced cytosolic Ca{sup 2+} clearance. Furthermore, PGC-1{alpha} induced the expression of SERCA2a in cultured cardiac myocytes. Importantly, overexpressing PGC-1{alpha} did not disturb cardiac Ca{sup 2+} homeostasis, because SR Ca{sup 2+} load and the propensity for Ca{sup 2+} waves remained unchanged. These data suggest that PGC-1{alpha} can ameliorate cardiac Ca{sup 2+} cycling and improve cardiac work output in response to physiological stress. Unraveling the PGC-1{alpha}-calcium handing pathway sheds new light on the role of PGC-1{alpha} in the therapy of cardiac diseases.

  1. Application of Joint Detection of AFP, CA19-9, CA125 and CEA in Identification and Diagnosis of Cholangiocarcinoma.

    Science.gov (United States)

    Li, Yong; Li, Da-Jiang; Chen, Jian; Liu, Wei; Li, Jian-Wei; Jiang, Peng; Zhao, Xin; Guo, Fei; Li, Xiao-Wu; Wang, Shu-Guang

    2015-01-01

    To explore the application of joint detection of serum AFP, CA19-9, CA125 and CEA in identification and diagnosis of cholangiocarcinoma (CC). The levels of serum AFP, CA19-9, CA125 and CEA of both 30 patients with CC and 30 patients with hepatocellular carcinoma (HCC) were assessed. Receiver operating characteristic (ROC) curves were used to evaluate the diagnostic effects of single and joint detection of those 4 kinds of tumor markers for CC. The levels of serum CA19-9, CA125 and CEA in CC patients were higher than that in HCC patients,whereas that of serum AFP was significantly lower s. The area under ROC curve of single detection of serum AFP, CA19-9, CA125 and CEA were 0.05, 0.86, 0.84 and 0.83, with the optimal cutoff values of 15.4 ng/ml, 125.1 U/ml, 95.7 U/ml and 25.9 ng/ml, correspondingly, and the percentage correct single diagnosis was AFP, CA19-9, CA125 and CEA was the highest, with an area under the ROC curve of 0.94 (95%CI 0.88~0.99). Single detection of serum CA19-9, CA125 and EA is not meaningful. The sensitivity, specificity, the rate of correct diagnosis and the area under ROC curve of joint detection of AFP, CA19-9, CA125 and CEA are highest, indicating that the joint detection of these 4 tumor markers is of great importance in the diagnosis of CC.

  2. Ca2+ oscillations, Ca2+ sensitization, and contraction activated by protein kinase C in small airway smooth muscle.

    Science.gov (United States)

    Mukherjee, Seema; Trice, Jacquelyn; Shinde, Paurvi; Willis, Ray E; Pressley, Thomas A; Perez-Zoghbi, Jose F

    2013-02-01

    Protein kinase C (PKC) has been implicated in the regulation of smooth muscle cell (SMC) contraction and may contribute to airway hyperresponsiveness. Here, we combined optical and biochemical analyses of mouse lung slices to determine the effects of PKC activation on Ca(2+) signaling, Ca(2+) sensitivity, protein phosphorylation, and contraction in SMCs of small intrapulmonary airways. We found that 10 µM phorbol-12-myristate-13-acetate or 1 µM phorbol 12,13-dibutyrate induced repetitive, unsynchronized, and transient contractions of the SMCs lining the airway lumen. These contractions were associated with low frequency Ca(2+) oscillations in airway SMCs that resulted from Ca(2+) influx through L-type voltage-gated Ca(2+) channels and the subsequent release of Ca(2+) from intracellular stores through ryanodine receptors. Phorbol ester stimulation of lung slices in which SMC intracellular Ca(2+) concentration ([Ca(2+)](i)) was "clamped" at a high concentration induced strong airway contraction, indicating that PKC mediated sensitization of the contractile response to [Ca(2+)](i). This Ca(2+) sensitization was accompanied by phosphorylation of both the PKC-potentiated PP1 inhibitory protein of 17 kD (CPI-17) and the regulatory myosin light chain. Thrombin, like the phorbol esters, induced a strong Ca(2+) sensitization that was inhibited by the PKC inhibitor GF-109203X and also potentiated airway contraction to membrane depolarization with KCl. In conclusion, we suggest that PKC activation in small airways leads to both the generation of Ca(2+) oscillations and strong Ca(2+) sensitization; agents associated with airway inflammation, such as thrombin, may activate this pathway to sensitize airway smooth muscle to agonists that cause membrane depolarization and Ca(2+) entry and induce airway hyperresponsiveness.

  3. Functional involvement of Ca(2+) and Ca(2+)-activated K(+) channels in anethol-induced changes in Ca(2+) dependent excitability of F1 neurons in Helix aspersa.

    Science.gov (United States)

    Ghasemi, Zahra; Hassanpour-Ezatti, Majid; Kamalinejad, Mohammad; Janahmadi, Mahyar

    2011-07-01

    The effects of anethol, the major component of anise oil, on the Ca(2+)-dependent excitability and afterhyperpolarization (AHP) in snail neurons were examined using intracellular recording. Anethol (0.5%) significantly broadened the spike, reduced the firing frequency and enhanced the AHP amplitude. In contrast, anethol (2%) significantly increased the firing frequency and decreased the AHP. Blockade of Ca(2+) channels after anethol application depolarized the membrane potential and significantly reduced the firing rate. Furthermore, in the presence of anethol (0.5%) a significant decrease in the AHP was observed by Ca(2+) channels blockage. Here, anethol-induced functional modification of Ca(2+) and Ca(2+)-activated K(+) channels is suggested. Copyright © 2011 Elsevier B.V. All rights reserved.

  4. Ca2+ Homeostasis Regulates Xenopus Oocyte Maturation1

    Science.gov (United States)

    Sun, Lu; Hodeify, Rawad; Haun, Shirley; Charlesworth, Amanda; MacNicol, Angus M.; Ponnappan, Subramaniam; Ponnappan, Usha; Prigent, Claude; Machaca, Khaled

    2008-01-01

    In contrast to the well-defined role of Ca2+ signals during mitosis, the contribution of Ca2+ signaling to meiosis progression is controversial, despite several decades of investigating the role of Ca2+ and its effectors in vertebrate oocyte maturation. We have previously shown that during Xenopus oocyte maturation, Ca2+ signals are dispensable for entry into meiosis and for germinal vesicle breakdown. However, normal Ca2+ homeostasis is essential for completion of meiosis I and extrusion of the first polar body. In this study, we test the contribution of several downstream effectors in mediating the Ca2+ effects during oocyte maturation. We show that calmodulin and calcium-calmodulin-dependent protein kinase II (CAMK2) are not critical downstream Ca2+ effectors during meiotic maturation. In contrast, accumulation of Aurora kinase A (AURKA) protein is disrupted in cells deprived of Ca2+ signals. Since AURKA is required for bipolar spindle formation, failure to accumulate AURKA may contribute to the defective spindle phenotype following Ca2+ deprivation. These findings argue that Ca2+ homeostasis is important in establishing the oocyte’s competence to undergo maturation in preparation for fertilization and embryonic development. PMID:18094360

  5. Mitochondrial Reprogramming Induced by CaMKIIδ Mediates Hypertrophy Decompensation

    Science.gov (United States)

    Westenbrink, B. Daan; Ling, Haiyun; Divakaruni, Ajit; Gray, Charles B. B.; Zambon, Alexander C.; Dalton, Nancy D.; Peterson, Kirk L.; Gu, Yusu; Matkovich, Scot J.; Murphy, Anne; Miyamoto, Shigeki; Dorn, Gerald W.; Brown, Joan Heller

    2015-01-01

    Rationale Sustained activation of Gq signaling during pressure overload causes cardiac hypertrophy that ultimately progresses to dilated cardiomyopathy. The molecular events that drive hypertrophy decompensation are incompletely understood. Ca2+/calmodulin-dependent protein kinase II delta (CaMKIIδ) is activated downstream of Gq and overexpression of Gq and CaMKIIδ recapitulates hypertrophy decompensation. Objective To determine whether CaMKIIδ contributes to hypertrophy decompensation provoked by Gq. Methods and Results Compared to Gαq transgenic (Gq) mice, compound Gq/CaMKIIδ knockout (KO) (Gq/KO) mice developed a similar degree of cardiac hypertrophy but exhibited significantly improved left ventricular function, less cardiac fibrosis and cardiomyocyte apoptosis, and fewer ventricular arrhythmias. Markers of oxidative stress were elevated in mitochondria from Gq vs. WT mice and respiratory rates were lower; these changes in mitochondrial function were restored by CaMKIIδ deletion. Gq-mediated increases in mitochondrial oxidative stress, compromised membrane potential and cell death were recapitulated in NRVMs infected with constitutively active Gq and attenuated by CaMKII inhibition. Deep RNA sequencing revealed altered expression of 41 mitochondrial genes in Gq hearts, with normalization of ~40% of these genes by CaMKIIδ deletion. Uncoupling protein 3 (UCP3) was markedly downregulated in Gq or by Gq expression in NRVMs and reversed by CaMKIIδ deletion or inhibition, as was Peroxisome proliferator-activated receptor alpha (PPAR-α). The protective effects of CaMKIIδ inhibition on ROS generation and cell death were abrogated by knock down of UCP3. Conversely, restoration of UCP3 expression attenuated ROS generation and cell death induced by CaMKIIδ. Our in vivo studies further demonstrated that pressure overload induced decreases in PPAR-α and UCP3, increases in mitochondrial protein oxidation, and hypertrophy decompensation which were attenuated by Ca

  6. Ca isotope fingerprints of early crust-mantle evolution

    Science.gov (United States)

    Kreissig, K.; Elliott, T.

    2005-01-01

    The utility of 40Ca/ 44Ca as a tracer of pre-existing crustal contributions in early Archaean cratons has been explored to identify traces of Hadean crust and to assess the style of continental growth. The relatively short half-life of 40K (˜1.3 Gy) means that its decay to 40Ca occurs dominantly during early Earth History. If Archaean crust had a significant component derived from a more ancient protolith, as anticipated by "steady state" crustal evolution models, this should be clearly reflected in radiogenic 40Ca/ 44Ca ratios (or positive initial ɛ Ca) in different Archaean cratons. A high precision thermal ionisation technique has been used to analyse the 40Ca/ 44Ca ratios of plagioclase separates and associated whole rocks in ˜3.6 Ga (early Archaean) samples from Zimbabwe and West Greenland. Three out of four tonalite, trondhjemite, granodiorite (TTG) suite samples from Zimbabwe display initial 40Ca/ 44Ca ratios indistinguishable from our measured modern MORB value (i.e., ɛ Ca(3.6) ˜ 0). Greenland samples, however, are very diverse ranging from ɛ Ca(3.7) = 0.1 in mafic pillow lavas and felsic sheets from the Isua supracrustal belt, up to very radiogenic signatures (ɛ Ca(3.7) = 2.9) in both mafic rocks of the Akilia association and felsic TTG from the coastal Amîtsoq gneisses. At face value, these results imply the Zimbabwe crust is juvenile whereas most Greenland samples include an earlier crustal component. Yet the west Greenland craton, as with many Archaean localities, has experienced a complex geological history and the interpretation of age-corrected initial isotope values requires great care. Both felsic and mafic samples from Greenland display ɛ Ca(3.7) so radiogenic that they are not readily explained by crustal growth scenarios. The presence of such radiogenic 40Ca/ 44Ca found in low K/Ca plagioclases requires Ca isotope exchange between plagioclase and whole rock during later metamorphic event(s). In addition the unexpectedly radiogenic Ca

  7. The many phases of CaC{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Konar, Sumit; Nylén, Johanna; Svensson, Gunnar; Bernin, Diana; Edén, Mattias [Department of Materials and Environmental Chemistry, Stockholm University, SE-10691 Stockholm (Sweden); Ruschewitz, Uwe [Department of Chemistry, University of Cologne, Greinstrasse 6, 50939 Cologne (Germany); Häussermann, Ulrich, E-mail: Ulrich.Haussermann@mmk.su.se [Department of Materials and Environmental Chemistry, Stockholm University, SE-10691 Stockholm (Sweden)

    2016-07-15

    Polymorphic CaC{sub 2} was prepared by reacting mixtures of CaH{sub 2} and graphite with molar ratios between 1:1.8 and 1:2.2 at temperatures between 700 and 1400 °C under dynamic vacuum. These conditions provided a well controlled, homogeneous, chemical environment and afforded products with high purity. The products, which were characterized by powder X-ray diffraction, solid state NMR and Raman spectroscopy, represented mixtures of the three known polymorphs, tetragonal CaC{sub 2}-I and monoclinic CaC{sub 2}-II and -III. Their proportion is dependent on the nominal C/CaH{sub 2} ratio of the reaction mixture and temperature. Reactions with excess carbon produced a mixture virtually free from CaC{sub 2}-I, whereas high temperatures (above 1100 °C) and C-deficiency favored the formation of CaC{sub 2}-I. From first principles calculations it is shown that CaC{sub 2}-I is dynamically unstable within the harmonic approximation. This indicates that existing CaC{sub 2}-I is structurally/dynamically disordered and may possibly even occur as slightly carbon-deficient phase CaC{sub 2-δ}. It is proposed that monoclinic II is the ground state of CaC{sub 2} and polymorph III is stable at temperatures above 200 °C. Tetragonal I represents a metastable, heterogeneous, phase of CaC{sub 2}. It is argued that a complete understanding of the occurrence of three room temperature modifications of CaC{sub 2} will require a detailed characterization of compositional and structural heterogeneities within the high temperature form CaC{sub 2}-IV, which is stable above 450 °C. The effect of high pressure on the stability of the monoclinic forms of CaC{sub 2} was studied in a diamond anvil cell using Raman spectroscopy. CaC{sub 2}-II and -III transform into tetragonal CaC{sub 2}-I at about 4 and 1GPa, respectively. - Graphical abstract: The famous tetragonal form of CaC{sub 2}, CaC{sub 2}-I, is dynamically unstable. Why does it exist? Display Omitted - Highlights: • Critical review

  8. Catecholamine-Independent Heart Rate Increases Require CaMKII

    Science.gov (United States)

    Gao, Zhan; Singh, Madhu V; Hall, Duane D; Koval, Olha M.; Luczak, Elizabeth D.; Joiner, Mei-ling A.; Chen, Biyi; Wu, Yuejin; Chaudhary, Ashok K; Martins, James B; Hund, Thomas J; Mohler, Peter J; Song, Long-Sheng; Anderson, Mark E.

    2011-01-01

    Background Catecholamines increase heart rate by augmenting the cAMP responsive HCN4 ‘pacemaker current’ (If) and/or by promoting inward Na+/Ca2+ exchanger current (INCX), by a ‘Ca2+ clock’ mechanism in sinoatrial nodal cells (SANCs). The importance, identity and function of signals that connect If and Ca2+ clock mechanisms are uncertain and controversial, but the multifunctional Ca2+ and calmodulin-dependent protein kinase II (CaMKII) is required for physiological heart rate responses to β-adrenergic receptor (β-AR) stimulation. The aim of this stuy is to measure the contribution of the Ca2+ clock and CaMKII to cardiac pacing independent of β-AR agonist stimulation. Methods and Results We used the L-type Ca2+ channel agonist BayK 8644 (BayK) to activate the SANC Ca2+ clock. BayK and isoproterenol were similarly effective in increasing rates in SANCs and Langendorff-perfused hearts from WT control mice. In contrast, SANCs and isolated hearts from mice with CaMKII inhibition by transgenic expression of an inhibitory peptide (AC3-I) were resistant to rate increases by BayK. BayK only activated CaMKII in control SANCs, but increased ICa equally in all SANCs, indicating that increasing ICa was insufficient and suggesting CaMKII activation was required for heart rate increases by BayK. BayK did not increase If or protein kinase A (PKA)-dependent phosphorylation of phospholamban (at Ser16), indicating that increased SANC Ca2+ by BayK did not augment cAMP/PKA signaling at these targets. Late diastolic intracellular Ca2+ release and INCX were significantly reduced in AC3-I SANCs and the response to BayK was eliminated by ryanodine in all groups. Conclusions The Ca2+ clock is capable of supporting physiological fight or flight responses, independent of β-AR stimulation or If increases. Complete Ca2+ clock and β-AR stimulation responses require CaMKII. PMID:21406683

  9. CASK and CaMKII function in Drosophila memory

    Directory of Open Access Journals (Sweden)

    Bilal eMalik

    2014-06-01

    Full Text Available Calcium (Ca2+ and Calmodulin (CaM-dependent serine/threonine kinase II (CaMKII plays a central role in synaptic plasticity and memory due to its ability to phosphorylate itself and regulate its own kinase activity. Autophosphorylation at threonine 287 (T287 switches CaMKII to a Ca2+ independent and constitutively active state replicated by overexpression of a phosphomimetic CaMKII-T287D transgene or blocked by expression of a T287A transgene. A second pair of sites, T306 T307 in the CaM binding region once autophosphorylated, prevents CaM binding and inactivates the kinase during synaptic plasticity and memory, and can be blocked by a TT306/7AA transgene. Recently the synaptic scaffolding molecule called CASK (Ca2+/CaM-associated serine kinase has been shown to control both sets of CaMKII autophosphorylation events during neuronal growth, Ca2+ signalling and memory in Drosophila. Deletion of either full length CASK or just its CaMK-like and L27 domains removed middle-term memory (MTM and long-term memory (LTM, with CASK function in the α’/ß’ mushroom body neurons being required for memory. In a similar manner directly changing the levels of CaMKII autophosphorylation (T287D, T287A or TT306/7AA in the α’/ß’ neurons also removed MTM and LTM. In the CASK null mutant expression of either the Drosophila or human CASK transgene in the α’/ß’ neurons was found to completely rescue memory, confirming that CASK signalling in α’/β’ neurons is necessary and sufficient for Drosophila memory formation and that the neuronal function of CASK is conserved between Drosophila and human. Expression of human CASK in Drosophila also rescued the effect of CASK deletion on the activity state of CaMKII, suggesting that human CASK may also regulate CaMKII autophosphorylation. Mutations in human CASK have recently been shown to result in intellectual disability and neurological defects suggesting a role in plasticity and learning possibly via

  10. Role of STIM1- and Orai1-mediated Ca2+ entry in Ca2+-induced epidermal keratinocyte differentiation.

    Science.gov (United States)

    Numaga-Tomita, Takuro; Putney, James W

    2013-01-15

    The uppermost thin layer on the surface of the skin, called the epidermis, is responsible for the barrier function of the skin. The epidermis has a multilayered structure in which each layer consists of keratinocytes (KCs) of different differentiation status. The integrity of KC differentiation is crucial for the function of skin and its loss causes or is accompanied by skin diseases. Intracellular and extracellular Ca(2+) is known to play important roles in KC differentiation. However, the molecular mechanisms underlying Ca(2+) regulation of KC differentiation are still largely unknown. Store-operated Ca(2+) entry (SOCE) is a major Ca(2+) influx pathway in most non-excitable cells. SOCE is evoked in response to a fall in Ca(2+) concentration in the endoplasmic reticulum. Two proteins have been identified as essential components of SOCE: STIM1, a Ca(2+) sensor in the ER, and Orai1, a subunit of Ca(2+) channels in the plasma membrane. In this study, we analyzed the contribution of SOCE to KC growth and differentiation using RNAi knockdown of STIM1 and Orai1 in the human keratinocyte cell line, HaCaT. KC differentiation was induced by a switch in extracellular Ca(2+) concentration from low (0.03 mM; undifferentiated KCs) to high (1.8 mM; differentiated KCs). This Ca(2+) switch triggers phospholipase-C-mediated intracellular Ca(2+) signals (Ca(2+)-switch-induced Ca(2+) response), which would probably involve the activation of SOCE. Knockdown of either STIM1 or Orai1 strongly suppressed SOCE and almost completely abolished the Ca(2+)-switch-induced Ca(2+) responses, resulting in impaired expression of keratin1, an early KC differentiation marker. Furthermore, loss of either STIM1 or Orai1 suppressed normal growth of HaCaT cells in low Ca(2+) and inhibited the growth arrest in response to a Ca(2+) switch. These results demonstrate that SOCE plays multiple crucial roles in KC differentiation and function.

  11. EF-hand protein Ca2+ buffers regulate Ca2+ influx and exocytosis in sensory hair cells.

    Science.gov (United States)

    Pangršič, Tina; Gabrielaitis, Mantas; Michanski, Susann; Schwaller, Beat; Wolf, Fred; Strenzke, Nicola; Moser, Tobias

    2015-03-03

    EF-hand Ca(2+)-binding proteins are thought to shape the spatiotemporal properties of cellular Ca(2+) signaling and are prominently expressed in sensory hair cells in the ear. Here, we combined genetic disruption of parvalbumin-α, calbindin-D28k, and calretinin in mice with patch-clamp recording, in vivo physiology, and mathematical modeling to study their role in Ca(2+) signaling, exocytosis, and sound encoding at the synapses of inner hair cells (IHCs). IHCs lacking all three proteins showed excessive exocytosis during prolonged depolarizations, despite enhanced Ca(2+)-dependent inactivation of their Ca(2+) current. Exocytosis of readily releasable vesicles remained unchanged, in accordance with the estimated tight spatial coupling of Ca(2+) channels and release sites (effective "coupling distance" of 17 nm). Substitution experiments with synthetic Ca(2+) chelators indicated the presence of endogenous Ca(2+) buffers equivalent to 1 mM synthetic Ca(2+)-binding sites, approximately half of them with kinetics as fast as 1,2-Bis(2-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid (BAPTA). Synaptic sound encoding was largely unaltered, suggesting that excess exocytosis occurs extrasynaptically. We conclude that EF-hand Ca(2+) buffers regulate presynaptic IHC function for metabolically efficient sound coding.

  12. Low extracellular Ca2+ conditions induce an increase in brain endothelial permeability that involves intercellular Ca2+ waves.

    Science.gov (United States)

    De Bock, Marijke; Culot, Maxime; Wang, Nan; da Costa, Anaelle; Decrock, Elke; Bol, Mélissa; Bultynck, Geert; Cecchelli, Romeo; Leybaert, Luc

    2012-12-03

    The intracellular calcium concentration ([Ca(2+)](i)) is an important factor determining the permeability of endothelial barriers including the blood-brain barrier (BBB). However, nothing is known concerning the effect of spatially propagated intercellular Ca(2+) waves (ICWs). The propagation of ICWs relies in large part on channels formed by connexins that are present in endothelia. We hypothesized that ICWs may result in a strong disturbance of endothelial function, because the [Ca(2+)](i) changes are coordinated and involve multiple cells. Thus, we aimed to investigate the effect of ICWs on endothelial permeability. ICW activity was triggered in immortalized and primary brain endothelial cells by lowering the extracellular Ca(2+) concentration. Low extracellular Ca(2+) increased the endothelial permeability and this was significantly suppressed by buffering [Ca(2+)](i) with BAPTA-AM, indicating a central role of [Ca(2+)](i) changes. The endothelial permeability increase was furthermore inhibited by the connexin channel blocking peptide Gap27, which also blocked the ICWs, and by inhibiting protein kinase C (PKC), Ca(2+)/calmodulin-dependent kinase II (CaMKII) and actomyosin contraction. We compared these observations with the [Ca(2+)](i) changes and permeability alterations provoked by the inflammatory agent bradykinin (BK), which triggers oscillatory [Ca(2+)](i) changes without wave activity. BK-associated [Ca(2+)](i) changes and the endothelial permeability increase were significantly smaller than those associated with ICWs, and the permeability increase was not influenced by inhibition of PKC, CaMKII or actomyosin contraction. We conclude that ICWs significantly increase endothelial permeability and therefore, the connexins that underlie wave propagation form an interesting target to limit BBB alterations. This article is part of a Special Issue entitled Electrical Synapses. Copyright © 2012 Elsevier B.V. All rights reserved.

  13. Inhibition of Ca++ sparks by oxyhemoglobin in rabbit cerebral arteries.

    Science.gov (United States)

    Jewell, Ryan P; Saundry, Christine M; Bonev, Adrian D; Tranmer, Bruce I; Wellman, George C

    2004-02-01

    Oxyhemoglobin (HbO2) causes cerebral artery constriction and is one component of blood that likely contributes to the pathogenesis of cerebral vasospasm after aneurysm rupture. This study was designed to examine the acute effect of HbO2 on subcellular Ca(++) release events (Ca(++) sparks) in cerebral artery myocytes. Calcium sparks provide a tonic hyperpolarizing and relaxing influence to vascular smooth muscle by the activation of plasmalemmal large-conductance Ca(++)-activated K+ channels. Evidence is provided that HbO2 may contract cerebral vascular muscle in part by free radical-mediated inhibition of Ca(++) sparks. Calcium sparks were visualized in intact pressurized rabbit cerebral arteries by using laser scanning confocal microscopy and a Ca(++) indicator dye. Calcium spark frequency was reduced by approximately 65% after a 15-minute application of HbO2 (10(-4) M). The HbO2-induced decrease in Ca(++) spark frequency was prevented by a combination of the free radical scavengers superoxide dismutase and catalase. Isometric force measurements were used to characterize the role of the vascular endothelium and smooth-muscle Ca(++) channels in HbO2-induced cerebral artery contraction. The HbO2-induced contractions were independent of the vascular endothelium, but were abolished by diltiazem, a blocker of L-type voltage-dependent Ca(++) channels (VDCCs). Ryanodine, a blocker of ryanodine-sensitive Ca(++) release channels located on the sarcoplasmic reticulum, also reduced HbO2-induced contractions by approximately 50%. These results support the hypothesis that HbO2 may contract cerebral artery segments in part by inhibition of Ca(++) sparks, leading to decreased large-conductance Ca(++)-activated K+ channel activity, membrane potential depolarization, and enhanced Ca(++) entry through VDCCs.

  14. SNL/CA Environmental Management System Program Manual.

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Barbara L.

    2007-04-01

    The Sandia National Laboratories, California (SNL/CA) Environmental Management System (EMS) Program Manual documents the elements of the site EMS Program. The SNL/CA EMS Program conforms to the International Standard on Environmental Management Systems, ISO 14001:2004. Elements of the ISO standard overlap with those of Department of Energy (DOE) Order 450.1, thus SNL/CA's EMS program also meets the DOE requirements.

  15. Improved custom statistics visualization for CA Performance Center data

    CERN Document Server

    Talevi, Iacopo

    2017-01-01

    The main goal of my project is to understand and experiment the possibilities that CA Performance Center (CA PC) offers for creating custom applications to display stored information through interesting visual means, such as maps. In particular, I have re-written some of the network statistics web pages in order to fetch data from new statistics modules in CA PC, which has its own API, and stop using the RRD data.

  16. The influence of the 2-neutron elastic transfer on the fusion of 42Ca + 40Ca

    Directory of Open Access Journals (Sweden)

    Stefanini A.M.

    2016-01-01

    We have measured the fusion excitation function of this system using the 42Ca beam of the XTU Tandem of LNL on a thin 40Ca target enriched to 99.96% in mass 40. Cross sections have been measured down to ≤1 mb. The extracted barrier distribution shows clearly two main peaks. We have performed preliminary CC calculations where the 2+ coupling strengths have been taken from the literature and the schematic 2n pair transfer form factor has been used, with a deformation length σt= 0.39 fm. The excitation function is well reproduced by the calculation including the 2n transfer channel. However, including the octupole excitations destroys the agreement.

  17. Influence of Ca substitution by Mg on the Ca3Co4O9 performances

    Directory of Open Access Journals (Sweden)

    Constantinescu, G.

    2014-02-01

    Full Text Available Ca3-xMgxCo4O9 polycrystalline thermoelectric ceramics with small amounts of Mg have been synthesized by the classical solid state method. Microstructural characterizations have shown that all the Mg has been incorporated into the Ca3Co4O9 structure and no Mg-based secondary phases have been identified. Apparent density measurements have shown that samples do not modify their density until 0.05 Mg content, decreasing for higher contents. Electrical resistivity decreases and Seebeck coefficient slightly raises when Mg content increases until 0.05 Mg addition. The improvement in both parameters leads to higher power factor values than the usually obtained in samples prepared by the conventional solid state routes and close to those obtained in textured materials.Se han preparado cerámicas termoeléctricas policristalinas de Ca3-xMgxCo4O9, con pequeñas cantidades de Mg, utilizando el método clásico de estado sólido. La caracterización microestructural ha mostrado que el Mg se ha incorporado en la estructura del Ca3Co4O9 y que no se han formado fases secundarias con el Mg. Las medidas de densidad aparente han mostrado que las muestras prácticamente poseen la misma densidad hasta un contenido de 0.05 Mg, disminuyendo para contenidos mayores. La resistividad eléctrica disminuye y el coeficiente Seebeck aumenta cuando el contenido de Mg se incrementa hasta valores de 0.05. La mejora de ambos parámetros conduce a valores del factor de potencia mayores que los obtenidos en muestras preparadas por la vía convencional de estado sólido, alcanzando valores próximos a los que se encuentran en materiales texturados.

  18. Effects of high pressure treatment on Ca2+ release and Ca2+ uptake of sarcoplasmic reticulum.

    Science.gov (United States)

    Okamoto, A; Suzuki, A; Ikeuchi, Y; Saito, M

    1995-02-01

    To clarify the mechanism of pressure-induced meat tenderization or acceleration of meat conditioning, the pressure-induced morphological and biochemical changes in sarcoplasmic reticulum (SR), and Ca2+ release from SR in the rabbit skeletal muscle treated with high pressure (100-300 MPa, 5 min) were investigated in comparison with those of the SR from conditioned muscle. The destruction of the membrane structure of the SR expanded with increasing pressure applied to the muscle. Significant changes in the SDS-PAGE profile were not observed in the SR from the pressurized muscle up to 200 MPa, but a marked decrease of the ATPase protein and high-affinity Ca(2+)-binding protein were observed in the SR from the pressurized muscle at 300 MPa. The ATPase activities increased in the SR isolated from the muscle exposed to high pressure up to 200 MPa. When the muscle was pressurized at 300 MPa, the ATPase activity dropped to the same level with that of the SR from the untreated muscle. Ca2+ uptake ability of the SR vesicles measured using a fluorescent chelating reagent decreased with increasing pressure applied to the muscle. Ultrastructural studies showed that Ca2+, which was mainly localized in the SR region of the untreated fiber bundles, was translocated into myofibrillar space in the pressurized muscle. It is clear that a brief exposure of the muscle to high pressure causes considerable changes in membrane structure and biochemical function of SR as compared with those of SR in the muscle induced by conditioning.(ABSTRACT TRUNCATED AT 250 WORDS)

  19. Semantic web data warehousing for caGrid.

    Science.gov (United States)

    McCusker, James P; Phillips, Joshua A; González Beltrán, Alejandra; Finkelstein, Anthony; Krauthammer, Michael

    2009-10-01

    The National Cancer Institute (NCI) is developing caGrid as a means for sharing cancer-related data and services. As more data sets become available on caGrid, we need effective ways of accessing and integrating this information. Although the data models exposed on caGrid are semantically well annotated, it is currently up to the caGrid client to infer relationships between the different models and their classes. In this paper, we present a Semantic Web-based data warehouse (Corvus) for creating relationships among caGrid models. This is accomplished through the transformation of semantically-annotated caBIG Unified Modeling Language (UML) information models into Web Ontology Language (OWL) ontologies that preserve those semantics. We demonstrate the validity of the approach by Semantic Extraction, Transformation and Loading (SETL) of data from two caGrid data sources, caTissue and caArray, as well as alignment and query of those sources in Corvus. We argue that semantic integration is necessary for integration of data from distributed web services and that Corvus is a useful way of accomplishing this. Our approach is generalizable and of broad utility to researchers facing similar integration challenges.

  20. Spectral components of cytosolic [Ca2+] spiking in neurons

    DEFF Research Database (Denmark)

    Kardos, J; Szilágyi, N; Juhász, G

    1998-01-01

    into evolutionary spectra of a characteristic set of frequencies. Non-delayed small spikes on top of sustained [Ca2+]c were synthesized by a main component frequency, 0.132+/-0.012 Hz, showing its maximal amplitude in phase with the start of depolarization (25 mM KCI) combined with caffeine (10 mM) application......We show here, by means of evolutionary spectral analysis and synthesis of cytosolic Ca2+ ([Ca2+]c) spiking observed at the single cell level using digital imaging fluorescence microscopy of fura-2-loaded mouse cerebellar granule cells in culture, that [Ca2+]c spiking can be resolved...

  1. Ovarian Cancer Early Detection by Circulating CA125 in the context of Anti-CA125 Autoantibody Levels

    DEFF Research Database (Denmark)

    Fortner, Renée T; Schock, Helena; Le Cornet, Charlotte

    2018-01-01

    CA125 is the best ovarian cancer early detection marker to date; however, sensitivity is limited and complementary markers are required to improve discrimination between ovarian cancer cases and non-cases. Anti-CA125 autoantibodies are observed in circulation. Our objective was to evaluate whether......-cases. We investigated these objectives using a nested case-control study within the European Prospective Investigation into Cancer and Nutrition cohort (EPIC) including 250 cases diagnosed within 4 years of blood collection and up to 4 matched controls. Circulating CA125 antigen and antibody levels were...... the first evidence of potentially synergistic discrimination effects of CA125 and anti-CA125 antibodies in ovarian early detection. If these findings are replicated, evaluating CA125 in the context of its antibody may improve ovarian cancer early detection. This article is protected by copyright. All rights...

  2. RESEM-CA: Validation and testing

    Energy Technology Data Exchange (ETDEWEB)

    Pal, Vineeta; Carroll, William L.; Bourassa, Norman

    2002-09-01

    This report documents the results of an extended comparison of RESEM-CA energy and economic performance predictions with the recognized benchmark tool DOE2.1E to determine the validity and effectiveness of this tool for retrofit design and analysis. The analysis was a two part comparison of patterns of (1) monthly and annual energy consumption of a simple base-case building and controlled variations in it to explore the predictions of load components of each program, and (2) a simplified life-cycle cost analysis of the predicted effects of selected Energy Conservation Measures (ECMs). The study tries to analyze and/or explain the differences that were observed. On the whole, this validation study indicates that RESEM is a promising tool for retrofit analysis. As a result of this study some factors (incident solar radiation, outside air film coefficient, IR radiation) have been identified where there is a possibility of algorithmic improvements. These would have to be made in a way that does not sacrifice the speed of the tool, necessary for extensive parametric search of optimum ECM measures.

  3. Solidification and Immobilization of Heavy metals in Soil using with nano-metallic Ca/CaO Dispersion Mixture

    OpenAIRE

    Mallampati S. R.; Mitoma Y.; Okuda T.; Sakita S.; Kakeda M.

    2013-01-01

    In the present work, the use of nano-metallic calcium (Ca) and calcium oxide (CaO) dispersion mixture for the immobilization of heavy metals (As, Cd, Cr and Pb) in soil was investigated. With simple grinding, 85-90% of heavy metals immobilization could be achieved, while it could be enhanced to 98-100% by grinding with the addition of nano-metallic Ca/CaO dispersion mixture. By SEM-EDS elemental maps as well as semi-quantitative analysis observed that the amount of As, Cd, Cr and Pb measurabl...

  4. Insulin resistance vs. hyperinsulinemia in hypertension: insulin regulation of Ca2+ transport and Ca(2+)-regulation of insulin sensitivity.

    Science.gov (United States)

    Zemel, M B

    1995-06-01

    Hypertension in obesity and insulin resistance has been attributed to insulin stimulation of sympathetic neural output and renal sodium retention. However, recent data demonstrates a significant vasodilatory effect of insulin and suggests that vascular smooth muscle resistance to this action may instead be the cause of hypertension in insulin resistance. This concept is supported by the observation that pharmacological amplification of peripheral insulin sensitivity results in reduced arterial pressure. Insulin attenuates vasoconstrictor responses to pressor agonists and accelerates vascular smooth muscle relaxation, while these effects are blunted in obesity and insulin resistance. Insulin regulation of vasoconstriction and vascular relaxation appears to be secondary to regulation of intracellular Ca2+ ([Ca2+]i), as insulin attenuates both voltage- and receptor-mediated Ca2+ influx and stimulates both the transcription and activity of Ca(2+)-ATPase in vascular smooth muscle cells. Further, these effects are also blunted in insulin resistance. Although [Ca2+]i plays a poorly understood role in insulin signalling, increases beyond an optimal range results in impaired insulin sensitivity, possibly by Ca(2+)-inhibition of insulin-induced dephosphorylation of insulin-sensitive substrates. Consistent with this concept, ectopic overexpression of the agouti gene in the viable yellow (Avy) mouse results in increased skeletal myocyte [Ca2+]i. Accordingly, increased [Ca2+]i in primary insulin target tissues appears to result in peripheral insulin resistance which then results in aberrant regulation of vascular smooth muscle [Ca2+]i and increases in arterial pressure.

  5. [Effect of curcumin on the learning, memory and hippocampal Ca+/CaMK II level in senescence-accelerated mice].

    Science.gov (United States)

    Sun, Chen-you; Qi, Shuang-shuang; Sun, Shu-hong

    2011-03-01

    To explore effect of curcumin in different concentrations on learning and memory of senescence-accelerated mice (SAM) and their possible mechanisms. Mice were randomly divided into six groups: the SAMR1 normal control group, the SAMP8 model control group, the SAMP8 + solvent (the peanut oil) control group, SAMP8 + low, middle and high dose curcumin groups. Mice were gastrogavage for 25 successive days. On the next day of ending the experiment, changes of learning and memory in mice of each group were observed by Morris water maze. The hippocampal [Ca2+] was determined. Expressions of hippocampal calmodulin-dependent protein kinase II (CaMK II) and Calmodulin (CaM) mRNA were detected using Western blot and reverse transcription polymerase chain reaction (RT-PCR) respectively. The latency to find the hidden platform was remarkably prolonged, the hippocampal [Ca2+]i was markedly increased, the expression of CaMK II in the hippocampal membrane and the level of hippocampal CaM mRNA were significantly reduced in the SAMP8-model control group (P CaMK II in the hippocampal membrane and the level of hippocampal CaM mRNA obviously increased in the SAMP8 + low, middle and high dose curcumin groups (P CaMK II expression in the hippocampal dose-dependently.

  6. Flavonoid Myricetin Modulates GABA(A) Receptor Activity through Activation of Ca(2+) Channels and CaMK-II Pathway.

    Science.gov (United States)

    Zhang, Xiao Hu; Ma, Ze Gang; Rowlands, Dewi Kenneth; Gou, Yu Lin; Fok, Kin Lam; Wong, Hau Yan; Yu, Mei Kuen; Tsang, Lai Ling; Mu, Li; Chen, Lei; Yung, Wing Ho; Chung, Yiu Wa; Zhang, Bei Lin; Zhao, Hua; Chan, Hsiao Chang

    2012-01-01

    The flavonoid myricetin is found in several sedative herbs, for example, the St. John's Wort, but its influence on sedation and its possible mechanism of action are unknown. Using patch-clamp technique on a brain slice preparation, the present study found that myricetin promoted GABAergic activity in the neurons of hypothalamic paraventricular nucleus (PVN) by increasing the decay time and frequency of the inhibitory currents mediated by GABA(A) receptor. This effect of myricetin was not blocked by the GABA(A) receptor benzodiazepine- (BZ-) binding site antagonist flumazenil, but by KN-62, a specific inhibitor of the Ca(2+)/calmodulin-stimulated protein kinase II (CaMK-II). Patch clamp and live Ca(2+) imaging studies found that myricetin could increase Ca(2+) current and intracellular Ca(2+) concentration, respectively, via T- and L-type Ca(2+) channels in rat PVN neurons and hypothalamic primary culture neurons. Immunofluorescence staining showed increased phosphorylation of CaMK-II after myricetin incubation in primary culture of rat hypothalamic neurons, and the myricetin-induced CaMK-II phosphorylation was further confirmed by Western blotting in PC-12 cells. The present results suggest that myricetin enhances GABA(A) receptor activity via calcium channel/CaMK-II dependent mechanism, which is distinctively different from that of most existing BZ-binding site agonists of GABA(A) receptor.

  7. Flavonoid Myricetin Modulates GABAA Receptor Activity through Activation of Ca2+ Channels and CaMK-II Pathway

    Directory of Open Access Journals (Sweden)

    Xiao Hu Zhang

    2012-01-01

    Full Text Available The flavonoid myricetin is found in several sedative herbs, for example, the St. John's Wort, but its influence on sedation and its possible mechanism of action are unknown. Using patch-clamp technique on a brain slice preparation, the present study found that myricetin promoted GABAergic activity in the neurons of hypothalamic paraventricular nucleus (PVN by increasing the decay time and frequency of the inhibitory currents mediated by GABAA receptor. This effect of myricetin was not blocked by the GABAA receptor benzodiazepine- (BZ- binding site antagonist flumazenil, but by KN-62, a specific inhibitor of the Ca2+/calmodulin-stimulated protein kinase II (CaMK-II. Patch clamp and live Ca2+ imaging studies found that myricetin could increase Ca2+ current and intracellular Ca2+ concentration, respectively, via T- and L-type Ca2+ channels in rat PVN neurons and hypothalamic primary culture neurons. Immunofluorescence staining showed increased phosphorylation of CaMK-II after myricetin incubation in primary culture of rat hypothalamic neurons, and the myricetin-induced CaMK-II phosphorylation was further confirmed by Western blotting in PC-12 cells. The present results suggest that myricetin enhances GABAA receptor activity via calcium channel/CaMK-II dependent mechanism, which is distinctively different from that of most existing BZ-binding site agonists of GABAA receptor.

  8. Pengujian Subtitusi CaCO3 Taiwan Dengan CaCO3 Produk Lokal Untuk Industri Berbahan Baku PVC

    OpenAIRE

    Ardjo, Anwar Sukito; Rofarsyam, Rofarsyam

    2005-01-01

    The paper reports an experiment to produce polyvinyl chloride (PVC) using local (from Gunung Kidul) and imported (from Taiwan) CaCO3. The laboratory test shows that PVC produced using Taiwanese CaCO3 is superior over that using local CaCO3 in terms of its flexibity. Hence, it is not recommended to use local CaCO3 producing PVC-based products that requires high flexibility such as water pipe, cable isolator. On the other hand, the local PVC may be used to produce, for instance, blinds and c...

  9. Localization of Ca2+ and Ca-ATPase on wet (Ruscus aculeatus and dry (Primula officinalis stigma surface

    Directory of Open Access Journals (Sweden)

    Elżbieta Bednarska

    2014-01-01

    Full Text Available Calcium is present in the surface cells of both types of stigma. The chlorotetracycline method was used to show that the papillae of the dry stigma of Primula officinalis are the source of fluorescence of the CTC-Ca2+ complex. The precipitation method (NHA localized calcium ions mainly in the pellicula surrounding these papillae. The NHA-Ca2+ precipitates were localized on the plasma membrane in the papillae of the wet stigma of Ruscus aculeatus. Ca-ATPase activity was found in both types of stigma in sites where the presence of Ca2+ had been determined.

  10. Ca2+-stores in sperm: their identities and functions

    Science.gov (United States)

    Costello, Sarah; Michelangeli, Francesco; Nash, Kate; Lefievre, Linda; Morris, Jennifer; Machado-Oliveira, Gisela; Barratt, Christopher; Kirkman-Brown, Jackson; Publicover, Stephen

    2013-01-01

    Intracellular Ca2+ stores play a central role in the regulation of cellular [Ca2+]i and the generation of complex [Ca2+] signals such as oscillations and waves. Ca2+ signalling is of particular significance in sperm cells, where it is a central regulator in many key activities (including capacitation, hyperactivation, chemotaxis and acrosome reaction) yet mature sperm lack endoplasmic reticulum and several other organelles which serve as Ca2+ stores in somatic cells. Here we review (i) the evidence for the expression in sperm of the molecular components (pumps and channels) which are functionally significant in the activity of Ca2+ stores of somatic cells and (ii) the evidence for the existence of functional Ca2+ stores in sperm. This evidence supports the existence of at least two storage organelles in mammalian sperm, one in the acrosomal region and another in the region of the sperm neck and midpiece. We then go on to discuss the likely identity of these organelles and their discrete functions: regulation by the acrosome of its own secretion and regulation by membranous organelles at the sperm neck (and possibly by the mitochondria) of flagellar activity and hyperactivation. Finally we consider the ability of the sperm discretely to control mobilisation of these stores and the functional interaction of stored Ca2+ at the sperm neck/midpiece with CatSper channels in the principal piece in regulation of the activities of mammalian sperm. PMID:19542252

  11. PIK3CA mutant tumors depend on oxoglutarate dehydrogenase

    Science.gov (United States)

    Ilic, Nina; Birsoy, Kıvanç; Aguirre, Andrew J.; Kory, Nora; Pacold, Michael E.; Singh, Shambhavi; Moody, Susan E.; DeAngelo, Joseph D.; Spardy, Nicole A.; Freinkman, Elizaveta; Weir, Barbara A.; Cowley, Glenn S.; Root, David E.; Asara, John M.; Vazquez, Francisca; Widlund, Hans R.; Sabatini, David M.; Hahn, William C.

    2017-01-01

    Oncogenic PIK3CA mutations are found in a significant fraction of human cancers, but therapeutic inhibition of PI3K has only shown limited success in clinical trials. To understand how mutant PIK3CA contributes to cancer cell proliferation, we used genome scale loss-of-function screening in a large number of genomically annotated cancer cell lines. As expected, we found that PIK3CA mutant cancer cells require PIK3CA but also require the expression of the TCA cycle enzyme 2-oxoglutarate dehydrogenase (OGDH). To understand the relationship between oncogenic PIK3CA and OGDH function, we interrogated metabolic requirements and found an increased reliance on glucose metabolism to sustain PIK3CA mutant cell proliferation. Functional metabolic studies revealed that OGDH suppression increased levels of the metabolite 2-oxoglutarate (2OG). We found that this increase in 2OG levels, either by OGDH suppression or exogenous 2OG treatment, resulted in aspartate depletion that was specifically manifested as auxotrophy within PIK3CA mutant cells. Reduced levels of aspartate deregulated the malate–aspartate shuttle, which is important for cytoplasmic NAD+ regeneration that sustains rapid glucose breakdown through glycolysis. Consequently, because PIK3CA mutant cells exhibit a profound reliance on glucose metabolism, malate–aspartate shuttle deregulation leads to a specific proliferative block due to the inability to maintain NAD+/NADH homeostasis. Together these observations define a precise metabolic vulnerability imposed by a recurrently mutated oncogene. PMID:28396387

  12. Hierarchic stochastic modelling applied to intracellular Ca(2+ signals.

    Directory of Open Access Journals (Sweden)

    Gregor Moenke

    Full Text Available Important biological processes like cell signalling and gene expression have noisy components and are very complex at the same time. Mathematical analysis of such systems has often been limited to the study of isolated subsystems, or approximations are used that are difficult to justify. Here we extend a recently published method (Thurley and Falcke, PNAS 2011 which is formulated in observable system configurations instead of molecular transitions. This reduces the number of system states by several orders of magnitude and avoids fitting of kinetic parameters. The method is applied to Ca(2+ signalling. Ca(2+ is a ubiquitous second messenger transmitting information by stochastic sequences of concentration spikes, which arise by coupling of subcellular Ca(2+ release events (puffs. We derive analytical expressions for a mechanistic Ca(2+ model, based on recent data from live cell imaging, and calculate Ca(2+ spike statistics in dependence on cellular parameters like stimulus strength or number of Ca(2+ channels. The new approach substantiates a generic Ca(2+ model, which is a very convenient way to simulate Ca(2+ spike sequences with correct spiking statistics.

  13. CaII Κ Imaging to Understand UV Irradiance Variability

    Indian Academy of Sciences (India)

    tribpo

    CaII Κ Imaging to Understand UV Irradiance Variability. R. Kariyappa, Indian Institute of ... Introduction. The CaII Η and Κ resonance lines have been recognized as useful indicators for identifying regions of ... magnetic features, we have calculated histograms over the complete full disc image. (Paper I). We have applied the ...

  14. Intracellular Ca-carbonate biomineralization is widespread in cyanobacteria.

    Science.gov (United States)

    Benzerara, Karim; Skouri-Panet, Feriel; Li, Jinhua; Férard, Céline; Gugger, Muriel; Laurent, Thierry; Couradeau, Estelle; Ragon, Marie; Cosmidis, Julie; Menguy, Nicolas; Margaret-Oliver, Isabel; Tavera, Rosaluz; López-García, Purificación; Moreira, David

    2014-07-29

    Cyanobacteria have played a significant role in the formation of past and modern carbonate deposits at the surface of the Earth using a biomineralization process that has been almost systematically considered induced and extracellular. Recently, a deep-branching cyanobacterial species, Candidatus Gloeomargarita lithophora, was reported to form intracellular amorphous Ca-rich carbonates. However, the significance and diversity of the cyanobacteria in which intracellular biomineralization occurs remain unknown. Here, we searched for intracellular Ca-carbonate inclusions in 68 cyanobacterial strains distributed throughout the phylogenetic tree of cyanobacteria. We discovered that diverse unicellular cyanobacterial taxa form intracellular amorphous Ca-carbonates with at least two different distribution patterns, suggesting the existence of at least two distinct mechanisms of biomineralization: (i) one with Ca-carbonate inclusions scattered within the cell cytoplasm such as in Ca. G. lithophora, and (ii) another one observed in strains belonging to the Thermosynechococcus elongatus BP-1 lineage, in which Ca-carbonate inclusions lie at the cell poles. This pattern seems to be linked with the nucleation of the inclusions at the septum of the cells, showing an intricate and original connection between cell division and biomineralization. These findings indicate that intracellular Ca-carbonate biomineralization by cyanobacteria has been overlooked by past studies and open new perspectives on the mechanisms and the evolutionary history of intra- and extracellular Ca-carbonate biomineralization by cyanobacteria.

  15. Unanimous Model for Describing the Fast Bioluminescence Kinetics of Ca

    NARCIS (Netherlands)

    Eremeeva, Elena V.; Bartsev, Sergey I.; Berkel, van Willem J.H.; Vysotski, Eugene S.

    2017-01-01

    Upon binding their metal ion cofactors, Ca2+-regulated photoproteins display a rapid increase of light signal, which reaches its peak within milliseconds. In the present study, we investigate bioluminescence kinetics of the entire photoprotein family. All five recombinant hydromedusan Ca2+-regulated

  16. Purification and biochemical characterization of a Ca2+- ...

    African Journals Online (AJOL)

    On the other hand, Ca+2 and EDTA (1 to 5 mM) did not significantly affect the enzyme activity. The main substrate for the enzyme was found to be starch but it could also hydrolyze raw starch, dextrin, γ-cyclodextrin and pullulan. Key words: Ca2+-independent, Bacillus sp, thermostable α-amylases, low pH profile, enzyme, ...

  17. Elemental composition of coccoliths: Mg/Ca relationships

    Directory of Open Access Journals (Sweden)

    Lluïsa Cros

    2013-01-01

    Full Text Available Coccolithophores produce calcium carbonate platelets, the coccoliths, and play a significant role in the C and Ca cycles. Coccoliths are important components of marine biogenic carbonate sediments and their chemical analysis can provide tools for paleoceanographic investigation. In particular, the Mg/Ca ratio of coccoliths has been proposed as a paleotemperature proxy. The present study uses X-ray microanalysis to evaluate the Ca and Mg composition of heterococcoliths and holococcoliths of different coccolithophore species. Our measurements indicate that the Mg values in heterococcoliths do not exceed a low threshold and do not show any consistent relationship with the Ca content, while the Mg content of holococcoliths spans a wider range, can reach much higher values and shows a linear relationship with the Ca content. Several heterococcolithophore species tend to form separate clusters according to their Mg and Ca values. Within each cluster, there were no consistent differences in the Mg/Ca ratios of specimens sampled at different temperatures or seasons, suggesting that using the Mg/Ca ratio as a paleothermometer may be problematic. Our findings could have implications for the interpretation of the fossil record because Mg-rich calcite dissolves more easily.

  18. Synthesis and microwave dielectric properties of Ca substituted ...

    Indian Academy of Sciences (India)

    Keywords. Patch antenna; theoretical density; phase; ceramics. Abstract. Microwave dielectric ceramics in Sr1-CaLa4Ti4.93Zr0.07O17 (0 ≤ ≤ 0.5) composition series were processed via a solid-state sintering rout. X-ray diffraction revealed single phase ceramics. Ca substitutions for Sr tuned f towards zero with ...

  19. SNL/CA Environmental Management System Program Manual.

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Barbara L.

    2005-09-01

    The Sandia National Laboratories, California (SNL/CA) Environmental Management System (EMS) Program Manual documents the elements of the site EMS Program. The SNL/CA EMS Program was developed in accordance with Department of Energy (DOE) Order 450.1 and incorporates the elements of the International Standard on Environmental Management Systems, ISO 14001.

  20. Past experience resets behavior: CaMK takes the heat.

    Science.gov (United States)

    Yadlapalli, Swathi; Wani, Khursheed A; Xu, X Z Shawn

    2014-12-03

    How past experiences reshape behavior is not well understood. In this issue, two studies (Schild et al., 2014; Yu et al., 2014) dissected the molecular mechanisms underlying experience-dependent plasticity in thermosensory behavior. They show that Ca(2+)/calmodulin-dependent kinase I (CaMKI) regulates thermal preferences according to past experience. Copyright © 2014 Elsevier Inc. All rights reserved.

  1. Isolation and characterization of higher metallofullerenes Ca@C92 ...

    Indian Academy of Sciences (India)

    Administrator

    ... Ca@C94 for the first time. The o-dichlo- robenzene extraction, chlorobenzene and benzene mo- bile phase for isolation of fullerenes and endohedral fullerenes in our work had never been reported before. 2. Experimental. Our raw soot containing Ca metallofullerenes was produced by an optimized direct current arc (DC) ...

  2. Spectral components of cytosolic [Ca2+] spiking in neurons

    DEFF Research Database (Denmark)

    Kardos, J; Szilágyi, N; Juhász, G

    1998-01-01

    . Delayed complex responses of large [Ca2+]c spiking observed in cells from a different set of cultures were synthesized by a set of frequencies within the range 0.018-0.117 Hz. Differential frequency patterns are suggested as characteristics of the [Ca2+]c spiking responses of neurons under different...

  3. {sup 41}Ca measurements at the Zurich AMS facility

    Energy Technology Data Exchange (ETDEWEB)

    Schnabel, C.; Gartenmann, P.; Suter, M. [Eidgenoessische Technische Hochschule, Zurich (Switzerland); Synal, H.A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Gloris, M.; Leya, I.; Michel, R. [Hannover Univ. (Germany); Herpers, U. [Koeln Univ. (Germany)

    1997-09-01

    Proton-induced production cross sections for {sup 41}Ca from Fe and Ni determined using 6 MV tandem accelerator are presented. The calibration of two secondary standard materials to a standard material of {sup 41}Ca concentration determined by PTB (Braunschweig, Germany) has been carried out. (author) 2 figs., 3 refs.

  4. 46 CFR 7.115 - Santa Catalina Island, CA.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Santa Catalina Island, CA. 7.115 Section 7.115 Shipping... Coast § 7.115 Santa Catalina Island, CA. (a) A line drawn from the northernmost point of Lion Head to the north tangent of Bird Rock Island; thence to the northernmost point of Blue Cavern Point. (b) A...

  5. 33 CFR 80.1102 - Santa Catalina Island, CA.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Santa Catalina Island, CA. 80... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Pacific Coast § 80.1102 Santa Catalina Island, CA. The 72 COLREGS shall apply to the harbors on Santa Catalina Island. ...

  6. Characterization of the Ca2+ Channels Involved in the Progesterone ...

    African Journals Online (AJOL)

    There is evidence that intracellular Ca2+ concentration plays significant roles in sperm function such as motility and acrosome reaction. Many calcium channels have been identified in the plasma membrane of sperm. Progesterone (P4) stimulates Ca2+ influx and acrosome reaction in human spermatozoa. The effects of ...

  7. Cyanobacterial formation of intracellular Ca-carbonates in undersaturated solutions.

    Science.gov (United States)

    Cam, N; Benzerara, K; Georgelin, T; Jaber, M; Lambert, J-F; Poinsot, M; Skouri-Panet, F; Moreira, D; López-García, P; Raimbault, E; Cordier, L; Jézéquel, D

    2018-01-01

    Cyanobacteria have long been thought to induce the formation of Ca-carbonates as secondary by-products of their metabolic activity, by shifting the chemical composition of their extracellular environment to conditions favoring mineral precipitation. Some cyanobacterial species forming Ca-carbonates intracellularly were recently discovered. However, the environmental conditions under which this intracellular biomineralization process can occur and the impact of cyanobacterial species forming Ca-carbonates intracellularly on extracellular carbonatogenesis are not known. Here, we show that these cyanobacteria can form Ca-carbonates intracellularly while growing in extracellular solutions undersaturated with respect to all Ca-carbonate phases, that is, conditions thermodynamically unfavorable to mineral precipitation. This shows that intracellular Ca-carbonate biomineralization is an active process; that is, it costs energy provided by the cells. The cost of energy may be due to the active accumulation of Ca intracellularly. Moreover, unlike cyanobacterial strains that have been usually considered before by studies on Ca-carbonate biomineralization, cyanobacteria forming intracellular carbonates may slow down or hamper extracellular carbonatogenesis, by decreasing the saturation index of their extracellular solution following the buffering of the concentration of extracellular calcium to low levels. © 2017 John Wiley & Sons Ltd.

  8. Intracellular Ca-carbonate biomineralization is widespread in cyanobacteria

    Science.gov (United States)

    Benzerara, Karim; Skouri-Panet, Feriel; Li, Jinhua; Férard, Céline; Gugger, Muriel; Laurent, Thierry; Couradeau, Estelle; Ragon, Marie; Cosmidis, Julie; Menguy, Nicolas; Margaret-Oliver, Isabel; Tavera, Rosaluz; López-García, Purificación; Moreira, David

    2014-01-01

    Cyanobacteria have played a significant role in the formation of past and modern carbonate deposits at the surface of the Earth using a biomineralization process that has been almost systematically considered induced and extracellular. Recently, a deep-branching cyanobacterial species, Candidatus Gloeomargarita lithophora, was reported to form intracellular amorphous Ca-rich carbonates. However, the significance and diversity of the cyanobacteria in which intracellular biomineralization occurs remain unknown. Here, we searched for intracellular Ca-carbonate inclusions in 68 cyanobacterial strains distributed throughout the phylogenetic tree of cyanobacteria. We discovered that diverse unicellular cyanobacterial taxa form intracellular amorphous Ca-carbonates with at least two different distribution patterns, suggesting the existence of at least two distinct mechanisms of biomineralization: (i) one with Ca-carbonate inclusions scattered within the cell cytoplasm such as in Ca. G. lithophora, and (ii) another one observed in strains belonging to the Thermosynechococcus elongatus BP-1 lineage, in which Ca-carbonate inclusions lie at the cell poles. This pattern seems to be linked with the nucleation of the inclusions at the septum of the cells, showing an intricate and original connection between cell division and biomineralization. These findings indicate that intracellular Ca-carbonate biomineralization by cyanobacteria has been overlooked by past studies and open new perspectives on the mechanisms and the evolutionary history of intra- and extracellular Ca-carbonate biomineralization by cyanobacteria. PMID:25009182

  9. On multiferroicity of TTF-CA molecular crystal

    NARCIS (Netherlands)

    Filatov, Michael

    2011-01-01

    Magnetic properties of the TTF-CA molecular crystal below the neutral to ionic transition temperature are studied using the embedded cluster approach in combination with density functional theory. The calculated values of the Heisenberg exchange integral between the neighboring TTF and CA molecules

  10. Activation of gill Ca2+-sensing receptor as a protective pathway to reduce Ca2+-induced cytotoxicity.

    Science.gov (United States)

    Gu, J; Law, A Y S; Yeung, B H Y; Wong, C K C

    2014-10-01

    The expression of the Ca(2) (+)-sensing receptor (Casr) in the endocrine gland known as the corpuscle of Stannius (CS) regulates the secretion of the hypocalcemic hormone stanniocalcin-1 (STC1) to inhibit gill Ca(2) (+) uptake. Although numerous studies have reported the branchial expression of Casr and Stc1, the functions of these proteins in gills have not been elucidated yet. On the basis of recent findings regarding the autocrine/paracrine functions of STC1 in mammalian models, we proposed the hypothesis that branchial CaSR has an in situ 'sensing' function to regulate STC1 that maintains local Ca(2) (+) homeostasis. In this study, we investigated Casr-mediated signaling and its regulation of Stc1 and cyclooxygenase-2 (Cox2) expression/function using a primary gill-cell culture model. The biochemical responses of gill cells isolated from Japanese eels to an increasing concentration of extracellular Ca(2) (+) (0.1-1 mM) were tested. This stimulation led to a transient increase in phosphatidylcholine-phospholipase C (PC-PLC) activity, followed by activation of ERK and inositol 1,4,5-trisphosphate-Ca(2) (+)/calmodulin-dependent protein kinase 2 (CaMK2) signaling pathways. Cotreatment with the calcimimetic R467 caused synergistic effects on Ca(2) (+)-stimulated PC-PLC activity, ERK signaling, and CaMK2 signaling. The activation of the CaSR-PLC-ERK pathway was associated with increased expression levels of Stc1 and Cox2 as confirmed by the inhibition of Erk using a chemical inhibitor, PD98059. Functionally, Ca(2) (+)/R-467 pretreatment was found to protect cells from thapsigargin-induced cell death. Inhibition of COX2 activity using NS398 abolished this protection, while transduction of STC1 lentiviral particles in the gill cells increased the protective effects. Collectively, our data revealed the expression of functional CaSR in gill tissues. The identification of the CaSR-STC1/COX2-mediated protective pathway in gill cells sheds light on a possible cellular

  11. CA1 contributes to microcalcification and tumourigenesis in breast cancer.

    Science.gov (United States)

    Zheng, Yabing; Xu, Bing; Zhao, Yan; Gu, He; Li, Chang; Wang, Yao; Chang, Xiaotian

    2015-10-12

    Although mammary microcalcification is frequently observed and has been associated with poor survival in patients with breast cancer, the genesis of calcification remains unclear. Carbonic anhydrase I (CA1) has been shown to promote calcification by catalysing the hydration of CO2. This study aimed to determine whether CA1 was correlated with microcalcification and with other processes that are involved in breast cancer tumourigenesis. CA1 expression in breast cancer tissues and blood samples was detected using western blotting, real-time PCR, immunohistochemistry and ELISA. Calcification was induced in the cultured 4T1 cell line originating from mouse breast tumours, using ascorbic acid and β-glycerophosphate. Acetazolamide, a chemical inhibitor of CA1, was also added to the culture to determine the role of CA1 in calcification. The MCF-7 human breast cancer cell line was treated with anti-CA1 siRNA and was assessed using a CCK-8 cell proliferation assay, an annexin V cell apoptosis assay, transwell migration assay and a human breast cancer PCR array. The tag SNP rs725605, which is located in the CA1 locus, was genotyped using TaqMan® genotyping. Increased CA1 expression was detected in samples of breast carcinoma tissues and blood obtained from patients with breast cancer. A total of 15.3 % of these blood samples exhibited a 2.1-fold or higher level of CA1 expression, compared to the average level of CA1 expression in samples from healthy controls. Following the induction of calcification of 4T1 cells, both the number of calcium-rich deposits and the expression of CA1 increased, whereas the calcification and CA1 expression were significantly supressed in the presence of acetazolamide. Increased migration and apoptosis were observed in MCF-7 cells that were treated with anti-CA1 siRNA. The PCR array detected up-regulation of the androgen receptor (AR) and down-regulation of X-box binding protein 1 (XBP1) in the treated MCF-7 cells. Significant differences in

  12. Synthesis of Al2Ca Dispersoids by Powder Metallurgy Using a Mg–Al Alloy and CaO Particles

    Directory of Open Access Journals (Sweden)

    Junji Fujita

    2017-06-01

    Full Text Available The elemental mixture of Mg-6 wt %Al-1 wt %Zn-0.3 wt %Mn (AZ61B alloy powder and CaO particles was consolidated by an equal-channel angular bulk mechanical alloying (ECABMA process to form a composite precursor. Subsequently, the precursor was subjected to a heat treatment to synthesize fine Al2Ca particles via a solid-state reaction between the Mg–Al matrix and CaO additives. Scanning electron microscopy-energy-dispersive spectroscopy (SEM-EDS and electron probe micro-analysis on the precursor indicated that 4.7-at % Al atoms formed a supersaturated solid solution in the α-Mg matrix. Transmission electron microscopy-EDS and X-ray diffraction analyses on the AZ61B composite precursor with 10-vol % CaO particles obtained by heat treatment confirmed that CaO additives were thermally decomposed in the Mg–Al alloy, and the solid-soluted Ca atoms diffused along the α-Mg grain boundaries. Al atoms also diffused to the grain boundaries because of attraction to the Ca atoms resulting from a strong reactivity between Al and Ca. As a result, needle-like (Mg,Al2Ca intermetallics were formed as intermediate precipitates in the initial reaction stage during the heat treatment. Finally, the precipitates were transformed into spherical Al2Ca particles by the substitution of Al atoms for Mg atoms in (Mg,Al2Ca after a long heat treatment.

  13. Studies of synoptic solar activity using Kodaikanal Ca K data

    Science.gov (United States)

    Raju, K. P.

    2017-10-01

    The chromospheric network, the bright emission network seen in the chromospheric lines such as Ca ii K and Hα, outline the supergranulation cells. The Ca images are dominated by the chromospheric network and plages which are good indicators of solar activity. Further, the Ca line is a good proxy to the UV irradiance which is particularly useful in the pre-satellite era where UV measurements are not available. The Ca spectroheliograms of the Sun from Kodaikanal have a data span of about 100 years and covers over 9 solar cycles. The archival data is now available in the digitized form. Programs have been developed to obtain the activity indices and the length scales of the chromospheric network from the data. The preliminary results from the analysis are reported here. It is shown that the Ca ii K intensity and the network boundary width are dependent on the solar cycle.

  14. Serum tetranectin and CA125 in endometrial adenocarcinoma

    DEFF Research Database (Denmark)

    Lundstrøm, M S; Høgdall, C K; Nielsen, Anette Lynge

    2000-01-01

    BACKGROUND: CA125 and tetranectin (TN) are prognostic markers in ovarian cancer. This study examines the values of these markers in endometrial cancer. MATERIALS AND METHODS: TN and CA125 were determined preoperatively in 99 patients with primary endometrioid adenocarcinoma and evaluated in relat......BACKGROUND: CA125 and tetranectin (TN) are prognostic markers in ovarian cancer. This study examines the values of these markers in endometrial cancer. MATERIALS AND METHODS: TN and CA125 were determined preoperatively in 99 patients with primary endometrioid adenocarcinoma and evaluated....../ml was not an independent factor when stage was introduced. TN levels were within the normal range in all patients and did not show any association with tumor grade, stage or survival. CONCLUSIONS: The study confirmed the role of CA125 as a prognostic factor in endometrial cancer and may be of aid in pointing out patients...

  15. Improved thermoelectric performance of n-type Ca and Ca-Ce filled skutterudites

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, Daniel R.; Liu, Chang; Ellison, Nicole D. [Optimal CAE, Plymouth, Michigan 48170 (United States); Salvador, James R.; Meyer, Martin S.; Haddad, Daad B. [General Motors Research and Development, Warren, Michigan 48090 (United States); Wang, Hsin; Cai, W. [Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States)

    2014-12-28

    Thermoelectric (TE) technology for use in automotive waste heat recovery is being advanced by General Motors with support from the US Department of Energy. Skutterudites are a very promising material for this application of TE technology due to their superior mechanical properties and good TE performance. Double-filled Yb{sub x}Ba{sub y}Co{sub 4}Sb{sub 12} with ZT values around 1.1 at 750 K are the best performing n-type skutterudites produced on a large scale using an economically viable approach of melt spinning (MS) in conjunction with spark plasma sintering (SPS). Another economical production method on the tons scale, the melt quench annealing (MQA) technique, has been recently claimed by Treibacher Industrie AG, further information is available [G. Rogl et al., Acta Mater. 76, 434–448 (2014)]. A possible hurdle to commercial implementation of these materials is the use of rare earths as the fillers to reduce thermal conductivity and improve the electrical transport properties. It will be shown herein that skutterudites double-filled with Ca and Ce, both of which are lower-cost fillers, display markedly different TE properties depending on whether they are produced by MQA or MS + SPS synthesis techniques. Ca and Ce double-filled skutterudites prepared by MS + SPS have TE properties that are superior to the same compositions prepared by MQA and that are comparable to the best performing Yb and Ba filled materials. Furthermore, the results of this study suggest that the unusually poor transport properties of MQA Ca-filled skutterudites can be ascribed to deleterious secondary phases, which is contrary to reports in the literature attempting to explain these irregularities via band structure features.

  16. K(Ca)2 and k(ca)3 channels in learning and memory processes, and neurodegeneration

    NARCIS (Netherlands)

    Kuiper, Els F.E.; Nelemans, Ad; Luiten, Paul; Nijholt, Ingrid; Dolga, Amalia; Eisel, Uli

    2012-01-01

    Calcium-activated potassium (K(Ca)) channels are present throughout the central nervous system as well as many peripheral tissues. Activation of K(Ca) channels contribute to maintenance of the neuronal membrane potential and was shown to underlie the afterhyperpolarization (AHP) that regulates

  17. Proton emission in inelastic scattering of Ca-40 on Ca-40 at 50 MeV/nucleon

    NARCIS (Netherlands)

    Scarpaci, JA; Lamehi-Rachti, M; Roynette, JC; Blumenfeld, Y; Chomaz, P; Frascaria, N; Garron, JP; Suomijarvi, T; Beaumel, D; Lhenry, [No Value; Alamanos, N; Gillibert, A; van der Woude, A

    1997-01-01

    Inelastic scattering of Ca-40 on Ca-40 at 50 MeV/nucleon has been measured in coincidence with Light charged particles detected over a large angular domain. The giant resonance region of the inelastic spectrum is shown to be dominated by the isoscalar giant quadrupole resonance. The characteristics

  18. Age-Induced Loss of Mossy Fibre Synapses on CA3 Thorns in the CA3 Stratum Lucidum

    Directory of Open Access Journals (Sweden)

    Bunmi Ojo

    2013-01-01

    Full Text Available Advanced ageing is associated with hippocampal deterioration and mild cognitive decline. The hippocampal subregion CA3 stratum lucidum (CA3-SL receives neuronal inputs from the giant mossy fibre boutons of the dentate gyrus, but relatively little is known about the integrity of this synaptic connection with ageing. Using serial electron microscopy and unbiased stereology, we examined age-related changes in mossy fibre synapses on CA3 thorny excrescences within the CA3-SL of young adults (4-month-old, middle-aged (12-month-old, and old-aged (28-month-old Wistar rats. Our data show that while there is an increase in CA3 volume with ageing, there is a significant (40–45% reduction in synaptic density within the CA3-SL of 12- and 28-month-old animals compared with 4-month-old animals. We also present preliminary data showing that the CA3 neuropil in advanced ageing was conspicuously full of lipofuscin and phagolysosome positive, activated microglial cellular processes, and altered perivascular pathology. These data suggest that synaptic density in the CA3-SL is significantly impaired in ageing, accompanied by underlying prominent ultrastructural glial and microvascular changes.

  19. Solidification and Immobilization of Heavy metals in Soil using with nano-metallic Ca/CaO Dispersion Mixture

    Directory of Open Access Journals (Sweden)

    Mallampati S. R.

    2013-04-01

    Full Text Available In the present work, the use of nano-metallic calcium (Ca and calcium oxide (CaO dispersion mixture for the immobilization of heavy metals (As, Cd, Cr and Pb in soil was investigated. With simple grinding, 85-90% of heavy metals immobilization could be achieved, while it could be enhanced to 98-100% by grinding with the addition of nano-metallic Ca/CaO dispersion mixture. By SEM-EDS elemental maps as well as semi-quantitative analysis observed that the amount of As, Cd, Cr and Pb measurable on soil particle surface decreases after nano-metallic Ca/CaO treatment. The leachable heavy metals concentrations were reduced, to the concentration lower than the Japan soil elution standard regulatory threshold, i. e., < 0.01 mg/l for As, Cd and Pb and 0.05mg/l for Cr. Whereas, the effect of soil moisture and pH on heavy metals immobilization was not much influenced. The results suggest that nano-metallic Ca/CaO mixture is suitable to be used for the gentle immobilization of heavy metals contaminated soil at normal moisture conditions.

  20. Thermoelectric properties of antiperovskite calcium oxides Ca3PbO and Ca3SnO

    Science.gov (United States)

    Okamoto, Y.; Sakamaki, A.; Takenaka, K.

    2016-05-01

    We report the thermoelectric properties of polycrystalline samples of Ca3Pb1-xBixO (x = 0, 0.1, 0.2) and Ca3SnO, both crystallizing in a cubic antiperovskite-type structure. The Ca3SnO sample shows metallic resistivity and its thermoelectric power approaches 100 μV K-1 at room temperature, resulting in the thermoelectric power factor of Ca3SnO being larger than that of Ca3Pb1-xBixO. On the basis of Hall and Sommerfeld coefficients, the Ca3SnO sample is found to be a p-type metal with a carrier density of ˜1019 cm-3, a mobility of ˜80 cm2 V-1 s-1, both comparable to those in degenerated semiconductors, and a moderately large hole carrier effective mass. The coexistence of moderately high mobility and large effective mass observed in Ca3SnO, as well as possible emergence of a multivalley electronic structure with a small band gap at low-symmetry points in k-space, suggests that the antiperovskite Ca oxides have strong potential as a thermoelectric material.

  1. Thapsigargin, a tumor promoter, discharges intracellular Ca2+ stores by specific inhibition of the endoplasmic reticulum Ca2(+)-ATPase

    DEFF Research Database (Denmark)

    Thastrup, Ole; Cullen, P J; Drøbak, B K

    1990-01-01

    Thapsigargin, a tumor-promoting sesquiterpene lactone, discharges intracellular Ca2+ in rat hepatocytes, as it does in many vertebrate cell types. It appears to act intracellularly, as incubation of isolated rat liver microsomes with thapsigargin induces a rapid, dose-dependent release of stored Ca...

  2. CA-45(2+) MOVEMENTS INDUCED BY CA2+ CHLORIDE IN ISOLATED RAT AORTA UNDER K+-FREE CONDITIONS

    NARCIS (Netherlands)

    WERMELSKIRCHEN, D; NEBEL, U; WIRTH, A; WILFFERT, B

    1991-01-01

    Increasing the extracellular Ca2+ concentration induced a dihydropyridine-insensitive contraction in the isolated rat aorta bathed in K+-free solution. To obtain further insight into the mechanism of this contraction Ca-45(2+) uptake measurements were carried out with isolated rat aorta. Increasing

  3. 45Ca2+movements induced by Ca2+chloride in isolated rat aorta under K+-free conditions

    NARCIS (Netherlands)

    Wermelskirchen, D.; Nebel, U.; Wirth, A.; Wilffert, B.

    1991-01-01

    Increasing the extracellular Ca2+concentration induced a dihydropyridine-insensitive contraction in the isolated rat aorta bathed in K+-free solution. To obtained further insight into the mechanisms of this contraction45Ca2+uptake measurements were carried out with isolated rat aorta. Increasing the

  4. Cadmium activates CaMK-II and initiates CaMK-II-dependent apoptosis in mesangial cells.

    Science.gov (United States)

    Liu, Ying; Templeton, Douglas M

    2007-04-03

    Cadmium is a toxic metal that initiates both mitogenic responses and cell death. We show that Cd(2+) increases phosphorylation and activity of Ca(2+)/calmodulin-dependent protein kinase II (CaMK-II) in mesangial cells, in a concentration-dependent manner. Activation is biphasic with peaks at 1-5 min and 4-6 h. Cadmium also activates Erk, but this appears to be independent of CaMK-II. At 10-20 microM, Cd(2+) initiates apoptosis in 25-55% of mesangial cells by 6h. Inhibition of CaMK-II, but not of Erk, suppresses Cd(2+)-induced apoptosis. We conclude that activation of CaMK-II by Cd(2+) contributes to apoptotic cell death, independent of Erk activation.

  5. The effects of CaCl2 and CaBr2 on the reproduction of Daphnia magna Straus.

    Science.gov (United States)

    Mažuran, Neda; Hršak, Vladimir; Kovačević, Goran

    2015-06-01

    Concentrated CaCl2 and CaBr2 salt solutions of densities up to 2.3 kg L-1 are regularly used to control hydrostatic pressure in oil wells during special operations in the exploration and production of natural gas and crude oil. Various concentrations of high density salts are frequently left in mud pits near the drilling site as waste, polluting fresh and ground waters by spillage and drainage. The toxic effects of these salts have already been observed. This study investigated the effects of CaCl2 and CaBr2 on water flea Daphnia magna Straus in a 21-day reproduction test. The three tested concentrations of CaCl2 (240, 481, and 1925 mg L-1) caused a significant dose-response decrease of reproduction (psubstance. The results suggest that high concentrations of the tested chemicals are harmful to Daphnia's reproduction and could reduce its abundance.

  6. Crystallization of high-Ca chromium garnet upon interaction of serpentine, chromite, and Ca-bearing hydrous fluid

    Science.gov (United States)

    Chepurov, A. A.; Turkin, A. I.; Pokhilenko, N. P.

    2017-10-01

    The results of experimental modeling of the conditions of crystallization of high-Ca chromium garnets in the system serpentine-chromite-Ca-Cr-bearing hydrous fluid at a pressure of 5 GPa and temperature of 1300°C are reported. The mineral association including quantitatively predominant high-Mg olivine and diopside-rich clinopyroxene, bright-green garnet, and newly formed chrome spinel was formed. Garnet mostly crystallized around primary chromite grains and was characterized by a high concentration of CaO and Cr2O3. According to the chemical composition, garnets obtained are close to the uvarovite-pyrope varieties, which enter the composition of relatively rare natural paragenesis of garnet wehrlite. The experimental data obtained clearly show that high-Ca chromium garnets are formed in the reaction of chromite-bearing peridotite and Ca-rich fluid at high P-T parameters.

  7. A Ca2(+ )release-activated Ca2(+) (CRAC) modulatory domain (CMD) within STIM1 mediates fast Ca2(+)-dependent inactivation of ORAI1 channels.

    Science.gov (United States)

    Derler, Isabella; Fahrner, Marc; Muik, Martin; Lackner, Barbara; Schindl, Rainer; Groschner, Klaus; Romanin, Christoph

    2009-09-11

    STIM1 and ORAI1, the two limiting components in the Ca(2+) release-activated Ca(2+) (CRAC) signaling cascade, have been reported to interact upon store depletion, culminating in CRAC current activation. We have recently identified a modulatory domain between amino acids 474 and 485 in the cytosolic part of STIM1 that comprises 7 negatively charged residues. A STIM1 C-terminal fragment lacking this domain exhibits enhanced interaction with ORAI1 and 2-3-fold higher ORAI1/CRAC current densities. Here we focused on the role of this CRAC modulatory domain (CMD) in the fast inactivation of ORAI1/CRAC channels, utilizing the whole-cell patch clamp technique. STIM1 mutants either with C-terminal deletions including CMD or with 7 alanines replacing the negative amino acids within CMD gave rise to ORAI1 currents that displayed significantly reduced or even abolished inactivation when compared with STIM1 mutants with preserved CMD. Consistent results were obtained with cytosolic C-terminal fragments of STIM1, both in ORAI1-expressing HEK 293 cells and in RBL-2H3 mast cells containing endogenous CRAC channels. Inactivation of the latter, however, was much more pronounced than that of ORAI1. The extent of inactivation of ORAI3 channels, which is also considerably more prominent than that of ORAI1, was also substantially reduced by co-expression of STIM1 constructs missing CMD. Regarding the dependence of inactivation on Ca(2+), a decrease in intracellular Ca(2+) chelator concentrations promoted ORAI1 current fast inactivation, whereas Ba(2+) substitution for extracellular Ca(2+) completely abrogated it. In summary, CMD within the STIM1 cytosolic part provides a negative feedback signal to Ca(2+) entry by triggering fast Ca(2+)-dependent inactivation of ORAI/CRAC channels.

  8. Development and evaluation of materials for thermochemical heat storage based on the CaO/CaCO3 reaction couple

    Science.gov (United States)

    Sakellariou, Kyriaki G.; Tsongidis, Nikolaos I.; Karagiannakis, George; Konstandopoulos, Athanasios G.; Baciu, Diana; Charalambopoulou, Georgia; Steriotis, Theodore; Stubos, Athanasios; Arlt, Wolfgang

    2016-05-01

    The current work relates to the development of synthetic calcium oxide (CaO) based compositions as candidate materials for energy storage under a cyclic carbonation/decarbonation reaction scheme. Although under such a cyclic scheme the energy density of natural lime based CaO is high (˜ 3MJ/kg), the particular materials suffer from notable cycle-to-cycle deactivation. To this direction, pure CaO and CaO/Al2O3 composites have been prepared and preliminarily evaluated under the suggested cyclic carbonation/decarbonation scheme in the temperature range of 600-800°C. For the composite materials, Ca/Al molar ratios were in the range between 95/5 and 52/48 and upon calcination the formation of mixed Ca/Al phases was verified. The preliminary evaluation of materials studied was conducted under 3 carbonation/decarbonation cycles and the loss of activity for the case of natural CaO was obvious. Synthetic materials with superior stability/capture c.f. natural CaO were further subjected to multi-cyclic carbonation/decarbonation, via which the positive effect of alumina addition was made evident. Selected compositions exhibited adequately high CO2 capture capacity and stable performance during multi-cyclic operation. Moreover, this study contains preliminary experiments referring to proof-of-principle validation of a concept based on the utilization of a CaO-based honeycomb reactor/heat exchanger preliminary design. In particular, cordierite monolithic structures were coated with natural CaO and in total 11 cycles were conducted. Upon operation, clear signs of heat dissipation by the imposed flow in the duration of the exothermic reaction step were identified.

  9. Ca intercalated bilayer graphene as a thinnest limit of superconducting C6Ca.

    Science.gov (United States)

    Kanetani, Kohei; Sugawara, Katsuaki; Sato, Takafumi; Shimizu, Ryota; Iwaya, Katsuya; Hitosugi, Taro; Takahashi, Takashi

    2012-11-27

    Success in isolating a 2D graphene sheet from bulky graphite has triggered intensive studies of its physical properties as well as its application in devices. Graphite intercalation compounds (GICs) have provided a platform of exotic quantum phenomena such as superconductivity, but it is unclear whether such intercalation is feasible in the thinnest 2D limit (i.e., bilayer graphene). Here we report a unique experimental realization of 2D GIC, by fabricating calcium-intercalated bilayer graphene C(6)CaC(6) on silicon carbide. We have investigated the structure and electronic states by scanning tunneling microscopy and angle-resolved photoemission spectroscopy. We observed a free-electron-like interlayer band at the Brillouin-zone center, which is thought to be responsible for the superconductivity in 3D GICs, in addition to a large π* Fermi surface at the zone boundary. The present success in fabricating Ca-intercalated bilayer graphene would open a promising route to search for other 2D superconductors as well as to explore its application in devices.

  10. Changes to a CA Programme - Practitioners' Perspectives

    Directory of Open Access Journals (Sweden)

    Elizabeth Wheeler

    2014-03-01

    Full Text Available This paper examines the perceptions of practitioners of the new directions taken by NZICA with respect to its academic and professional programme requirements to obtain CA Institute membership. The “future viability of any professional body is dependent on continuously attracting new members, ideally the best and the brightest new tertiary graduates”, and this is “undoubtedly the case for New Zealand’s professional accounting body, the New Zealand Institute of Chartered Accountants (NZICA” (Malthus & Fowler 2009, p. 26. In this study, the concurrent triangulation approach to mixed methods described by Creswell (2009 was used to collect data. This approach enabled the results of the two quantitative and qualitative databases to be integrated and compared. It was found that accounting practitioners felt the changes made by NZICA may devalue the brand, while the reduction in liberal papers would result in a narrower degree. Overall, accounting practitioners agreed that three to four years of tertiary accounting education was adequate, a broader four-year course would result in a better-rounded graduates. The reduction in the length of the tertiary programme caused concern that future graduates would be less mature. Accounting practitioners also felt that the changes would harm the credibility of NZICA internationally. However, some accounting practitioners did welcome the fact that the NZICA membership requirements will be more aligned with Institute of Chartered Accountants Australia. Accounting practitioners felt that the new technical modules would offer more flexibility. They believed that the four technical modules should repeat the material taught at university, as long as a balance was maintained between technical and practical skills. They also believed that the changes would result in an increased onus on the employer. Additionally, accounting practitioners agreed that on-the-job training should not replace a tertiary

  11. Effects of Hyperglycemia on Vascular Smooth Muscle Ca2+ Signaling

    Science.gov (United States)

    El-Najjar, Nahed; Kulkarni, Rashmi P.; Nader, Nancy; Hodeify, Rawad

    2017-01-01

    Diabetes is a complex disease that is characterized with hyperglycemia, dyslipidemia, and insulin resistance. These pathologies are associated with significant cardiovascular implications that affect both the macro- and microvasculature. It is therefore important to understand the effects of various pathologies associated with diabetes on the vasculature. Here we directly test the effects of hyperglycemia on vascular smooth muscle (VSM) Ca2+ signaling in an isolated in vitro system using the A7r5 rat aortic cell line as a model. We find that prolonged exposure of A7r5 cells to hyperglycemia (weeks) is associated with changes to Ca2+ signaling, including most prominently an inhibition of the passive ER Ca2+ leak and the sarcoplasmic reticulum Ca2+-ATPase (SERCA). To translate these findings to the in vivo condition, we used primary VSM cells from normal and diabetic subjects and find that only the inhibition of the ER Ca2+ leaks replicates in cells from diabetic donors. These results show that prolonged hyperglycemia in isolation alters the Ca2+ signaling machinery in VSM cells. However, these alterations are not readily translatable to the whole organism situation where alterations to the Ca2+ signaling machinery are different. PMID:28713824

  12. Relationship of CA 19-9 with choledocholithiasis and cholangitis.

    Science.gov (United States)

    Doğan, Ümit Bilge; Gümürdülü, Yüksel; Gölge, Necmettin; Kara, Banu

    2011-01-01

    It is well known that increased concentrations of CA 19-9 can be found in benign disease of the liver, pancreas and biliary tract, especially in cases with gallstone disease with cholangitis. The aim of this study was to investigate the relation of CA 19-9 with the number and size of the stones, cholangitis and biliary obstruction in patients with choledocholithiasis. Seventy patients with radiologically proven choledocholithiasis were studied. Endoscopic retrograde cholangiopancreatography, sphincterotomy and stone extraction were applied to all patients. In each case, the parameters recorded included the levels of CA 19-9 and other laboratory tests before and after endoscopic retrograde cholangiopancreatography and the results of imaging techniques and immunoserologic tests. The correlations of these parameters were determined by SPSS 17 package program for statistical analysis. Elevation of CA 19-9 was found in 32 patients (46%), while 8 patients (11%) had extraordinarily high levels (>1000 U/ml). CA 19-9 levels were correlated with serum alkaline phosphatase (r=0.5, palkaline phosphatase, gamma glutamyl transpeptidase and bilirubin levels. After stone extraction, CA 19-9 levels started to decrease and reached normal values 1-28 days later. In conclusion, CA 19-9 levels are associated with biliary obstruction and cholangitis but not with the number and size of stones in patients with choledocholithiasis.

  13. Aerobic Hydrogen Production via Nitrogenase in Azotobacter vinelandii CA6

    Science.gov (United States)

    Noar, Jesse; Loveless, Telisa; Navarro-Herrero, José Luis; Olson, Jonathan W.

    2015-01-01

    The diazotroph Azotobacter vinelandii possesses three distinct nitrogenase isoenzymes, all of which produce molecular hydrogen as a by-product. In batch cultures, A. vinelandii strain CA6, a mutant of strain CA, displays multiple phenotypes distinct from its parent: tolerance to tungstate, impaired growth and molybdate transport, and increased hydrogen evolution. Determining and comparing the genomic sequences of strains CA and CA6 revealed a large deletion in CA6's genome, encompassing genes related to molybdate and iron transport and hydrogen reoxidation. A series of iron uptake analyses and chemostat culture experiments confirmed iron transport impairment and showed that the addition of fixed nitrogen (ammonia) resulted in cessation of hydrogen production. Additional chemostat experiments compared the hydrogen-producing parameters of different strains: in iron-sufficient, tungstate-free conditions, strain CA6's yields were identical to those of a strain lacking only a single hydrogenase gene. However, in the presence of tungstate, CA6 produced several times more hydrogen. A. vinelandii may hold promise for developing a novel strategy for production of hydrogen as an energy compound. PMID:25911479

  14. Shock Compression Response of Calcium Fluoride (CaF2)

    Science.gov (United States)

    Root, Seth

    2017-06-01

    The fluorite crystal structure is a textbook lattice that is observed for many systems, such as CaF2, Mg2 Si, and CeO2. Specifically, CaF2 is a useful material for studying the fluorite system because it is readily available as a single crystal. Under static compression, CaF2 is known to have at least three solid phases: fluorite, cotunnite, and a Ni2 In phase. Along the Hugoniot CaF2 undergoes a fluorite to cotunnite phase transition, however, at higher shock pressures it is unknown whether CaF2 undergoes another solid phase transition or melts directly from the cotunnite phase. In this work, we conducted planar shock compression experiments on CaF2 using Sandia's Z-machine and a two-stage light gun up to 900 GPa. In addition, we use density functional theory (DFT) based quantum molecular dynamics (QMD) simulations to provide insight into the CaF2 state along the Hugoniot. In collaboration with: Michael Desjarlais, Ray Lemke, Patricia Kalita, Scott Alexander, Sandia National Laboratories. Sandia National Laboratories is a multi-mission laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL850.

  15. Inhibitory Gating of Input Comparison in the CA1 Microcircuit.

    Science.gov (United States)

    Milstein, Aaron D; Bloss, Erik B; Apostolides, Pierre F; Vaidya, Sachin P; Dilly, Geoffrey A; Zemelman, Boris V; Magee, Jeffrey C

    2015-09-23

    Spatial and temporal features of synaptic inputs engage integration mechanisms on multiple scales, including presynaptic release sites, postsynaptic dendrites, and networks of inhibitory interneurons. Here we investigate how these mechanisms cooperate to filter synaptic input in hippocampal area CA1. Dendritic recordings from CA1 pyramidal neurons reveal that proximal inputs from CA3 as well as distal inputs from entorhinal cortex layer III (ECIII) sum sublinearly or linearly at low firing rates due to feedforward inhibition, but sum supralinearly at high firing rates due to synaptic facilitation, producing a high-pass filter. However, during ECIII and CA3 input comparison, supralinear dendritic integration is dynamically balanced by feedforward and feedback inhibition, resulting in suppression of dendritic complex spiking. We find that a particular subpopulation of CA1 interneurons expressing neuropeptide Y (NPY) contributes prominently to this dynamic filter by integrating both ECIII and CA3 input pathways and potently inhibiting CA1 pyramidal neuron dendrites. Copyright © 2015 Elsevier Inc. All rights reserved.

  16. Decoding Dynamic Ca2+ Signaling in the Vascular Endothelium

    Directory of Open Access Journals (Sweden)

    Mark Stephen Taylor

    2014-11-01

    Full Text Available Although acute and chronic vasoregulation is inherently driven by endothelial Ca2+, control and targeting of Ca2+-dependent signals are poorly understood. Recent studies have revealed localized and dynamic endothelial Ca2+ events comprising an intricate signaling network along the vascular intima. Discrete Ca2+ transients emerging from both internal stores and plasmalemmal cation channels couple to specific membrane K+ channels, promoting endothelial hyperpolarization and vasodilation. The spatiotemporal tuning of these signals, rather than global Ca2+ elevation, appear to direct endothelial functions under physiologic conditions. In fact, altered patterns of dynamic Ca2+ signaling may underlie essential endothelial dysfunction in a variety of cardiovascular diseases. Advances in imaging approaches and analyses in recent years have allowed for detailed detection, quantification, and evaluation of Ca2+ dynamics in intact endothelium. Here, we discuss recent insights into these signals, including their sources of origination and their functional encoding. We also address key aspects of data acquisition and interpretation, including broad applications of automated high-content analysis.

  17. Mutations of PIK3CA in gastric adenocarcinoma

    Directory of Open Access Journals (Sweden)

    So Samuel

    2005-03-01

    Full Text Available Abstract Background Activation of the phosphatidylinositol 3-kinase (PI3K through mutational inactivation of PTEN tumour suppressor gene is common in diverse cancer types, but rarely reported in gastric cancer. Recently, mutations in PIK3CA, which encodes the p110α catalytic subunit of PI3K, have been identified in various human cancers, including 3 of 12 gastric cancers. Eighty percent of these reported mutations clustered within 2 regions involving the helical and kinase domains. In vitro study on one of the "hot-spot" mutants has demonstrated it as an activating mutation. Methods Based on these data, we initiated PIK3CA mutation screening in 94 human gastric cancers by direct sequencing of the gene regions in which 80% of all the known PIK3CA mutations were found. We also examined PIK3CA expression level by extracting data from the previous large-scale gene expression profiling study. Using Significance Analysis of Microarrays (SAM, we further searched for genes that show correlating expression with PIK3CA. Results We have identified PIK3CA mutations in 4 cases (4.3%, all involving the previously reported hotspots. Among these 4 cases, 3 tumours demonstrated microsatellite instability and 2 tumours harboured concurrent KRAS mutation. Data extracted from microarray studies showed an increased expression of PIK3CA in gastric cancers when compared with the non-neoplastic gastric mucosae (p PIK3CA. Conclusion Our data suggested that activation of the PI3K signalling pathway in gastric cancer may be achieved through up-regulation or mutation of PIK3CA, in which the latter may be a consequence of mismatch repair deficiency.

  18. Ca(2+ permeable AMPA receptor induced long-term potentiation requires PI3/MAP kinases but not Ca/CaM-dependent kinase II.

    Directory of Open Access Journals (Sweden)

    Suhail Asrar

    Full Text Available Ca(2+ influx via GluR2-lacking Ca(2+-permeable AMPA glutamate receptors (CP-AMPARs can trigger changes in synaptic efficacy in both interneurons and principle neurons, but the underlying mechanisms remain unknown. We took advantage of genetically altered mice with no or reduced GluR2, thus allowing the expression of synaptic CP-AMPARs, to investigate the molecular signaling process during CP-AMPAR-induced synaptic plasticity at CA1 synapses in the hippocampus. Utilizing electrophysiological techniques, we demonstrated that these receptors were capable of inducing numerous forms of long-term potentiation (referred to as CP-AMPAR dependent LTP through a number of different induction protocols, including high-frequency stimulation (HFS and theta-burst stimulation (TBS. This included a previously undemonstrated form of protein-synthesis dependent late-LTP (L-LTP at CA1 synapses that is NMDA-receptor independent. This form of plasticity was completely blocked by the selective CP-AMPAR inhibitor IEM-1460, and found to be dependent on postsynaptic Ca(2+ ions through calcium chelator (BAPTA studies. Surprisingly, Ca/CaM-dependent kinase II (CaMKII, the key protein kinase that is indispensable for NMDA-receptor dependent LTP at CA1 synapses appeared to be not required for the induction of CP-AMPAR dependent LTP due to the lack of effect of two separate pharmacological inhibitors (KN-62 and staurosporine on this form of potentiation. Both KN-62 and staurosporine strongly inhibited NMDA-receptor dependent LTP in control studies. In contrast, inhibitors for PI3-kinase (LY294002 and wortmannin or the MAPK cascade (PD98059 and U0126 significantly attenuated this CP-AMPAR-dependent LTP. Similarly, postsynaptic infusion of tetanus toxin (TeTx light chain, an inhibitor of exocytosis, also had a significant inhibitory effect on this form of LTP. These results suggest that distinct synaptic signaling underlies GluR2-lacking CP-AMPAR-dependent LTP, and reinforces

  19. Microstructures and Mechanical Study of Mg Alloy Foam Based on Mg-Zn-Ca-CaCO3 System

    Science.gov (United States)

    Erryani, A.; Pramuji, F.; Annur, D.; Amal, M. I.; Kartika, I.

    2017-05-01

    Magnesium alloy, a material that has potential to use some applications such as aerospace components, computer parts, and mobile phones. Magnesium alloy can also be a popular candidate as an orthopedic implant material for biodegradability, non-toxicity, and mechanical and physical properties that are excellent. Magnesium, one of the main macro elements required for the proper functioning of the human organism, is used to test the materials for biodegradable implants. The main objective of this study was to find out the microstructure, and mechanical characteristics of the Mg-Ca-Zn-CaCO3 alloy as porous implant materials are biodegradable. The presence of CaCO3 on the alloy functions as a foaming agent expected to produce gas bubbles during manufacturing process taken place that will form pores in the alloy. Mg-Ca-Zn-CaCO3 alloy was made by powder metallurgy method with three variations of composition (96Mg-Ca-3Zn-CaCO3, 91Mg-Ca-3Zn-5CaCO3, and 86Mg-Ca-3Zn-10CaCO3 wt%). Milling process was by using a shaker mill for 2 hours to produce a powder size distribution which was more homogeneous. The mixed powder was uniaxially pressed at a pressure of 100 MPa for 2 minutes and 200 MPa for 3 minutes into green compacts with dimensions of 10 mm in diameter and 10 mm in length. The sintering process was carried out at 650°C with a variation of holding time of 10 and 15 hours, and then the specimens were cooled down at room temperature. Microstructural analysis was performed by using X-Ray diffraction technique and Scanning electron microscopy equipped with an energy disperse spectrometry (EDS). The mechanical characteristics were analyzed by using Universal Testing Machine. The density and porosity of specimen were further measured by using Archimedes method. The results show that the optimum microstructure and mechanical characteristics are the holding time of 10 hours. The value of compression was 208.398 N/mm2, the density was 1.63 g/cc and a porosity was 18% on the

  20. Structural and magnetic properties of the layered compound Ca2 ...

    Indian Academy of Sciences (India)

    The brownmillerite-type layered compound Ca2.375La0.125Sr0.5GaMn2O8 has ... La3+ is doped at the Ca2+ site in the parent compound Ca2.5Sr0.5GaMn2O8. In .... 0.248(14). 1.03(4). 0.99(9) spins. Along the b-axis, the Mn spin is found to be ferromagnetically coupled to the nearest-neighbour Mn spin in the other MnO6 ...

  1. Peran Enzim Ca2+ - ATPase pada Membran Sel Darah Merah

    Directory of Open Access Journals (Sweden)

    Ferry P. Gultom

    2015-10-01

    Full Text Available Ca2+ - ATP ase enzyme is transmembrane protein which is found in membrane cell. This protein works as a pump in many cases such as thalassemia which causes leakage of the cell as there is oxidation of sulphidril chain from amino acid in membrane. The calcium-ion intake must be pumped out to get red blood cell homeostatic condition. The aim of this paper is to determine the activity of Ca2+ - ATPase enzyme as a pump of Ca ion in membrane cell.

  2. Meigs' Syndrome with Elevated Serum CA125: Case Report

    Directory of Open Access Journals (Sweden)

    Esin Kasap

    2016-06-01

    Full Text Available An elevated serum CA125 level in association with a pelvic mass,pleural effusion,and massive ascites usually signifies a dismal prognosis in a postmenopausal woman.However, surgery and histopathological examination are required for the correct diagnosis and treatment,since an elevated CA125 level can be falsely positive for ovarian malignancy.We present a case of Meigs' syndrome due to left ovarian fibroma with elevated CA125 level in a postmenopausal woman. [J Contemp Med 2016; 6(2.000: 114-117

  3. Coping with Asymmetric Channel Losses in CSMA/CA

    DEFF Research Database (Denmark)

    Paramanathan, Achuthan; Roetter, Daniel Enrique Lucani; Fitzek, Frank

    2013-01-01

    /CA is very sensitive to asymmetric channel losses caused by channel conditions. Leveraging this analysis, we present an adaptive channel priority protocol that copes with asymmetric channel losses while being compatible with CSMA/CA. We implement this protocol and perform real-life measurements that (i......) confirm the sensitivity of the CSMA/CA scheme in real implementations, and (ii) shows that our adaptive protocol provides a simple, yet potent mechanism to cope with asymmetric channel losses and ultimately to enhance end-to-end throughput in high-load scenarios....

  4. Metal halide doped metal borohydrides for hydrogen storage: The case of Ca(BH{sub 4}){sub 2}-CaX{sub 2} (X = F, Cl) mixture

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ji Youn [Materials/Devices Division, Korea Institute of Science and Technology, Seoul 136-791 (Korea, Republic of); Lee, Young-Su, E-mail: lee0su@kist.re.k [Materials/Devices Division, Korea Institute of Science and Technology, Seoul 136-791 (Korea, Republic of); Suh, Jin-Yoo; Shim, Jae-Hyeok; Cho, Young Whan [Materials/Devices Division, Korea Institute of Science and Technology, Seoul 136-791 (Korea, Republic of)

    2010-09-17

    Research highlights: {yields} Metal halides, CaF{sub 2} and CaCl{sub 2}, can change dehydrogenation pathway of Ca(BH{sub 4}){sub 2}. {yields} CaCl{sub 2} forms a solid solution with Ca(BH{sub 4}){sub 2}. {yields} CaF{sub 2} does not interact with Ca(BH{sub 4}){sub 2}. {yields} Metal halide and CaH{sub 2} interaction changes thermodynamics of Ca(BH{sub 4}){sub 2}. - Abstract: We have explored metal halide doping in metal borohydrides in order to modify hydrogen desorption/absorption properties of such high-capacity solid-state hydrogen storage materials. The specific application here is 10 mol% addition of CaX{sub 2} (X = F, Cl) to Ca(BH{sub 4}){sub 2}. The materials are analyzed using in-situ X-ray diffraction, differential scanning calorimetry, thermogravimetry, and IR spectroscopy, and the experimental results are compared against theoretical predictions from first-principles. Interestingly, in a fully hydrogenated state, CaCl{sub 2} dissolves into Ca(BH{sub 4}){sub 2} whereas CaF{sub 2} exists as a separate phase. During the course of dehydrogenation, CaH{sub 2}-CaF{sub 2} solid solution, CaHCl, and a new Ca-H-Cl compound are observed. In-situ X-ray diffraction study reveals that CaX{sub 2} interacts with Ca(BH{sub 4}){sub 2} in the early stage of decomposition, which could facilitate a direct decomposition of Ca(BH{sub 4}){sub 2} into CaH{sub 2} and CaB{sub 6} without forming intermediate phases such as CaB{sub 2}H{sub x} which seem to be thermodynamically in close competition with the formation of CaH{sub 2} and CaB{sub 6}. Our first-principles calculation estimates that the decrease in the decomposition temperature due to the CaH{sub 2}-CaX{sub 2} interaction would be less than 10 {sup o}C, and therefore the major contribution of CaX{sub 2} is to change the dehydrogenation pathway rather than the overall thermodynamics.

  5. Synaptically activated Ca2+ waves and NMDA spikes locally suppress voltage-dependent Ca2+ signalling in rat pyramidal cell dendrites.

    Science.gov (United States)

    Manita, Satoshi; Miyazaki, Kenichi; Ross, William N

    2011-10-15

    Postsynaptic [Ca(2+)](i) changes contribute to several kinds of plasticity in pyramidal neurons. We examined the effects of synaptically activated Ca(2+) waves and NMDA spikes on subsequent Ca(2+) signalling in CA1 pyramidal cell dendrites in hippocampal slices. Tetanic synaptic stimulation evoked a localized Ca(2+) wave in the primary apical dendrites. The [Ca(2+)](i) increase from a backpropagating action potential (bAP) or subthreshold depolarization was reduced if it was generated immediately after the wave. The suppression had a recovery time of 30-60 s. The suppression only occurred where the wave was generated and was not due to a change in bAP amplitude or shape. The suppression also could be generated by Ca(2+) waves evoked by uncaging IP(3), showing that other signalling pathways activated by the synaptic tetanus were not required. The suppression was proportional to the amplitude of the [Ca(2+)](i) change of the Ca(2+) wave and was not blocked by a spectrum of kinase or phosphatase inhibitors, consistent with suppression due to Ca(2+)-dependent inactivation of Ca(2+) channels. The waves also reduced the frequency and amplitude of spontaneous, localized Ca(2+) release events in the dendrites by a different mechanism, probably by depleting the stores at the site of wave generation. The same synaptic tetanus often evoked NMDA spike-mediated [Ca(2+)](i) increases in the oblique dendrites where Ca(2+) waves do not propagate. These NMDA spikes suppressed the [Ca(2+)](i) increase caused by bAPs in those regions. [Ca(2+)](i) increases by Ca(2+) entry through voltage-gated Ca(2+) channels also suppressed the [Ca(2+)](i) increases from subsequent bAPs in regions where the voltage-gated [Ca(2+)](i) increases were largest, showing that all ways of raising [Ca(2+)](i) could cause suppression.

  6. Controls over δ44/40Ca and Sr/Ca variations in coccoliths: New perspectives from laboratory cultures and cellular models

    Science.gov (United States)

    Mejía, Luz María; Paytan, Adina; Eisenhauer, Anton; Böhm, Florian; Kolevica, Ana; Bolton, Clara; Méndez-Vicente, Ana; Abrevaya, Lorena; Isensee, Kirsten; Stoll, Heather

    2018-01-01

    Coccoliths comprise a major fraction of the global carbonate sink. Therefore, changes in coccolithophores' Ca isotopic fractionation could affect seawater Ca isotopic composition, affecting interpretations of the global Ca cycle and related changes in seawater chemistry and climate. Despite this, a quantitative interpretation of coccolith Ca isotopic fractionation and a clear understanding of the mechanisms driving it are not yet available. Here, we address this gap in knowledge by developing a simple model (CaSri-Co) to track coccolith Ca isotopic fractionation during cellular Ca uptake and allocation to calcification. We then apply it to published and new δ 44 / 40 Ca and Sr/Ca data of cultured coccolithophores of the species Emiliania huxleyi and Gephyrocapsa oceanica. We identify changes in calcification rates, Ca retention efficiency and solvation-desolvation rates as major drivers of the Ca isotopic fractionation and Sr/Ca variations observed in cultures. Higher calcification rates, higher Ca retention efficiencies and lower solvation-desolvation rates increase both coccolith Ca isotopic fractionation and Sr/Ca. Coccolith Ca isotopic fractionation is most sensitive to changes in solvation-desolvation rates. Changes in Ca retention efficiency may be a major driver of coccolith Sr/Ca variations in cultures. We suggest that substantial changes in the water structure strength caused by past changes in temperature could have induced significant changes in coccolithophores' Ca isotopic fractionation, potentially having some influence on seawater Ca isotopic composition. We also suggest a potential effect on Ca isotopic fractionation via modification of the solvation environment through cellular exudates, a hypothesis that remains to be tested.

  7. Delta(9)-tetrahydrocannabinol activates [Ca2+], increases partly sensitive to capacitative store refilling

    NARCIS (Netherlands)

    Filipeanu, CM; deZeeuw, D; Nelemans, SA

    1997-01-01

    Delta(9)-Tetrahydrocannabinol induces [Ca2+](i) increases in DDT1MF-2 smooth muscle cells. Both Ca2+ entry and release from intracellular Ca2+ stores were concentration dependently activated. The Ca2+ entry component contributed most to the increases in [Ca2+](i). Stimulation with

  8. Aberrant astrocyte Ca2+signals "AxCa signals" exacerbate pathological alterations in an Alexander disease model.

    Science.gov (United States)

    Saito, Kozo; Shigetomi, Eiji; Yasuda, Rei; Sato, Ryuichi; Nakano, Masakazu; Tashiro, Kei; Tanaka, Kenji F; Ikenaka, Kazuhiro; Mikoshiba, Katsuhiko; Mizuta, Ikuko; Yoshida, Tomokatsu; Nakagawa, Masanori; Mizuno, Toshiki; Koizumi, Schuichi

    2018-01-31

    Alexander disease (AxD) is a rare neurodegenerative disorder caused by gain of function mutations in the glial fibrillary acidic protein (GFAP) gene. Accumulation of GFAP proteins and formation of Rosenthal fibers (RFs) in astrocytes are hallmarks of AxD. However, malfunction of astrocytes in the AxD brain is poorly understood. Here, we show aberrant Ca 2+ responses in astrocytes as playing a causative role in AxD. Transcriptome analysis of astrocytes from a model of AxD showed age-dependent upregulation of GFAP, several markers for neurotoxic reactive astrocytes, and downregulation of Ca 2+ homeostasis molecules. In situ AxD model astrocytes produced aberrant extra-large Ca 2+ signals "AxCa signals", which increased with age, correlated with GFAP upregulation, and were dependent on stored Ca 2+ . Inhibition of AxCa signals by deletion of inositol 1,4,5-trisphosphate type 2 receptors (IP3R2) ameliorated AxD pathogenesis. Taken together, AxCa signals in the model astrocytes would contribute to AxD pathogenesis. © 2018 Wiley Periodicals, Inc.

  9. A study of the dissociative recombination of CaO+ with electrons: Implications for Ca chemistry in the upper atmosphere

    Science.gov (United States)

    Bones, D. L.; Gerding, M.; Höffner, J.; Martín, Juan Carlos Gómez; Plane, J. M. C.

    2016-12-01

    The dissociative recombination of CaO+ ions with electrons has been studied in a flowing afterglow reactor. CaO+ was generated by the pulsed laser ablation of a Ca target, followed by entrainment in an Ar+ ion/electron plasma. A kinetic model describing the gas-phase chemistry and diffusion to the reactor walls was fitted to the experimental data, yielding a rate coefficient of (3.0 ± 1.0) × 10-7 cm3 molecule-1 s-1 at 295 K. This result has two atmospheric implications. First, the surprising observation that the Ca+/Fe+ ratio is 8 times larger than Ca/Fe between 90 and 100 km in the atmosphere can now be explained quantitatively by the known ion-molecule chemistry of these two metals. Second, the rate of neutralization of Ca+ ions in a descending sporadic E layer is fast enough to explain the often explosive growth of sporadic neutral Ca layers.

  10. Formation mechanism of Ca-deficient hydroxyapatite coating on Mg–Zn–Ca alloy for orthopaedic implant

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Huanxin [School of Materials Science and Engineering, Zhengzhou University, Zhengzhou 450002 (China); College of Materials and Chemical Engineering, Zhengzhou University of Light Industry, Zhengzhou 450002 (China); Zhu, Shijie; Wang, Liguo; Feng, Yashan; Ma, Xun [School of Materials Science and Engineering, Zhengzhou University, Zhengzhou 450002 (China); Guan, Shaokang, E-mail: skguan@zzuedu.cn [School of Materials Science and Engineering, Zhengzhou University, Zhengzhou 450002 (China)

    2014-07-01

    A biodegradable Ca-deficient hydroxyapatite (Ca-def HA) coating has been directly prepared on Mg–Zn–Ca alloy by pulse electrodeposition to improve its corrosion resistance and biocompatibility. However, the formation mechanism of such a Ca-def HA coating on magnesium substrate is still not clear. In this study, the microstructure evolution of the coating was characterized using x-ray diffractometer, x-ray photoelectron spectroscopy and scanning electron microscopy. Thermodynamic and kinetic studies of the precipitation of hydroxyapatite (HA), octacalcium phosphate (OCP) and dicalcium phosphate dihydrate (DCPD) in the used electrolyte were also carried out. Theoretical analyses illustrate that the precipitation of HA, OCP and DCPD are all possible when the electrolyte pH is higher than 6 at 80 °C, and that the higher the pH value, the more favorable is the formation of HA. Nevertheless, there is mainly poor crystalline Ca-def HA on the substrate when pulse electrodeposition lasts for 5 min, and its crystallinity increases with duration time The direct formation of the Ca-def HA coating on Mg–Zn–Ca alloy is closely dependent on the phase composition and microstructure of the substrate, the deposition parameters and Mg{sup 2+} ions substitution in HA structure.

  11. Towards reconstructing ancient seawater Mg/Ca by combining porcelaneous and hyaline foraminiferal Mg/Ca-temperature calibrations

    Science.gov (United States)

    Wit, J. C.; de Nooijer, L. J.; Haig, J.; Jorissen, F. J.; Thomas, E.; Reichart, G.-J.

    2017-08-01

    The temperature of the deep ocean plays a vital role in the Earth's climate system. Paleo-reconstructions of deep-sea temperatures have traditionally been based on the oxygen isotope composition of deep-sea benthic foraminiferal calcite shells, although this parameter depends upon polar ice volume as well as temperature. More recent reconstructions use Mg/Ca in these shells, with temperature calibrations based on empirical relationships observed in present-day oceans. Incorporation of Mg (DMg) into foraminiferal calcite is, however, not solely dependent on temperature, but also on seawater Mg/Ca. Due to its long oceanic residence time, Mg concentrations remained relatively constant over time scales of a few hundred thousand years, but varied significantly over longer geological time scales. Accurate reconstruction of past temperatures using foraminiferal Mg/Ca, therefore, hinges on our understanding of Mg/Ca seawater changes on geological timescales. We explore a novel, independent approach to reconstructing past seawater Mg/Ca using the temperature-dependent offset in DMg between porcelaneous (secreting intermediate- or high-Mg calcite, abbreviated as IMC or HMC, respectively) and hyaline (producing low-Mg calcite, abbreviated as LMC) benthic foraminifera. We calibrated the Mg/Ca-temperature dependence for Pyrgo spp. (one of the few common, large-sized porcelaneous taxa present in the deep-sea since the middle Miocene), and combined this with an existing calibration of hyaline Cibicidoides spp. to mathematically solve for changes in Mg/Ca seawater through time. We show that changes in Mg/Ca seawater can be reconstructed using the offset between porcelaneous and hyaline foraminifera, but absolute values are highly dependent on the species-specific offset between Mg/Ca seawater and Mg-partition coefficients.

  12. Localization of Ca2+ and Ca-ATPase on wet (Ruscus aculeatus) and dry (Primula officinalis) stigma surface

    OpenAIRE

    Elżbieta Bednarska

    2014-01-01

    Calcium is present in the surface cells of both types of stigma. The chlorotetracycline method was used to show that the papillae of the dry stigma of Primula officinalis are the source of fluorescence of the CTC-Ca2+ complex. The precipitation method (NHA) localized calcium ions mainly in the pellicula surrounding these papillae. The NHA-Ca2+ precipitates were localized on the plasma membrane in the papillae of the wet stigma of Ruscus aculeatus. Ca-ATPase activity was found in both types of...

  13. BCL-2, Ca, and Apoptosis in Breast Cancer

    National Research Council Canada - National Science Library

    Machen, Terry

    1998-01-01

    The central hypothesis of this project is that bcl-2 controls PCD and oncogenesis by altering Ca permeability by the ER/nuclear membranes, mitochondria and/or plasma membrane of mammary epithelial cells...

  14. Structural studies of Ca2+-ATPase ligand and regulatory complexes

    DEFF Research Database (Denmark)

    Drachmann, Nikolaj Düring

    2015-01-01

    is regulated by the Sarcolipin homologue Phospholamban. They act upon binding by increasing the apparent Ca2+ affinity of the ATPases, thus regulating the activity in the physiologically relevant Ca2+ concentrations. In the first part of the thesis, a purification protocol of native SERCA2a from pig hearts...... is presented. The purified protein was used for X-ray crystallographic studies aiming at determining the three dimensional structure of the SERCA2a isoform in a Ca2+-free conformation. Crystals of the Ca2+ free state of SERCA2a stabilised by the inhibitor cyclopiazonic acid was obtained and a dataset...... was collected scaling to 3.26 Å resolution, allowing a preliminary structural analysis. The overall crystal structure is very similar to SERCA1a. Additionally, co-crystallisation studies have been initiated of SERCA2a and recombinantly expressed Phospholamban. Besides the above mentioned regulatory peptides...

  15. Mixing Corrosion of CaCO3 in Natural Waters

    Directory of Open Access Journals (Sweden)

    Qian Hui

    2011-01-01

    Full Text Available The methods of aqueous speciation calculation, pH calculation and the solubility (precipitability calculation of CaCO3 were used to study the mixing corrosion of CaCO3 in natural waters. Mixing processes were done between two unsaturated (with CaCO3 solutions, two oversaturated solutions and between an unsaturated solution and an oversaturated solution, respectively. Results show that the mixing corrosion can be divided into two different levels: mixing corrosion in strict sense and mixing corrosion in broad sense. When mixing corrosion occurs, the HCO3- concentration in one end member solution is usually higher than that in the other solution, and the Ca2+ concentration in the former solution is also usually higher than that in the latter one.

  16. Global Database of Borehole Temperatures and Climate Reconstructions - CA-0003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data collected from borehole site CA-0003. For an accurate assessment of the relative roles of natural variability and anthropogenic influence in the Earth's...

  17. 75 FR 52804 - Environmental Impact Statement: Stanislaus County, CA

    Science.gov (United States)

    2010-08-27

    ... Federal Highway Administration Environmental Impact Statement: Stanislaus County, CA AGENCY: Federal... Environmental Impact Statement (EIS) will be prepared for a proposed highway project in Stanislaus County... subsequent environmental documentation for project-specific impacts. Letters describing the proposed action...

  18. A vaccination strategy to SEIR-CA model

    Science.gov (United States)

    Almuzakki, Muhammad Zaki; Nuraini, Nuning

    2016-04-01

    A combination between Susceptible-Exposed-Infected-Removed (SEIR) model and Cellular Automaton (CA) called SEIR-CA model has been proposed to simulate spreading diseases through populations. We make an improvement to the parameter which describe the impact of neighborhood in CA system. We also propose a vaccination strategy to the model. Three examples are given to illustrate the model. The first one shows that the previously established SEIR-CA model does not work properly in a population with randomly distributed individuals. After an improvement to the neighborhood impact parameter has been made, the model works properly in a population with randomly distributed individuals and it is shown in the second example. The last example shows the spreading mechanisms with a chosen vaccination strategy. We also show that the vaccination strategy can reduce the number of infected individuals and can suppress the spread of the diseases.

  19. Vibrational spectra of CaGa2O4, Ca2GeO4, CaIn2O4 and CaSnO3 prepared by electrospinning

    Science.gov (United States)

    Zheng, H. L.; Zhang, Z. C.; Zhou, J. G.; Yang, S. S.; Zhao, J.

    2012-08-01

    CaGa2O4 nanofibers, Ca2GeO4 microfibers, CaIn2O4 nanorods, and CaSnO3 nanofibers were synthesized by using an electrospinning technique. Structures and morphologies of the as-synthesized oxides were characterized by X-ray diffraction and scanning electron microscopy, respectively. Raman and infrared spectra were also recorded and analyzed at room temperature. More significantly, nuclear site group analysis was carried out and the number of normal vibrational modes, Raman-active, and infrared-active optical phonon modes were obtained by theoretical calculation. Finally, vibrational assignments of the observed Raman peaks and infrared absorption bands were given based on the group theoretical analysis and experimental data from literature.

  20. Targeting Cardiomyocyte Ca2+ Homeostasis in Heart Failure

    Science.gov (United States)

    Røe, Åsmund T.; Frisk, Michael; Louch, William E.

    2015-01-01

    Improved treatments for heart failure patients will require the development of novel therapeutic strategies that target basal disease mechanisms. Disrupted cardiomyocyte Ca2+ homeostasis is recognized as a major contributor to the heart failure phenotype, as it plays a key role in systolic and diastolic dysfunction, arrhythmogenesis, and hypertrophy and apoptosis signaling. In this review, we outline existing knowledge of the involvement of Ca2+ homeostasis in these deficits, and identify four promising targets for therapeutic intervention: the sarcoplasmic reticulum Ca2+ ATPase, the Na+-Ca2+ exchanger, the ryanodine receptor, and t-tubule structure. We discuss experimental data indicating the applicability of these targets that has led to recent and ongoing clinical trials, and suggest future therapeutic approaches. PMID:25483944

  1. Measurement of the half-life of [sup 45]Ca

    Energy Technology Data Exchange (ETDEWEB)

    Los Arcos, J.M. (Metrologia de Radiaciones, Inst. de Investigacion Basica, CIEMAT, Madrid (Spain)); Rodriguez, L. (Metrologia de Radiaciones, Inst. de Investigacion Basica, CIEMAT, Madrid (Spain)); Roteta, M. (Metrologia de Radiaciones, Inst. de Investigacion Basica, CIEMAT, Madrid (Spain)); Garcia-Torano, E. (Metrologia de Radiaciones, Inst. de Investigacion Basica, CIEMAT, Madrid (Spain))

    1994-01-22

    The currently accepted value of 163.8[+-]1.8 d for the [sup 45]Ca half-life is based on the two most accurate measurements of 162.6[+-]0.1 d and 165.1[+-]0.7 d, which are nevertheless discrepant. New measurements have been carried out using a liquid scintillation spectrometer to follow the decay of [sup 45]Ca for three half-lives. A set of eight liquid sources prepared with [sup 45]Ca-labelled calcium chloride, HDEHP and 2-ethylhexanoate were measured in Hisafe II, Ultima-Gold and Instagel. Solid sources of [sup 45]Ca were sandwiched between two sheets of thin metallized Mylar, and measured with a proportional counter and a Si detector to test their reliability and consistency. The new half-life value of 162.67[+-]0.25 d is in good agreement with the lower value of the two measurements previously reported. (orig.)

  2. CA 19-9 (Cancer Antigen 19-9)

    Science.gov (United States)

    ... antigen negative (about 30% in people of African ancestry) and do not produce CA 19-9. The ... are slightly more likely to have it than women), family history, diabetes , chronic pancreatitis , and workplace exposure ...

  3. Neuronal migration and its disorders affecting the CA3 region

    Directory of Open Access Journals (Sweden)

    Richard eBelvindrah

    2014-03-01

    Full Text Available In this review, we focus on CA3 neuronal migration disorders in the rodent. We begin by introducing the main steps of hippocampal development, and we summarize characteristic hippocampal malformations in human. We then describe various mouse mutants showing structural hippocampal defects. Notably, genes identified in human cortical neuronal migration disorders consistently give rise to a CA3 phenotype when mutated in the mouse. We successively describe their molecular, physiological and behavioral phenotypes that together contribute to a better understanding of CA3-dependent functions. We finally discuss potential factors underlying the CA3 vulnerability revealed by these mouse mutants and that may also contribute to other human neurological and psychiatric disorders.

  4. Thermal unfolding of a Ca- and Lanthanide-binding protein

    Energy Technology Data Exchange (ETDEWEB)

    Fahmy, Karim [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Biophysics; Goettfert, M. [Technische Univ. Dresden (Germany); Knoeppel, J.

    2017-06-01

    The MIIA (metal ion-induced autocleavage)-domain of the protein Vic001052 from the pathogen Vibrio coralliilyticus, comprises 173 amino acids and exhibits Ca-dependent autoproteolytic activity. It shows homology to nodulation proteins which are secreted by Rhizobiacea into plant host cells where they exert Ca-dependent functions. We have studied the structural and energetic aspects of metal protein interactions of the MIIA domain which appear attractive for engineering metal-binding synthetic peptides. Using a non-cleavable MIIA domain construct, we detected very similar structural changes upon binding to Ca{sup 2+} and Eu{sup 3+}. The thermal denaturation of the Ca-bound state was studied by circular dichroism spectroscopy. The metal-bound folded state unfolds reversibly into an unstructured metal-free state similar to the metal-free state at room temperature.

  5. CA-125: A Biomarker Put to the Test

    National Research Council Canada - National Science Library

    Schmidt, Charlie

    2011-01-01

    .... "Please, please, p-l-e-a-s-e tell all your female friends and relatives to insist on a CA-125 blood test every year as part of their annual physical exams," pleaded the note from a cancer patient...

  6. Envejecimiento Neuronal y Transporte de Ca2+ Intracelular

    OpenAIRE

    Hernando Pérez, Mª Elena

    2017-01-01

    El envejecimiento promueve pérdida cognitiva y susceptibilidad a enfermedades neurodegenerativas, lo que se ha relacionado con la dishomeostasis del Ca2+ intracelular. Para investigar esta hipótesis se utiliza el cultivo a largo plazo de neuronas de hipocampo de rata, modelo de envejecimiento neuronal in vitro. Mediante imagen de fluorescencia se han estudiado cambios en transporte de Ca2+ en neuronas a lo largo del envejecimiento in vitro. Las neuronas se han identificado mediante inmunofluo...

  7. Benthic foraminiferal Mn / Ca ratios reflect microhabitat preferences

    Directory of Open Access Journals (Sweden)

    K. A. Koho

    2017-06-01

    Full Text Available The Mn / Ca of calcium carbonate tests of living (rose-Bengal-stained benthic foraminifera (Elphidium batialis, Uvigerina spp., Bolivina spissa, Nonionellina labradorica and Chilostomellina fimbriata were determined in relation to pore water manganese (Mn concentrations for the first time along a bottom water oxygen gradient across the continental slope along the NE Japan margin (western Pacific. The local bottom water oxygen (BWO gradient differs from previous field study sites focusing on foraminiferal Mn / Ca and redox chemistry, therefore allowing further resolution of previously observed trends. The Mn / Ca ratios were analysed using laser ablation inductively coupled plasma-mass spectrometer (ICP-MS, allowing single-chamber determination of Mn / Ca. The incorporation of Mn into the carbonate tests reflects environmental conditions and is not influenced by ontogeny. The inter-species variability in Mn / Ca reflected foraminiferal in-sediment habitat preferences and associated pore water chemistry but also showed large interspecific differences in Mn partitioning. At each station, Mn / Ca ratios were always lower in the shallow infaunal E. batialis, occupying relatively oxygenated sediments, compared to intermediate infaunal species, Uvigerina spp. and B. spissa, which were typically found at greater depth, under more reducing conditions. The highest Mn / Ca was always recorded by the deep infaunal species N. labradorica and C. fimbriata. Our results suggest that although partitioning differs, Mn / Ca ratios in the intermediate infaunal taxa are promising tools for palaeoceanographic reconstructions as their microhabitat exposes them to higher variability in pore water Mn, thereby making them relatively sensitive recorders of redox conditions and/or bottom water oxygenation.

  8. Secure electronic commerce communication system based on CA

    Science.gov (United States)

    Chen, Deyun; Zhang, Junfeng; Pei, Shujun

    2001-07-01

    In this paper, we introduce the situation of electronic commercial security, then we analyze the working process and security for SSL protocol. At last, we propose a secure electronic commerce communication system based on CA. The system provide secure services such as encryption, integer, peer authentication and non-repudiation for application layer communication software of browser clients' and web server. The system can implement automatic allocation and united management of key through setting up the CA in the network.

  9. Soc.ca: Specific Correspondence Analysis for the Social Sciences

    DEFF Research Database (Denmark)

    2016-01-01

    Specific and class specific multiple correspondence analysis on survey-like data. Soc.ca is optimized to the needs of the social scientist and presents easily interpretable results in near publication ready quality.......Specific and class specific multiple correspondence analysis on survey-like data. Soc.ca is optimized to the needs of the social scientist and presents easily interpretable results in near publication ready quality....

  10. CA 2025: The Strategic Design of Civil Affairs

    Science.gov (United States)

    2015-06-01

    cases—Lewis and Clark, James Beckwourth and General Winfield Scott—to represent the breath and width of CA. Lewis, Clark and Beckwourth were specially...reductions, a lower demand signal for RC CA also spells troubles for USACAPOC(A). Efforts, such as the establishment of the IMSG at Fort Bragg, NC to...an organization hold in common—Sathe (1985) asserts that the content of an organizational culture is determined by how they interrelate, or more

  11. Effects of ca treatments and temperature on broccoli colour development

    OpenAIRE

    Schouten, R.E.; Zhang, X.; Tijskens, L.M.M.; Kooten, van, G.C.

    2010-01-01

    Broccoli combines high contents of vitamins, fibres and glucosinolates with a low calorie count and is sometimes referred to as the ‘crown jewel of nutrition’. Colour is one of the most important quality attributes of broccoli, and yellowing due to senescence of broccoli florets is the main external quality problem in the broccoli supply chain. Controlled Atmosphere (CA) is a very effective method to maintain broccoli quality but the effects of CA on colour retention have not been studied ext...

  12. Ca-Lignosulphonate and sclerotial viability of Sclerotinia sclerotiorum

    Directory of Open Access Journals (Sweden)

    MATTEO MONTANARI

    2012-01-01

    Full Text Available Lignosulphonates, low cost by-products of the pulping process, have shown suppressive effects against some diseases caused by soil-borne pathogens. In this study, the effect of 1.5% v/v calcium lignosulphonate (Ca-Ls amendment to two commercial potting mixes (peat + coconut fibres; PC; and municipal compost + peat + pumice; MCPP on the viability of Sclerotinia sclerotiorum sclerotia was investigated. Sclerotia were buried in the Ca-Ls amended substrates for 30 days. Non-amended PC and MCPP, sterile sand and sterile PC with and without Ca-Ls were used as controls. The viability of sclerotia recovered from PC and MCPP amended with Ca-Ls was reduced by 50 and 42% respectively compared to control treatments. Ca-Ls amendment decreased sclerotial viability by enhancing the activity of the indigenous mycoparasitic fungi, Fusarium oxysporum, Mucor spp. and Trichoderma spp. The biocontrol ability of Ca-Ls against sclerotia was due to the stimulation of microbial activity and is, therefore, strictly dependent on the microbial composition of the substrate.

  13. Ca isotopic geochemistry of an Antarctic aquatic system

    Science.gov (United States)

    Lyons, W. Berry; Bullen, Thomas D.; Welch, Kathleen A.

    2017-01-01

    The McMurdo Dry Valleys, Antarctica, are a polar desert ecosystem. The hydrologic system of the dry valleys is linked to climate with ephemeral streams that flow from glacial melt during the austral summer. Past climate variations have strongly influenced the closed-basin, chemically stratified lakes on the valley floor. Results of previous work point to important roles for both in-stream processes (e.g., mineral weathering, precipitation and dissolution of salts) and in-lake processes (e.g., mixing with paleo-seawater and calcite precipitation) in determining the geochemistry of these lakes. These processes have a significant influence on calcium (Ca) biogeochemistry in this aquatic ecosystem, and thus variations in Ca stable isotope compositions of the waters can aid in validating the importance of these processes. We have analyzed the Ca stable isotope compositions of streams and lakes in the McMurdo Dry Valleys. The results validate the important roles of weathering of aluminosilicate minerals and/or CaCO3 in the hyporheic zone of the streams, and mixing of lake surface water with paleo-seawater and precipitation of Ca-salts during cryo-concentration events to form the deep lake waters. The lakes in the McMurdo Dry Valleys evolved following different geochemical pathways, evidenced by their unique, nonsystematic Ca isotope signatures.

  14. Review - Synthesis and superconducting properties of CaC6

    Directory of Open Access Journals (Sweden)

    Nicolas Emery, Claire Herold, Jean-François Mareche and Philippe Lagrange

    2008-01-01

    Full Text Available Among the superconducting graphite intercalation compounds, CaC6 exhibits the highest critical temperature Tc=11.5 K. Bulk samples of CaC6 are obtained by immersing highly oriented pyrographite pieces in a well-chosen liquid Li–Ca alloy for 10 days at 350 °C. The crystal structure of CaC6 belongs to the { m R}ar{3}{ m m} space group. In order to study the superconducting properties of CaC6, magnetisation was measured as a function of temperature and direction of magnetic field applied parallel or perpendicular to the c-axis. Meissner effect was evidenced, as well as a type II superconducting behaviour and a small anisotropy. In agreement with calculations, experimental results obtained from various techniques suggest that a classical electron-phonon mechanism is responsible for the superconductivity of CaC6. Application of high pressure increases the Tc up to 15.1 K at 8 GPa.

  15. Formation of carrageenan-CaCO{sub 3} bioactive membranes

    Energy Technology Data Exchange (ETDEWEB)

    Nogueira, Lucas F.B.; Maniglia, Bianca C.; Pereira, Lourivaldo S.; Tapia-Blácido, Delia R.; Ramos, Ana P., E-mail: anapr@ffclrp.usp.br

    2016-01-01

    The high biocompatibility and resorbability of polymeric membranes have encouraged their use to manufacture medical devices. Here, we report on the preparation of membranes consisting of carrageenan, a naturally occurring sulfated polysaccharide that forms helical structures in the presence of calcium ions. We incorporated CaCO{sub 3} particles into the membranes to enhance their bioactivity and mechanical properties. Infrared spectroscopy and X-ray diffraction data confirmed CaCO{sub 3} incorporation into the polymeric matrix. We tested the bioactivity of the samples by immersing them in a solution that mimics the ionic composition and pH of the human body fluid. The hybrid membranes generated hydroxyapatite, as attested by X-ray diffraction data. Scanning electron and atomic force microscopies aided investigation of membrane topography before and after CaCO{sub 3} deposition. The wettability and surface free energy, evaluated by contact angle measures, increased in the presence of CaCO{sub 3} particles. These parameters are important for membrane implantation in the body. Moreover, membrane stiffness was up to 110% higher in the presence of the inorganic particles, as revealed by Young's modulus. - Highlights: • Hybrid kappa and iota carrageenan-CaCO{sub 3} membranes were formed. • The hybrid membrane's origin hydroxyapatite after exposure to simulated body fluid • The carrageenan's specificity to bind Ca{sup 2+} ions tailors the surface properties.

  16. Meiosis, egg activation, and nuclear envelope breakdown are differentially reliant on Ca2+, whereas germinal vesicle breakdown is Ca2+ independent in the mouse oocyte

    Science.gov (United States)

    Tombes, R. M.; Simerly, C.; Borisy, G. G.; Schatten, G.

    1992-01-01

    During early development, intracellular Ca2+ mobilization is not only essential for fertilization, but has also been implicated during other meiotic and mitotic events, such as germinal vesicle breakdown (GVBD) and nuclear envelope breakdown (NEBD). In this study, the roles of intracellular and extracellular Ca2+ were examined during meiotic maturation and reinitiation at parthenogenetic activation and during first mitosis in a single species using the same methodologies. Cumulus-free metaphase II mouse oocytes immediately resumed anaphase upon the induction of a large, transient Ca2+ elevation. This resumption of meiosis and associated events, such as cortical granule discharge, were not sensitive to extracellular Ca2+ removal, but were blocked by intracellular Ca2+ chelators. In contrast, meiosis I was dependent on external Ca2+; in its absence, the formation and function of the first meiotic spindle was delayed, the first polar body did not form and an interphase-like state was induced. GVBD was not dependent on external Ca2+ and showed no associated Ca2+ changes. NEBD at first mitosis in fertilized eggs, on the other hand, was frequently, but not always associated with a brief Ca2+ transient and was dependent on Ca2+ mobilization. We conclude that GVBD is Ca2+ independent, but that the dependence of NEBD on Ca2+ suggests regulation by more than one pathway. As cells develop from Ca(2+)-independent germinal vesicle oocytes to internal Ca(2+)-dependent pronuclear eggs, internal Ca2+ pools increase by approximately fourfold.

  17. Caffeine-Induced Ca2+ Oscillations in Type I Horizontal Cells of the Carp Retina and the Contribution of the Store-Operated Ca2+ Entry Pathway

    Science.gov (United States)

    Lv, Ting; Gong, Hai-Qing; Liang, Pei-Ji

    2014-01-01

    The mechanisms of release, depletion, and refilling of endoplasmic reticulum (ER) Ca2+ were investigated in type I horizontal cells of the carp retina using a fluo-3-based Ca2+ imaging technique. Exogenous application of caffeine, a ryanodine receptor agonist, induced oscillatory intracellular free Ca2+ concentration ([Ca2+]i) responses in a duration- and concentration-dependent manner. In Ca2+-free Ringer’s solution, [Ca2+]i transients could also be induced by a brief caffeine application, whereas subsequent caffeine application induced no [Ca2+]i increase, which implied that extracellular Ca2+ was required for ER refilling, confirming the necessity of a Ca2+ influx pathway for ER refilling. Depletion of ER Ca2+ by thapsigargin triggered a Ca2+ influx which could be blocked by the store-operated channel inhibitor 2-APB, which proved the existence of the store-operated Ca2+ entry pathway. Taken together, these results suggested that after being depleted by caffeine, the ER was replenished by Ca2+ influx via store-operated channels. These results reveal the fine modulation of ER Ca2+ signaling, and the activation of the store-operated Ca2+ entry pathway guarantees the replenishment of the ER so that the cell can be ready for response to the subsequent stimulus. PMID:24918937

  18. STIM1/Orai1-mediated store-operated Ca2+ entry: the tip of the iceberg

    Directory of Open Access Journals (Sweden)

    F.R. Giachini

    2011-11-01

    Full Text Available Highly efficient mechanisms regulate intracellular calcium (Ca2+ levels. The recent discovery of new components linking intracellular Ca2+ stores to plasma membrane Ca2+ entry channels has brought new insight into the understanding of Ca2+ homeostasis. Stromal interaction molecule 1 (STIM1 was identified as a Ca2+ sensor essential for Ca2+ store depletion-triggered Ca2+ influx. Orai1 was recognized as being an essential component for the Ca2+ release-activated Ca2+ (CRAC channel. Together, these proteins participate in store-operated Ca2+ channel function. Defective regulation of intracellular Ca2+ is a hallmark of several diseases. In this review, we focus on Ca2+ regulation by the STIM1/Orai1 pathway and review evidence that implicates STIM1/Orai1 in several pathological conditions including cardiovascular and pulmonary diseases, among others.

  19. Involvement of Ca2+, CaMK II and PKA in EGb 761-induced insulin secretion in INS-1 cells.

    Science.gov (United States)

    Choi, Sung-E; Shin, Ha-Chul; Kim, Hyo-Eun; Lee, Soo-Jin; Jang, Hyun-Ju; Lee, Kwan-Woo; Kang, Yup

    2007-03-01

    EGb 761, a standardized form of Ginkgo biloba L. (Ginkgoaceae) leaf extract, was recently reported to increase pancreatic beta-cell function. To determine whether EGb 761 elicits insulin secretion directly, we treated INS-1 rat beta cells with EGb 761 and then measured insulin release. Treatment of EGb 761 (50 microg/ml) significantly stimulated insulin secretion in INS-1 cells, compared with untreated control (pCaMK) II and protein kinase A (PKA) inhibitor, respectively, significantly reduced EGb 761-induced insulin secretion. Immunoblotting studies showed an increase in the phosphorylated-forms of CaMK II and of PKA substrates after EGb 761 treatment. Our data suggest that EGb 761-induced insulin secretion is mediated by [Ca(2+)](i) elevation and subsequent activation of CaMK II and PKA.

  20. Distribution of CaMKIIα expression in the brain in vivo, studied by CaMKIIα-GFP mice

    Science.gov (United States)

    Wang, Xinjun; Zhang, Chunzhao; Szábo, Gábor; Sun, Qian-Quan

    2013-01-01

    To facilitate the study of the CaMKIIα function in vivo, a CaMKIIα-GFP transgenic mouse line was generated. Here, our goal is to provide the first neuroanatomical characterization of GFP expression in the CNS of this line of mouse. Overall, CaMKIIα -GFP expression is strong and highly heterogeneous, with the dentate gyrus of the hippocampus as the most abundantly expressed region. In the hippocampus, around 70% of granule and pyramidal neurons expressed strong GFP. In the neocortex, presumed pyramidal neurons were GFP positive: around 32% of layer II/III and 35% of layer VI neurons expressed GFP, and a lower expression rate was found in other layers. In the thalamus and hypothalamus, strong GFP signals were detected in the neuropil. GFP-positive cells were also found in many other regions such as the spinal trigeminal nucleus, cerebellum and basal ganglia. We further compared the GFP expression with specific antibody staining for CaMKIIα and GABA. We found that GFP+ neurons were mostly positive for CaMKIIα-IR throughout the brain, with some exceptions throughout the brain, especially in the deeper layers of neocortex. GFP and GABA-IR marked distinct neuronal populations in most brain regions with the exception of granule cells in the olfactory bulb, purkinje cells in the cerebellar, and some layer I cells in neocortex. In conclusion, GFP expression in the CaMKIIα-GFP mice is similar to the endogenous expression of CaMKIIα protein, thus these mice can be used in in vivo and in vitro physiological studies in which visualization of CaMKIIα- neuronal populations is required. PMID:23632380

  1. Cyclic AMP directs inositol (1,4,5)-trisphosphate-evoked Ca2+ signalling to different intracellular Ca2+ stores

    OpenAIRE

    Tovey, Stephen C.; Taylor, Colin W.

    2013-01-01

    Cholesterol depletion reversibly abolishes carbachol-evoked Ca2+ release from inositol (1,4,5)-trisphosphate (IP3)-sensitive stores, without affecting the distribution of IP3 receptors (IP3R) or endoplasmic reticulum, IP3 formation or responses to photolysis of caged IP3. Receptors that stimulate cAMP formation do not alone evoke Ca2+ signals, but they potentiate those evoked by carbachol. We show that these potentiated signals are entirely unaffected by cholesterol depletion and that, within...

  2. Ca2+-independent and Ca2+/GTP-binding protein-controlled exocytosis in a plant cell.

    Science.gov (United States)

    Homann, U; Tester, M

    1997-06-10

    Exocytosis allows the release of secretory products and the delivery of new membrane material to the plasma membrane. So far, little is known about the underlying molecular mechanism and its control in plant cells. We have used the whole-cell patch-clamp technique to monitor changes in membrane capacitance to study exocytosis in barley aleurone protoplasts. To investigate the involvement of Ca2+ and GTP-binding proteins in exocytosis, protoplasts were dialyzed with very low (Ca2+ and nonhydrolyzable guanine nucleotides guanosine 5'-gamma-thio]triphosphate (GTP[gammaS]) or guanosine 5'-[beta-thio]diphosphate (GDP[betaS]). With less than 2 nM cytoplasmic free Ca2+, the membrane capacitance increased significantly over 20 min. This increase was not altered by GTP[gammaS] or GDP[betaS]. In contrast, dialyzing protoplasts with 1 microM free Ca2+ resulted in a large increase in membrane capacitance that was slightly reduced by GTP[gammaS] and strongly inhibited by GDP[betaS]. We conclude that two exocytotic pathways exist in barley aleurone protoplasts: one that is Ca2+-independent and whose regulation is currently not known and another that is stimulated by Ca2+ and modulated by GTP-binding proteins. We suggest that Ca2+-independent exocytosis may be involved in cell expansion in developing protoplasts. Ca2+-stimulated exocytosis may play a role in gibberellic acid-stimulated alpha-amylase secretion in barley aleurone and, more generally, may be involved in membrane resealing in response to cell damage.

  3. Stellar rotation periods determined from simultaneously measured Ca II H&K and Ca II IRT lines

    Science.gov (United States)

    Mittag, M.; Hempelmann, A.; Schmitt, J. H. M. M.; Fuhrmeister, B.; González-Pérez, J. N.; Schröder, K.-P.

    2017-11-01

    Aims: Previous studies have shown that, for late-type stars, activity indicators derived from the Ca II infrared-triplet (IRT) lines are correlated with the indicators derived from the Ca II H&K lines. Therefore, the Ca II IRT lines are in principle usable for activity studies, but they may be less sensitive when measuring the rotation period. Our goal is to determine whether the Ca II IRT lines are sufficiently sensitive to measure rotation periods and how any Ca II IRT derived rotation periods compare with periods derived from the "classical" Mount Wilson S-index. Methods: To analyse the Ca II IRT lines' sensitivity and to measure rotation periods, we define an activity index for each of the Ca II IRT lines similar to the Mount Wilson S-index and perform a period analysis for the lines separately and jointly. Results: For eleven late-type stars we can measure the rotation periods using the Ca II IRT indices similar to those found in the Mount Wilson S-index time series and find that a period derived from all four indices gives the most probable rotation period; we find good agreement for stars with already existing literature values. In a few cases the computed periodograms show a complicated structure with multiple peaks, meaning that formally different periods are derived in different indices. We show that in one case, this is due to data sampling effects and argue that denser cadence sampling is necessary to provide credible evidence for differential rotation. However, our TIGRE data for HD 101501 shows good evidence for the presence of differential rotation.

  4. Ca2+signaling and emesis: Recent progress and new perspectives.

    Science.gov (United States)

    Zhong, Weixia; Picca, Andrew J; Lee, Albert S; Darmani, Nissar A

    2017-01-01

    Cisplatin-like chemotherapeutics cause vomiting via calcium (Ca 2+ )-dependent release of multiple neurotransmitters (dopamine, serotonin, substance P, etc.) from the gastrointestinal enterochromaffin cells and/or the brainstem. Intracellular Ca 2+ signaling is triggered by activation of diverse emetic receptors (including tachykininergic NK 1 , serotonergic 5-HT 3 , dopaminergic D 2 , cholinergic M 1 , or histaminergic H 1 ) , whose activation in vomit-competent species can evoke emesis. Other emetogens such as cisplatin, rotavirus NSP4 protein and bacterial toxins can also induce intracellular Ca 2+ elevation. Netupitant is a highly selective neurokinin NK 1 receptor (NK 1 R) antagonist and palonosetron is a selective second-generation serotonin 5-HT 3 receptor (5-HT 3 R) antagonist with a distinct pharmacological profile. An oral fixed combination of netupitant/palonosetron (NEPA; Akynzeo(®)) with >85% antiemetic efficacy is available for use in the prevention of acute and delayed chemotherapy-induced nausea and vomiting (CINV). Cannabinoid CB 1 receptor agonists possess broad-spectrum antiemetic activity since they prevent vomiting caused by a variety of emetic stimuli including the chemotherapeutic agent cisplatin, 5-HT 3 R agonists, and D 2 R agonists. Our findings demonstrate that application of the L-type Ca 2+ channel (LTCC) agonist FPL 64176 and the intracellular Ca 2+ mobilizing agent thapsigargin (a sarco/endoplasmic reticulum Ca 2+ -ATPase inhibitor) cause vomiting in the least shrew. On the other hand, blockade of LTCCs by corresponding antagonists (nifedipine or amlodipine) not only provide broad-spectrum antiemetic efficacy against diverse agents that specifically activate emetogenic receptors such as 5-HT 3 , NK 1 , D 2 , and M 1 receptors, but can also potentiate the antiemetic efficacy of palonosetron against the non-specific emetogen, cisplatin. In this review, we will provide an overview of Ca 2+ involvement in the emetic process; discuss the

  5. Estrogen deficiency-induced Ca balance impairment is associated with decrease in expression of epithelial Ca transport proteins in aged female rats.

    Science.gov (United States)

    Dong, Xiao-Li; Zhang, Yan; Wong, Man-Sau

    2014-02-06

    The study is designed to determine whether estrogen and vitamin D endocrine systems interact to regulate calcium (Ca) balance as well as changes in mRNA expression of epithelial Ca transport proteins involved in intestinal and renal Ca transport in aging animals in response to ovariectomy and low dietary Ca intake. Eleven-month-old female sham or ovariectomized (OVX) rats were divided into four groups and fed with either a low-Ca (LCD; 0.1% Ca, 0.65% P) or a high-Ca (HCD; 1.2% Ca, 0.65% P) diet for 12weeks. Ca balance and mRNA expression of Ca transport proteins in the intestine and kidney from rats were systematically studied. OVX rats fed with LCD resulted in a negative Ca balance. LCD suppressed serum Ca in OVX but not sham rats, resulting in an induction of serum PTH and 1,25(OH)2D3 levels. The surge in serum 1,25(OH)2D3 levels in LCD-fed OVX rats was associated with an increase in mRNA expression of intestinal transient receptor potential cation channel (TRPV6) and calbindin D9k (CaBP9k) as well as renal vitamin D receptor (VDR), but such an induction was unable to restore Ca balance in vivo. In contrast, the negative Ca balance was associated with suppression of intestinal plasma membrane Ca pump (PMCA1b) and renal transient receptor potential cation channel (TRPV5), calbindin D28k (CaBP28k) and PMCA1b mRNA expression in aged OVX rats. Negative Ca balance in aged female OVX rats is associated with estrogen-dependent and vitamin D-independent downregulation of epithelial Ca transport protein mRNA expression. Copyright © 2013. Published by Elsevier Inc.

  6. Astragalus Granule Prevents Ca2+ Current Remodeling in Heart Failure by the Downregulation of CaMKII

    Directory of Open Access Journals (Sweden)

    Sinai Li

    2017-01-01

    Full Text Available Background. Astragalus was broadly used for treating heart failure (HF and arrhythmias in East Asia for thousands of years. Astragalus granule (AG, extracted from Astragalus, shows beneficial effect on the treatment of HF in clinical research. We hypothesized that administration of AG prevents the remodeling of L-type Ca2+ current (ICa-L in HF mice by the downregulation of Ca2+/calmodulin-dependent protein kinase II (CaMKII. Methods. HF mice were induced by thoracic aortic constriction (TAC. After 4 weeks of AG treatment, cardiac function and QT interval were evaluated. Single cardiac ventricular myocyte was then isolated and whole-cell patch clamp was used to record action potential (AP and ICa-L. The expressions of L-type calcium channel alpha 1C subunit (Cav1.2, CaMKII, and phosphorylated protein kinase A (p-PKA were examined by western blot. Results. The failing heart manifested distinct electrical remodeling including prolonged repolarization time and altered ICa-L kinetics. AG treatment attenuated this electrical remodeling, supported by AG-related shortened repolarization time, decreased peak ICa-L, accelerated ICa-L inactivation, and positive frequency-dependent ICa-L facilitation. In addition, AG treatment suppressed the overexpression of CaMKII, but not p-PKA, in the failing heart. Conclusion. AG treatment protected the failing heart against electrical remodeling and ICa-L remodeling by downregulating CaMKII.

  7. Upconversion luminescence of lanthanide-doped mixed CaMoO4-CaWO4 micro-/nano-materials.

    Science.gov (United States)

    Liu, Jing; Kaczmarek, Anna M; Billet, Jonas; Van Driessche, Isabel; Van Deun, Rik

    2016-08-14

    Uniform mixed CaMoO4-CaWO4 micro-/nano-materials have been successfully synthesised by a facile hydrothermal method. The morphology of these upconversion materials could be changed to different shapes and the size could also be decreased from the micro- to nano-scale by varying the type of surfactant used. It was observed that before heat treatment, the materials show relatively weak green light emission under excitation at 975 nm, whereas after heat treatment, the intensity of the upconversion luminescence increases dramatically while the intensity of the red component decreases relatively. By adjusting the molybdate/tungstate ratio, it was found that the samples with a higher molybdate content have stronger luminescence properties. XRD measurements have been done to investigate the structure of the mixed CaMoO4-CaWO4 upconversion materials. The effect of heat treatment at different temperatures on the emission spectra and XRD patterns has also been studied. TG-DTA was used to further confirm the most suitable temperature for heat treatment. The luminescence lifetimes and CIE coordinates for these samples were also determined. Additionally it was found that Gd(3+) co-doping could further increase the upconversion luminescence from these mixed CaMoO4-CaWO4 materials. Finally, monitoring the upconversion luminescence intensity as a function of laser pump power confirmed the upconversion process to be a two-photon absorption mechanism.

  8. Tumor marker CA-125 in adnexal inflammatory tumors

    Directory of Open Access Journals (Sweden)

    Nikolić Branka

    2006-01-01

    Full Text Available Background/Aim. The glycoprotein of a high molecular weight CA-125, which is not a specific tumor marker of ovarian cancer, is secreted by the endothelial cells of most pelvic organs. Endometriosis, inflammatory processes in the pelvic cavity, as well as some nongynecoligical malignant diseases, could be followed by the increased values of CA-125. Serial assessment of the values of CA- 125 makes it possible to avoid surgical treatment, and, by means of the used conservative treatment, to avoid malignant diseases not to be noticed. Methods. The study included 57 female patients hospitalized due to inflammable adnexal tumors. Besides following the values of serum CA-125 during and after the therapy, also performed were the transvaginal Doppler ultrasonography and the determination of the values of resistance index (RI. Results. In 27 patients (55.1% the CA-125 values ranged from 38.8 U/ml to 794 U/ml, while in 30 of the patients they were within the range of normal. In this group of the patients, besides the increased values of CA- 125, also increased were the values of leucocytes (119/l − 209/l, as well as the sedimentation rates (65−120 within the first hour. In all the 57 patients, transvaginal Doppler ultrasonography revealed the presence of adnexal tumor of inflammatory kind. The measured values of RI were within the range of 0.539−0.681. Eight of the patients were treated by the conservative - triple antibiotic therapy, while in 49 patients explorative laparotomy was performed. Hystorectomy was done in 12 of the patients, and one-side adnexectomy in 37 of them. Conclusion. The method for the assessment of CA-125 is simple and available which facilitates the monitoring of surgical, conservative or the combined therapy that is particularly significant in younger patients with inflammable adnexal tumor developed on the basis of endometrosis.

  9. Analysis of PIK3CA mutations in breast cancer subtypes.

    Science.gov (United States)

    Arsenic, Ruza; Lehmann, Annika; Budczies, Jan; Koch, Ines; Prinzler, Judith; Kleine-Tebbe, Anke; Schewe, Christiane; Loibl, Sibylle; Dietel, Manfred; Denkert, Carsten

    2014-01-01

    Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit α (PIK3CA) is a central element of a signaling pathway involved in cell proliferation, survival, and growth. Certain mutations in this pathway result in enhanced PI3K signaling, which is associated with oncogenic cellular transformation and cancer. The aims of this study were to characterize different types of PIK3CA mutations in exons 9 and 20 in a series of primary breast carcinomas and to correlate the results with clinicopathologic parameters and survival. We used frozen tissue samples and sequenced exons 9 and 20 for a series of 241 patients with a diagnosis of breast carcinoma. We found that 15.8% of the primary breast carcinomas possessed PIK3CA mutations in either exon 9 or exon 20. The rate of PIK3CA mutations was increased in HR(+)/HER2(-) tumors (18.6%), but this difference did not reach a statistical significance. The lowest rate of mutations was observed in HR(+)/HER2(+) tumors (5.3%). No statistically significant association was found between the presence of PIK3CA mutations and the prognostic/clinical features of breast cancer, including histologic subtype, Her2 status, axillary lymph node involvement, tumor grade, and tumor stage. However, the presence of the H1047R mutation in 10 samples was associated with a statistically significantly worse overall survival. PIK3CA mutation was found to be a frequent genetic change in all breast cancer subtypes but occurred with the highest rate in HR(+)/HER2(-) tumors. Further studies are needed to validate the prognostic impact of different PIK3CA mutations.

  10. Ca(2+) and CaM are involved in Al(3+) pretreatment-promoted fluoride accumulation in tea plants (Camellia sinesis L.).

    Science.gov (United States)

    Zhang, Xian-Chen; Gao, Hong-Jian; Wu, Hong-Hong; Yang, Tian-Yuan; Zhang, Zheng-Zhu; Mao, Jing-Dong; Wan, Xiao-Chun

    2015-11-01

    Tea plant (Camellia sinensis (L.) O. kuntze) is known to be a fluoride (F) and aluminum (Al(3+)) hyper-accumulator. Previous study showed that pre-treatment of Al(3+) caused a significant increase of F accumulation in tea plants. However, less is known about the intricate network of Al(3+) promoted F accumulation in tea plants. In this study, the involvement of endogenous Ca(2+) and CaM in Al(3+) pretreatment-promoted F accumulation in tea plants was investigated. Our results showed that Al(3+) induced the inverse change of intracellular Ca(2+) fluorescence intensity and stimulated Ca(2+) trans-membrane transport in the mature zone of tea root. Also, a link between internal Ca(2+) and CaM was found in tea roots under the presence of Al(3+). In order to investigate whether Ca(2+) and CaM were related to F accumulation promoted by Al(3+) pretreatment, Ca(2+) chelator EGTA and CaM antagonists CPZ and TFP were used. EGTA, CPZ, and TFP pretreatment inhibited Al(3+)-induced increase of Ca(2+) fluorescence intensity and CaM content in tea roots, and also significantly reduced Al(3+)-promoted F accumulation in tea plants. Taken together, our results suggested that the endogenous Ca(2+) and CaM are involved in Al(3+) pretreatment-promoted F accumulation in tea roots. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  11. A model of cardiac ryanodine receptor gating predicts experimental Ca2+-dynamics and Ca2+-triggered arrhythmia in the long QT syndrome

    Science.gov (United States)

    Wilson, Dan; Ermentrout, Bard; Němec, Jan; Salama, Guy

    2017-09-01

    Abnormal Ca2+ handling is well-established as the trigger of cardiac arrhythmia in catecholaminergic polymorphic ventricular tachycardia and digoxin toxicity, but its role remains controversial in Torsade de Pointes (TdP), the arrhythmia associated with the long QT syndrome (LQTS). Recent experimental results show that early afterdepolarizations (EADs) that initiate TdP are caused by spontaneous (non-voltage-triggered) Ca2+ release from Ca2+-overloaded sarcoplasmic reticulum (SR) rather than the activation of the L-type Ca2+-channel window current. In bradycardia and long QT type 2 (LQT2), a second, non-voltage triggered cytosolic Ca2+ elevation increases gradually in amplitude, occurs before overt voltage instability, and then precedes the rise of EADs. Here, we used a modified Shannon-Puglisi-Bers model of rabbit ventricular myocytes to reproduce experimental Ca2+ dynamics in bradycardia and LQT2. Abnormal systolic Ca2+-oscillations and EADs caused by SR Ca2+-release are reproduced in a modified 0-dimensional model, where 3 gates in series control the ryanodine receptor (RyR2) conductance. Two gates control RyR2 activation and inactivation and sense cytosolic Ca2+ while a third gate senses luminal junctional SR Ca2+. The model predicts EADs in bradycardia and low extracellular [K+] and cessation of SR Ca2+-release terminate salvos of EADs. Ca2+-waves, systolic cell-synchronous Ca2+-release, and multifocal diastolic Ca2+ release seen in subcellular Ca2+-mapping experiments are observed in the 2-dimensional version of the model. These results support the role of SR Ca2+-overload, abnormal SR Ca2+-release, and the subsequent activation of the electrogenic Na+/Ca2+-exchanger as the mechanism of TdP. The model offers new insights into the genesis of cardiac arrhythmia and new therapeutic strategies.

  12. Clinical Significance and Prognostic Value of CA72-4 Compared with CEA and CA19-9 in Patients with Gastric Cancer

    Directory of Open Access Journals (Sweden)

    M. Ychou

    2000-01-01

    Full Text Available Carcinoembryonic antigen (CEA and CA 19-9 are both widely used in the follow up of patients with gastrointestinal cancer. More recently another tumor marker, named CA 72-4 has been identified and characterized using two different monoclonal antibodies B72.3 and CC49. Several reports evaluated CA 72-4 as a serum tumor marker for gastric cancer and compared its clinical utility with that of CEA or CA 19-9; few reports concerned its prognostic value. In the present study, CA 72-4 is evaluated and compared with CEA and CA 19-9 in various populations of patients with gastric cancer and benign disease; for 52 patients with gastric adenocarcinoma and 57 patients without neoplastic disease CEA, CA 19-9 and CA 72-4 were evaluated before treatment. Sensitivity of the tumor markers CA 72-4, CA 19-9 and CEA at the recommended cut-off level in all 52 patients were 58%, 50% the sensitivity increased to 75%. of these markers, for non metastatic patients, multivariate analyses indicated that none of the markers were significant, when adjusted for gender and age (which were indicators of poor prognosis; patients with abnormal values of CA72-4 tended to have shorter survival than patients with normal values (p < 0.07. In the metastatic population, only high values of CA19-9 (p < 0.02 and gender (women (p < 0.03 were indicators of poor prognosis in univariate analysis; multivariate analysis revealed that both CA72-4 (p = 0.034 and CA19-9 p = 0.009, adjusted for gender were independent prognostic factors. However, CA72-4 lost significance (p = 0.41 when adjusted for CA19-9 and gender, indicating that CA19-9 provides more prognostic information than CA72-4.

  13. Pepper protein phosphatase type 2C, CaADIP1 and its interacting partner CaRLP1 antagonistically regulate ABA signalling and drought response.

    Science.gov (United States)

    Lim, Chae Woo; Lee, Sung Chul

    2016-07-01

    Abscisic acid (ABA) is a key phytohormone that regulates plant growth and developmental processes, including seed germination and stomatal closing. Here, we report the identification and functional characterization of a novel type 2C protein phosphatase, CaADIP1 (Capsicum annuum ABA and Drought-Induced Protein phosphatase 1). The expression of CaADIP1 was induced in pepper leaves by ABA, drought and NaCl treatments. Arabidopsis plants overexpressing CaADIP1 (CaADIP1-OX) exhibited an ABA-hyposensitive and drought-susceptible phenotype. We used a yeast two-hybrid screening assay to identify CaRLP1 (Capsicum annuum RCAR-Like Protein 1), which interacts with CaADIP1 in the cytoplasm and nucleus. In contrast to CaADIP1-OX plants, CaRLP1-OX plants displayed an ABA-hypersensitive and drought-tolerant phenotype, which was characterized by low levels of transpirational water loss and increased expression of stress-responsive genes relative to those of wild-type plants. In CaADIP1-OX/CaRLP1-OX double transgenic plants, ectopic expression of the CaRLP1 gene led to strong suppression of CaADIP1-induced ABA hyposensitivity during the germinative and post-germinative stages, indicating that CaADIP1 and CaRLP1 act in the same signalling pathway and CaADIP1 functions downstream of CaRLP1. Our results indicate that CaADIP1 and its interacting partner CaRLP1 antagonistically regulate the ABA-dependent defense signalling response to drought stress. © 2016 John Wiley & Sons Ltd.

  14. Identifying vital effects in Halimeda algae with Ca isotopes

    Directory of Open Access Journals (Sweden)

    C. L. Blättler

    2014-12-01

    Full Text Available Geochemical records of biogenic carbonates provide some of the most valuable records of the geological past, but are often difficult to interpret without a mechanistic understanding of growth processes. In this experimental study, Halimeda algae are used as a test organism to untangle some of the specific factors that influence their skeletal composition, in particular their Ca-isotope composition. Algae were stimulated to precipitate both calcite and aragonite by growth in artificial Cretaceous seawater, resulting in experimental samples with somewhat malformed skeletons. The Ca-isotope fractionation of the algal calcite (−0.6‰ appears to be much smaller than that for the algal aragonite (−1.4‰, similar to the behaviour observed in inorganic precipitates. However, the carbonate from Halimeda has higher Ca-isotope ratios than inorganic forms by approximately 0.25‰, likely because of Rayleigh distillation within the algal intercellular space. In identifying specific vital effects and the magnitude of their influence on Ca-isotope ratios, this study suggests that mineralogy has a first-order control on the marine Ca-isotope cycle.

  15. Identification of Cl(Ca) channel distributions in olfactory cilia.

    Science.gov (United States)

    Badamdorj, Dorjsuren; Edwards, David A; French, Donald A; Kleene, Steven J

    2008-01-01

    Identification of detailed features of neuronal systems is an important challenge in the biosciences today. Transduction of an odor into an electrical signal occurs in the membranes of the cilia. The Cl(Ca) channels that reside in the ciliary membrane are activated by calcium, allow a depolarizing efflux of Cl(-) and are thought to amplify the electrical signal to the brain.In this paper, a mathematical model consisting of partial differential equations is developed to study two different experiments; one involving the interaction of the cyclic-nucleotide-gated (CNG) and Cl(Ca) channels and the other, the diffusion of Ca(2+) into cilia. This work builds on an earlier study (Mathematical modeling of the Cl(Ca) ion channels in frog olfactory cilia. Ph.D. Thesis, University of Cincinnati, Cincinnati, OH, 2006; Math. Comput. Modelling 2006; 43:945-956; Biophys. J. 2006; 91:179-188), which suggested that the CNG channels are clustered at about 0.28 of the length of a cilium from its open end. Closed-form solutions are derived after certain reductions in the model are made. These special solutions provide estimates of the channel distributions. Scientific computation is also used. This preliminary study suggests that the Cl(Ca) ion channels are also clustered at about one-third of the length of a cilium from its open end.

  16. Kainic acid (KA)-induced Ca2+/calmodulin-dependent protein kinase II (CaMK II) expression in the neurons, astrocytes and microglia of the mouse hippocampal CA3 region, and the phosphorylated CaMK II only in the hippocampal neurons.

    Science.gov (United States)

    Suh, Hong-Won; Lee, Han-Kyu; Seo, Young-Jun; Kwon, Min-Soo; Shim, Eon-Jeong; Lee, Jin-Young; Choi, Seong-Soo; Lee, Jong-Ho

    2005-06-24

    In the present study, we investigated the role of Ca2+/calmodulin-dependent protein kinase II (CaMK II) and which types of neuronal cells contain CaMK II and phosphorylated CaMK II (p-CaMK II) in the CA3 hippocampal region of mice using confocal immunofluorescence study. KA increased the CaMK II, p-CaMK II, glial fibrillary acidic protein (GFAP) and complement receptor type 3 (OX-42) immunoreactivities (IR) at 30 min after KA treatment in mouse hippocampal area. In studies, nevertheless KA-induced CaMK II is expressed in neurons or astrocytes or microglia, p-CaMK II is expressed only in neurons. Thus, our results suggest that the activated CaMK II in early time may be performed important roles only in neurons but not in the astrocytes and microglia.

  17. Distinct contributions of Orai1 and TRPC1 to agonist-induced [Ca(2+](i signals determine specificity of Ca(2+-dependent gene expression.

    Directory of Open Access Journals (Sweden)

    Hwei Ling Ong

    Full Text Available Regulation of critical cellular functions, including Ca(2+-dependent gene expression, is determined by the temporal and spatial aspects of agonist-induced Ca(2+ signals. Stimulation of cells with physiological concentrations of agonists trigger increases [Ca(2+](i due to intracellular Ca(2+ release and Ca(2+ influx. While Orai1-STIM1 channels account for agonist-stimulated [Ca(2+](i increase as well as activation of NFAT in cells such as lymphocytes, RBL and mast cells, both Orai1-STIM1 and TRPC1-STIM1 channels contribute to [Ca(2+](i increases in human submandibular gland (HSG cells. However, only Orai1-mediated Ca(2+ entry regulates the activation of NFAT in HSG cells. Since both TRPC1 and Orai1 are activated following internal Ca(2+ store depletion in these cells, it is not clear how the cells decode individual Ca(2+ signals generated by the two channels for the regulation of specific cellular functions. Here we have examined the contributions of Orai1 and TRPC1 to carbachol (CCh-induced [Ca(2+](i signals and activation of NFAT in single cells. We report that Orai1-mediated Ca(2+ entry generates [Ca(2+](i oscillations at different [CCh], ranging from very low to high. In contrast, TRPC1-mediated Ca(2+ entry generates sustained [Ca(2+](i elevation at high [CCh] and contributes to frequency of [Ca(2+](i oscillations at lower [agonist]. More importantly, the two channels are coupled to activation of distinct Ca(2+ dependent gene expression pathways, consistent with the different patterns of [Ca(2+](i signals mediated by them. Nuclear translocation of NFAT and NFAT-dependent gene expression display "all-or-none" activation that is exclusively driven by local [Ca(2+](i generated by Orai1, independent of global [Ca(2+](i changes or TRPC1-mediated Ca(2+ entry. In contrast, Ca(2+ entry via TRPC1 primarily regulates NFκB-mediated gene expression. Together, these findings reveal that Orai1 and TRPC1 mediate distinct local and global Ca(2+ signals

  18. The leucine-rich repeat (LRR) protein, CaLRR1, interacts with the hypersensitive induced reaction (HIR) protein, CaHIR1, and suppresses cell death induced by the CaHIR1 protein.

    Science.gov (United States)

    Jung, Ho Won; Hwang, Byung Kook

    2007-07-01

    Leucine-rich repeat proteins (LRRs) function in a number of signal transduction pathways via protein-protein interactions. The gene encoding a small protein of pepper, CaLRR1, is specifically induced upon pathogen challenge and treatment with pathogen-associated molecular patterns (PAMPs). We identified a pepper hypersensitive induced reaction (CaHIR1) protein that interacts with the LRR domain of the CaLRR1 protein using yeast two-hybrid screening. Ectopic expression of the pepper CaHIR1 gene induces cell death in tobacco and Arabidopsis, indicating that the CaHIR1 protein may be a positive regulator of HR-like cell death. Because transformation is very difficult in pepper plants, we over-expressed CaLRR1 and CaHIR1 in Arabidopsis to determine cellular functions of the two genes. The over-expression of the CaHIR1 gene, but not the CaLRR1 gene, in transgenic Arabidopsis confers disease resistance in response to Pseudomonas syringae infection, accompanied by the strong expression of PR genes, the accumulation of both salicylic acid and H(2)O(2), and K(+) efflux in plant cells. In Arabidopsis and tobacco plants over-expressing both CaHIR1 and CaLRR1, the CaLRR1 protein suppresses not only CaHIR1-induced cell death, but also PR gene expression elicited by CaHIR1 via its association with HIR protein. We propose that the CaLRR1 protein functions as a novel negative regulator of CaHIR1-mediated cell death responses in plants.

  19. Store-operated Ca2+ entry regulates Ca2+-activated chloride channels and eccrine sweat gland function.

    Science.gov (United States)

    Concepcion, Axel R; Vaeth, Martin; Wagner, Larry E; Eckstein, Miriam; Hecht, Lee; Yang, Jun; Crottes, David; Seidl, Maximilian; Shin, Hyosup P; Weidinger, Carl; Cameron, Scott; Turvey, Stuart E; Issekutz, Thomas; Meyts, Isabelle; Lacruz, Rodrigo S; Cuk, Mario; Yule, David I; Feske, Stefan

    2016-11-01

    Eccrine sweat glands are essential for sweating and thermoregulation in humans. Loss-of-function mutations in the Ca2+ release-activated Ca2+ (CRAC) channel genes ORAI1 and STIM1 abolish store-operated Ca2+ entry (SOCE), and patients with these CRAC channel mutations suffer from anhidrosis and hyperthermia at high ambient temperatures. Here we have shown that CRAC channel-deficient patients and mice with ectodermal tissue-specific deletion of Orai1 (Orai1K14Cre) or Stim1 and Stim2 (Stim1/2K14Cre) failed to sweat despite normal sweat gland development. SOCE was absent in agonist-stimulated sweat glands from Orai1K14Cre and Stim1/2K14Cre mice and human sweat gland cells lacking ORAI1 or STIM1 expression. In Orai1K14Cre mice, abolishment of SOCE was associated with impaired chloride secretion by primary murine sweat glands. In human sweat gland cells, SOCE mediated by ORAI1 was necessary for agonist-induced chloride secretion and activation of the Ca2+-activated chloride channel (CaCC) anoctamin 1 (ANO1, also known as TMEM16A). By contrast, expression of TMEM16A, the water channel aquaporin 5 (AQP5), and other regulators of sweat gland function was normal in the absence of SOCE. Our findings demonstrate that Ca2+ influx via store-operated CRAC channels is essential for CaCC activation, chloride secretion, and sweat production in humans and mice.

  20. The Correlation between Serum and Peritoneal Fluid CA125 The Correlation between Serum and Peritoneal Fluid CA125

    Directory of Open Access Journals (Sweden)

    Saghar Salehpour

    2009-01-01

    Full Text Available Background: Despite a high prevalence of endometriosis, there still exist many challenges indiagnosing the disease. This study aims to evaluate non-invasive and practical diagnostic methodsby measuring serum and peritoneal fluid CA 125 levels in patients with endometriosis. A secondaryaim is to determine the correlation between these markers with the stage of disease as well as therelationship of the two markers with each other.Materials and Methods: This is a cross-sectional study of 60 women who underwent laparoscopyfor benign conditions. Based on laparoscopic findings and biopsy results, patients were divided to twogroups; one group included patients with pelvic endometriosis (35 patients and the second enrolledpatients free from endometriosis (25 patients. Serum and peritoneal fluid specimens were provided at thetime of laparoscopy and CA125 levels were then assessed by electrochemiluminescence immunoassay.Results: Mean serum and peritoneal fluid CA125 levels were significantly higher in women withendometriosis as compared to the control group (26.42 ± 24.34 IU/ml versus 12.64 ± 6.87 IU/mlin serum and 2203.54 + 993.19 IU/ml versus 1583.42 ± 912.51 IU/ml in peritoneal fluid, p<0.05.CA 125 levels also varied proportionally with the stage of endometriosis; but showed a significantdifference only in higher stages of the disease, both in serum and peritoneal fluid. We calculatedthe cut-off value suggesting a diagnosis of pelvic endometriosis as 14.70 IU/ml for serum and1286.5 IU/ml for peritoneal fluid CA125. A linear correlation between CA 125 levels in serum andperitoneal fluid in patients with pelvic endometriosis has also been observed.Conclusion: Serum and peritoneal fluid CA 125 levels are simple and non-surgical tools fordiagnosing and staging pelvic endometriosis. These markers are of greater diagnostic value inhigher stages of the disease.

  1. Effect of [10]-Gingerol on [Ca2+]i and Cell Death in Human Colorectal Cancer Cells

    Directory of Open Access Journals (Sweden)

    Chung-Yi Chen

    2009-03-01

    Full Text Available The effect of [10]-gingerol on cytosol free Ca2+ concentration ([Ca2+]i and viability is large unknown. This study examines the early signaling effects of [10]-gingerol on human colorectal cancer cells. It was found that this compound caused a slow and sustained rise of [Ca2+]i in a concentration-dependent manner. [10]-Gingerol also induced a [Ca2+]i rise when extracellular Ca2+ was removed, but the magnitude was reduced by 38%. In a Ca2+-free medium, the [10]-gingerol-induced [Ca2+]i rise was partially abolished by depleting stored Ca2+ with thapsigargin (an endoplasmic reticulum Ca2+ pump inhibitor. The elevation of [10]-gingerol-caused [Ca2+]i in a Ca2+-containing medium was not affected by modulation of protein kinase C activity. The [10]-gingerol-induced Ca2+ influx was insensitive to L-type Ca2+ channel blockers. At concentrations of 10-100 mM, [10]-gingerol killed cells in a concentration-dependent manner. These findings suggest that [10]-gingerol induces [Ca2+]i rise by causing Ca2+ release from the endoplasmic reticulum and Ca2+ influx from non-L-type Ca2+ channels in SW480 cancer cells.

  2. The permeability transition pore as a Ca(2+) release channel: new answers to an old question.

    Science.gov (United States)

    Bernardi, Paolo; von Stockum, Sophia

    2012-07-01

    Mitochondria possess a sophisticated array of Ca(2+) transport systems reflecting their key role in physiological Ca(2+) homeostasis. With the exception of most yeast strains, energized organelles are endowed with a very fast and efficient mechanism for Ca(2+) uptake, the ruthenium red (RR)-sensitive mitochondrial Ca(2+) uniporter (MCU); and one main mechanism for Ca(2+) release, the RR-insensitive 3Na(+)-Ca(2+) antiporter. An additional mechanism for Ca(2+) release is provided by a Na(+) and RR-insensitive release mechanism, the putative 3H(+)-Ca(2+) antiporter. A potential kinetic imbalance is present, however, because the V(max) of the MCU is of the order of 1400nmol Ca(2+)mg(-1) proteinmin(-1) while the combined V(max) of the efflux pathways is about 20nmol Ca(2+)mg(-1) proteinmin(-1). This arrangement exposes mitochondria to the hazards of Ca(2+) overload when the rate of Ca(2+) uptake exceeds that of the combined efflux pathways, e.g. for sharp increases of cytosolic [Ca(2+)]. In this short review we discuss the hypothesis that transient opening of the Ca(2+)-dependent permeability transition pore may provide mitocondria with a fast Ca(2+) release channel preventing Ca(2+) overload. We also address the relevance of a mitochondrial Ca(2+) release channel recently discovered in Drosophila melanogaster, which possesses intermediate features between the permeability transition pore of yeast and mammals. Copyright © 2012 Elsevier Ltd. All rights reserved.

  3. The permeability transition pore as a Ca2+ release channel: New answers to an old question

    Science.gov (United States)

    Bernardi, Paolo; von Stockum, Sophia

    2012-01-01

    Mitochondria possess a sophisticated array of Ca2+ transport systems reflecting their key role in physiological Ca2+ homeostasis. With the exception of most yeast strains, energized organelles are endowed with a very fast and efficient mechanism for Ca2+ uptake, the ruthenium red (RR)-sensitive mitochondrial Ca2+ uniporter (MCU); and one main mechanism for Ca2+ release, the RR-insensitive 3Na+–Ca2+ antiporter. An additional mechanism for Ca2+ release is provided by a Na+ and RR-insensitive release mechanism, the putative 3H+–Ca2+ antiporter. A potential kinetic imbalance is present, however, because the Vmax of the MCU is of the order of 1400 nmol Ca2+ mg−1 protein min−1 while the combined Vmax of the efflux pathways is about 20 nmol Ca2+ mg−1 protein min−1. This arrangement exposes mitochondria to the hazards of Ca2+ overload when the rate of Ca2+ uptake exceeds that of the combined efflux pathways, e.g. for sharp increases of cytosolic [Ca2+]. In this short review we discuss the hypothesis that transient opening of the Ca2+-dependent permeability transition pore may provide mitocondria with a fast Ca2+ release channel preventing Ca2+ overload. We also address the relevance of a mitochondrial Ca2+ release channel recently discovered in Drosophila melanogaster, which possesses intermediate features between the permeability transition pore of yeast and mammals. PMID:22513364

  4. Crosstalk between mitochondrial and sarcoplasmic reticulum Ca2+ cycling modulates cardiac pacemaker cell automaticity.

    Directory of Open Access Journals (Sweden)

    Yael Yaniv

    Full Text Available Mitochondria dynamically buffer cytosolic Ca(2+ in cardiac ventricular cells and this affects the Ca(2+ load of the sarcoplasmic reticulum (SR. In sinoatrial-node cells (SANC the SR generates periodic local, subsarcolemmal Ca(2+ releases (LCRs that depend upon the SR load and are involved in SANC automaticity: LCRs activate an inward Na(+-Ca(2+ exchange current to accelerate the diastolic depolarization, prompting the ensemble of surface membrane ion channels to generate the next action potential (AP.To determine if mitochondrial Ca(2+ (Ca(2+ (m, cytosolic Ca(2+ (Ca(2+ (c-SR-Ca(2+ crosstalk occurs in single rabbit SANC, and how this may relate to SANC normal automaticity.Inhibition of mitochondrial Ca(2+ influx into (Ru360 or Ca(2+ efflux from (CGP-37157 decreased [Ca(2+](m to 80 ± 8% control or increased [Ca(2+](m to 119 ± 7% control, respectively. Concurrent with inhibition of mitochondrial Ca(2+ influx or efflux, the SR Ca(2+ load, and LCR size, duration, amplitude and period (imaged via confocal linescan significantly increased or decreased, respectively. Changes in total ensemble LCR Ca(2+ signal were highly correlated with the change in the SR Ca(2+ load (r(2 = 0.97. Changes in the spontaneous AP cycle length (Ru360, 111 ± 1% control; CGP-37157, 89 ± 2% control in response to changes in [Ca(2+](m were predicted by concurrent changes in LCR period (r(2 = 0.84.A change in SANC Ca(2+ (m flux translates into a change in the AP firing rate by effecting changes in Ca(2+ (c and SR Ca(2+ loading, which affects the characteristics of spontaneous SR Ca(2+ release.

  5. Ca(AlH4)2, CaAlH5, and CaH2+6LiBH4 : Calculated dehydrogenation enthalpy, including zero point energy, and the structure of the phonon spectra

    NARCIS (Netherlands)

    Marashdeh, A.; Frankcombe, T.J.

    2008-01-01

    The dehydrogenation enthalpies of Ca(AlH4)2, CaAlH5, and CaH2+6LiBH4 have been calculated using density functional theory calculations at the generalized gradient approximation level. Harmonic phonon zero point energy (ZPE) corrections have been included using Parlinski’s direct method. The

  6. Spins, moments and charge radii beyond $^{48}$Ca

    CERN Multimedia

    Neyens, G; Rajabali, M M; Hammen, M; Blaum, K; Froemmgen, N E; Garcia ruiz, R F; Kreim, K D; Budincevic, I

    Laser spectroscopy of $^{49-54}$Ca is proposed as a continuation of the experimental theme initiated with IS484 “Ground-state properties of K-isotopes from laser and $\\beta$-NMR spectroscopy” and expanded in INTC-I-117 “Moments, Spins and Charge Radii Beyond $^{48}$Ca.” It is anticipated that the charge radii of these isotopes can show strong evidence for the existence of a sub-shell closure at N=32 and could provide a first tentative investigation into the existence of a shell effect at N=34. Furthermore the proposed experiments will simultaneously provide model-independent measurements of the spins, magnetic moments and quadrupole moments of $^{51,53}$Ca permitting existing and future excitation spectra to be pinned to firm unambiguous ground states.

  7. Crystal chemistry of ordered rocksalt-type Ca2NF

    Science.gov (United States)

    Al-Azzawi, Mohanad; Zeller, Matthias; Li, Dingqiang; Wagner, Timothy R.

    2017-10-01

    Ordered rocksalt-type Ca2NF has a cubic unit cell that is doubled along [100] relative to the rocksalt-type polymorph due to N/F ordering. Crystals for the present study were prepared from a pure, dry KCuF3 precursor by reaction with Ca metal under nitrogen, and analyzed via high resolution single crystal X-ray diffraction. From this analysis, as well as qualitative compositional analysis using energy dispersive spectroscopy, it was determined that interstitial fluoride ions previously interpreted as Frenkel defects are actually due to a non-stoichiometric defect. The refined composition is Ca2N0.925F1.23, and the ordered cubic phase has space group Fd 3 bar m (No. 227) with a = 10.0301(5) Å and Z = 16.

  8. Ca2+ signaling in pancreatic acinar cells: physiology and pathophysiology

    Directory of Open Access Journals (Sweden)

    O.H. Petersen

    2009-01-01

    Full Text Available The pancreatic acinar cell is a classical model for studies of secretion and signal transduction mechanisms. Because of the extensive endoplasmic reticulum and the large granular compartment, it has been possible - by direct measurements - to obtain considerable insights into intracellular Ca2+ handling under both normal and pathological conditions. Recent studies have also revealed important characteristics of stimulus-secretion coupling mechanisms in isolated human pancreatic acinar cells. The acinar cells are potentially dangerous because of the high intra-granular concentration of proteases, which become inappropriately activated in the human disease acute pancreatitis. This disease is due to toxic Ca2+ signals generated by excessive liberation of Ca2+ from both the endoplasmic reticulum and the secretory granules.

  9. High extracellular Ca2+ stimulates Ca2+-activated Cl- currents in frog parathyroid cells through the mediation of arachidonic acid cascade.

    Directory of Open Access Journals (Sweden)

    Yukio Okada

    Full Text Available Elevation of extracellular Ca(2+ concentration induces intracellular Ca(2+ signaling in parathyroid cells. The response is due to stimulation of the phospholipase C/Ca(2+ pathways, but the direct mechanism responsible for the rise of intracellular Ca(2+ concentration has remained elusive. Here, we describe the electrophysiological property associated with intracellular Ca(2+ signaling in frog parathyroid cells and show that Ca(2+-activated Cl(- channels are activated by intracellular Ca(2+ increase through an inositol 1,4,5-trisphophate (IP(3-independent pathway. High extracellular Ca(2+ induced an outwardly-rectifying conductance in a dose-dependent manner (EC(50 ∼6 mM. The conductance was composed of an instantaneous time-independent component and a slowly activating time-dependent component and displayed a deactivating inward tail current. Extracellular Ca(2+-induced and Ca(2+ dialysis-induced currents reversed at the equilibrium potential of Cl(- and were inhibited by niflumic acid (a specific blocker of Ca(2+-activated Cl(- channel. Gramicidin-perforated whole-cell recording displayed the shift of the reversal potential in extracellular Ca(2+-induced current, suggesting the change of intracellular Cl(- concentration in a few minutes. Extracellular Ca(2+-induced currents displayed a moderate dependency on guanosine triphosphate (GTP. All blockers for phospholipase C, diacylglycerol (DAG lipase, monoacylglycerol (MAG lipase and lipoxygenase inhibited extracellular Ca(2+-induced current. IP(3 dialysis failed to induce conductance increase, but 2-arachidonoylglycerol (2-AG, arachidonic acid and 12S-hydroperoxy-5Z,8Z,10E,14Z-eicosatetraenoic acid (12(S-HPETE dialysis increased the conductance identical to extracellular Ca(2+-induced conductance. These results indicate that high extracellular Ca(2+ raises intracellular Ca(2+ concentration through the DAG lipase/lipoxygenase pathway, resulting in the activation of Cl(- conductance.

  10. Cloning and quantitative determination of the human Ca2+/calmodulin-dependent protein kinase II (CaMK II) isoforms in human beta cells.

    Science.gov (United States)

    Rochlitz, H; Voigt, A; Lankat-Buttgereit, B; Göke, B; Heimberg, H; Nauck, M A; Schiemann, U; Schatz, H; Pfeiffer, A F

    2000-04-01

    The Ca2+/calmodulin-dependent protein kinase II (CaMK II) is highly expressed in pancreatic islets and associated with insulin secretion vesicles. The suppression of CaMK II disturbs insulin secretion and insulin gene expression. There are four isoforms of CaMK II, alpha to delta, that are expressed from different genes in mammals. Our aim was to identify the isoforms of CaMK II expressed in human beta cells by molecular cloning from a human insulinoma cDNA library and to assess its distribution in humans. The previously unknown complete coding sequences of human CaMK IIbeta and the kinase domain of CaMK IIdelta were cloned from a human insulinoma cDNA library. Quantitative determination of CaMK II isoform mRNA was carried out in several tissues and beta cells purified by fluorescence activated cell sorting and compared to the housekeeping enzyme pyruvate dehydrogenase. We found CaMK IIbeta occurred in three splice variants and was highly expressed in endocrine tissues such as adrenals, pituitary and beta cells. Liver showed moderate expression but adipose tissue or lymphocytes had very low levels of CaMK IIbeta-mRNA. In human beta cells CaMK IIbeta and delta were expressed equally with pyruvate dehydrogenase whereas tenfold lower expression of CaMK IIgamma and no expression of CaMK IIalpha were found. Although CaMK IIdelta is ubiquitously expressed, CaMK IIbeta shows preferential expression in neuroendocrine tissues. In comparison with the expression of a key regulatory enzyme in glucose oxidation, pyruvate dehydrogenase, two of the four CaM kinases investigated are expressed at equally high levels, which supports an important role in beta-cell physiology. These results provide the basis for exploring the pathophysiological relevance of CaMK IIbeta in human diabetes.

  11. Ca{sup 2+}/calmodulin-dependent protein kinase phosphatase (CaMKP/PPM1F) interacts with neurofilament L and inhibits its filament association

    Energy Technology Data Exchange (ETDEWEB)

    Ozaki, Hana [Laboratory of Molecular Brain Science, Graduate School of Integrated Arts and Sciences, Hiroshima University, Higashi-Hiroshima, 739-8521 (Japan); Katoh, Tsuyoshi [Department of Biochemistry, Asahikawa Medical University, Asahikawa, 078-8510 (Japan); Nakagawa, Ryoko; Ishihara, Yasuhiro [Laboratory of Molecular Brain Science, Graduate School of Integrated Arts and Sciences, Hiroshima University, Higashi-Hiroshima, 739-8521 (Japan); Sueyoshi, Noriyuki; Kameshita, Isamu [Department of Life Sciences, Faculty of Agriculture, Kagawa University, Kagawa, 761-0795 (Japan); Taniguchi, Takanobu [Department of Biochemistry, Asahikawa Medical University, Asahikawa, 078-8510 (Japan); Hirano, Tetsuo; Yamazaki, Takeshi [Laboratory of Molecular Brain Science, Graduate School of Integrated Arts and Sciences, Hiroshima University, Higashi-Hiroshima, 739-8521 (Japan); Ishida, Atsuhiko, E-mail: aishida@hiroshima-u.ac.jp [Laboratory of Molecular Brain Science, Graduate School of Integrated Arts and Sciences, Hiroshima University, Higashi-Hiroshima, 739-8521 (Japan)

    2016-09-02

    Ca{sup 2+}/calmodulin-dependent protein kinase phosphatase (CaMKP/PPM1F) is a Ser/Thr phosphatase that belongs to the PPM family. Growing evidence suggests that PPM phosphatases including CaMKP act as a complex with other proteins to regulate cellular functions. In this study, using the two-dimensional far-western blotting technique with digoxigenin-labeled CaMKP as a probe, in conjunction with peptide mass fingerprinting analysis, we identified neurofilament L (NFL) as a CaMKP-binding protein in a Triton-insoluble fraction of rat brain. We confirmed binding of fluorescein-labeled CaMKP (F-CaMKP) to NFL in solution by fluorescence polarization. The analysis showed that the dissociation constant of F-CaMKP for NFL is 73 ± 17 nM (n = 3). Co-immunoprecipitation assay using a cytosolic fraction of NGF-differentiated PC12 cells showed that endogenous CaMKP and NFL form a complex in cells. Furthermore, the effect of CaMKP on self-assembly of NFL was examined. Electron microscopy revealed that CaMKP markedly prevented NFL from forming large filamentous aggregates, suggesting that CaMKP-binding to NFL inhibits its filament association. These findings may provide new insights into a novel mechanism for regulating network formation of neurofilaments during neuronal differentiation. - Highlights: • NFL was identified as a CaMKP-binding protein in an insoluble fraction of rat brain. • CaMKP bound to NFL in solution with a K{sub d} value of 73 ± 17 nM. • A CaMKP-NFL complex was found in NGF-differentiated PC12 cells. • CaMKP-binding to NFL inhibited its filament association. • CaMKP may regulate network formation of neurofilaments in neurons.

  12. Photolysis of Postsynaptic Caged Ca2+ Can Potentiate and Depress Mossy Fiber Synaptic Responses in Rat Hippocampal CA3 Pyramidal Neurons

    Science.gov (United States)

    Wang, Jun; Yeckel, Mark F.; Johnston, Daniel; Zucker, Robert S.

    2010-01-01

    The induction of mossy fiber-CA3 long-term potentiation (LTP) and depression (LTD) has been variously described as being dependent on either pre- or postsynaptic factors. Some of the postsynaptic factors for LTP induction include ephrin-B receptor tyrosine kinases and a rise in postsynaptic Ca2+ ([Ca2+]i). Ca2+ is also believed to be involved in the induction of the various forms of LTD at this synapse. We used photolysis of caged Ca2+ compounds to test whether a postsynaptic rise in [Ca2+]i is sufficient to induce changes in synaptic transmission at mossy fiber synapses onto rat hippocampal CA3 pyramidal neurons. We were able to elevate postsynaptic [Ca2+]i to approximately 1 μm for a few seconds in pyramidal cell somata and dendrites. We estimate that CA3 pyramidal neurons have approximately fivefold greater endogenous Ca2+ buffer capacity than CA1 neurons, limiting the rise in [Ca2+]i achievable by photolysis. This [Ca2+]i rise induced either a potentiation or a depression at mossy fiber synapses in different preparations. Neither the potentiation nor the depression was accompanied by consistent changes in paired-pulse facilitation, suggesting that these forms of plasticity may be distinct from synaptically induced LTP and LTD at this synapse. Our results are consistent with a postsynaptic locus for the induction of at least some forms of synaptic plasticity at mossy fiber synapses. PMID:14645386

  13. Phase transformations of (Ca, Ti)-partially stabilized zirconia

    Energy Technology Data Exchange (ETDEWEB)

    Hon Yungshon; Shen Pouyan (Inst. of Materials Science and Engineering, Nation Sun Yat-Sen Univ., Kaohsiung (Taiwan))

    1991-01-20

    The results of phase transformation and microstructural investigation of the ZrO{sub 2}-rich corner of the CaO-TiO{sub 2}-ZrO{sub 2} system are reported. Samples of Ca-PSZ powder (where PSZ is partially stabilized zirconia) containing 10.8 mol.% CaO, had added to them 0-14 mol.% TiO{sub 2} (designated specimens 0T to 14T). The samples were sintered at 1600deg C for 6 h and studied by X-ray diffraction and electron microscopy. Saturation of TiO{sub 2} in the cubic (c) zirconia was reached at a total TiO{sub 2} addition of about 4 mol.% at 1600deg C, whereas the solubility limit in tetragonal (t) zirconia was not reached in the composition range studied. The t-zirconia precipitates remained tweed in the cubic matrix for specimens 2T and 4T, but became lenticular with the (101) habit plane for specimens having a larger TiO{sub 2} content (e.g. 8T). The amount of t-zirconia increased with increasing TiO{sub 2} content at 1600deg C. The addition of TiO{sub 2} also enhanced the eutectoid decomposition of Ca-PSZ to form the PHI{sub 1}-phase (CaZr{sub 4}O{sub 9}). Calzirtite (Ca{sub 2}Zr{sub 5}Ti{sub 2}O{sub 16}) was precipitated from the shell of the zirconia grains in specimen 8T. (orig.).

  14. CaMKK-CaMK1a, a new post-traumatic signalling pathway induced in mouse somatosensory neurons.

    Directory of Open Access Journals (Sweden)

    Lucie Elzière

    Full Text Available Neurons innervating peripheral tissues display complex responses to peripheral nerve injury. These include the activation and suppression of a variety of signalling pathways that together influence regenerative growth and result in more or less successful functional recovery. However, these responses can be offset by pathological consequences including neuropathic pain. Calcium signalling plays a major role in the different steps occurring after nerve damage. As part of our studies to unravel the roles of injury-induced molecular changes in dorsal root ganglia (DRG neurons during their regeneration, we show that the calcium calmodulin kinase CaMK1a is markedly induced in mouse DRG neurons in several models of mechanical peripheral nerve injury, but not by inflammation. Intrathecal injection of NRTN or GDNF significantly prevents the post-traumatic induction of CaMK1a suggesting that interruption of target derived factors might be a starter signal in this de novo induction. Inhibition of CaMK signalling in injured DRG neurons by pharmacological means or treatment with CaMK1a siRNA resulted in decreased velocity of neurite growth in vitro. Altogether, the results suggest that CaMK1a induction is part of the intrinsic regenerative response of DRG neurons to peripheral nerve injury, and is thus a potential target for therapeutic intervention to improve peripheral nerve regeneration.

  15. Minocycline chelates Ca2+, binds to membranes, and depolarizes mitochondria by formation of Ca2+-dependent ion channels

    Science.gov (United States)

    Antonenko, Yuri N.; Rokitskaya, Tatyana I.; Cooper, Arthur J. L.

    2010-01-01

    Minocycline (an anti-inflammatory drug approved by the FDA) has been reported to be effective in mouse models of amyotrophic lateral sclerosis and Huntington disease. It has been suggested that the beneficial effects of minocycline are related to its ability to influence mitochondrial functioning. We tested the hypothesis that minocycline directly inhibits the Ca2+-induced permeability transition in rat liver mitochondria. Our data show that minocycline does not directly inhibit the mitochondrial permeability transition. However, minocycline has multiple effects on mitochondrial functioning. First, this drug chelates Ca2+ ions. Secondly, minocycline, in a Ca2+-dependent manner, binds to mitochondrial membranes. Thirdly, minocycline decreases the proton-motive force by forming ion channels in the inner mitochondrial membrane. Channel formation was confirmed with two bilayer lipid membrane models. We show that minocycline, in the presence of Ca2+, induces selective permeability for small ions. We suggest that the beneficial action of minocycline is related to the Ca2+-dependent partial uncoupling of mitochondria, which indirectly prevents induction of the mitochondrial permeability transition. PMID:20180001

  16. Cell surface topology creates high Ca2+ signalling microdomains

    DEFF Research Database (Denmark)

    Brasen, Jens Christian; Olsen, Lars Folke; Hallett, Maurice B

    2010-01-01

    of a smooth cell surface predicts only moderate localized effects, the more realistic "wrinkled" surface topology predicts that Ca2+ concentrations up to 80 microM can persist within the folds of membranes for significant times. This intra-wrinkle location may account for 5% of the total cell volume. Using...... different geometries of wrinkles, our simulations show that high Ca2+ microdomains will be generated most effectively by long narrow membrane wrinkles of similar dimensions to those found experimentally. This is a new concept which has not previously been considered, but which has ramifications as the intra-wrinkle...

  17. Prediction of Land use changes using CA in GIS Environment

    Science.gov (United States)

    Kiavarz Moghaddam, H.; Samadzadegan, F.

    2009-04-01

    Urban growth is a typical self-organized system that results from the interaction between three defined systems; developed urban system, natural non-urban system and planned urban system. Urban growth simulation for an artificial city is carried out first. It evaluates a number of urban sprawl parameters including the size and shape of neighborhood besides testing different types of constraints on urban growth simulation. The results indicate that circular-type neighborhood shows smoother but faster urban growth as compared to nine-cell Moore neighborhood. Cellular Automata is proved to be very efficient in simulating the urban growth simulation over time. The strength of this technology comes from the ability of urban modeler to implement the growth simulation model, evaluating the results and presenting the output simulation results in visual interpretable environment. Artificial city simulation model provides an excellent environment to test a number of simulation parameters such as neighborhood influence on growth results and constraints role in driving the urban growth .Also, CA rules definition is critical stage in simulating the urban growth pattern in a close manner to reality. CA urban growth simulation and prediction of Tehran over the last four decades succeeds to simulate specified tested growth years at a high accuracy level. Some real data layer have been used in the CA simulation training phase such as 1995 while others used for testing the prediction results such as 2002. Tuning the CA growth rules is important through comparing the simulated images with the real data to obtain feedback. An important notice is that CA rules need also to be modified over time to adapt to the urban growth pattern. The evaluation method used on region basis has its advantage in covering the spatial distribution component of the urban growth process. Next step includes running the developed CA simulation over classified raster data for three years in a developed Arc

  18. Site Environmental Report for 2014 SNL/CA

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Barbara L. [Sandia National Lab. (SNL-CA), Livermore, CA (United States)

    2015-06-01

    Sandia National Laboratories, California (SNL/CA) is a government-owned/contractoroperated laboratory. Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, manages and operates the laboratory for the Department of Energy’s National Nuclear Security Administration (NNSA). The NNSA Sandia Field Office administers the contract and oversees contractor operations at the site. This Site Environmental Report for 2014 was prepared in accordance with DOE Order 231.1B, Environment, Safety and Health Reporting (DOE 2011d). The report provides a summary of environmental monitoring information and compliance activities that occurred at SNL/CA during calendar year 2014. General site and environmental program information is also included.

  19. EFFECT OF FERRITE PHASE ON THE FORMATION AND COEXISTENCE OF 3CaO.3Al₂O₃.CaSO₄ AND 3CaO.SiO₂ MINERALS

    Directory of Open Access Journals (Sweden)

    Xiaolei Lu

    2017-12-01

    Full Text Available The effect of ferrite on the formation and coexistence of 3CaO.3Al₂O₃.CaSO₄ (C₄A₃$ and 3CaO.SiO₂ (C3S was investigated in this paper. The results indicate that 20 % content of ferrite phase with the composition of C₂A0.5F0.5 can facilitate the coexistence of C₄A₃$ and C₃S solid solutions at 1350 ° C. There are other trace elements that incorporate into clinker minerals and form solid solutions. In addition, the dark and polygonal C₄A₃$ solid solution is not dissolved in liquid phase at 1350 ° C. It can promote the burnability of the raw mixes and provide a favorable condition for the formation of C₃S. However, it has an adverse effect on the coexistence of two clinker minerals with the changing of ferrite compositions. This will provide the important basis for the preparation of the calcium sulphoaluminate cement clinker containing C₃S.

  20. Age-dependent alterations in Ca2+ homeostasis: role of TRPV5 and TRPV6

    NARCIS (Netherlands)

    Abel, M. van; Huybers, S.; Hoenderop, J.G.J.; Kemp, J.W.C.M. van der; Leeuwen, J.P.P.M. van; Bindels, R.J.M.

    2006-01-01

    Aging is associated with alterations in Ca2+ homeostasis, which predisposes elder people to hyperparathyroidism and osteoporosis. Intestinal Ca2+ absorption decreases with aging and, in particular, active transport of Ca2+ by the duodenum. In addition, there are age-related changes in renal Ca2+

  1. Experimental investigation of Ca isotopic fractionation during abiotic gypsum precipitation

    Science.gov (United States)

    Harouaka, Khadouja; Eisenhauer, Anton; Fantle, Matthew S.

    2014-03-01

    Experiments investigating Ca isotopic fractionation during gypsum precipitation were undertaken in order to elucidate the mechanisms and conditions that govern isotopic fractionation during mineral precipitation. Both stirred and unstirred free drift gypsum precipitation experiments were conducted at constant initial ionic strength (0.6 M) and variable initial saturation states (4.8-1.5) and Ca2+:SO42- ratios (3 and 0.33). Experimental durations varied between 0.5 and 190 h, while temperature (25.9-24.0 °C), pH (5.8-5.4) and ionic strength (0.6-0.5) were relatively constant. In all experiments, 20-80% of the initial dissolved Ca reservoir was precipitated. Isotopically light Ca preferentially partitioned into the precipitated gypsum; the effective isotopic fractionation factor (Δ44/40Cas-f = δ44/40Casolid - δ44/40Cafluid) of the experimental gypsum ranged from -2.25‰ to -0.82‰. The log weight-averaged, surface area normalized precipitation rates correlated with saturation state and varied between 4.6 and 2.0 μmol/m2/h. The crystal size and aspect ratios, determined by SEM images, BET surface area, and particle size measurements, co-varied with precipitation rate, such that fast growth produced small (10-20 μm), tabular crystals and slow growth produced larger (>1000 μm), needle shaped crystals. Mass balance derived δ44Cas and Δ44Cas-f, calculated using the initial fluid δ44Ca and the mass fraction of Ca removed during precipitation (fCa) as constraints, suggest that the precipitate was not always sampled homogeneously due to the need to preserve the sample for SEM, surface area, and particle size analyses. The fractionation factor (αs-f), derived from Rayleigh model fits to the fluid and calculated bulk solid, ranged from 0.9985 to 0.9988 in stirred experiments and 0.9987 to 0.9992 in unstirred experiments. The αs-f demonstrated no clear dependence on either precipitation rate or initial saturation state in stirred reactors, but exhibited a positive

  2. Nuclear structure of light Ca and heavy Cr isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Buerger, A.

    2007-07-01

    In the present thesis, the shell structure in exotic nuclei has been investigated. The focus of the work was on finding new experimental data in neutron-rich Cr and proton-rich Ca isotopes. The investigation of light Ca isotopes concentrated on the nucleus {sup 36}Ca which was produced in a knockout reaction from a radioactive {sup 37}Ca beam. For {sup 36}Ca, the excitation energy of the first 2{sup +} state has been measured for the first time. Furthermore, momentum distributions were analyzed using a Monte-Carlo simulation of the knockout reaction. This analysis yielded the contributions of neutrons from individual orbitals to the total knockout cross section. In principle, these may be used to calculate spectroscopic factors, but such a calculation is hampered by difficulties of present knockout-reaction models in predicting precise single-particle cross sections. The measured branching ratio to the ground and excited states, on the other hand, is close to the predicted value. A remaining difference might be due to emission of protons which cannot be detected with the present experimental setup. Both the branching ratio and the large excitation energy are compatible with a large N=16 gap in {sup 36}Ca that leads to relatively pure configurations both in the ground state and the excited 2{sup +} state. As a by-product of the experiment, two excitation energies in the T=2 nuclei {sup 32}Ar and {sup 28}S have been confirmed, and two {gamma}-ray transitions have been observed for the first time in {sup 37}Ca. While the mirror energy differences in the T=2 pairs {sup 36}Ca-{sup 36}S, {sup 32}Ar-{sup 32}Si, and {sup 28}S-{sup 28}Mg can be reproduced in shell model calculations using a modified USD interaction, these modifications are not sufficient to explain the mirror energy differences for the pair {sup 37}Ca-{sup 37}Cl. In the heavy Cr isotopes, new experimental evidence for a sub-shell closure at N=32 was found in a measurement of B(E2) values using high

  3. Seawater Mg/Ca controls polymorph mineralogy of microbial CaCO3: a potential proxy for calcite-aragonite seas in Precambrian time.

    Science.gov (United States)

    Ries, J B; Anderson, M A; Hill, R T

    2008-03-01

    A previously published hydrothermal brine-river water mixing model driven by ocean crust production suggests that the molar Mg/Ca ratio of seawater (mMg/Ca(sw)) has varied significantly (approximately 1.0-5.2) over Precambrian time, resulting in six intervals of aragonite-favouring seas (mMg/Ca(sw) > 2) and five intervals of calcite-favouring seas (mMg/Ca(sw) mineralogical proxy for Precambrian calcite-aragonite seas, calcifying microbial marine biofilms were cultured in experimental seawaters formulated over the range of Mg/Ca ratios believed to have characterized Precambrian seawater. Biofilms cultured in experimental aragonite seawater (mMg/Ca(sw) = 5.2) precipitated primarily aragonite with lesser amounts of high-Mg calcite (mMg/Ca(calcite) = 0.16), while biofilms cultured in experimental calcite seawater (mMg/Ca(sw) = 1.5) precipitated exclusively lower magnesian calcite (mMg/Ca(calcite) = 0.06). Furthermore, Mg/Ca(calcite )varied proportionally with Mg/Ca(sw). This nearly abiotic mineralogical response of the biofilm CaCO3 to altered Mg/Ca(sw) is consistent with the assertion that biofilm calcification proceeds more through the elevation of , via metabolic removal of CO2 and/or H+, than through the elevation of Ca2+, which would alter the Mg/Ca ratio of the biofilm's calcifying fluid causing its pattern of CaCO3 polymorph precipitation (aragonite vs. calcite; Mg-incorporation in calcite) to deviate from that of abiotic calcification. If previous assertions are correct that the physicochemical properties of Precambrian seawater were such that Mg/Ca(sw) was the primary variable influencing CaCO3 polymorph mineralogy, then the observed response of the biofilms' CaCO3 polymorph mineralogy to variations in Mg/Ca(sw), combined with the ubiquity of such microbial carbonates in Precambrian strata, suggests that the original polymorph mineralogy and Mg/Ca(calcite )of well-preserved microbial carbonates may be an archive of calcite-aragonite seas throughout Precambrian

  4. Synthesis of Mesoporous CaCO3 Powder using Natural Limestone as Ca Ion Source with Solution Mixing Method

    Science.gov (United States)

    Arifin, Zaenal; Lailiyah, Qudsiyyatul; Zainuri, Mochamad; Darminto

    2017-05-01

    In this study, the CaCO3 powder has successfully been synthesized by mixing CaCl2 derived from natural limestone and Na2CO3 in the same molar ratio. The mixing process of two solutions was performed by employing the molar contents of 0.25, 0.5, 0.75 and 1 M at varying temperatures of 35, 50 and 80°C. The produced CaCO3 microparticles were characterized by scanning electron microscopy (SEM), X-ray diffraction (XRD) and Brunauer-Emmett-Teller (BET). The highest content of vaterite phase of the samples is around 96 wt%, resulted from the process using solution of 0.25 M at 35°C. All the samples prepared show mesoporous solids with pore sizes of 3-4 nm and specific surface area of 81-90 m2/g.

  5. Effect of [10]-Gingerol on [Ca2+]i and Cell Death in Human Colorectal Cancer Cells

    OpenAIRE

    Chung-Yi Chen; Yi-Wen Li; Soong-Yu Kuo

    2009-01-01

    The effect of [10]-gingerol on cytosol free Ca2+ concentration ([Ca2+]i) and viability is large unknown. This study examines the early signaling effects of [10]-gingerol on human colorectal cancer cells. It was found that this compound caused a slow and sustained rise of [Ca2+]i in a concentration-dependent manner. [10]-Gingerol also induced a [Ca2+]i rise when extracellular Ca2+ was removed, but the magnitude was reduced by 38%. In a Ca2+-free medium, the [10]-gingerol-induced [Ca2+]i rise w...

  6. caGrid 1.0: a Grid enterprise architecture for cancer research.

    Science.gov (United States)

    Oster, Scott; Langella, Stephen; Hastings, Shannon; Ervin, David; Madduri, Ravi; Kurc, Tahsin; Siebenlist, Frank; Covitz, Peter; Shanbhag, Krishnakant; Foster, Ian; Saltz, Joel

    2007-10-11

    caGrid is the core Grid architecture of the NCI-sponsored cancer Biomedical Informatics Grid (caBIG) program. The current release, caGrid version 1.0, is developed as the production Grid software infrastructure of caBIG. Based on feedback from adopters of the previous version (caGrid 0.5), it has been significantly enhanced with new features and improvements to existing components. This paper presents an overview of caGrid 1.0, its main components, and enhancements over caGrid 0.5.

  7. Data of evolutionary structure change: 1NTOH-1P0CA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 77.958 45.497 71.703 1.00 26.17 C -map> GLU CA -map> ASN CA 286 ALA CA 281 SER C...5 CA VAL A1252 17.966 31.475 76.692 1.00 33.87 C -map> VAL GLU TY...A 5.11 5.40 3.81 TYR CA 5.45 3.80 GLU CA 3.81 VAL CA ...1.00 20.03 C -map> VAL TYR LYS GLY GLN

  8. Data of evolutionary structure change: 1NTOA-1P0CA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 20.937 -6.285 46.686 1.00 21.03 C -map> GLU CA -map> ASN CA 288 ALA CA 289 SER C...5 CA VAL A1252 17.966 31.475 76.692 1.00 33.87 C -map> VAL GLU TY...A 5.11 5.40 3.81 TYR CA 5.45 3.80 GLU CA 3.81 VAL CA ...14.82 C -map> VAL TYR LYS GLY GLN LYS

  9. Possible involvement of transient receptor potential ankyrin 1 in Ca2+signaling via T-type Ca2+channel in mouse sensory neurons.

    Science.gov (United States)

    Nishizawa, Yuki; Takahashi, Kenji; Oguma, Naoko; Tominaga, Makoto; Ohta, Toshio

    2017-12-28

    T-type Ca 2+ channels and TRPA1 are expressed in sensory neurons and both are associated with pain transmission, but their functional interaction is unclear. Here we demonstrate that pharmacological evidence of the functional relation between T-type Ca 2+ channels and TRPA1 in mouse sensory neurons. Low concentration of KCl at 15 mM (15K) evoked increases of intracellular Ca 2+ concentration ([Ca 2+ ] i ), which were suppressed by selective T-type Ca 2+ channel blockers. RT-PCR showed that mouse sensory neurons expressed all subtypes of T-type Ca 2+ channel. The magnitude of 15K-induced [Ca 2+ ] i increase was significantly larger in neurons sensitive to allylisothiocyanate (AITC, a TRPA1 agonist) than in those insensitive to it, and in TRPA1 -/- mouse sensory neurons. TRPA1 blockers diminished the [Ca 2+ ] i responses to 15K in neurons sensitive to AITC, but failed to inhibit 40 mM KCl-induced [Ca 2+ ] i increases even in AITC-sensitive neurons. TRPV1 blockers did not inhibit the 15K-induced [Ca 2+ ] i increase regardless of the sensitivity to capsaicin. [Ca 2+ ] i responses to TRPA1 agonist were enhanced by co-application with 15K. These pharmacological data suggest the possibility of functional interaction between T-type Ca 2+ channels and TRPA1 in sensory neurons. Since TRPA1 channel is activated by intracellular Ca 2+ , we hypothesize that Ca 2+ entered via T-type Ca 2+ channel activation may further stimulate TRPA1, resulting in an enhancement of nociceptive signaling. Thus, T-type Ca 2+ channel may be a potential target for TRPA1-related pain. © 2017 Wiley Periodicals, Inc.

  10. Constraining the mechanisms driving coccolith δ44/40Ca and Sr/Ca variations: new perspectives from cultures, cellular models, and the sediment record

    Science.gov (United States)

    María Mejía, Luz; Paytan, Adina; Eisenhauer, Anton; Kolevica, Ana; Bolton, Clara; Méndez-Vicente, Ana; Abrevaya, Lorena; Isensee, Kirsten; Stoll, Heather

    2017-04-01

    Coccoliths comprise a major fraction of the calcium carbonate (CaCO3) production, with contributions varying from 95% of the global carbonate sink during the Cenozoic, to 50% in the modern ocean. Therefore, significant changes in coccolith Ca isotopic fractionation could have affected past seawater Ca isotopic composition (δ44/40Ca), with potential important implications for the interpretation of the global Ca cycle and related changes in seawater chemistry. Here we evaluate the mechanisms driving coccolith Ca isotopic fractionation in a quantitative framework, by deriving a steady-state mass balance geochemical model (CaSri-Co), which assumes that fractionation is solely associated with desolvation (i.e. dehydration) of Ca during cellular transport through membranes. The application of the CaSri-Co model to previously published and to our new δ44/40Ca and Sr/Ca results from cultured coccolithophores (Emiliania huxleyi, Gephyrocapsa oceanica and Calcidiscus leptoporus) allowed us to identify calcification rates, Ca retention efficiency and water structure strength as main regulators of the Ca isotopic fractionation and Sr/Ca ratios of cultured coccolith calcite. Higher calcification rates, higher Ca retention efficiencies and higher water structure strength (slower Ca solvation-desolvation reactions) increase both coccolith Sr/Ca and Ca isotopic fractionation. The CaSri-Co model shows that coccolith Ca isotopic fractionation is especially sensitive to changes in water structure strength. On the other hand, Ca retention efficiency appears to be the main driver of the observed Sr/Ca trends, which results from the incomplete usage of the Sr transported to the calcification vesicle and subsequent Sr enrichment of the cytosol, while Ca inside the calcification vesicle is assumed to be completely utilized in the model. In this study we also measured δ44/40Ca and Sr/Ca in two coccolith size fraction from site 925 in the Western Equatorial Atlantic representing the last

  11. The functional genome of CA1 and CA3 neurons under native conditions and in response to ischemia

    Directory of Open Access Journals (Sweden)

    Rossner Moritz

    2007-10-01

    Full Text Available Abstract Background The different physiological repertoire of CA3 and CA1 neurons in the hippocampus, as well as their differing behaviour after noxious stimuli are ultimately based upon differences in the expressed genome. We have compared CA3 and CA1 gene expression in the uninjured brain, and after cerebral ischemia using laser microdissection (LMD, RNA amplification, and array hybridization. Results Profiling in CA1 vs. CA3 under normoxic conditions detected more than 1000 differentially expressed genes that belong to different, physiologically relevant gene ontology groups in both cell types. The comparison of each region under normoxic and ischemic conditions revealed more than 5000 ischemia-regulated genes for each individual cell type. Surprisingly, there was a high co-regulation in both regions. In the ischemic state, only about 100 genes were found to be differentially expressed in CA3 and CA1. The majority of these genes were also different in the native state. A minority of interesting genes (e.g. inhibinbetaA displayed divergent expression preference under native and ischemic conditions with partially opposing directions of regulation in both cell types. Conclusion The differences found in two morphologically very similar cell types situated next to each other in the CNS are large providing a rational basis for physiological differences. Unexpectedly, the genomic response to ischemia is highly similar in these two neuron types, leading to a substantial attenuation of functional genomic differences in these two cell types. Also, the majority of changes that exist in the ischemic state are not generated de novo by the ischemic stimulus, but are preexistant from the genomic repertoire in the native situation. This unexpected influence of a strong noxious stimulus on cell-specific gene expression differences can be explained by the activation of a cell-type independent conserved gene-expression program. Our data generate both novel

  12. Low temperature synthesis of CaZrO3 nanoceramics from CaCl2–NaCl molten eutectic salt

    Directory of Open Access Journals (Sweden)

    Rahman Fazli

    2015-06-01

    Full Text Available CaZrO3 nanoceramics were successfully synthesized at 700 C using the molten salt method, and the effects of processing parameters, such as temperature, holding time, and amount of salt on the crystallization of CaZrO3 were investigated. CaCl2, Na2CO3, and nano-ZrO2 were used as starting materials. On heating, CaCl2–NaCl molten eutectic salt provided a liquid medium for the reaction of CaCO3 and ZrO2 to form CaZrO3. The results demonstrated that CaZrO3 started to form at about 600C and that, after the temperature was increased to 1,000C, the amounts of CaZrO3 in the resultant powders increased with a concomitant decrease in CaCO3and ZrO2 contents. After washing with hot distilled water, the samples heated for 3 h at 700C were single-phase CaZrO3 with 90–95 nm particle size. Furthermore, the synthesized CaZrO3 particles retained the size and morphology of the ZrO2 powders which indicated that a template mechanism dominated the formation of CaZrO3 by molten-salt method.

  13. Aberrant Splicing Promotes Proteasomal Degradation of L-type Ca v 1.2 Calcium Channels by Competitive Binding for CaV β Subunits in Cardiac Hypertrophy

    NARCIS (Netherlands)

    Hu, Zhenyu; Wang, Jiong Wei; Yu, Dejie; Soon, Jia Lin; De Kleijn, Dominique P V|info:eu-repo/dai/nl/30481489X; Foo, Roger; Liao, Ping; Colecraft, Henry M.; Soong, Tuck Wah

    2016-01-01

    Decreased expression and activity of Ca V1.2 calcium channels has been reported in pressure overload-induced cardiac hypertrophy and heart failure. However, the underlying mechanisms remain unknown. Here we identified in rodents a splice variant of Ca V1.2 channel, named Ca V1.2 e21+22, that

  14. Punta Pitt Stable Isotope and Ion Data (delta 18O, delta 13C, Cd/Ca, Mn/Ca) for 1936 to 1982.5

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — File contains data presented by Shen et al. (1992a). Table includes d18O, d13C, Cd/Ca, Mn/Ca, and Ba/Ca data from a 2m coral head and, for comparison, SST records...

  15. Isoflurane reduces the carbachol-evoked Ca2+ influx in neuronal cells.

    Science.gov (United States)

    Corrales, Alexandra; Xu, Fang; Garavito-Aguilar, Zayra V; Blanck, Thomas J J; Recio-Pinto, Esperanza

    2004-10-01

    The authors previously reported that the isoflurane-caused reduction of the carbachol-evoked cytoplasmic Ca transient increase ([Ca]cyt) was eliminated by K or caffeine-pretreatment. In this study the authors investigated whether the isoflurane-sensitive component of the carbachol-evoked [Ca]cyt transient involved Ca influx through the plasma membrane. Perfused attached human neuroblastoma SH-SY5Y cells were exposed to carbachol (1 mm, 2 min) in the absence and presence of isoflurane (1 mm) and in the absence and presence of extracellular Ca (1.5 mm). The authors studied the effect of the nonspecific cationic channel blocker La (100 microm), of the L-type Ca channel blocker nitrendipine (10 microm), and of the N-type Ca channel blocker omega-conotoxin GVIA (0.1 microm) on isoflurane modulation of the carbachol-evoked [Ca]cyt transient. [Ca]cyt was detected with fura-2 and experiments were carried out at 37 degrees C. Isoflurane reduced the peak and area of the carbachol-evoked [Ca]cyt transient in the presence but not in the absence of extracellular Ca. La had a similar effect as the removal of extracellular Ca. Omega-conotoxin GVIA and nitrendipine did not affect the isoflurane sensitivity of the carbachol response although nitrendipine reduced the magnitude of the carbachol response. The current data are consistent with previous observations in that the carbachol-evoked [Ca]cyt transient involves both Ca release from intracellular Ca stores and Ca entry through the plasma membrane. It was found that isoflurane attenuates the carbachol-evoked Ca entry. The isoflurane sensitive Ca entry involves a cationic channel different from the L- or N- type voltage-dependent Ca channels. These results indicate that isoflurane attenuates the carbachol-evoked [Ca]cyt transient at a site at the plasma membrane that is distal to the muscarinic receptor.

  16. CaPiTo: protocol stacks for services

    DEFF Research Database (Denmark)

    Gao, Han; Nielson, Flemming; Nielson, Hanne Riis

    2011-01-01

    CaPiTo allows the modelling of service-oriented applications using process algebras at three levels of abstraction. The abstract level focuses on the key functionality of the services; the plug-in level shows how to obtain security using standardised protocol stacks; finally, the concrete level a...

  17. Cuscuta reflexa invasion induces Ca2+ release in its host

    NARCIS (Netherlands)

    Albert, M.; Krol, van der A.R.; Kaldenhoff, R.

    2010-01-01

    Cuscuta reflexa induces a variety of reaction in its hosts. Some of these are visual reactions, and it is clear that these morphological changes are preceded by events at the molecular level, where signal transduction is one of the early processes. Calcium (Ca(2+)) release is the major second

  18. Cañoncillo, un paraíso cercano

    OpenAIRE

    Mariñas, Ángela

    2014-01-01

    Tenemos un paraíso en medio de esta civilización agitada. Se llama Cañoncillo. Es un bosque muy bien conservado en el que los visitantes pueden bañarse en su laguna o admirar embelesados la flora y la fauna a cambio de casi nada.

  19. Negative chemical pressure effects induced by Y substitution for Ca ...

    Indian Academy of Sciences (India)

    exotic' magnetic behavior of the spin-chain compound, Ca3Co2O6. S Rayaprol E V ... Department of Condensed Matter Physics and Material Science, Tata Institute of Fundamental Research, Homi Bhabha Road, Colaba, Mumbai 400 005, India ...

  20. Request for proposal from C & AG empanelled CA firms

    Indian Academy of Sciences (India)

    IAS

    ... undertake the audit of an international publishing agency with whom the Academy has a co-publication agreement. This notice is to seek proposal from C & AG empanelled CA firms who are familiar with the auditing of online subscription of journals, periodicals etc and who have knowledge of activities of an organization ...

  1. 75 FR 63431 - Radio Broadcasting Services; Willow Creek, CA

    Science.gov (United States)

    2010-10-15

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Willow Creek, CA AGENCY: Federal Communications... 47 CFR Part 73 Radio, Radio broadcasting. For the reasons discussed in the preamble, the Federal Communications Commission proposes to amend 47 CFR part 73 as follows: PART 73--RADIO BROADCAST SERVICES 1. The...

  2. 78 FR 32 - Radio Broadcasting Services; Westley, CA

    Science.gov (United States)

    2013-01-02

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Westley, CA AGENCY: Federal Communications Commission.... 8. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications Commission... Federal Communications Commission amends 47 CFR Part 73 as follows: PART 73--RADIO BROADCAST SERVICES 0 1...

  3. Influence of pairing in double beta decay of 48Ca

    Indian Academy of Sciences (India)

    Influence of pairing in double beta decay of 48Ca. PRIANKA ROY∗ and SHASHI K DHIMAN. Department of Physics, Himachal Pradesh University, Shimla 171 005, India. ∗Corresponding author. E-mail: royprianka04@gmail.com. MS received 4 August 2009; accepted 9 October 2009. Abstract. Two-neutrino ββ decay ...

  4. EST Table: CA946121 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CA946121 KI000181 10/09/28 67 %/199 aa ref|XP_001607023.1| PREDICTED: similar to mandela...0308|ref|XP_972041.1| PREDICTED: similar to mandelate racemase [Tribolium castaneum] CK507909 L9 ...

  5. 76 FR 13017 - Environmental Impact Statement: Los Angeles County, CA

    Science.gov (United States)

    2011-03-09

    ... Federal Highway Administration Environmental Impact Statement: Los Angeles County, CA AGENCY: Federal... Environmental Impact Statement will be prepared for a proposed highway project in Los Angeles County, California... Environmental Impact Statement on a proposal for the State Route 710 Gap North Closure project in Los Angeles...

  6. 75 FR 69154 - Environmental Impact Statement: Kern County, CA

    Science.gov (United States)

    2010-11-10

    ... TRANSPORTATION Federal Highway Administration Environmental Impact Statement: Kern County, CA AGENCY: Federal Highway Administration (FHWA), DOT. ACTION: Rescind Notice of Intent to prepare an Environmental Impact... prepare an Environmental Impact Statement (EIS) for the proposed 24th Street Improvement Project in Kern...

  7. HIGHLY ACTIVE CaO FOR THE TRANSESTERIFICATION TO ...

    African Journals Online (AJOL)

    Preferred Customer

    KEY WORDS: Biodiesel, Base catalyst, CaO, Modification. INTRODUCTION. Depletion of fossil reserves increases many initiatives to search for alternate fuel, which have same properties as diesel, to supply or replace such fossil fuel[1, 2]. Biodiesel, fatty acid methyl esters of seed oils and fats, has already been found ...

  8. Collective modes in Ca70Mg30 glass

    Indian Academy of Sciences (India)

    Unknown

    of interatomic potential in the solids, has been used to generate the collective modes in the Ca70Mg30 glass. A model potential is proposed to describe the effective interaction in the glass. Three different forms of the local field correction functions viz. Hartree, Taylor and Ichimaru and Utsumi are used to examine relative ...

  9. Serum CA 125 concentrations in women with endometriosis or ...

    African Journals Online (AJOL)

    Several studies have noted significant elevation of. CA 125 levels in women with endometriosis, uterine fibroids and other benign gynaecological conditions and .... This woman presented with ascites and a pelvic mass, and at exploratory laparotomy, severe endometriosis was diagnosed and histologically confirmed.

  10. Structural, dielectric and piezoelectric study of Ca-, Zr-modified ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 40; Issue 5. Structural, dielectric and piezoelectric study of Ca-, Zr-modified BaTiO 3 lead-free ceramics. H MSOUNI A TACHAFINE M EL AATMANI D FASQUELLE J C CARRU M EL HAMMIOUI M RGUITI A ZEGZOUTI A OUTZOURHIT M DAOUD. Volume 40 Issue 5 ...

  11. Enhanced antioxidant defense after exogenous application of Ca 2+ ...

    African Journals Online (AJOL)

    Both of these nutrients play an important role in ameliorating drought stress in crop plants. This experiment was designed to study whether exogenous application of Ca2+ and K+ before the drought could enhance the potential of plants to survive under limiting water conditions. Brassica napus L. cv Bulbul-98 seedlings ...

  12. 78 FR 23849 - Inland Waterways Navigation Regulation: Sacramento River, CA

    Science.gov (United States)

    2013-04-23

    ... SECURITY Coast Guard 33 CFR Part 162 RIN 1625-AB95 Inland Waterways Navigation Regulation: Sacramento River... entitled, ``Inland Waterways Navigation Regulation: Sacramento River, CA'' in the Federal Register (78 FR 4785). That rule announced our intent to update the inland waterways navigation regulations by removing...

  13. Ca2+ Receptor, Prostate Cancer, and Bone Metastases

    Science.gov (United States)

    2005-03-01

    the skeletal complications of metastatic niurie hyperealcemia andother syndromes ofaltered respansive- breast cancer and on the incidence of new... dhat an hicrease in extra.ehlinlar Ca42 resulted :in delayed activation of exlracellular signal-regulated kinwse (ERK) in PC-3 cells. Pre-intcubation

  14. Correlation between cyanide-induced decreases in ocular Ca 2+ ...

    African Journals Online (AJOL)

    The effect of cyanide toxicity on Ca2+-ATPase activities were significantly decreased in the lens and vitreous humour of the cyanide-fed rabbits (p< 0.05), while the corneal enzyme was unaffected. Ophthalmoscopic examination of the cyanide-exposed rabbits revealed adverse morphological changes, including pale fundus ...

  15. Construction of CaF2-appended PVA nanofibre scaffold

    Indian Academy of Sciences (India)

    2018-02-02

    Feb 2, 2018 ... Transmission electron microscopy results showed that many CaF2 nanoparticles were well dispersed in the PVA fibre matrix. The water- resistant ability of the scaffold was improved through intermolecular crosslinking of PVA by formaldehyde vapour. This novel material seems to be a promising scaffold for ...

  16. Synthesis of BiPbSrCaCuO superconductor

    Science.gov (United States)

    Hults, William L.; Kubat-Martin, Kimberly A.; Salazar, Kenneth V.; Phillips, David S.; Peterson, Dean E.

    1994-01-01

    A process and a precursor composition for preparing a lead-doped bismuth-strontium-calcium-copper oxide superconductor of the formula Bi.sub.a Pb.sub.b Sr.sub.c Ca.sub.d Cu.sub.e O.sub.f wherein a is from about 1.7 to about 1.9, b is from about 0.3 to about 0.45, c is from about 1.6 to about 2.2, d is from about 1.6 to about 2.2, e is from about 2.97 to about 3.2 and f is 10.+-.z by reacting a mixture of Bi.sub.4 Sr.sub.3 Ca.sub.3 Cu.sub.4 O.sub.16.+-.z, an alkaline earth metal cuprate, e.g., Sr.sub.9 Ca.sub.5 Cu.sub.24 O.sub.41, and an alkaline earth metal plumbate, e.g., Ca.sub.2-x Sr.sub.x PbO.sub.4 wherein x is about 0.5, is disclosed.

  17. 76 FR 13524 - Radio Broadcasting Services; Willow Creek, CA

    Science.gov (United States)

    2011-03-14

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Willow Creek, CA AGENCY: Federal Communications... Congressional Review Act, see U.S.C. 801(a)(1)(A). List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting... as follows: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for part 73 continues to...

  18. 77 FR 43216 - Radio Broadcasting Services; Randsburg, CA

    Science.gov (United States)

    2012-07-24

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Randsburg, CA AGENCY: Federal Communications....415 and 1.420. List of Subjects in 47 CFR Part 73 Radio, Radio broadcasting. Federal Communications... preamble, the Federal Communications Commission proposes to amend 47 CFR part 73 as follows: PART 73--RADIO...

  19. 77 FR 64758 - Radio Broadcasting Services; Randsburg, CA

    Science.gov (United States)

    2012-10-23

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Randsburg, CA AGENCY: Federal Communications... Radio, Radio broadcasting. Federal Communications Commission. Nazifa Sawez, Assistant Chief, Audio... amends 47 CFR Part 73 as follows: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for part...

  20. 77 FR 50053 - Radio Broadcasting Services; Westley, CA

    Science.gov (United States)

    2012-08-20

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Westley, CA AGENCY: Federal Communications Commission... 73 Radio, Radio broadcasting. Federal Communications Commission. Peter H. Doyle, Chief, Audio... amends 47 CFR part 73 as follows: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation for part...

  1. 78 FR 15878 - Drawbridge Operation Regulations; Sacramento River, Sacramento, CA

    Science.gov (United States)

    2013-03-13

    ... across Sacramento River, mile 59.0, at Sacramento, CA. The deviation is necessary to allow the community[email protected] . If you have questions on viewing the docket, call Barbara Hairston, Program Manager... community to participate in the Ninth Annual Shamrock footrace. This temporary deviation has been...

  2. Burstein Moss effect in nanocrystalline CaS: Ce

    Indian Academy of Sciences (India)

    Administrator

    studies are carried out using UV–Vis absorption spectroscopy. The absorption edge is found to show blue shift ... Burstein Moss effect; calcium sulphide; nanophosphors. 1. Introduction. Calcium sulphide (CaS) is being .... in good agreement with the standard data available in. JCPDS Card number 77-2011 and shows ...

  3. DISTRIBUTION OF MAJOR ELEMENTS (Na, K, Ca, Mg) IN THE ...

    African Journals Online (AJOL)

    a

    Levels of sodium, potassium, calcium and magnesium were determined in plant organs (bud, flowers .... Elmer Model 306 Atomic Absorption Spectrophotometer for magnesium and calcium while potassium and ... 131 in Ca to 142 in K. Only the root and leaves are available for analyses in Zea mays in zone. C. In these two ...

  4. DISTRIBUTION OF MAJOR ELEMENTS (NA, K, CA, MG) IN THE ...

    African Journals Online (AJOL)

    Levels of sodium, potassium, calcium and magnesium were determined in plant organs (bud, flowers, fruit, seed, leaves, stems, roots, cobs, styles, shaft, grains and efflorescences) of three Fadama farms located in Ifaki-Ekiti, Ado-Ekiti and Ikere-Ekiti of Ekiti State, Nigeria. The highest levels of Mg, K, Na and Ca were ...

  5. Systematic B-metal substitution in CaNi5

    DEFF Research Database (Denmark)

    Jensen, Jens Oluf; Bjerrum, Niels

    1999-01-01

    The aim of this work has been to study the effect of B metal substitutions in CaNi5 (AB(5)) which is known to suffer from poor cycling stability as a hydride electrode material. Systematic monosubstitutions of nickel with the most common other B metals (i.e. Al, Cr, Mn, Fe, Co, Cu, Zn and Sn...

  6. 75 FR 66344 - Amendment of Jet Route J-93; CA

    Science.gov (United States)

    2010-10-28

    ... Federal Aviation Administration 14 CFR Part 71 RIN 2120-AA66 Amendment of Jet Route J-93; CA AGENCY... action proposes to amend Jet Route J-93 in California between the Julian VHF Omnidirectional Radio Range... is necessary to realign Jet Route J-93 with the revised location of the Penasco VOR. The Proposal The...

  7. 76 FR 2799 - Amendment of Jet Route J-93; CA

    Science.gov (United States)

    2011-01-18

    ... Administration 14 CFR Part 71 RIN 2120-AA66 Amendment of Jet Route J-93; CA AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action amends Jet Route J-93 in California between...) to amend J-93, (75 FR 66344). Interested parties were invited to participate in this rulemaking...

  8. Vasopressin inhibits LTP in the CA2 mouse hippocampal area.

    Directory of Open Access Journals (Sweden)

    Magda Chafai

    Full Text Available Growing evidence points to vasopressin (AVP as a social behavior regulator modulating various memory processes and involved in pathologies such as mood disorders, anxiety and depression. Accordingly, AVP antagonists are actually envisaged as putative treatments. However, the underlying mechanisms are poorly characterized, in particular the influence of AVP on cellular or synaptic activities in limbic brain areas involved in social behavior. In the present study, we investigated AVP action on the synapse between the entorhinal cortex and CA2 hippocampal pyramidal neurons, by using both field potential and whole-cell recordings in mice brain acute slices. Short application (1 min of AVP transiently reduced the synaptic response, only following induction of long-term potentiation (LTP by high frequency stimulation (HFS of afferent fibers. The basal synaptic response, measured in the absence of HFS, was not affected. The Schaffer collateral-CA1 synapse was not affected by AVP, even after LTP, while the Schaffer collateral-CA2 synapse was inhibited. Although investigated only recently, this CA2 hippocampal area appears to have a distinctive circuitry and a peculiar role in controlling episodic memory. Accordingly, AVP action on LTP-increased synaptic responses in this limbic structure may contribute to the role of this neuropeptide in controlling memory and social behavior.

  9. EST Table: CA946264 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CA946264 KI000001 10/09/28 75 %/192 aa ref|XP_001653815.1| crooked neck protein [Ae...des aegypti] gb|EAT38766.1| crooked neck protein [Aedes aegypti] 10/08/30 73 %/189 aa FBpp0261973|DyakGE1696

  10. Development of electrically insulating CaO coatings

    Energy Technology Data Exchange (ETDEWEB)

    Natesan, K.; Reed, C.B.; Uz, M.; Rink, D.L. [Argonne National Lab., IL (United States)

    1998-09-01

    A systematic study has been initiated to develop electrically insulating CaO coatings by vapor phase transport and by in-situ formation in a liquid Li environment. Several experiments were conducted in vapor transport studies with variations in process temperature, time, specimen location, specimen surface preparation, and pretreatment. Several of the coatings obtained by the method exhibited Ca concentration in the range of 60--95 wt.% on the surface. However, coating thickness has not been very uniform among several samples exposed in the same run or even within the same sample. The coatings developed in these early tests degraded after 24 h exposure to Li at 500 C. Additional experiments are underway to develop better-adhering and more dense coatings by this method. A program to develop in-situ CaO coatings in Li has been initiated, and the first set of capsule tests at 800 C in three different Li-Ca mixtures will be completed in early July. Specimens included in the run are bare V-4Cr-4Ti alloy, specimens with a grit-blasted surface and O-precharged in 99.999% Ar, polished specimens precharged in a 99.999% Ar and 5000 ppm O{sub 2}-N{sub 2} mixture, and prealuminized V-5Cr-5Ti alloy preoxidized in a 5000 ppm O{sub 2}-N{sub 2} mixture. Additional experiments at lower temperatures are planned.

  11. Natural Solution to FraCaS Entailment Problems

    NARCIS (Netherlands)

    Abzianidze, Lasha

    2016-01-01

    Reasoning over several premises is not a common feature of RTE systems as it usually requires deep semantic analysis. On the other hand, FraCaS is a collection of entailment problems consisting of multiple premises and covering semantically challenging phenomena. We employ the tableau theorem prover

  12. Mississippi CaP HBCU Undergraduate Research Training Program

    Science.gov (United States)

    2015-09-01

    TITLE AND SUBTITLE Mississippi CaP HBCU Undergraduate Research Training Program 5a. CONTRACT NUMBER W81XWH-14-1-0151 5b. GRANT NUMBER PC131783... Bacillus bacteria and pediatric brain malignancies. He has been listed as an author on papers from the lab of Dr. Bianca Garner of Tougaloo College

  13. Epithelial Ca2+ and Mg2+ channels in kidney disease.

    NARCIS (Netherlands)

    Thebault, S.C.; Hoenderop, J.G.J.; Bindels, R.J.M.

    2006-01-01

    Many physiological functions rely on the precise maintenance of body calcium (Ca2+) and magnesium (Mg2+) balance, which is tightly regulated by the concerted actions of intestinal absorption, renal reabsorption, and exchange with bone. The kidney plays an important role in the homeostasis of

  14. Suppression of Sleep Spindle Rhythmogenesis in Mice with Deletion of CaV3.2 and CaV3.3 T-type Ca2+ Channels

    Science.gov (United States)

    Pellegrini, Chiara; Lecci, Sandro; Lüthi, Anita; Astori, Simone

    2016-01-01

    Study Objectives: Low-threshold voltage-gated T-type Ca2+ channels (T-channels or CaV3 channels) sustain oscillatory discharges of thalamocortical (TC) and nucleus Reticularis thalami (nRt) cells. The CaV3.3 subtype dominates nRt rhythmic bursting and mediates a substantial fraction of spindle power in the NREM sleep EEG. CaV3.2 channels are also found in nRt, but whether these contribute to nRt-dependent spindle generation is unexplored. We investigated thalamic rhythmogenesis in mice lacking this subtype in isolation (CaV3.2KO mice) or in concomitance with CaV3.3 deletion (CaV3.double-knockout (DKO) mice). Methods: We examined discharge characteristics of thalamic cells and intrathalamic evoked synaptic transmission in brain slices from wild-type, CaV3.2KO and CaV3.DKO mice through patch-clamp recordings. The sleep profile of freely behaving CaV3.2KO and CaV3.DKO mice was assessed by polysomnographic recordings. Results: CaV3.2 channel deficiency left nRt discharge properties largely unaltered, but additional deletion of CaV3.3 channels fully abolished low-threshold whole-cell Ca2+ currents and bursting, and suppressed burst-mediated inhibitory responses in TC cells. CaV3.DKO mice had more fragmented sleep, with shorter NREM sleep episodes and more frequent microarousals. The NREM sleep EEG power spectrum displayed a relative suppression of the σ frequency band (10–15 Hz), which was accompanied by an increase in the δ band (1–4 Hz). Conclusions: Consistent with previous findings, CaV3.3 channels dominate nRt rhythmogenesis, but the lack of CaV3.2 channels further aggravates neuronal, synaptic, and EEG deficits. Therefore, CaV3.2 channels can boost intrathalamic synaptic transmission, and might play a modulatory role adjusting the relative presence of NREM sleep EEG rhythms. Citation: Pellegrini C, Lecci S, Lüthi A, Astori S. Suppression of sleep spindle rhythmogenesis in mice with deletion of Cav3.2 and Cav3.3 T-type Ca2+ channels. SLEEP 2016;39(4):875

  15. Hippocampal area CA2: an emerging modulatory gateway in the hippocampal circuit.

    Science.gov (United States)

    Benoy, Amrita; Dasgupta, Ananya; Sajikumar, Sreedharan

    2018-01-31

    The hippocampus is a critical brain region for the formation of declarative memories. While social memory had long been attributed to be a function of the hippocampus, it is only of late that the area CA2 of the hippocampus was demarcated as essential for social memory formation. In addition to this distinct role, CA2 possesses unique molecular, structural and physiological characteristics compared to the other CA regions-CA1 and CA3, and the dentate gyrus (DG). CA2 pyramidal neurons are positioned at a location between CA1 and CA3, receiving inputs from CA3 and DG, in addition to forming a powerful disynaptic circuit with direct input from the entorhinal cortical layer II neurons. CA2 also receives direct inputs from the hypothalamic regions and displays a unique expression pattern for receptors for neuromodulators. The location, inputs, and molecular signatures of the area CA2 point to the possibility that CA2 serves as a modulatory gateway that processes information from the entorhinal cortex and CA3, before relaying them onto CA1, the major output of the hippocampus. This review discusses recent findings regarding plasticity and neuromodulation in the CA2 region of the hippocampus, and how this may have the potential to influence plasticity in connecting circuits, and thereby memory and behaviour.

  16. Physiological and Pathological Roles of CaMKII-PP1 Signaling in the Brain

    Directory of Open Access Journals (Sweden)

    Norifumi Shioda

    2017-12-01

    Full Text Available Ca2+/calmodulin (CaM-dependent protein kinase II (CaMKII, a multifunctional serine (Ser/threonine (Thr protein kinase, regulates diverse activities related to Ca2+-mediated neuronal plasticity in the brain, including synaptic activity and gene expression. Among its regulators, protein phosphatase-1 (PP1, a Ser/Thr phosphatase, appears to be critical in controlling CaMKII-dependent neuronal signaling. In postsynaptic densities (PSDs, CaMKII is required for hippocampal long-term potentiation (LTP, a cellular process correlated with learning and memory. In response to Ca2+ elevation during hippocampal LTP induction, CaMKIIα, an isoform that translocates from the cytosol to PSDs, is activated through autophosphorylation at Thr286, generating autonomous kinase activity and a prolonged Ca2+/CaM-bound state. Moreover, PP1 inhibition enhances Thr286 autophosphorylation of CaMKIIα during LTP induction. By contrast, CaMKII nuclear import is regulated by Ser332 phosphorylation state. CaMKIIδ3, a nuclear isoform, is dephosphorylated at Ser332 by PP1, promoting its nuclear translocation, where it regulates transcription. In this review, we summarize physio-pathological roles of CaMKII/PP1 signaling in neurons. CaMKII and PP1 crosstalk and regulation of gene expression is important for neuronal plasticity as well as survival and/or differentiation.

  17. CA1 subfield contributions to memory integration and inference

    Science.gov (United States)

    Schlichting, Margaret L.; Zeithamova, Dagmar; Preston, Alison R.

    2014-01-01

    The ability to combine information acquired at different times to make novel inferences is a powerful function of episodic memory. One perspective suggests that by retrieving related knowledge during new experiences, existing memories can be linked to the new, overlapping information as it is encoded. The resulting memory traces would thus incorporate content across event boundaries, representing important relationships among items encountered during separate experiences. While prior work suggests that the hippocampus is involved in linking memories experienced at different times, the involvement of specific subfields in this process remains unknown. Using both univariate and multivariate analyses of high-resolution functional magnetic resonance imaging (fMRI) data, we localized this specialized encoding mechanism to human CA1. Specifically, right CA1 responses during encoding of events that overlapped with prior experience predicted subsequent success on a test requiring inferences about the relationships among events. Furthermore, we employed neural pattern similarity analysis to show that patterns of activation evoked during overlapping event encoding were later reinstated in CA1 during successful inference. The reinstatement of CA1 patterns during inference was specific to those trials that were performed quickly and accurately, consistent with the notion that linking memories during learning facilitates novel judgments. These analyses provide converging evidence that CA1 plays a unique role in encoding overlapping events and highlight the dynamic interactions between hippocampal-mediated encoding and retrieval processes. More broadly, our data reflect the adaptive nature of episodic memories, in which representations are derived across events in anticipation of future judgments. PMID:24888442

  18. Metadata mapping and reuse in caBIG™

    Science.gov (United States)

    Kunz, Isaac; Lin, Ming-Chin; Frey, Lewis

    2009-01-01

    Background This paper proposes that interoperability across biomedical databases can be improved by utilizing a repository of Common Data Elements (CDEs), UML model class-attributes and simple lexical algorithms to facilitate the building domain models. This is examined in the context of an existing system, the National Cancer Institute (NCI)'s cancer Biomedical Informatics Grid (caBIG™). The goal is to demonstrate the deployment of open source tools that can be used to effectively map models and enable the reuse of existing information objects and CDEs in the development of new models for translational research applications. This effort is intended to help developers reuse appropriate CDEs to enable interoperability of their systems when developing within the caBIG™ framework or other frameworks that use metadata repositories. Results The Dice (di-grams) and Dynamic algorithms are compared and both algorithms have similar performance matching UML model class-attributes to CDE class object-property pairs. With algorithms used, the baselines for automatically finding the matches are reasonable for the data models examined. It suggests that automatic mapping of UML models and CDEs is feasible within the caBIG™ framework and potentially any framework that uses a metadata repository. Conclusion This work opens up the possibility of using mapping algorithms to reduce cost and time required to map local data models to a reference data model such as those used within caBIG™. This effort contributes to facilitating the development of interoperable systems within caBIG™ as well as other metadata frameworks. Such efforts are critical to address the need to develop systems to handle enormous amounts of diverse data that can be leveraged from new biomedical methodologies. PMID:19208192

  19. Altered short-term synaptic plasticity and reduced muscle strength in mice with impaired regulation of presynaptic CaV2.1 Ca2+ channels.

    Science.gov (United States)

    Nanou, Evanthia; Yan, Jin; Whitehead, Nicholas P; Kim, Min Jeong; Froehner, Stanley C; Scheuer, Todd; Catterall, William A

    2016-01-26

    Facilitation and inactivation of P/Q-type calcium (Ca(2+)) currents through the regulation of voltage-gated Ca(2+) (CaV) 2.1 channels by Ca(2+) sensor (CaS) proteins contributes to the facilitation and rapid depression of synaptic transmission in cultured neurons that transiently express CaV2.1 channels. To examine the modulation of endogenous CaV2.1 channels by CaS proteins in native synapses, we introduced a mutation (IM-AA) into the CaS protein-binding site in the C-terminal domain of CaV2.1 channels in mice, and tested synaptic facilitation and depression in neuromuscular junction synapses that use exclusively CaV2.1 channels for Ca(2+) entry that triggers synaptic transmission. Even though basal synaptic transmission was unaltered in the neuromuscular synapses in IM-AA mice, we found reduced short-term facilitation in response to paired stimuli at short interstimulus intervals in IM-AA synapses. In response to trains of action potentials, we found increased facilitation at lower frequencies (10-30 Hz) in IM-AA synapses accompanied by slowed synaptic depression, whereas synaptic facilitation was reduced at high stimulus frequencies (50-100 Hz) that would induce strong muscle contraction. As a consequence of altered regulation of CaV2.1 channels, the hindlimb tibialis anterior muscle in IM-AA mice exhibited reduced peak force in response to 50 Hz stimulation and increased muscle fatigue. The IM-AA mice also had impaired motor control, exercise capacity, and grip strength. Taken together, our results indicate that regulation of CaV2.1 channels by CaS proteins is essential for normal synaptic plasticity at the neuromuscular junction and for muscle strength, endurance, and motor coordination in mice in vivo.

  20. Sodium-calcium exchanger and R-type Ca(2+) channels mediate spontaneous [Ca(2+)]i oscillations in magnocellular neurones of the rat supraoptic nucleus.

    Science.gov (United States)

    Kortus, Stepan; Srinivasan, Chinnapaiyan; Forostyak, Oksana; Zapotocky, Martin; Ueta, Yoichi; Sykova, Eva; Chvatal, Alexandr; Verkhratsky, Alexei; Dayanithi, Govindan

    2016-06-01

    Isolated supraoptic neurones generate spontaneous [Ca(2+)]i oscillations in isolated conditions. Here we report in depth analysis of the contribution of plasmalemmal ion channels (Ca(2+), Na(+)), Na(+)/Ca(2+) exchanger (NCX), intracellular Ca(2+) release channels (InsP3Rs and RyRs), Ca(2+) storage organelles, plasma membrane Ca(2+) pump and intracellular signal transduction cascades into spontaneous Ca(2+) activity. While removal of extracellular Ca(2+) or incubation with non-specific voltage-gated Ca(2+) channel (VGCC) blocker Cd(2+) suppressed the oscillations, neither Ni(2+) nor TTA-P2, the T-type VGCC blockers, had an effect. Inhibitors of VGCC nicardipine, ω-conotoxin GVIA, ω-conotoxin MVIIC, ω-agatoxin IVA (for L-, N-, P and P/Q-type channels, respectively) did not affect [Ca(2+)]i oscillations. In contrast, a specific R-type VGCC blocker SNX-482 attenuated [Ca(2+)]i oscillations. Incubation with TTX had no effect, whereas removal of the extracellular Na(+) or application of an inhibitor of the reverse operation mode of Na(+)/Ca(2+) exchanger KB-R7943 blocked the oscillations. The mitochondrial uncoupler CCCP irreversibly blocked spontaneous [Ca(2+)]i activity. Exposure of neurones to Ca(2+) mobilisers (thapsigargin, cyclopiazonic acid, caffeine and ryanodine); 4-aminopyridine (A-type K(+) current blocker); phospholipase C and adenylyl cyclase pathways blockers U-73122, Rp-cAMP, SQ-22536 and H-89 had no effect. Oscillations were blocked by GABA, but not by glutamate, apamin or dynorphin. In conclusion, spontaneous oscillations in magnocellular neurones are mediated by a concerted action of R-type Ca(2+) channels and the NCX fluctuating between forward and reverse modes. Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. Mexican data indicating ca.700 Ma breakup of Rodinia and ca.550 Ma separation of Avalonia: analogous to events in western Laurentia

    Science.gov (United States)

    Keppie, J. D.; Nance, R. D.; Miller, B. V.; Dostal, J.

    2004-05-01

    The supercontinent, Rodinia, appears to have been amalgamated by ca.1 Ga, however, its breakup in Laurentia appears to have occurred in two stages. Current hypotheses suggest that East Gondwana or Siberia separated from western Laurentia at ca.700 Ma followed by separation of (?) South China at ca.550 Ma producing two superposed passive margin sequences. Although prevailing wisdom suggests that the birth of Iapetus between North and South America occurred at ca.550 Ma, a similar 2-stage process is evident in both eastern Laurentia and Mexico. At ca.1 Ga, Mexico appears to have been located in or close to the North-South America suture and so provides crucial data. Geochronological data indicate that cooling following ca.1 Ga granulite facies orogenesis in Mexico followed two different paths. In southern Mexico the rocks initially cooled through ca.450° C at a rate of ca.8° C/my between 978 Ma and 945 Ma related to flat-slab subduction, followed by a cooling rate of ca.2° C/my through ca.150° C. In northern Mexico the rocks cooled at a steady rate of ca.1.8° C/my through ca.300° C and are cut by plume-related mafic dykes. Extrapolating these cooling paths to the surface indicates that southern Mexico reached the surface between 710 and 760 Ma, whereas northern Mexico reached the surface by 550 Ma. This may be partly explained by different depths of exhumation: 30 versus 37 km for southern and northern Mexico, respectively. On the other hand, the oldest rocks resting on the ca.1 Ga basement are Tremadocian (ca.490-480 Ma) in southern Mexico and Middle Silurian (ca.430-425 Ma) in northern Mexico. Thus it would appear that Mexico records two breakup stages: (1) at ca.700 Ma possibly related to the breakup of Rodinia; (2) at ca.550 Ma possibly related to the transcurrent separation of Avalonia followed by thermal equilibration at ca.500 Ma leading to subsidence and development of a passive margin. These data suggest that the breakup of Rodinia occurred at ca.700

  2. Tracking Ca2+-dependent and Ca2+-independent conformational transitions in syntaxin 1A during exocytosis in neuroendocrine cells.

    Science.gov (United States)

    Greitzer-Antes, Dafna; Barak-Broner, Noa; Berlin, Shai; Oron, Yoram; Chikvashvili, Dodo; Lotan, Ilana

    2013-07-01

    A key issue for understanding exocytosis is elucidating the various protein interactions and the associated conformational transitions underlying soluble N-ethylmeleimide-sensitive factor attachment protein receptor (SNARE) protein assembly. To monitor dynamic changes in syntaxin 1A (Syx) conformation along exocytosis, we constructed a novel fluorescent Syx-based probe that can be efficiently incorporated within endogenous SNARE complexes, support exocytosis, and report shifts in Syx between 'closed' and 'open' conformations by fluorescence resonance energy transfer analysis. Using this probe we resolve two distinct Syx conformational transitions during membrane depolarization-induced exocytosis in PC12 cells: a partial 'opening' in the absence of Ca(2+) entry and an additional 'opening' upon Ca(2+) entry. The Ca(2+)-dependent transition is abolished upon neutralization of the basic charges in the juxtamembrane regions of Syx, which also impairs exocytosis. These novel findings provide evidence of two conformational transitions in Syx during exocytosis, which have not been reported before: one transition directly induced by depolarization and an additional transition that involves the juxtamembrane region of Syx. The superior sensitivity of our probe also enabled detection of subtle Syx conformational changes upon interaction with VAMP2, which were absolutely dependent on the basic charges of the juxtamembrane region. Hence, our results further suggest that the Ca(2+)-dependent transition in Syx involves zippering between the membrane-proximal juxtamembrane regions of Syx and VAMP2 and support the recently implied existence of this zippering in the final phase of SNARE assembly to catalyze exocytosis.

  3. Expression of PIK3CA, PTEN mRNA and PIK3CA mutations in primary breast cancer

    DEFF Research Database (Denmark)

    Palimaru, Irina; Brügmann, Anja; Wium-Andersen, Marie Kim

    2013-01-01

    PURPOSE: High activity of the intracellular phosphatidylinositol-3 kinase (PI3K) pathway is common in breast cancer. Here, we explore differences in expression of important PI3K pathway regulators: the activator, phosphatidylinositol-3-kinase catalytic subunit alpha (PIK3CA), and the tumour...

  4. CASK regulates CaMKII autophosphorylation in neuronal growth, calcium signalling and learning

    Directory of Open Access Journals (Sweden)

    John Michael Gillespie

    2013-09-01

    Full Text Available Calcium (Ca2+/calmodulin (CaM-dependent kinase II (CaMKII activity plays a fundamental role in learning and memory. A key feature of CaMKII in memory formation is its ability to be regulated by autophosphorylation, which switches its activity on and off during synaptic plasticity. The synaptic scaffolding protein CASK (calcium (Ca2+/calmodulin (CaM associated serine kinase is also important for learning and memory, as mutations in CASK result in intellectual disability and neurological defects in humans. We show that in Drosophila larvae, CASK interacts with CaMKII to control neuronal growth and calcium signalling. Furthermore, deletion of the CaMK-like and L27 domains of CASK (CASK β null or expression of overactive CaMKII (T287D produced similar effects on synaptic growth and Ca2+ signalling. CASK overexpression rescues the effects of CaMKII overactivity, consistent with the notion that CASK and CaMKII act in a common pathway that controls these neuronal processes. The reduction in Ca2+ signalling observed in the CASK β null mutant caused a decrease in vesicle trafficking at synapses. In addition, the decrease in Ca2+ signalling in CASK mutants was associated with an increase in Ether-à-go-go (EAG potassium (K+ channel localisation to synapses. Reducing EAG restored the decrease in Ca2+ signalling observed in CASK mutants to the level of wildtype, suggesting that CASK regulates Ca2+ signalling via EAG. CASK knockdown reduced both appetitive associative learning and odour evoked Ca2+ responses in Drosophila mushroom bodies, which are the learning centres of Drosophila. Expression of human CASK in Drosophila rescued the effect of CASK deletion on the activity state of CaMKII, suggesting that human CASK may also regulate CaMKII autophosphorylation.

  5. CASK regulates CaMKII autophosphorylation in neuronal growth, calcium signaling, and learning

    Science.gov (United States)

    Gillespie, John M.; Hodge, James J. L.

    2013-01-01

    Calcium (Ca2+)/calmodulin (CaM)-dependent kinase II (CaMKII) activity plays a fundamental role in learning and memory. A key feature of CaMKII in memory formation is its ability to be regulated by autophosphorylation, which switches its activity on and off during synaptic plasticity. The synaptic scaffolding protein CASK (calcium (Ca2+)/calmodulin (CaM) associated serine kinase) is also important for learning and memory, as mutations in CASK result in intellectual disability and neurological defects in humans. We show that in Drosophila larvae, CASK interacts with CaMKII to control neuronal growth and calcium signaling. Furthermore, deletion of the CaMK-like and L27 domains of CASK (CASK β null) or expression of overactive CaMKII (T287D) produced similar effects on synaptic growth and Ca2+ signaling. CASK overexpression rescues the effects of CaMKII overactivity, consistent with the notion that CASK and CaMKII act in a common pathway that controls these neuronal processes. The reduction in Ca2+ signaling observed in the CASK β null mutant caused a decrease in vesicle trafficking at synapses. In addition, the decrease in Ca2+ signaling in CASK mutants was associated with an increase in Ether-à-go-go (EAG) potassium (K+) channel localization to synapses. Reducing EAG restored the decrease in Ca2+ signaling observed in CASK mutants to the level of wildtype, suggesting that CASK regulates Ca2+ signaling via EAG. CASK knockdown reduced both appetitive associative learning and odor evoked Ca2+ responses in Drosophila mushroom bodies, which are the learning centers of Drosophila. Expression of human CASK in Drosophila rescued the effect of CASK deletion on the activity state of CaMKII, suggesting that human CASK may also regulate CaMKII autophosphorylation. PMID:24062638

  6. CaMELS: In silico prediction of calmodulin binding proteins and their binding sites.

    Science.gov (United States)

    Abbasi, Wajid Arshad; Asif, Amina; Andleeb, Saiqa; Minhas, Fayyaz Ul Amir Afsar

    2017-09-01

    Due to Ca 2+ -dependent binding and the sequence diversity of Calmodulin (CaM) binding proteins, identifying CaM interactions and binding sites in the wet-lab is tedious and costly. Therefore, computational methods for this purpose are crucial to the design of such wet-lab experiments. We present an algorithm suite called CaMELS (CalModulin intEraction Learning System) for predicting proteins that interact with CaM as well as their binding sites using sequence information alone. CaMELS offers state of the art accuracy for both CaM interaction and binding site prediction and can aid biologists in studying CaM binding proteins. For CaM interaction prediction, CaMELS uses protein sequence features coupled with a large-margin classifier. CaMELS models the binding site prediction problem using multiple instance machine learning with a custom optimization algorithm which allows more effective learning over imprecisely annotated CaM-binding sites during training. CaMELS has been extensively benchmarked using a variety of data sets, mutagenic studies, proteome-wide Gene Ontology enrichment analyses and protein structures. Our experiments indicate that CaMELS outperforms simple motif-based search and other existing methods for interaction and binding site prediction. We have also found that the whole sequence of a protein, rather than just its binding site, is important for predicting its interaction with CaM. Using the machine learning model in CaMELS, we have identified important features of protein sequences for CaM interaction prediction as well as characteristic amino acid sub-sequences and their relative position for identifying CaM binding sites. Python code for training and evaluating CaMELS together with a webserver implementation is available at the URL: http://faculty.pieas.edu.pk/fayyaz/software.html#camels. © 2017 Wiley Periodicals, Inc.

  7. Mg/Ca and Sr/Ca as novel geochemical proxies for understanding sediment transport processes within coral reefs

    Science.gov (United States)

    Gacutan, J.; Vila-Concejo, A.; Nothdurft, L. D.; Fellowes, T. E.; Cathey, H. E.; Opdyke, B. N.; Harris, D. L.; Hamylton, S.; Carvalho, R. C.; Byrne, M.; Webster, J. M.

    2017-10-01

    Sediment transport is a key driver of reef zonation and biodiversity, where an understanding of sediment dynamics gives insights into past reef processes and allows the prediction of geomorphic responses to changing environmental conditions. However, modal conditions within the back-reef seldom promote sediment transport, hence direct observation is inherently difficult. Large benthic foraminifera (LBF) have previously been employed as 'tracers' to infer sediment transport pathways on coral reefs, as their habitat is largely restricted to the algal flat and post-mortem, their calcium carbonate test is susceptible to sediment transport forces into the back-reef. Foraminiferal test abundance and post-depositional test alteration have been used as proxies for sediment transport, although the resolution of these measures becomes limited by low test abundance and the lack of variation within test alteration. Here we propose the novel use of elemental ratios as a proxy for sediment transport. Two species, Baculogypsina sphaerulata and Calcarina capricornia, were analysed using a taphonomic index within One Tree and Lady Musgrave reefs, Great Barrier Reef (Australia). Inductively coupled plasma-atomic emission spectrometry (ICP-AES) was used to determine Mg/Ca and Sr/Ca and these ratios were compared with taphonomic data. Decreases in test Mg/Ca accompany increases in Sr/Ca in specimens from algal-flat to lagoonal samples in both species, mirroring trends indicated by taphonomic values, therefore indicating a relationship with test alteration. To delineate mechanisms driving changes in elemental ratios, back-scattered electron (BSE) images, elemental mapping and in situ quantitative spot analyses by electron microprobe microanalysis (EPMA) using wavelength dispersive X-ray spectrometers (WDS) were performed on un-altered algal flat and heavily abraded tests for both species. EPMA analyses reveal heterogeneity in Mg/Ca between spines and the test wall, implying the loss of

  8. Synthesis and characterization of calcium beta-diketonate complexes. X-ray crystal and molecular structures of: [{Ca(tmhd)2}2(18-crown-6)], [Ca(dpp)2(thf)2] and [Ca(dpp)2(triglyme)].

    Science.gov (United States)

    El Habra, Naida; Benetollo, Franco; Casarin, Maurizio; Bolzan, Marco; Sartori, Andrea; Rossetto, Gilberto

    2010-09-14

    Reactions of 2,2,6,6-tetramethyl-3,5-heptanedione (Htmhd), 1,1,1,5,5,5-hexafluoro-2,4-pentanedione (Hhfa) or 1,3-diphenyl-1,3-propanedione (Hdpp) with calcium methoxide in hexane or toluene afford the corresponding known oligomeric beta-diketonates: [Ca(3)(tmhd)(6)], [{Ca(hfa)(2)}(n)] and [{Ca(dpp)(2)}(n)]. The complexes react with tetrahydrofuran, 2,5,8,11-tetraoxadodecane (triglyme) or 1,4,7,10,13,16-hexaoxacyclooctadecane (18-crown-6) leading to the formation of the new mononuclear [Ca(dpp)(2)(thf)(2)], [Ca(dpp)(2)(triglyme)] and dinuclear [{Ca(dpp)(2)}(2)(18-crown-6)] and [{Ca(tmhd)(2)}(2)(18-crown-6)] adducts. The obtained complexes were characterized by elemental analyses, IR, (1)H and (13)C NMR spectroscopies; moreover, single crystal X-ray diffraction measurements were also carried out for: [{Ca(tmhd)(2)}(2)(18-crown-6)], [Ca(dpp)(2)(thf)(2)] and [Ca(dpp)(2)(triglyme)].

  9. Ca2+-calmodulin-dependent protein kinase expression and signalling in skeletal muscle during exercise

    DEFF Research Database (Denmark)

    Rose, Adam John; Kiens, Bente; Richter, Erik

    2006-01-01

    Ca2+ signalling is proposed to play an important role in skeletal muscle function during exercise. Here, we examined the expression of multifunctional Ca2+-calmodulin-dependent protein kinases (CaMK) in human skeletal muscle and show that CaMKII and CaMKK, but not CaMKI or CaMKIV, are expressed...... response factor at Ser103, a putative CaMKII substrate, was higher after 30 min of exercise. PLN phosphorylation at Thr17 was higher with increasing exercise intensities. These data indicate that CaMKII is the major multifunctional CaMK in skeletal muscle and its activation occurs rapidly and is sustained...

  10. Mechanisms of involvement in calmodulin in regulation of affinity for Ca/sup 2 +/ and maximum activity of Ca pump of erythrocyte membranes

    Energy Technology Data Exchange (ETDEWEB)

    Orlov, S.N.; Pokudin, N.I.; Sitozhevskii, A.V.

    1986-06-20

    The activity of the Ca pump of inside-out vesicles of human erythrocyte membranes was studied using /sup 45/Ca and membrane filters. It was found that trifluoperazine completely inhibits the increase in the maximum activity of the Ca pump caused by the addition of calmodulin and has no effect on the calmodulin-stimulated increase in the affinity of the Ca pump for Ca/sup 2 +/. A comparison of characteristic curves of the calmodulin-stimulated components of the activity of the Ca pump, inhibited and not inhibited by trifluoperazine, and the fluorescence intensity of N-phenyl-1-naphthylamine in the presence of calmodulin showed that the mechanisms of action of calmodulin on the maximum activity of the Ca pump and its affinity for Ca/sup 2 +/ differ significantly. In the first case the activation was due to the Ca-calmodulin complex and in the second to the calcium-free form of calmodulin. This conclusion is supported by data on the dependence of the activity of the Ca pump on the calmodulin concentration at low and saturating Ca/sup 2 +/ concentrations as well as by the results obtained in the case of moderate treatment of the membranes with trypsin.

  11. Sarco(endo)plasmic reticulum Ca2+ ATPase (SERCA) gene silencing and remodeling of the Ca2+ signaling mechanism in cardiac myocytes.

    Science.gov (United States)

    Seth, M; Sumbilla, C; Mullen, S P; Lewis, D; Klein, M G; Hussain, A; Soboloff, J; Gill, D L; Inesi, G

    2004-11-23

    Transient elevations of cytosolic Ca2+ are a common mechanism of cellular signaling. In striated muscle, the sarco(endo)plasmic reticulum Ca2+ ATPase (SERCA) plays an important role in terminating Ca2+ transients by returning cytosolic Ca2+ to intracellular stores. Stored Ca2+ can then be released again for subsequent signaling. We down-regulated SERCA2 gene expression in cultured cardiac myocytes by means of endogenous transcription of small interfering RNA encoded by an exogenous cDNA template. The cDNA template was delivered by adenovirus vector. Reduction of SERCA expression in all myocytes in culture was documented by immunochemistry, real-time RT-PCR, and determination of ATP-dependent Ca2+ transport. The reduction of SERCA2 expression was associated with the up-regulation of transient receptor potential (TRP) channel proteins (TRPC4 and TRPC5) and Na+/Ca2+ exchanger, indicating that intracellular store deficiency was compensated for by Ca2+ fluxes through the plasma membrane. In fact, SERCA silencing was followed by increased transcription of Na+/Ca2+ exchanger, TRPC4, TRPC5, and related transcriptional factors, such as stimulating protein 1, myocyte enhancer factor 2, and nuclear factor of activated cells 4, through activation of calcineurin. This finding demonstrates that the observed compensation occurs through transcriptional crosstalk and the remodeling of Ca2+ signaling pathways. The wide significance of this regulatory mechanism is related to its general involvement in Ca2+ signaling dynamics and in cardiac development and hypertrophy.

  12. In vitro aging promotes endoplasmic reticulum (ER)-mitochondria Ca2+cross talk and loss of store-operated Ca2+entry (SOCE) in rat hippocampal neurons.

    Science.gov (United States)

    Calvo-Rodríguez, María; García-Durillo, Mónica; Villalobos, Carlos; Núñez, Lucía

    2016-11-01

    Aging is associated to cognitive decline and susceptibility to neuron death, two processes related recently to subcellular Ca 2+ homeostasis. Memory storage relies on mushroom spines stability that depends on store-operated Ca 2+ entry (SOCE). In addition, Ca 2+ transfer from endoplasmic reticulum (ER) to mitochondria sustains energy production but mitochondrial Ca 2+ overload promotes apoptosis. We have addressed whether SOCE and ER-mitochondria Ca 2+ transfer are influenced by culture time in long-term cultures of rat hippocampal neurons, a model of neuronal aging. We found that short-term cultured neurons show large SOCE, low Ca 2+ store content and no functional coupling between ER and mitochondria. In contrast, in long-term cultures reflecting aging neurons, SOCE is essentially lost, Stim1 and Orai1 are downregulated, Ca 2+ stores become overloaded, Ca 2+ release is enhanced, expression of the mitochondrial Ca 2+ uniporter (MCU) increases and most Ca 2+ released from the ER is transferred to mitochondria. These results suggest that neuronal aging is associated to increased ER-mitochondrial cross talking and loss of SOCE. This subcellular Ca 2+ remodeling might contribute to cognitive decline and susceptibility to neuron cell death in the elderly. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. The CaMKII/NMDAR complex as a molecular memory

    Directory of Open Access Journals (Sweden)

    Sanhueza Magdalena

    2013-02-01

    Full Text Available Abstract CaMKII is a major synaptic protein that is activated during the induction of long-term potentiation (LTP by the Ca2+ influx through NMDARs. This activation is required for LTP induction, but the role of the kinase in the maintenance of LTP is less clear. Elucidating the mechanisms of maintenance may provide insights into the molecular processes that underlie the stability of stored memories. In this brief review, we will outline the criteria for evaluating an LTP maintenance mechanism. The specific hypothesis evaluated is that LTP is maintained by the complex of activated CaMKII with the NMDAR. The evidence in support of this hypothesis is substantial, but further experiments are required, notably to determine the time course and persistence of complex after LTP induction. Additional work is also required to elucidate how the CaMKII/NMDAR complex produces the structural growth of the synapse that underlies late LTP. It has been proposed by Frey and Morris that late LTP involves the setting of a molecular tag during LTP induction, which subsequently allows the activated synapse to capture the proteins responsible for late LTP. However, the molecular processes by which this leads to the structural growth that underlies late LTP are completely unclear. Based on known binding reactions, we suggest the first molecularly specific version of tag/capture hypothesis: that the CaMKII/NMDAR complex, once formed, serves as a tag, which then leads to a binding cascade involving densin, delta-catenin, and N-cadherin (some of which are newly synthesized. Delta-catenin binds AMPA-binding protein (ABP, leading to the LTP-induced increase in AMPA channel content. The addition of postsynaptic N-cadherin, and the complementary increase on the presynaptic side, leads to a trans-synaptically coordinated increase in synapse size (and more release sites. It is suggested that synaptic strength is stored stably through the combined actions of the Ca

  14. Cch1p mediates Ca2+ influx to protect Saccharomyces cerevisiae against eugenol toxicity.

    Science.gov (United States)

    Roberts, Stephen K; McAinsh, Martin; Widdicks, Lisa

    2012-01-01

    Eugenol has antifungal activity and is recognised as having therapeutic potential. However, little is known of the cellular basis of its antifungal activity and a better understanding of eugenol tolerance should lead to better exploitation of eugenol in antifungal therapies. The model yeast, Saccharomyces cerevisiae, expressing apoaequorin was used to show that eugenol induces cytosolic Ca(2+) elevations. We investigated the eugenol Ca(2+) signature in further detail and show that exponentially growing cells exhibit Ca(2+) elevation resulting exclusively from the influx of Ca(2+) across the plasma membrane whereas in stationary growth phase cells Ca(2+) influx from intracellular and extracellular sources contribute to the eugenol-induced Ca(2+) elevation. Ca(2+) channel deletion yeast mutants were used to identify the pathways mediating Ca(2+) influx; intracellular Ca(2+) release was mediated by the vacuolar Ca(2+) channel, Yvc1p, whereas the Ca(2+) influx across the plasma membrane could be resolved into Cch1p-dependent and Cch1p-independent pathways. We show that the growth of yeast devoid the plasma membrane Ca(2+) channel, Cch1p, was hypersensitive to eugenol and that this correlated with reduced Ca(2+) elevations. Taken together, these results indicate that a cch1p-mediated Ca(2+) influx is part of an intracellular signal which protects against eugenol toxicity. This study provides fresh insight into the mechanisms employed by fungi to tolerate eugenol toxicity which should lead to better exploitation of eugenol in antifungal therapies.

  15. Cch1p Mediates Ca2+ Influx to Protect Saccharomyces cerevisiae against Eugenol Toxicity

    Science.gov (United States)

    Roberts, Stephen K.; McAinsh, Martin; Widdicks, Lisa

    2012-01-01

    Eugenol has antifungal activity and is recognised as having therapeutic potential. However, little is known of the cellular basis of its antifungal activity and a better understanding of eugenol tolerance should lead to better exploitation of eugenol in antifungal therapies. The model yeast, Saccharomyces cerevisiae, expressing apoaequorin was used to show that eugenol induces cytosolic Ca2+ elevations. We investigated the eugenol Ca2+ signature in further detail and show that exponentially growing cells exhibit Ca2+ elevation resulting exclusively from the influx of Ca2+ across the plasma membrane whereas in stationary growth phase cells Ca2+ influx from intracellular and extracellular sources contribute to the eugenol-induced Ca2+ elevation. Ca2+ channel deletion yeast mutants were used to identify the pathways mediating Ca2+ influx; intracellular Ca2+ release was mediated by the vacuolar Ca2+ channel, Yvc1p, whereas the Ca2+ influx across the plasma membrane could be resolved into Cch1p-dependent and Cch1p-independent pathways. We show that the growth of yeast devoid the plasma membrane Ca2+ channel, Cch1p, was hypersensitive to eugenol and that this correlated with reduced Ca2+ elevations. Taken together, these results indicate that a cch1p-mediated Ca2+ influx is part of an intracellular signal which protects against eugenol toxicity. This study provides fresh insight into the mechanisms employed by fungi to tolerate eugenol toxicity which should lead to better exploitation of eugenol in antifungal therapies. PMID:23028482

  16. [Study on interference effect of Sijunzi decoction on brain-gut CaM/CaMK II of spleen Qi deficiency syndrome rats].

    Science.gov (United States)

    Tian, Rong; Gong, Zi-han; Yang, Xiao-yi; Zhu, Li-ming; Duan, Yong-qiang; Cheng, Ying-xia; Du, Juan; Wang, Yan

    2015-10-01

    To observe the dynamic time-phase expressions of key genes of brain-gut CaM signal pathway of spleen Qi deficiency rats and the intervention effect of Sijunzi decoction. Male Wistar rats were randomly divided into the normal control group, model 14 d, 21 d, 28 d groups, and Sijunzi decoction 14 d, 21 d, 28 d groups. Except for the normal control group, the remaining groups were included into the spleen Qi deficiency model with the bitter cold breaking Qi method (ig 7.5 g · kg⁻¹ · d⁻¹ of Rheum officinale, Fructus aurantii immaturus, Magnolia officinalis preparation) and the exhaustive swimming method. On the 7th day after the modeling, the Sijunzi decoction groups were orally administered with Sijunzi decoction 20 g · kg⁻¹ · d⁻¹. The expressions of key genes CaM/CaMK II of CaM signaling pathway in hippocampus and intestine at different time points by immunohistochemical method and Western blot. At the same time, the intervention effect of Sijunzi decoction on spleen Qi deficiency rats and its mechanism were analyzed. Spleen Qi deficiency rats showed higher intestinal CaM/CaMK II expression and lower hippocampus CaM/CaMK II expression than normal rats (P CaMK II expression and increase in hippocampus CaM/CaMK II expression (P CaMK II in small intestine tissues and its low expression in hippocampus tissues. Sijunzi decoction may achieve the therapeutic effect in spleen Qi deficiency syndrome by reducing the CaM/CaMK II expression in intestinal tissues and increasing it in hippocampus tissues.

  17. Beta-Adrenoceptor Stimulation Reveals Ca2+ Waves and Sarcoplasmic Reticulum Ca2+ Depletion in Left Ventricular Cardiomyocytes from Post-Infarction Rats with and without Heart Failure.

    Directory of Open Access Journals (Sweden)

    Mani Sadredini

    Full Text Available Abnormal cellular Ca2+ handling contributes to both contractile dysfunction and arrhythmias in heart failure. Reduced Ca2+ transient amplitude due to decreased sarcoplasmic reticulum Ca2+ content is a common finding in heart failure models. However, heart failure models also show increased propensity for diastolic Ca2+ release events which occur when sarcoplasmic reticulum Ca2+ content exceeds a certain threshold level. Such Ca2+ release events can initiate arrhythmias. In this study we aimed to investigate if both of these aspects of altered Ca2+ homeostasis could be found in left ventricular cardiomyocytes from rats with different states of cardiac function six weeks after myocardial infarction when compared to sham-operated controls. Video edge-detection, whole-cell Ca2+ imaging and confocal line-scan imaging were used to investigate cardiomyocyte contractile properties, Ca2+ transients and Ca2+ waves. In baseline conditions, i.e. without beta-adrenoceptor stimulation, cardiomyocytes from rats with large myocardial infarction, but without heart failure, did not differ from sham-operated animals in any of these aspects of cellular function. However, when exposed to beta-adrenoceptor stimulation, cardiomyocytes from both non-failing and failing rat hearts showed decreased sarcoplasmic reticulum Ca2+ content, decreased Ca2+ transient amplitude, and increased frequency of Ca2+ waves. These results are in line with a decreased threshold for diastolic Ca2+ release established by other studies. In the present study, factors that might contribute to a lower threshold for diastolic Ca2+ release were increased THR286 phosphorylation of Ca2+/calmodulin-dependent protein kinase II and increased protein phosphatase 1 abundance. In conclusion, this study demonstrates both decreased sarcoplasmic reticulum Ca2+ content and increased propensity for diastolic Ca2+ release events in ventricular cardiomyocytes from rats with heart failure after myocardial

  18. Conditional Deletion of Hippocampal CA2/CA3a Oxytocin Receptors Impairs the Persistence of Long-Term Social Recognition Memory in Mice.

    Science.gov (United States)

    Lin, Yu-Ting; Hsieh, Tsan-Yu; Tsai, Tsung-Chih; Chen, Chien-Chung; Huang, Chiung-Chun; Hsu, Kuei-Sen

    2018-01-31

    Oxytocin (OXT) receptors (OXTRs) are prominently expressed in hippocampal CA2 and CA3 pyramidal neurons, but little is known about its physiological function. As the functional necessity of hippocampal CA2 for social memory processing, we tested whether CA2 OXTRs may contribute to long-term social recognition memory (SRM) formation. Here, we found that conditional deletion of Oxtr from forebrain (Oxtr-/-) or CA2/CA3a-restricted excitatory neurons in adult male mice impaired the persistence of long-term SRM but had no effect on sociability and preference for social novelty. Conditional deletion of CA2/CA3a Oxtr showed no changes in anxiety-like behavior assessed using the open-field, elevated plus maze and novelty-suppressed feeding tests. Application of a highly selective OXTR agonist [Thr4,Gly7]-OXT to hippocampal slices resulted in an acute and lasting potentiation of excitatory synaptic responses in CA2 pyramidal neurons that relied on N-methyl-d-aspartate receptor activation and calcium/calmodulin-dependent protein kinase II activity. In addition, Oxtr-/- mice displayed a defect in the induction of long-term potentiation, but not long-term depression, at the synapses between the entorhinal cortex and CA2 pyramidal neurons. Furthermore, Oxtr deletion led to a reduced complexity of basal dendritic arbors of CA2 pyramidal neurons, but caused no alteration in the density of apical dendritic spines. Considering that the methodologies we have used to delete Oxtr do not rule out targeting the neighboring CA3a region, these findings suggest that OXTR signaling in the CA2/CA3a is crucial for the persistence of long-term SRM.SIGNIFICANCE STATEMENT Oxytocin receptors (OXTRs) are abundantly expressed in hippocampal CA2 and CA3 regions, but there are little known about their physiological function. Taking advantage of the conditional Oxtr knock-out mice, the present study highlights the importance of OXTR signaling in the induction of long-term potentiation at the synapses

  19. Modulation of intracellular calcium waves and triggered activities by mitochondrial ca flux in mouse cardiomyocytes.

    Directory of Open Access Journals (Sweden)

    Zhenghang Zhao

    Full Text Available Recent studies have suggested that mitochondria may play important roles in the Ca(2+ homeostasis of cardiac myocytes. However, it is still unclear if mitochondrial Ca(2+ flux can regulate the generation of Ca(2+ waves (CaWs and triggered activities in cardiac myocytes. In the present study, intracellular/cytosolic Ca(2+ (Cai (2+ was imaged in Fluo-4-AM loaded mouse ventricular myocytes. Spontaneous sarcoplasmic reticulum (SR Ca(2+ release and CaWs were induced in the presence of high (4 mM external Ca(2+ (Cao (2+. The protonophore carbonyl cyanide p-(trifluoromethoxyphenylhydrazone (FCCP reversibly raised basal Cai (2+ levels even after depletion of SR Ca(2+ in the absence of Cao (2+ , suggesting Ca(2+ release from mitochondria. FCCP at 0.01 - 0.1 µM partially depolarized the mitochondrial membrane potential (Δψ m and increased the frequency and amplitude of CaWs in a dose-dependent manner. Simultaneous recording of cell membrane potentials showed the augmentation of delayed afterdepolarization amplitudes and frequencies, and induction of triggered action potentials. The effect of FCCP on CaWs was mimicked by antimycin A (an electron transport chain inhibitor disrupting Δψ m or Ru360 (a mitochondrial Ca(2+ uniporter inhibitor, but not by oligomycin (an ATP synthase inhibitor or iodoacetic acid (a glycolytic inhibitor, excluding the contribution of intracellular ATP levels. The effects of FCCP on CaWs were counteracted by the mitochondrial permeability transition pore blocker cyclosporine A, or the mitochondrial Ca(2+ uniporter activator kaempferol. Our results suggest that mitochondrial Ca(2+ release and uptake exquisitely control the local Ca(2+ level in the micro-domain near SR ryanodine receptors and play an important role in regulation of intracellular CaWs and arrhythmogenesis.

  20. Influences of calcium availability and tree species on Ca isotope fractionation in soil and vegetation

    Science.gov (United States)

    Page, B.D.; Bullen, T.D.; Mitchell, M.J.

    2008-01-01

    The calcium (Ca) isotope system is potentially of great use for understanding biogeochemical processes at multiple scales in forest ecosystems, yet remains largely unexplored for this purpose. In order to further our understanding of Ca behavior in forests, we examined two nearly adjacent hardwood-dominated catchments with differing soil Ca concentrations, developed from crystalline bedrock, to determine the variability of 44Ca/ 40Ca ratios (expressed as ??44Ca) within soil and vegetation pools. For both sugar maple and American beech, the Ca isotope compositions of the measured roots and calculated bulk trees were considerably lighter than those of soil pools at these sites, suggesting that the trees were able to preferentially take up light Ca at the root-soil interface. The Ca isotope compositions of three of four root samples were among the lightest values yet reported for terrestrial materials (??44Ca ???-3.95???). Our results further indicate that Ca isotopes were fractionated along the transpiration streams of both tree species with roots having the least ??44Ca values and leaf litter the greatest. An approximately 2??? difference in ??44Ca values between roots and leaf litter of both tree species suggests a persistent fractionation mechanism along the transpiration stream, likely related to Ca binding in wood tissue coupled with internal ion exchange. Finally, our data indicate that differing tree species demand for Ca and soil Ca concentrations together may influence Ca isotope distribution within the trees. Inter-catchment differences in Ca isotope distributions in soils and trees were minor, indicating that the results of our study may have broad transferability to studies of forest ecosystems in catchments developed on crystalline substrates elsewhere. ?? 2008 Springer Science+Business Media B.V.

  1. Methamphetamine induces a rapid increase of intracellular Ca(++) levels in neurons overexpressing GCaMP5.

    Science.gov (United States)

    Yu, Seong-Jin; Wu, Kou-Jen; Bae, Eun K; Hsu, Man-Jung; Richie, Christopher T; Harvey, Brandon K; Wang, Yun

    2016-03-01

    In this study, methamphetamine (Meth)- and glutamate (Glu)-mediated intracellular Ca(++) (Ca(++) i) signals were examined in real time in primary cortical neurons overexpressing an intracellular Ca(++) probe, GCaMP5, by adeno-associated viral (AAV) serotype 1. Binding of Ca(++) to GCaMP increased green fluorescence intensity in cells. Both Meth and Glu induced a rapid increase in Ca(++) i, which was blocked by MK801, suggesting that Meth enhanced Ca(++) i through Glu receptor in neurons. The Meth-mediated Ca(++) signal was also blocked by Mg(++) , low Ca(++) or the L-type Ca(++) channel inhibitor nifedipine. The ryanodine receptor inhibitor dantrolene did not alter the initial Ca(++) influx but partially reduced the peak of Ca(++) i. These data suggest that Meth enhanced Ca(++) influx through membrane Ca(++) channels, which then triggered the release of Ca(++) from the endoplasmic reticulum in the cytosol. AAV-GCaMP5 was also injected to the parietal cortex of adult rats. Administration of Meth enhanced fluorescence in the ipsilateral cortex. Using immunohistochemistry, Meth-induced green fluorescence was found in the NeuN-containing cells in the cortex, suggesting that Meth increased Ca(++) in neurons in vivo. In conclusion, we have used in vitro and in vivo techniques to demonstrate a rapid increase of Ca(++) i by Meth in cortical neurons through overexpression of GCaMP5. As Meth induces behavioral responses and neurotoxicity through Ca(++) i, modulation of Ca(++) i may be useful to reduce Meth-related reactions. © 2014 Society for the Study of Addiction.

  2. Role of Na+/Ca2+ Exchangers in Therapy Resistance of Medulloblastoma Cells.

    Science.gov (United States)

    Pelzl, Lisann; Hosseinzadeh, Zohreh; Al-Maghout, Tamer; Singh, Yogesh; Sahu, Itishri; Bissinger, Rosi; Schmidt, Sebastian; Alkahtani, Saad; Stournaras, Christos; Toulany, Mahmoud; Lang, Florian

    2017-01-01

    Alterations of cytosolic Ca2+-activity ([Ca2+]i) are decisive in the regulation of tumor cell proliferation, migration and survival. Transport processes participating in the regulation of [Ca2+]i include Ca2+ extrusion through K+-independent (NCX) and/or K+-dependent (NCKX) Na+/Ca2+-exchangers. The present study thus explored whether medulloblastoma cells express Na+/Ca2+-exchangers, whether expression differs between therapy sensitive D283 and therapy resistant UW228-3 medulloblastoma cells, and whether Na+/Ca2+-exchangers participate in the regulation of cell survival. In therapy sensitive D283 and therapy resistant UW228-3 medulloblastoma cells transcript levels were estimated by RT-PCR, protein abundance by Western blotting, cytosolic Ca2+-activity ([Ca2+]i) from Fura-2-fluorescence, Na+/ Ca2+-exchanger activity from the increase of [Ca2+]i (Δ[Ca2+]i) and from whole cell current (Ica) following abrupt replacement of Na+ containing (130 mM) and Ca2+ free by Na+ free and Ca2+ containing (2 mM) extracellular perfusate as well as cell death from PI -staining and annexin-V binding in flow cytometry. The transcript levels of NCX3, NCKX2, and NCKX5, protein abundance of NCX3, slope and peak of Δ[Ca2+]i as well as Ica were significantly lower in therapy sensitive D283 than in therapy resistant UW228-3 medulloblastoma cells. The Na+/Ca2+-exchanger inhibitor KB-R7943 (10 µM) significantly blunted Δ[Ca2+]i, and augmented the ionizing radiation-induced apoptosis but did not significantly modify clonogenicity of medulloblastoma cells. Apoptosis was further enhanced by NCX3 silencing. Na+/Ca2+-exchanger activity significantly counteracts apoptosis but does not significantly affect clonogenicity after radiation of medulloblastoma cells. © 2017 The Author(s). Published by S. Karger AG, Basel.

  3. SNL/CA Facilities Management Design Standards Manual

    Energy Technology Data Exchange (ETDEWEB)

    Rabb, David [Sandia National Lab. (SNL-CA), Livermore, CA (United States); Clark, Eva [Sandia National Lab. (SNL-CA), Livermore, CA (United States)

    2014-12-01

    At Sandia National Laboratories in California (SNL/CA), the design, construction, operation, and maintenance of facilities is guided by industry standards, a graded approach, and the systematic analysis of life cycle benefits received for costs incurred. The design of the physical plant must ensure that the facilities are "fit for use," and provide conditions that effectively, efficiently, and safely support current and future mission needs. In addition, SNL/CA applies sustainable design principles, using an integrated whole-building design approach, from site planning to facility design, construction, and operation to ensure building resource efficiency and the health and productivity of occupants. The safety and health of the workforce and the public, any possible effects on the environment, and compliance with building codes take precedence over project issues, such as performance, cost, and schedule.

  4. Water-bearing, high-pressure Ca-silicates

    Science.gov (United States)

    Németh, Péter; Leinenweber, Kurt; Ohfuji, Hiroaki; Groy, Thomas; Domanik, Kenneth J.; Kovács, István J.; Kovács, Judit S.; Buseck, Peter R.

    2017-07-01

    Water-bearing minerals provide fundamental knowledge regarding the water budget of the mantle and are geophysically significant through their influence on the rheological and seismic properties of Earth's interior. Here we investigate the CaO-SiO2-H2O system at 17 GPa and 1773 K, corresponding to mantle transition-zone condition, report new high-pressure (HP) water-bearing Ca-silicates and reveal the structural complexity of these phases. We document the HP polymorph of hartrurite (Ca3SiO5), post-hartrurite, which is tetragonal with space group P4/ncc, a = 6.820 (5), c = 10.243 (8) Å, V = 476.4 (8) Å3, and Z = 4, and is isostructural with Sr3SiO5. Post-hartrurite occurs in hydrous and anhydrous forms and coexists with larnite (Ca2SiO4), which we find also has a hydrous counterpart. Si is 4-coordinated in both post-hartrurite and larnite. In their hydrous forms, H substitutes for Si (4H for each Si; hydrogrossular substitution). Fourier transform infrared (FTIR) spectroscopy shows broad hydroxyl absorption bands at ∼3550 cm-1 and at 3500-3550 cm-1 for hydrous post-hartrurite and hydrous larnite, respectively. Hydrous post-hartrurite has a defect composition of Ca2.663Si0.826O5H1.370 (5.84 weight % H2O) according to electron-probe microanalysis (EPMA), and the Si deficiency relative to Ca is also observed in the single-crystal data. Hydrous larnite has average composition of Ca1.924Si0.851O4H0.748 (4.06 weight % H2O) according to EPMA, and it is in agreement with the Si occupancy obtained using X-ray data collected on a single crystal. Superlattice reflections occur in electron-diffraction patterns of the hydrous larnite and could indicate crystallographic ordering of the hydroxyl groups and their associated cation defects. Although textural and EPMA-based compositional evidence suggests that hydrous perovskite may occur in high-Ca-containing (or low silica-activity) systems, the FTIR measurement does not show a well-defined hydroxyl absorption band for this

  5. Geoamenazas y vulnerabilidad en Cañas, Guanacaste

    OpenAIRE

    Sánchez Castillo, Sergio

    2003-01-01

    Este artículo se explica en que consiste el Proyecto Piloto de Geoamenazas y Vulnerabilidad, el cual se desarrolla en el cantón de Cañas. Este proyecto es auspiciado y financiado por diferentes organismos internacionales y su ejecución está a cargo de la Comisión Nacional de Prevención de Riesgos y Atención de Emergencias (CNE). Se presentan los aspectos que propiciaron la escogencia del cantón de Cañas: amenaza sísmica, composición de los suelos, amenaza de inundación, base de datos catastra...

  6. Inhibiting the Ca2+ Influx Induced by Human CSF

    Directory of Open Access Journals (Sweden)

    Anna Drews

    2017-12-01

    Full Text Available One potential therapeutic strategy for Alzheimer’s disease (AD is to use antibodies that bind to small soluble protein aggregates to reduce their toxic effects. However, these therapies are rarely tested in human CSF before clinical trials because of the lack of sensitive methods that enable the measurement of aggregate-induced toxicity at low concentrations. We have developed highly sensitive single vesicle and single-cell-based assays that detect the Ca2+ influx caused by the CSF of individuals affected with AD and healthy controls, and we have found comparable effects for both types of samples. We also show that an extracellular chaperone clusterin; a nanobody specific to the amyloid-β peptide (Aβ; and bapineuzumab, a humanized monoclonal antibody raised against Aβ, could all reduce the Ca2+ influx caused by synthetic Aβ oligomers but are less effective in CSF. These assays could be used to characterize potential therapeutic agents in CSF before clinical trials.

  7. A Study of the Superallowed β+ Decay of 38 Ca

    Science.gov (United States)

    Park, H. I.; Hardy, J. C.; Iacob, V. E.; Chen, L.; Goodwin, J.; Hovart, V.; Nica, N.; Trache, L.; Tribble, R. E.

    2011-04-01

    To test the unitarity of the CKM matrix via precise measurements of superallowed 0+ -->0+ nuclear β+ decay, accurate calculations of small nuclear-structure-dependent corrections are essential. Currently, uncertainties in these calculations are comparable to the present level of experimental precision. However, these theoretical uncertainties can, in principle, be reduced by experiment. 38 Ca is a particularly favorable case for this purpose because its nuclear-structure-dependent correction term is calculated to be one of the largest in the sd shell [1]. We report our measured half-life to be 443.88(36) ms and the first preliminary results from a branching-ratio measurement. Combined with the well-known QEC value [1,2], these two results will ultimately lead to a precise F t value for 38 Ca, and a valuable test of the calculated nuclear- structure-dependent correction term.

  8. Development and dissipation of Ca(2+) gradients in adrenal chromaffin cells.

    Science.gov (United States)

    Marengo, F D; Monck, J R

    2000-01-01

    We used pulsed laser imaging to measure the development and dissipation of Ca(2+) gradients evoked by the activation of voltage-sensitive Ca(2+) channels in adrenal chromaffin cells. Ca(2+) gradients appeared rapidly (buffer capacity on the order of 1000 and appropriate affinity and kinetics, approximated the size of the Ca(2+) increases and rate of dissipation of the measured gradients. Finally, simulations without exogenous buffer suggest that the Ca(2+) signal due to Ca(2+) channel activation is restricted by the endogenous buffer to a space less than 1 microm from the cell membrane. PMID:11023887

  9. CO2 capture performance of Ca-Mg acetates at realistic Calcium Looping conditions

    OpenAIRE

    Miranda-Pizarro, Juan; Perejón, Antonio; Valverde, J.M.; Pérez-Maqueda, Luis A.; Sánchez-Jiménez, P.E.

    2017-01-01

    The Calcium Looping (CaL) process, based on the cyclic carbonation/calcination of CaO, has emerged in the last years as a potentially low cost technique for CO2 capture at reduced energy penalty. In the present work, natural limestone and dolomite have been pretreated with diluted acetic acid to obtain Ca and Ca-Mg mixed acetates, whose CO2 capture performance has been tested at CaL conditions that necessarily imply sorbent regeneration under high CO2 partial pressure. The CaL multicycle capt...

  10. Structures of pure and Ca-segregated MgO (001) surfaces

    CERN Document Server

    Yanfa, Y; Pennycook, S J; Pantelides, S T

    1999-01-01

    The structures of pure and Ca-segregated MgO (001) surfaces have been studied using first-principles density functional theory. The relaxation and rumpling for the pure surface are found to be 0.48 and 1.62, respectively. Ca segregation significantly modifies the surface structure. The surface-segregated Ca atoms protrude outwards owing to the size mismatch between Ca and Mg. Consequently, their nearest neighbor oxygen atoms are pulled up. The value of the protrusion of Ca atoms is strongly dependent on the Ca coverage of the surface. (18 refs).

  11. Optical spectroscopy of Ca3Sc2Si3O12, Ca3Y2Si3O12 and Ca3Lu2Si3O12 doped with Pr3+

    NARCIS (Netherlands)

    Ivanovskikh, K.|info:eu-repo/dai/nl/311489605; Meijerink, A.|info:eu-repo/dai/nl/075044986; Piccinelli, F.; Speghini, A.; Zenin, E.I.; Ronda, R.C.; Bettinelli, M.

    2010-01-01

    The silicates Ca3Sc2Si3O12, Ca3Y2Si3O12 and Ca3Lu2Si3O12, both undoped and doped with Pr3+ ions, have been synthesized by solid-state reaction at high temperature. The luminescence spectroscopy and the excited state dynamics of the materials have been studied upon VUV and X-ray excitation using

  12. CA-074Me Protection against Anthrax Lethal Toxin▿

    OpenAIRE

    Zachary L Newman; Stephen H Leppla; Moayeri, Mahtab

    2009-01-01

    Anthrax lethal toxin (LT) activates the NLRP1b (NALP1b) inflammasome and caspase-1 in macrophages from certain inbred mouse strains, but the mechanism by which this occurs is poorly understood. We report here that similar to several NLRP3 (NALP3, cryopyrin)-activating stimuli, LT activation of the NLRP1b inflammasome involves lysosomal membrane permeabilization (LMP) and subsequent cytoplasmic cathepsin B activity. CA-074Me, a potent cathepsin B inhibitor, protects LT-sensitive macrophages fr...

  13. SELECTIVE TRANSFORMATIONS OF THE CA-2+ PUMP INHIBITOR THAPSIGARGIN

    DEFF Research Database (Denmark)

    Andersen, A.; Cornett, Claus; Lauridsen, A.

    1994-01-01

    The importance of the sesquiterpene lactone thapsigargin as a tool for studying Ca2+ homeostasis has created a need for structure-activity relationship studies and consequently for procedures for selective transformations of the functional groups in the molecule. Methods for the selective inversi...... of configuration at C-3 and C-8, selective acetylation, and selective cleavage of the ester groups at 0-3, 0-8 and 0-10 are presented....

  14. The definitive guide to the C&A transformation process

    CERN Document Server

    Mehan, Julie E

    2009-01-01

    'The Definitive Guide to the C&A Transformation' is the first comprehensive manual that sets out to explain the current standards and best practices. The book provides all the information needed to recognize, implement and manage the relevant authorization requirements, and therefore to achieve compliance with federal, local and agency laws and policies. Each chapter not only provides a list of related references but also offers recommendations for additional reading.

  15. Mora y Cañas en familia

    OpenAIRE

    Obando Cairol, Emilio Gerardo

    2013-01-01

    Se desarrollan y comentan las genealogías descendentes del expresidenteJuan Rafael Mora Porras y el general José María Cañas Escamilla, héroes de la Campaña Nacional. Aparte de su valor histórico y genealógico, se pretende que, al reconocerse como tales, los descendientes de estos genearcas se sientan orgullosos de su ancestría

  16. ASnO/sub 3/ (A=Ca,Sr) perovskites

    Energy Technology Data Exchange (ETDEWEB)

    Vegas, A.; Vallet-Regi, M.; Gonzalez-Calbet, J.M.; Alario-Franco, M.A.

    1986-04-01

    The crystal structures of the perovskites ASnO/sub 3/(A=Ca, Sr) have been solved. CaSnO/sub 3/: Msub(T)=206.77, orthorhombic, Pbnm, a=5.532(2), b=5.681(2), c=7.906(2) A, V=248.46(8) A/sup 3/, Z=4, Dsub(x)=5.52 Mg m/sup -3/, lambda(Mo K..cap alpha..)=0.7107 A, ..mu..(Mo K..cap alpha..)=11.3 mm/sup -1/, F(000)=376, T=295 K. Its structure was refined from 381 (346 observed) X-ray single-crystal data to R=0.026. SrSnO/sub 3/ single crystals, previously reported as cubic (a=8.0682 A), were studied by electron microscopy and X-ray techniques, showing the presence of multitwinning which gives rise to the fictitious ''double'' cubic cell. The real cell has a=5.707(2), b=5.707(2), c=8.064(2) A, V=262.64(8) A/sup 3/, Z=4, Dsub(x)=6.43 Mg m/sup -3/, Msub(T)=254.31, T=295 K, and probably the same space group as CaSnO/sub 3/. Because of the twin, the structure was solved topologically, by a novel use of the expressions given by O'Keeffe and Hyde by assuming an Sn-O bond length of 2.062 A, equal to that derived for CaSnO/sub 3/.

  17. Concentration of Ca in blood of amateur runners using NAA

    Science.gov (United States)

    Kovacs, L.; Zamboni, C. B.; Metairon, S.; Nunes, L. A. S.; Lourenço, T. F.; Macedo, D. V.

    2013-05-01

    In this study the Ca levels were determined in amateur runners blood at LABEX (Laboratório de Bioquímica do Exercício - UNICAMP, Brazil), using Neutron Activation Analyses (NAA) technique. The range established at rest (162 - 410 mgL-1) when compared with control group (51 - 439 mgL-1) suggests that there is a dependency of these limits in the function of the adopted physical training.

  18. Concentration of Ca in blood of amateur runners using NAA

    Energy Technology Data Exchange (ETDEWEB)

    Kovacs, L.; Zamboni, C. B.; Metairon, S. [Instituto de Pesquisas Energeticas e Nucleares (IPEN / CNEN - SP) - Centro do Reator de Pesquisas Av. Professor Lineu Prestes, 2242 - 05508-000 Sao Paulo, SP (Brazil); Nunes, L. A. S.; Lourenco, T. F.; Macedo, D. V. [Universidade Estadual de Campinas - UNICAMP - Laboratorio de Bioquimica do Exercicio - LABEX Cidade Universitaria 13083-970 - Campinas, SP Brazil - Caixa-Postal: 6109 (Brazil)

    2013-05-06

    In this study the Ca levels were determined in amateur runners blood at LABEX (Laboratorio de Bioquimica do Exercicio - UNICAMP, Brazil), using Neutron Activation Analyses (NAA) technique. The range established at rest (162 - 410 mgL{sup -1}) when compared with control group (51 - 439 mgL{sup -1}) suggests that there is a dependency of these limits in the function of the adopted physical training.

  19. Component geochronology in the polyphase ca. 3920 Ma Acasta Gneiss

    Science.gov (United States)

    Mojzsis, Stephen J.; Cates, Nicole L.; Caro, Guillaume; Trail, Dustin; Abramov, Oleg; Guitreau, Martin; Blichert-Toft, Janne; Hopkins, Michelle D.; Bleeker, Wouter

    2014-01-01

    The oldest compiled U–Pb zircon ages for the Acasta Gneiss Complex in the Northwest Territories of Canada span about 4050–3850 Ma; yet older ca. 4200 Ma xenocrystic U–Pb zircon ages have also been reported for this terrane. The AGC expresses at least 25 km2 of outcrop exposure, but only a small subset of this has been documented in the detail required to investigate a complex history and resolve disputes over emplacement ages. To better understand this history, we combined new ion microprobe235,238U–207,206Pb zircon geochronology with whole-rock and zircon rare earth element compositions ([REE]zirc), Ti-in-zircon thermometry (Tixln) and 147Sm–143Nd geochronology for an individual subdivided ∼60 cm2 slab of Acasta banded gneiss comprising five separate lithologic components. Results were compared to other variably deformed granitoid-gneisses and plagioclase-hornblende rocks from elsewhere in the AGC. We show that different gneissic components carry distinct [Th/U]zirc vs. Tixln and [REE]zirc signatures correlative with different zircon U–Pb age populations and WR compositions, but not with 147Sm–143Nd isotope systematics. Modeled  [REE] from lattice-strain theory reconciles only the ca. 3920 Ma zircons with the oldest component that also preserves strong positive Eu∗ anomalies. Magmas which gave rise to the somewhat older (inherited) ca. 4020 Ma AGC zircon age population formed at ∼IW (iron–wüstite) to ca. 3920 Ma emplacement age for the AGC is contemporaneous with bombardment of the inner solar system. Analytical bombardment simulations show that crustal re-working from the impact epoch potentially affected the precursors to the Acasta gneisses.

  20. The CaSSIS imaging system: optical performance overview

    Science.gov (United States)

    Gambicorti, L.; Piazza, D.; Pommerol, A.; Roloff, V.; Gerber, M.; Ziethe, R.; El-Maarry, M. R.; Weigel, T.; Johnson, M.; Vernani, D.; Pelo, E.; Da Deppo, V.; Cremonese, G.; Ficai Veltroni, I.; Thomas, N.

    2016-07-01

    The Colour and Stereo Surface Imaging System (CaSSIS) is the high-resolution scientific imager on board the European Space Agency's (ESA) ExoMars Trace Gas Orbiter (TGO) which was launched on 14th March 2016 to Mars. CaSSIS will observe the Martian surface from an altitude of 400 km with an optical system based on a modified TMA telescope (Three Mirrors Anastigmatic configuration) with a 4th powered folding mirror. The camera EPD (Entrance Pupil Diameter) is 135 mm, and the expected focal length is 880 mm, giving an F# 6.5 in the wavelength range of 400- 1100 nm with a distortion designed to be less than 2%. CaSSIS will operate in a "push-frame" mode with a monolithic Filter Strip Assembly (FSA) produced by Optics Balzers Jena GmbH selecting 4 colour bands and integrated on the focal plane by Leonardo-Finmeccanica SpA (under TAS-I responsibility). The detector is a spare of the Simbio-Sys detector of the Italian Space Agency (ASI), developed by Raytheon Vision Systems. It is a 2kx2k hybrid Si-PIN array with a 10 μm pixel pitch. A scale of 4.6 m/px from the nominal orbit is foreseen to produce frames of 9.4 km × 47 km on the Martian surface. The University of Bern was in charge of the full instrument integration as well as the characterization of the focal plane and calibration of the entire instrument. The paper will present an overview of the CaSSIS telescope and FPA optical performance. The preliminary results of on-ground calibration and the first commissioning campaign (April 2016) will be described.

  1. CEE/CA: Report calls for decriminalization of sex work.

    Science.gov (United States)

    Betteridge, Glenn

    2006-04-01

    In December 2005, the Central and Eastern European Harm Reduction Network (CEEHRN) released a report calling for the decriminalization of sex work in the 27 countries of Central and Eastern Europe and Central Asia (CEE/CA). The report brings together a wealth of published and original information concerning sex work, laws regulating sex work, epidemiological data regarding HIV and other sexually transmitted infections (STIs), services available to sex workers, and human rights abuses faced by sex workers.

  2. Archaeological Study of CA-VEN-110, Ventura, California.

    Science.gov (United States)

    1986-01-01

    near the north end of Las Virgenes Creek in Calabasas, and perhaps in the Thousand Oaks area (Foster and Greenwood 1985:16). Hematite, as found at CA...District. Edberg, Bob E. 1982 Ethnohistoric and Historic Overview of Talepop and the Rancho Las Virgenes . In Archaeological Investigations at TalepoD (LAN...Qrbinula alascanus x Guadalupe fur seal -Arctocenhalus townsend1 x Northern elephant seal - Mioug angustirostris x Whales - Cetacea x Porpoises

  3. CA 2025: the strategic design of Civil Affairs

    OpenAIRE

    Hayes, Samuel L., Jr.; Nguyen, Ken

    2015-01-01

    Approved for public release; distribution is unlimited The goal of this capstone is the strategic redesign of the U.S. Army Civil Affairs (CA) Regiment in 2025 in support of the Army 2025 strategic vision. Design Thinking is the process used to plan and develop this strategic design. The authors led a twenty-person Civil Affairs design team through the five-phase process of Design Thinking adapted from the Stanford D School model: discovery; problem framing; ideation; prototyping; and test...

  4. A dynamic model of interactions of Ca2+, calmodulin, and catalytic subunits of Ca2+/calmodulin-dependent protein kinase II.

    Directory of Open Access Journals (Sweden)

    Shirley Pepke

    2010-02-01

    Full Text Available During the acquisition of memories, influx of Ca2+ into the postsynaptic spine through the pores of activated N-methyl-D-aspartate-type glutamate receptors triggers processes that change the strength of excitatory synapses. The pattern of Ca2+influx during the first few seconds of activity is interpreted within the Ca2+-dependent signaling network such that synaptic strength is eventually either potentiated or depressed. Many of the critical signaling enzymes that control synaptic plasticity,including Ca2+/calmodulin-dependent protein kinase II (CaMKII, are regulated by calmodulin, a small protein that can bindup to 4 Ca2+ ions. As a first step toward clarifying how the Ca2+-signaling network decides between potentiation or depression, we have created a kinetic model of the interactions of Ca2+, calmodulin, and CaMKII that represents our best understanding of the dynamics of these interactions under conditions that resemble those in a postsynaptic spine. We constrained parameters of the model from data in the literature, or from our own measurements, and then predicted time courses of activation and autophosphorylation of CaMKII under a variety of conditions. Simulations showed that species of calmodulin with fewer than four bound Ca2+ play a significant role in activation of CaMKII in the physiological regime,supporting the notion that processing of Ca2+ signals in a spine involves competition among target enzymes for binding to unsaturated species of CaM in an environment in which the concentration of Ca2+ is fluctuating rapidly. Indeed, we showed that dependence of activation on the frequency of Ca2+ transients arises from the kinetics of interaction of fluctuating Ca2+with calmodulin/CaMKII complexes. We used parameter sensitivity analysis to identify which parameters will be most beneficial to measure more carefully to improve the accuracy of predictions. This model provides a quantitative base from which to build more complex dynamic

  5. Broadband set-top box using MAP-CA processor

    Science.gov (United States)

    Bush, John E.; Lee, Woobin; Basoglu, Chris

    2001-12-01

    Advances in broadband access are expected to exert a profound impact in our everyday life. It will be the key to the digital convergence of communication, computer and consumer equipment. A common thread that facilitates this convergence comprises digital media and Internet. To address this market, Equator Technologies, Inc., is developing the Dolphin broadband set-top box reference platform using its MAP-CA Broadband Signal ProcessorT chip. The Dolphin reference platform is a universal media platform for display and presentation of digital contents on end-user entertainment systems. The objective of the Dolphin reference platform is to provide a complete set-top box system based on the MAP-CA processor. It includes all the necessary hardware and software components for the emerging broadcast and the broadband digital media market based on IP protocols. Such reference design requires a broadband Internet access and high-performance digital signal processing. By using the MAP-CA processor, the Dolphin reference platform is completely programmable, allowing various codecs to be implemented in software, such as MPEG-2, MPEG-4, H.263 and proprietary codecs. The software implementation also enables field upgrades to keep pace with evolving technology and industry demands.

  6. Ultrasonic Investigations on Polonides of Ba, Ca, and Pb

    Science.gov (United States)

    Singh, Devraj; Bhalla, Vyoma; Bala, Jyoti; Wadhwa, Shikha

    2017-10-01

    The temperature-dependent mechanical and ultrasonic properties of barium, calcium, and lead polonides (BaPo, CaPo, and PbPo) were investigated in the temperature range 100-300 K. The second- and third-order elastic constants (SOECs and TOECs) were computed using Coulomb and Born-Mayer potential and these in turn have been used to estimate other secondary elastic properties such as strength, anisotropy, microhardness, etc. The theoretical approach followed the prediction that BaPo, CaPo, and PbPo are brittle in nature. PbPo is found to be the hardest amongst the chosen compounds. Further the SOECs and TOECs are applied to determine ultrasonic velocities, Debye temperature, and acoustic coupling constants along , , and orientations at room temperature. Additionally thermal conductivity has been computed using Morelli and Slack's approach along different crystallographic directions at room temperature. Finally ultrasonic attenuation due to phonon-phonon interaction and thermoelastic relaxation mechanisms has been computed for BaPo, CaPo, and PbPo. The behaviour of these compounds is similar to that of semi-metals with thermal relaxation time of the order 10-11 s. The present computation study is reasonably in agreement with the available theoretical data for the similar type of materials.

  7. Mutational profiling reveals PIK3CA mutations in gallbladder carcinoma

    Directory of Open Access Journals (Sweden)

    Bardeesy Nabeel

    2011-02-01

    Full Text Available Abstract Background The genetics of advanced biliary tract cancers (BTC, which encompass intra- and extra-hepatic cholangiocarcinomas as well as gallbladder carcinomas, are heterogeneous and remain to be fully defined. Methods To better characterize mutations in established known oncogenes and tumor suppressor genes we tested a mass spectrometric based platform to interrogate common cancer associated mutations across a panel of 77 formalin fixed paraffin embedded archived BTC cases. Results Mutations among three genes, KRAS, NRAS and PIK3CA were confirmed in this cohort. Activating mutations in PIK3CA were identified exclusively in GBC (4/32, 12.5%. KRAS mutations were identified in 3 (13% intra-hepatic cholangiocarcinomas and 1 (33% perihillar cholangiocarcinoma but were not identified in gallbladder carcinomas and extra-hepatic cholangiocarcinoma. Conclusions The presence of activating mutations in PIK3CA specifically in GBC has clinical implications in both the diagnosis of this cancer type, as well as the potential utility of targeted therapies such as PI3 kinase inhibitors.

  8. Active transport of Ca2+ by an artificial photosynthetic membrane.

    Science.gov (United States)

    Bennett, Ira M; Farfano, Hebe M Vanegas; Bogani, Federica; Primak, Alex; Liddell, Paul A; Otero, Luis; Sereno, Leonides; Silber, Juana J; Moore, Ana L; Moore, Thomas A; Gust, Devens

    2002-11-28

    Transport of calcium ions across membranes and against a thermodynamic gradient is essential to many biological processes, including muscle contraction, the citric acid cycle, glycogen metabolism, release of neurotransmitters, vision, biological signal transduction and immune response. Synthetic systems that transport metal ions across lipid or liquid membranes are well known, and in some cases light has been used to facilitate transport. Typically, a carrier molecule located in a symmetric membrane binds the ion from aqueous solution on one side and releases it on the other. The thermodynamic driving force is provided by an ion concentration difference between the two aqueous solutions, coupling to such a gradient in an auxiliary species, or photomodulation of the carrier by an asymmetric photon flux. Here we report a different approach, in which active transport is driven not by concentration gradients, but by light-induced electron transfer in a photoactive molecule that is asymmetrically disposed across a lipid bilayer. The system comprises a synthetic, light-driven transmembrane Ca2+ pump based on a redox-sensitive, lipophilic Ca2+-binding shuttle molecule whose function is powered by an intramembrane artificial photosynthetic reaction centre. The resulting structure transports calcium ions across the bilayer of a liposome to develop both a calcium ion concentration gradient and a membrane potential, expanding Mitchell's concept of a redox loop mechanism for protons to include divalent cations. Although the quantum yield is relatively low (approximately 1 per cent), the Ca2+ electrochemical potential developed is significant.

  9. Regulation of CaMKII signaling in cardiovascular disease

    Directory of Open Access Journals (Sweden)

    Mariya Yordanova Mollova

    2015-08-01

    Full Text Available Heart failure (HF is a major cause of death in the developed countries. (Murray and Lopez, 1996;Koitabashi and Kass, 2012. Adverse cardiac remodeling that precedes heart muscle dysfunction is characterized by a myriad of molecular changes affecting the cardiomyocyte. Among these, alterations in protein kinase pathways play often an important mediator role since they link upstream pathologic stress signaling with downstream regulatory programs and thus affect both the structural and functional integrity of the heart muscle. In the context of cardiac disease, a profound understanding for the overriding mechanisms that regulate protein kinase activity (protein-protein interactions, post-translational modifications, or targeting via anchoring proteins is crucial for the development of specific and effective pharmacological treatment strategies targeting the failing myocardium.In this review, we focus on several mechanisms of upstream regulation of Ca2+/Calmodulin-dependent kinase II (CaM Kinase II, CaMKII that play a relevant pathophysiological role in the development and progression of cardiovascular disease; precise targeting of these mechanisms might therefore represent novel and promising tools for prevention and treatment of HF.

  10. Ion microprobe assessment of the heterogeneity of Mg/Ca, Sr/Ca and Mn/Ca ratios in Pecten maximus and Mytilus edulis (bivalvia shell calcite precipitated at constant temperature

    Directory of Open Access Journals (Sweden)

    P. S. Freitas

    2009-07-01

    Full Text Available Small-scale heterogeneity of biogenic carbonate elemental composition can be a significant source of error in the accurate use of element/Ca ratios as geochemical proxies. In this study ion microprobe (SIMS profiles showed significant small-scale variability of Mg/Ca, Sr/Ca and Mn/Ca ratios in new shell calcite of the marine bivalves Pecten maximus and Mytilus edulis that was precipitated during a constant-temperature culturing experiment. Elevated Mg/Ca, Sr/Ca and Mn/Ca ratios were found to be associated with the deposition of elaborate shell features, i.e. a shell surface stria in P. maximus and surface shell disturbance marks in both species, the latter a common occurrence in bivalve shells. In both species the observed small-scale elemental heterogeneity most likely was not controlled by variable transport of ions to the extra-pallial fluid, but by factors such as the influence of shell organic content and/or crystal size and orientation, the latter reflecting conditions at the shell crystal-solution interface. In the mid and innermost regions of the P. maximus shell the lack of significant small-scale variation of Mg/Ca ratios, which is consistent with growth at constant temperature, suggest a potential application as a palaeotemperature proxy. Cross-growth band element/Ca ratio profiles in the interior of bivalve shells may provide more promising palaeo-environmental tools than sampling from the outer region of bivalve shells.

  11. Excitation-contraction coupling in zebrafish ventricular myocardium is regulated by trans-sarcolemmal Ca2+ influx and sarcoplasmic reticulum Ca2+ release.

    Science.gov (United States)

    Haustein, Moritz; Hannes, Tobias; Trieschmann, Jan; Verhaegh, Rabea; Köster, Annette; Hescheler, Jürgen; Brockmeier, Konrad; Adelmann, Roland; Khalil, Markus

    2015-01-01

    Zebrafish (Danio rerio) have become a popular model in cardiovascular research mainly due to identification of a large number of mutants with structural defects. In recent years, cardiomyopathies and other diseases influencing contractility of the heart have been studied in zebrafish mutants. However, little is known about the regulation of contractility of the zebrafish heart on a tissue level. The aim of the present study was to elucidate the role of trans-sarcolemmal Ca(2+)-flux and sarcoplasmic reticulum Ca(2+)-release in zebrafish myocardium. Using isometric force measurements of fresh heart slices, we characterised the effects of changes of the extracellular Ca(2+)-concentration, trans-sarcolemmal Ca(2+)-flux via L-type Ca(2+)-channels and Na(+)-Ca(2+)-exchanger, and Ca(2+)-release from the sarcoplasmic reticulum as well as beating frequency and β-adrenergic stimulation on contractility of adult zebrafish myocardium. We found an overall negative force-frequency relationship (FFR). Inhibition of L-type Ca(2+)-channels by verapamil (1 μM) decreased force of contraction to 22 ± 7% compared to baseline (n=4, pmyocardium (n=5, pmyocardium requires not only trans-sarcolemmal Ca2+-flux, but also intact sarcoplasmic reticulum Ca(2+)-cycling. In contrast to mammals, FFR is strongly negative in the zebrafish heart. These aspects need to be considered when using zebrafish to model human diseases of myocardial contractility.

  12. Activity-Dependent Phosphorylation by CaMKIIδ Alters the Ca2+ Affinity of the Multi-C2-Domain Protein Otoferlin

    Directory of Open Access Journals (Sweden)

    Sandra Meese

    2017-10-01

    Full Text Available Otoferlin is essential for fast Ca2+-triggered transmitter release from auditory inner hair cells (IHCs, playing key roles in synaptic vesicle release, replenishment and retrieval. Dysfunction of otoferlin results in profound prelingual deafness. Despite its crucial role in cochlear synaptic processes, mechanisms regulating otoferlin activity have not been studied to date. Here, we identified Ca2+/calmodulin-dependent serine/threonine kinase II delta (CaMKIIδ as an otoferlin binding partner by pull-downs from chicken utricles and reassured interaction by a co-immunoprecipitation with heterologously expressed proteins in HEK cells. We confirmed the expression of CaMKIIδ in rodent IHCs by immunohistochemistry and real-time PCR. A proximity ligation assay indicates close proximity of the two proteins in rat IHCs, suggesting that otoferlin and CaMKIIδ also interact in mammalian IHCs. In vitro phosphorylation of otoferlin by CaMKIIδ revealed ten phosphorylation sites, five of which are located within C2-domains. Exchange of serines/threonines at phosphorylated sites into phosphomimetic aspartates reduces the Ca2+ affinity of the recombinant C2F domain 10-fold, and increases the Ca2+ affinity of the C2C domain. Concordantly, we show that phosphorylation of otoferlin and/or its interaction partners are enhanced upon hair cell depolarization and blocked by pharmacological CaMKII inhibition. We therefore propose that otoferlin activity is regulated by CaMKIIδ in IHCs.

  13. A sequential vesicle pool model with a single release sensor and a ca(2+)-dependent priming catalyst effectively explains ca(2+)-dependent properties of neurosecretion

    DEFF Research Database (Denmark)

    Walter, Alexander M; da Silva Pinheiro, Paulo César; Verhage, Matthijs

    2013-01-01

    Neurotransmitter release depends on the fusion of secretory vesicles with the plasma membrane and the release of their contents. The final fusion step displays higher-order Ca(2+) dependence, but also upstream steps depend on Ca(2+). After deletion of the Ca(2+) sensor for fast release - synaptot......Neurotransmitter release depends on the fusion of secretory vesicles with the plasma membrane and the release of their contents. The final fusion step displays higher-order Ca(2+) dependence, but also upstream steps depend on Ca(2+). After deletion of the Ca(2+) sensor for fast release...... identified. We here propose a Sequential Pool Model (SPM), assuming a novel Ca(2+)-dependent action: a Ca(2+)-dependent catalyst that accelerates both forward and reverse priming reactions. While both models account for fast fusion from the Readily-Releasable Pool (RRP) under control of synaptotagmin-1...... that the elusive 'alternative Ca(2+) sensor' for slow release might be the upstream priming catalyst, and that a sequential model effectively explains Ca(2+)-dependent properties of secretion without assuming parallel pools or sensors....

  14. The effects of prenatal stress on expression of CaMK-II and L-Ca2+ channel in offspring hippocampus.

    Science.gov (United States)

    Cai, Qing; Zhang, Boli; Huang, Shuyun; Wang, Tao; Zhou, Tao

    2011-08-01

    The purpose of the present study was to characterize the expressions of phosphorylated Ca(2+)/calmodulin-dependent protein kinase II (p-CaMK-II), total CaMK-II, and L-type Ca(2+) channel in offspring hippocampus that was induced by prenatal restraint stress. Pregnant rats were divided into two groups: the control group and the prenatal stress (PNS) group. Pregnant rats in the PNS group were exposed to restraint stress on day 14-20 of pregnancy three times daily for 45 min. Adult offspring rats were used in this study. The results demonstrated that prenatal restraint stress induced a significant increase in the expression of p-CaMK-II, total CaMK-II, and L-Ca(2+) channel by western blot analysis in offspring hippocampus. The immunohistochemistry results revealed that PNS increased the expressions of CaMK-II and L-Ca(2+) channel in the hippocampal CA3 of offspring rats. These data suggest that PNS can have long-term neuronal effects within hippocampal structure involved in the feedback mechanisms of the hypothalamo-pituitary-adrenal axis.

  15. Basidiomycete-specific PsCaMKL1 encoding a CaMK-like protein kinase is required for full virulence of Puccinia striiformis f. sp. tritici.

    Science.gov (United States)

    Jiao, Min; Yu, Dan; Tan, Chenglong; Guo, Jia; Lan, Dingyun; Han, Ershang; Qi, Tuo; Voegele, Ralf Thomas; Kang, Zhensheng; Guo, Jun

    2017-10-01

    Calcium/calmodulin-dependent kinases (CaMKs) are Ser/Thr protein kinases (PKs) that respond to changes in cytosolic free Ca(2+) and play diverse roles in eukaryotes. In fungi, CAMKs are generally classified into four families CAMK1, CAMKL, RAD53 and CAMK-Unique. Among these, CAMKL constitutes the largest family. In some fungal plant pathogens, members of the CaMKL family have been shown to be responsible for pathogenesis. However, little is known about their role(s) in rust fungi. In this study, we functionally characterized a novel PK gene, PsCaMKL1, from Puccinia striiformis f. sp. tritici (Pst). PsCaMKL1 belongs to a group of PKs that is evolutionarily specific to basidiomyceteous fungi. PsCaMKL1 shows little intra-species polymorphism between Pst isolates. PsCaMKL1 transcripts are highly elevated at early infection stages, whereas gene expression is downregulated in barely germinated urediospores under KN93 treatment. Overexpression of PsCaMKL1 in fission yeast increased resistance to environmental stresses. Knock down of PsCaMKL1 using host-induced gene silencing (HIGS) reduced the virulence of Pst accompanied by reactive oxygen species (ROS) accumulation and a hypersensitive response. These results suggest that PsCaMKL1 is a novel pathogenicity factor that exerts it virulence function by regulating ROS production in wheat. © 2017 Society for Applied Microbiology and John Wiley & Sons Ltd.

  16. Capsicum annuum transcription factor WRKYa positively regulates defense response upon TMV infection and is a substrate of CaMK1 and CaMK2.

    Science.gov (United States)

    Huh, Sung Un; Lee, Gil-Je; Jung, Ji Hoon; Kim, Yunsik; Kim, Young Jin; Paek, Kyung-Hee

    2015-01-23

    Plants are constantly exposed to pathogens and environmental stresses. To minimize damage caused by these potentially harmful factors, plants respond by massive transcriptional reprogramming of various stress-related genes via major transcription factor families. One of the transcription factor families, WRKY, plays an important role in diverse stress response of plants and is often useful to generate genetically engineered crop plants. In this study, we carried out functional characterization of CaWRKYa encoding group I WRKY member, which is induced during hypersensitive response (HR) in hot pepper (Capsicum annuum) upon Tobacco mosaic virus (TMV) infection. CaWRKYa was involved in L-mediated resistance via transcriptional reprogramming of pathogenesis-related (PR) gene expression and affected HR upon TMV-P0 infection. CaWRKYa acts as a positive regulator of this defense system and could bind to the W-box of diverse PR genes promoters. Furthermore, we found Capsicum annuum mitogen-activated protein kinase 1 (CaMK1) and 2 (CaMK2) interacted with CaWRKYa and phosphorylated the SP clusters but not the MAPK docking (D)-domain of CaWRKYa. Thus, these results demonstrated that CaWRKYa was regulated by CaMK1 and CaMK2 at the posttranslational level in hot pepper.

  17. Investigation on hydration resistance of CaO added MgO clinker; CaO tenka MgO clinker no taishokasei no kento

    Energy Technology Data Exchange (ETDEWEB)

    Kaneyasu, A.; Arita, Y.; Yoshida, A.; Watanabe, T. [Ube Material Industries Ltd., Yamaguchi (Japan)

    1998-09-01

    In general, magnesia (MgO) has high melting point and has good dehydration resistance, however, it has minus property such as low spall resistance and slag penetrates easily. Therefore, MgO-CaO clinkers combined with the calcium oxide (CaO) having high melting point and better slag penetration resistance are used in the MgO-CaO bricks or dolomite bricks and so forth. However, MgO-CaO refractory has problem of hydration resistance de to the content of free CaO. The authors have been carried out constant research regarding the MgO-CaO clinker containing free CaO and reported firstly as a raw material of MgO, that the magnesium hydroxide containing iron was effective for achieving high bulk density and further, reported the high hydration resistance MgO-CaO clinker formed by combining TiO2 addition and phosphate coating. In this report, study of burning characteristics, hydration resistance properties and so forth of go clinker containing 20 to 5 mass % CaO revealed that MgO clinker showed similar hydration resistance in spite of containing free CaO. 2 refs., 11 figs., 2 tabs.

  18. Ca2+/calmodulin-dependent protein kinase II-γ (CaMKIIγ) negatively regulates vascular smooth muscle cell proliferation and vascular remodeling

    Science.gov (United States)

    Saddouk, Fatima Z.; Sun, Li-Yan; Liu, Yong Feng; Jiang, Miao; Singer, Diane V.; Backs, Johannes; Van Riper, Dee; Ginnan, Roman; Schwarz, John J.; Singer, Harold A.

    2016-01-01

    Vascular smooth muscle (VSM) expresses calcium/calmodulin-dependent protein kinase II (CaMKII)-δ and -γ isoforms. CaMKIIδ promotes VSM proliferation and vascular remodeling. We tested CaMKIIγ function in vascular remodeling after injury. CaMKIIγ protein decreased 90% 14 d after balloon injury in rat carotid artery. Intraluminal transduction of adenovirus encoding CaMKIIγC rescued expression to 35% of uninjured controls, inhibited neointima formation (>70%), inhibited VSM proliferation (>60%), and increased expression of the cell-cycle inhibitor p21 (>2-fold). Comparable doses of CaMKIIδ2 adenovirus had no effect. Similar dynamics in CaMKIIγ mRNA and protein expression were observed in ligated mouse carotid arteries, correlating closely with expression of VSM differentiation markers. Targeted deletion of CaMKIIγ in smooth muscle resulted in a 20-fold increase in neointimal area, with a 3-fold increase in the cell proliferation index, no change in apoptosis, and a 60% decrease in p21 expression. In cultured VSM, CaMKIIγ overexpression induced p53 mRNA (1.7 fold) and protein (1.8-fold) expression; induced the p53 target gene p21 (3-fold); decreased VSM cell proliferation (>50%); and had no effect on expression of apoptosis markers. We conclude that regulated CaMKII isoform composition is an important determinant of the injury-induced vasculoproliferative response and that CaMKIIγ and -δ isoforms have nonequivalent, opposing functions.—Saddouk, F. Z., Sun, L.-Y., Liu, Y. F., Jiang, M., Singer, D. V., Backs, J., Van Riper, D., Ginnan, R., Schwarz, J. J., Singer, H. A. Ca2+/calmodulin-dependent protein kinase II-γ (CaMKIIγ) negatively regulates vascular smooth muscle cell proliferation and vascular remodeling. PMID:26567004

  19. Inhibition of the sarcoplasmic reticulum Ca2+ pump with thapsigargin to estimate the contribution of Na+-Ca2+ exchange to ventricular myocyte relaxation

    Directory of Open Access Journals (Sweden)

    Bassani R.A.

    2003-01-01

    Full Text Available Relaxation in the mammalian ventricle is initiated by Ca2+ removal from the cytosol, which is performed by three main transport systems: sarcoplasmic reticulum Ca2+-ATPase (SR-A, Na+-Ca2+ exchanger (NCX and the so-called slow mechanisms (sarcolemmal Ca2+-ATPase and mitochondrial Ca2+ uptake. To estimate the relative contribution of each system to twitch relaxation, SR Ca2+ accumulation must be selectively inhibited, usually by the application of high caffeine concentrations. However, caffeine has been reported to often cause changes in membrane potential due to NCX-generated inward current, which compromises the reliability of its use. In the present study, we estimated integrated Ca2+ fluxes carried by SR-A, NCX and slow mechanisms during twitch relaxation, and compared the results when using caffeine application (Cf-NT and an electrically evoked twitch after inhibition of SR-A with thapsigargin (TG-TW. Ca2+ transients were measured in 20 isolated adult rat ventricular myocytes with indo-1. For transients in which one or more transporters were inhibited, Ca2+ fluxes were estimated from the measured free Ca2+ concentration and myocardial Ca2+ buffering characteristics. NCX-mediated integrated Ca2+ flux was significantly higher with TG-TW than with Cf-NT (12 vs 7 µM, whereas SR-dependent flux was lower with TG-TW (77 vs 81 µM. The relative participations of NCX (12.5 vs 8% with TG-TW and Cf-NT, respectively and SR-A (85 vs 89.5% with TG-TW and Cf-NT, respectively in total relaxation-associated Ca2+ flux were also significantly different. We thus propose TG-TW as a reliable alternative to estimate NCX contribution to twitch relaxation in this kind of analysis.

  20. In vitro degradation and cytotoxicity of Mg/Ca composites produced by powder metallurgy.

    Science.gov (United States)

    Zheng, Y F; Gu, X N; Xi, Y L; Chai, D L

    2010-05-01

    Mg/Ca (1 wt.%, 5 wt.%, 10 wt.% Ca) composites were prepared from pure magnesium and calcium powders using the powder metallurgy method, aiming to enlarge the addition of Ca content without the formation of Mg(2)Ca. The microstructures, mechanical properties and cytotoxicities of Mg/Ca composite samples were investigated. The corrosion of Mg/Ca composites in Dulbecco's modified Eagle's medium (DMEM) for various immersion intervals was studied by electrochemical impedance spectroscopy measurements and environmental scanning electron microscope, with the concentrations of released Mg and Ca ions in DMEM for various immersion time intervals being measured. It was shown that the main constitutional phases were Mg and Ca, which were uniformly distributed in the Mg matrix. The ultimate tensile strength (UTS) and elongation of experimental composites decreased with increasing Ca content, and the UTS of Mg/1Ca composite was comparable with that of as-extruded Mg-1Ca alloy. The corrosion potential increased with increasing Ca content, whereas the current density and the impedance decreased. It was found that the protective surface film formed quickly at the initial immersion stage. With increasing immersion time, the surface film became compact, and the corrosion rate of Mg/Ca composites slowed down. The surface film consisted mainly of CaCO(3), MgCO(3)x3H(2)O, HA and Mg(OH)(2) after 72 h immersion in DMEM. Mg/1Ca and Mg/5Ca composite extracts had no significant toxicity (p>0.05) to L-929 cells, whereas Mg/10Ca composite extract induced approximately 40% reduced cell viability. Copyright (c) 2009 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  1. Behavior of Ca(2+) waves in multicellular preparations from guinea pig ventricle.

    Science.gov (United States)

    Kurebayashi, Nagomi; Yamashita, Haruyo; Nakazato, Yuji; Daida, Hiroyuki; Ogawa, Yasuo

    2004-12-01

    Ca(+) waves have been implicated in Ca(2+) overload-induced cardiac arrhythmias. To deepen understanding of the behavior of Ca(2+) waves in a multicellular system, consecutive two-dimensional Ca(2+) images were obtained with a confocal microscope from surface cells of guinea pig ventricular papillary muscles loaded with fluo 3 or rhod 2. In intact muscles, no Ca(2+) waves were detected under the resting condition, whereas they were frequently observed during the rest immediately after high-frequency stimulations where cytoplasmic Ca(2+) concentration and Ca(2+) stored in the sarcoplasmic reticulum (SR) were gradually decreasing. The intervals of Ca(2+) waves increased as they occurred later, their amplitudes and velocities remaining unchanged. A SERCA inhibitor reversibly prolonged the wave intervals. In Na(+)-free/Ca(2+)-free medium where neither Ca(2+) influx nor Na(+)/Ca(2+) exchange took place, recurrent Ca(2+) waves emerged at constant intervals in each cell. These results are consistent with the conclusion that the loading level of the SR is critical for induction of Ca(2+) waves. Each cell independently exhibited its own regular rhythm of Ca(2+) wave with a distinct interval. These waves propagated in either direction along the longitudinal axis within a muscle cell, but seldom beyond the cell boundary. In contrast, in partially damaged muscles that showed spontaneous Ca(2+) waves at rest in normal Krebs solution, their propagation often was unidirectional, decreasing in frequency. In these cases, however, Ca(2+) waves rarely moved beyond the cellular boundary. The gradient of the cytoplasmic Ca(2+) concentration was suggested to be the cause of the one-way propagation.

  2. Variable luminal sarcoplasmic reticulum Ca(2+) buffer capacity in smooth muscle cells.

    Science.gov (United States)

    Dagnino-Acosta, Adán; Guerrero-Hernández, Agustín

    2009-09-01

    Sarcoplasmic reticulum contains the internal Ca(2+) store in smooth muscle cells and its lumen appears to be a continuum that lacks diffusion barriers. Accordingly, the free luminal Ca(2+) level is the same all throughout the SR; however, whether the Ca(2+) buffer capacity is the same in all the SR is unknown. We have estimated indirectly the luminal Ca(2+) buffer capacity of the SR by comparing the reduction in SR Ca(2+) levels with the corresponding increase in [Ca(2+)](i) during activation of either IP(3)Rs with carbachol or RyRs with caffeine, in smooth muscle cells from guinea pig urinary bladder. We have determined that carbachol-sensitive SR has a 2.4 times larger Ca(2+) buffer capacity than caffeine-sensitive SR. Rapid inhibition of SERCA pumps with thapsigargin revealed that this pump activity accounts for 80% and 60% of the Ca(2+) buffer capacities of carbachol- and caffeine-sensitive SR, respectively. Moreover, the Ca(2+) buffer capacity of carbachol-sensitive SR was similar to caffeine-sensitive SR when SERCA pumps were inhibited. Similar rates of Ca(2+) replenishments suggest similar levels of SERCA pump activities for either carbachol- or caffeine-sensitive SR. Paired pulses of caffeine, in conditions of low Ca(2+) influx, indicate the relevance of luminal SR Ca(2+) buffer capacity in the [Ca(2+)](i) response. To further study the importance of luminal SR Ca(2+) buffer capacity in the release process we used low levels of heparin to partially inhibit IP(3)Rs. This condition revealed carbachol-induced transient increase of luminal SR Ca(2+) levels provided that SERCA pumps were active. It thus appears that SERCA pump activity keeps the luminal SR Ca(2+)-binding proteins in the high-capacity, low-affinity conformation, particularly for IP(3)R-mediated Ca(2+) release.

  3. Functional expression of T-type Ca2+ channels in spinal motoneurons of the adult turtle.

    Directory of Open Access Journals (Sweden)

    Martha Canto-Bustos

    Full Text Available Voltage-gated Ca2+ (CaV channels are transmembrane proteins comprising three subfamilies named CaV1, CaV2 and CaV3. The CaV3 channel subfamily groups the low-voltage activated Ca2+ channels (LVA or T-type a significant role in regulating neuronal excitability. CaV3 channel activity may lead to the generation of complex patterns of action potential firing such as the postinhibitory rebound (PIR. In the adult spinal cord, these channels have been found in dorsal horn interneurons where they control physiological events near the resting potential and participate in determining excitability. In motoneurons, CaV3 channels have been found during development, but their functional expression has not yet been reported in adult animals. Here, we show evidence for the presence of CaV3 channel-mediated PIR in motoneurons of the adult turtle spinal cord. Our results indicate that Ni2+ and NNC55-0396, two antagonists of CaV3 channel activity, inhibited PIR in the adult turtle spinal cord. Molecular biology and biochemical assays revealed the expression of the CaV3.1 channel isotype and its localization in motoneurons. Together, these results provide evidence for the expression of CaV3.1 channels in the spinal cord of adult animals and show also that these channels may contribute to determine the excitability of motoneurons.

  4. Effect of carticaine on the sarcoplasmic reticulum Ca2+-adenosine triphosphatase. II. Cations dependence.

    Science.gov (United States)

    Takara, Delia; Sánchez, Gabriel A; Toma, Augusto F; Bonazzola, Patricia; Alonso, Guillermo L

    2005-05-01

    Ca2+-ATPase is a major intrinsic protein in the sarcoplasmic reticulum (SR) from skeletal muscles. It actively transports Ca2+ from the cytoplasm to the SR lumen, reducing cytoplasmic [Ca2+] to promote muscle relaxation. Carticaine is a local anesthetic widely used in operative dentistry. We previously showed that carticaine inhibits SR Ca2+-ATPase activity and the coupled Ca(2+) uptake by isolated SR vesicles, and increases the rate of Ca2+ efflux from preloaded vesicles. We also found that these effects were antagonized by divalent cations, and concluded that they were mainly due to the direct interaction of carticaine with the Ca2+-ATPase protein. Here we present additional results on the modulation of the above effects of carticaine by Ca2+ and Mg2+. The activating effect of Ca2+ on the ATPase activity is competitively inhibited by carticaine, indicating a decreased Ca2+ binding to the high affinity Ca2+ transport sites. The activating effect of Mg2+ on the phosphorylation of Ca2+-ATPase by orthophosphate is also inhibited by carticaine. The anesthetic does not affect the reaction mechanism of the cations acting as cofactors of ATP in the catalytic site. On the basis of the present and our previous results, we propose a model that describes the effect of carticaine on the Ca2+-ATPase cycle.

  5. A CaMK cascade activates CRE-mediated transcription in neurons of Caenorhabditis elegans

    Science.gov (United States)

    Kimura, Yoshishige; Corcoran, Ethan E.; Eto, Koh; Gengyo-Ando, Keiko; Muramatsu, Masa-aki; Kobayashi, Ryoji; Freedman, Jonathan H.; Mitani, Shohei; Hagiwara, Masatoshi; Means, Anthony R.; Tokumitsu, Hiroshi

    2002-01-01

    Calcium (Ca2+) signals regulate a diverse set of cellular responses, from proliferation to muscular contraction and neuro-endocrine secretion. The ubiquitous Ca2+ sensor, calmodulin (CaM), translates changes in local intracellular Ca2+ concentrations into changes in enzyme activities. Among its targets, the Ca2+/CaM-dependent protein kinases I and IV (CaMKs) are capable of transducing intraneuronal signals, and these kinases are implicated in neuronal gene regulation that mediates synaptic plasticity in mammals. Recently, the cyclic AMP response element binding protein (CREB) has been proposed as a target for a CaMK cascade involving not only CaMKI or CaMKIV, but also an upstream kinase kinase that is also CaM regulated (CaMKK). Here, we report that all components of this pathway are coexpressed in head neurons of Caenorhabditis elegans. Utilizing a transgenic approach to visualize CREB-dependent transcription in vivo, we show that this CaMK cascade regulates CRE-mediated transcription in a subset of head neurons in living nematodes. PMID:12231504

  6. Stimulation-induced Ca(2+) influx at nodes of Ranvier in mouse peripheral motor axons.

    Science.gov (United States)

    Zhang, Zhongsheng; David, Gavriel

    2016-01-01

    In peripheral myelinated axons of mammalian spinal motor neurons, Ca(2+) influx was thought to occur only in pathological conditions such as ischaemia. Using Ca(2+) imaging in mouse large motor axons, we find that physiological stimulation with trains of action potentials transiently elevates axoplasmic [C(2+)] around nodes of Ranvier. These stimulation-induced [Ca(2+)] elevations require Ca(2+) influx, and are partially reduced by blocking T-type Ca(2+) channels (e.g. mibefradil) and by blocking the Na(+)/Ca(2+) exchanger (NCX), suggesting an important contribution of Ca(2+) influx via reverse-mode NCX activity. Acute disruption of paranodal myelin dramatically increases stimulation-induced [Ca(2+)] elevations around nodes by allowing activation of sub-myelin L-type (nimodipine-sensitive) Ca(2+) channels. The Ca(2+) that enters myelinated motor axons during normal activity is likely to contribute to several signalling pathways; the larger Ca(2+) influx that occurs following demyelination may contribute to the axonal degeneration that occurs in peripheral demyelinating diseases. Activity-dependent Ca(2+) signalling is well established for somata and terminals of mammalian spinal motor neurons, but not for their axons. Imaging of an intra-axonally injected fluorescent [Ca(2+)] indicator revealed that during repetitive action potential stimulation, [Ca(2+)] elevations localized to nodal regions occurred in mouse motor axons from ventral roots, phrenic nerve and intramuscular branches. These [Ca(2+)] elevations (∼ 0.1 μm with stimulation at 50 Hz, 10 s) were blocked by removal of Ca(2+) from the extracellular solution. Effects of pharmacological blockers indicated contributions from both T-type Ca(2+) channels and reverse mode Na(+)/Ca(2+) exchange (NCX). Acute disruption of paranodal myelin (by stretch or lysophosphatidylcholine) increased the stimulation-induced [Ca(2+)] elevations, which now included a prominent contribution from L-type Ca(2+) channels. These

  7. Characterization of CaSn(OH6 and CaSnO3 Nanostructures Synthesized by a New Precursor

    Directory of Open Access Journals (Sweden)

    S. Moshtaghi

    2015-04-01

    Full Text Available In this paper, calcium stannate nanoparticles were synthesized by a fast and simple co-precipitation procedure. For CaSnO3 preparation ammonia was used as precipitation agent. The effect of various surfactants such as cationic, anionic and neutral on the morphology of the products was investigated. By changing in Ca(Sal2 as a new precursor different morphologies were obtained. Ligand as a capping agent with steric hindrance leads to preparation of product with lower particle size. These semiconductor nanostructures have photo-catalyst activities and can degrade organic dyes as water pollution. The synthesized materials were characterized by X-ray diffraction (XRD technique, scanning electron microscopy (SEM Fourier transform infrared (FT-IR and UV-visible spectroscopy.

  8. Size and receptor density of glutamatergic synapses: a viewpoint from left-right asymmetry of CA3-CA1 connections

    Directory of Open Access Journals (Sweden)

    Yoshiaki Shinohara

    2009-07-01

    Full Text Available Synaptic plasticity is considered to be the main mechanism for learning and memory. Excitatory synapses in the cerebral cortex and hippocampus undergo plastic changes during development and in response to electric stimulation. It is widely accepted that this process is mediated by insertion and elimination of various glutamate receptors. In a series of recent investigations on left-right asymmetry of hippocampal CA3-CA1 synapses, glutamate receptor subunits have been found to have distinctive expression patterns that depend on the postsynaptic density (PSD area. Particularly notable are the GluR1 AMPA receptor subunit and NR2B NMDA receptor subunit, where receptor density has either a supra-linear (GluR1 AMPA or inverse (NR2B NMDAR relationship to the PSD area. We review current understanding of structural and physiological synaptic plasticity and propose a scheme to classify receptor subtypes by their expression pattern with respect to PSD area.

  9. Heat recovery from a thermal energy storage based on the Ca(OH){sub 2}/CaO cycle

    Energy Technology Data Exchange (ETDEWEB)

    Azpiazu, M.N. [E.T.S. Ingenieros, Bilbao (Spain). Dpto. de Ingenieria Quimica y del Medio Ambiente; Morquillas, J.M. [E.T.S. Ingenieros, Bilbao (Spain). Dpto. de Maquinas y Motores Termicos; Vazquez, A. [E.S. da Marina Civil, La Coruna (Spain). Dpto. de Energia y Propulsion Maritima

    2003-04-01

    Thermal energy storage is very important in many applications related to the use of waste heat from industrial processes, renewable energies or from other sources. Thermochemical storage is very interesting for long-term storage as it can be carried out at room temperature with no energy losses. Dehydration/hydration cycle of Ca(OH){sub 2}/CaO has been applied for thermal energy storage in two types of reactors. One of them was a prototype designed by the authors, and in the other type conventional laboratory glassware was used. Parameters such as specific heats, reaction rate and enthalpy, mass losses and heat release were monitored during cycles. Although in the hydration step water is normally added in vapour phase, liquid water, at 0{sup o}C has been used in these experiences. Results indicated that the energy storage system performance showed no significant differences, when we compared several hydration/dehydration cycles. The selected chemical reaction did not exhibit a complete reversibility because complete Ca(OH){sub 2} dehydration, was not achieved. However the system could be used satisfactorily along 20 cycles at least. Heat recovery experiments showed general system behaviour during the hydration step in both types of reactors. The designed prototype was more efficient in this step. Main conclusions suggested carrying out one complete cycle at a higher dehydration temperature to recover total system reversibility. A modification of the prototype design trying to enhance heat transfer from the Ca(OH){sub 2} bed could also be proposed. (author)

  10. CA2+-DEPENDENT AND CA2+-INDEPENDENT MECHANISM OF CYCLIC-AMP REDUCTION - MEDIATION BY BRADYKININ B-2 RECEPTORS

    NARCIS (Netherlands)

    SIPMA, H; DENHERTOG, A; NELEMANS, A

    1 Bradykinin caused a transient reduction of about 25% in the cyclic AMP level in forskolin prestimulated DDT1 MF-2 smooth muscle cells (IC50: 36.4 +/- 4.9 nM) and a pronounced, sustained inhibition (40%) of the isoprenaline-stimulated cyclic AMP level (IC50: 37.5 +/- 1.1 nM). 2 The Ca2+ ionophore,

  11. Ca2+-independent and Ca2+/GTP-binding protein-controlled exocytosis in a plant cell

    OpenAIRE

    Homann, Ulrike; Tester, Mark

    1997-01-01

    Exocytosis allows the release of secretory products and the delivery of new membrane material to the plasma membrane. So far, little is known about the underlying molecular mechanism and its control in plant cells. We have used the whole-cell patch-clamp technique to monitor changes in membrane capacitance to study exocytosis in barley aleurone protoplasts. To investigate the involvement of Ca2+ and GTP-binding proteins in exocytosis, protoplasts were dialyzed with very low (

  12. Phospholipase C-η1 is activated by intracellular Ca(2+) mobilization and enhances GPCRs/PLC/Ca(2+) signaling.

    Science.gov (United States)

    Kim, Jung Kuk; Choi, Jung Woong; Lim, Seyoung; Kwon, Ohman; Seo, Jeong Kon; Ryu, Sung Ho; Suh, Pann-Ghill

    2011-06-01

    Phospholipase C-η1 (PLC-η1) is the most recently identified PLC isotype and is primarily expressed in nerve tissue. However, its functional role is unclear. In the present study, we report for the first time that PLC-η1 acts as a signal amplifier in G protein-coupled receptor (GPCR)-mediated PLC and Ca(2+) signaling. Short-hairpin RNA (shRNA)-mediated knockdown of endogenous PLC-η1 reduced lysophosphatidic acid (LPA)-, bradykinin (BK)-, and PACAP-induced PLC activity in mouse neuroblastoma Neuro2A (N2A) cells, indicating that PLC-η1 participates in GPCR-mediated PLC activation. Interestingly, ionomycin-induced PLC activity was significantly decreased by PLC-η1, but not PLC-η2, knockdown. In addition, we found that intracellular Ca(2+) source is enough for PLC-η1 activation. Furthermore, the IP(3) receptor inhibitor, 2-APB, inhibited LPA-induced PLC activity in control N2A cells, whereas this effect was not observed in PLC-η1 knockdown N2A cells, suggesting a pivotal role of intracellular Ca(2+) mobilization in PLC-η1 activation. Finally, we found that LPA-induced ERK1/2 phosphorylation and expression of the downstream target gene, krox-24, were significantly decreased by PLC-η1 knockdown, and these knockdown effects were abolished by 2-APB. Taken together, our results strongly suggest that PLC-η1 is activated via intracellular Ca(2+) mobilization from the ER, and therefore amplifies GPCR-mediated signaling. Copyright © 2010 Elsevier Inc. All rights reserved.

  13. Development of a moving bed pilot plant for thermochemical energy storage with CaO/Ca(OH)2

    Science.gov (United States)

    Schmidt, Matthias; Gollsch, Marie; Giger, Franz; Grün, Manfred; Linder, Marc

    2016-05-01

    Thermochemical energy storage, for instance with Ca(OH)2, offers high energy densities at low material costs and could therefore be a promising storage alternative for CSP-plants. Yet, due to the low thermal conductivity of the Ca(OH)2 material large storage capacities operated in an indirectly heated fixed bed also require large heat exchangers. In other words the fixed bed concept somehow opposes one of the main advantages of Ca(OH)2, its low material costs. One approach to overcome this issue is to detach the costly reactor with the heat exchanger (power) from the storage material (capacity). This can be accomplished by a moving bed concept where the material moves through the reactor. Therefore a novel moving bed pilot plant was developed within the consortium of the European project TCS Power. The pilot plant was set into operation and revealed important information about the material flow through the reactor and the operation strategy of a moving bed concept.

  14. Structural Properties of Human CaMKII Ca2+ /Calmodulin-Dependent Protein Kinase II using X-ray Crystallography

    Science.gov (United States)

    Cao, Yumeng Melody; McSpadden, Ethan; Kuriyan, John; Department of Molecular; Cell Biology; Department of Chemistry Team

    To this day, human memory storage remains a mystery as we can at most describe the process vaguely on a cellular level. Switch-like properties of Calcium/Calmodulin-Dependent Protein Kinase II make it a leading candidate in understanding the molecular basis of human memory. The protein crystal was placed in the beam of a synchrotron source and the x-ray crystallography data was collected as reflections on a diffraction pattern that undergo Fourier transform to obtain the electron density. We observed two drastic differences from our solved structure at 2.75Å to a similar construct of the mouse CaMKII association domain. Firstly, our structure is a 6-fold symmetric dodecamer, whereas the previously published construct was a 7-fold symmetric tetradecamer. This suggests the association domain of human CaMKII is a dynamic structure that is triggered subunit exchange process. Secondly, in our structure the N-terminal tag is docked as an additional beta-strand on an uncapped beta-sheet present in each association domain protomer. This is concrete evidence of the involvement of the polypeptide docking site in the molecular mechanism underlining subunit exchange. In the future, we would like to selectively inhibit the exchange process while not disrupting the other functionalities of CaMKII.

  15. Chronic fluoxetine administration enhances synaptic plasticity and increases functional dynamics in hippocampal CA3-CA1 synapses.

    Science.gov (United States)

    Popova, Dina; Castrén, Eero; Taira, Tomi

    2017-11-01

    Recent studies demonstrate that chronic administration of the widely used antidepressant fluoxetine (FLX) promotes neurogenesis, synaptogenesis and synaptic plasticity in the adult hippocampus, cortex and amygdala. However, the mechanisms underlying these effects and how are they related to the clinical antidepressant efficacy are still poorly understood. We show here that chronic FLX administration decreases hippocampus-associated neophobia in naïve mice. In parallel, electrophysiological recordings in hippocampal CA3-CA1 circuitry revealed that the FLX treatment resulted in increased short- and long-term plasticity likely attributed to changes in presynaptic function. These changes were accompanied by enhancement in the expression of proteins related to vesicular trafficking and release, namely synaptophysin, synaptotagmin 1, MUNC 18 and syntaxin 1. Thus, chronic FLX administration is associated with enhanced synaptic dynamics atypical of mature CA1 synapses, elevated hippocampal plasticity, improved hippocampus-dependent behavior as well as altered expression of synaptic proteins regulating neurotransmitter trafficking and release. The results support the idea that antidepressants can promote neuronal plasticity and show that they can increase the functional dynamic range and information processing in synaptic circuitries. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Thermal Protection System Materials (TPSM): Conformal Ablative TPS (CA-TPS) Project

    Data.gov (United States)

    National Aeronautics and Space Administration — CA-TPS is leveraging earlier investments made by ARMD’s Hypersonic and HEOMD’s ETDD program that matured the concept from TRL 1 to 2.CA-TPS starts with...

  17. Evidence for a Na+-Ca2+ exchanger in rat pancreatic ducts

    DEFF Research Database (Denmark)

    Hug, M; Pahl, C; Novak, I

    1996-01-01

    insensitive Ca2+ influx. Removal and reintroduction of extracellular Na+ induced transient hyperpolarization and depolarization of Vm, respectively. Taken together, our data indicate that pancreatic ducts possess an electrogenic Na+-Ca2+ exchanger, which under control conditions is responsible...

  18. Anoctamin/TMEM16 family members are Ca2+‐activated Cl− channels

    National Research Council Canada - National Science Library

    Hartzell, H. Criss; Yu, Kuai; Xiao, Qinhuan; Chien, Li‐Ting; Qu, Zhiqiang

    2009-01-01

    Ca 2+ ‐activated Cl − channels (CaCCs) perform many important functions in cell physiology including secretion of fluids from acinar cells of secretory glands, amplification of olfactory transduction, regulation of cardiac and neuronal...

  19. Integrin mobilizes intracellular Ca(2+) in renal vascular smooth muscle cells

    DEFF Research Database (Denmark)

    Chan, W L; Holstein-Rathlou, N H; Yip, K P

    2001-01-01

    Peptides with the Arg-Gly-Asp (RGD) motif induce vasoconstriction in rat afferent arterioles by increasing the intracellular Ca(2+) concentration ([Ca(2+)](i)) in vascular smooth muscle cells (VSMC). This finding suggests that occupancy of integrins on the plasma membrane of VSMC might affect...... vascular tone. The purpose of this study was to determine whether occupancy of integrins by exogenous RGD peptides initiates intracellular Ca(2+) signaling in cultured renal VSMC. When smooth muscle cells were exposed to 0.1 mM hexapeptide GRGDSP, [Ca(2+)](i) rapidly increased from 91 +/- 4 to 287 +/- 37 n...... a rapid elevation of nuclear [Ca(2+)](i). Spontaneous recurrence of smaller-amplitude Ca(2+) waves were found in 20% of cells examined after the initial response to RGD-containing peptides. Blocking dihydropyridine-sensitive Ca(2+) channels with nifedipine or removal of extracellular Ca(2+) did...

  20. Sphingosine inhibits the sarco(endo)plasmic reticulum Ca{sup 2+}-ATPase (SERCA) activity

    Energy Technology Data Exchange (ETDEWEB)

    Benaim, Gustavo, E-mail: gbenaim@idea.gob.ve [Instituto de Estudios Avanzados (IDEA), Caracas (Venezuela, Bolivarian Republic of); Instituto de Biología Experimental, Facultad de Ciencias, Universidad Central de Venezuela (UCV), Caracas (Venezuela, Bolivarian Republic of); Pimentel, Adriana A., E-mail: adriana.pimentel@ucv.ve [Facultad de Farmacia, Universidad Central de Venezuela (UCV), Caracas (Venezuela, Bolivarian Republic of); Felibertt, Pimali [Facultad de Ciencias, Universidad de Carabobo, Valencia (Venezuela, Bolivarian Republic of); Mayora, Adriana [Instituto de Biología Experimental, Facultad de Ciencias, Universidad Central de Venezuela (UCV), Caracas (Venezuela, Bolivarian Republic of); Colman, Laura [Instituto Pasteur de Montevideo, Montevideo (Uruguay); Sojo, Felipe [Instituto de Biología Experimental, Facultad de Ciencias, Universidad Central de Venezuela (UCV), Caracas (Venezuela, Bolivarian Republic of); Rojas, Héctor [Instituto de Inmunología, Universidad Central de Venezuela (UCV), Caracas (Venezuela, Bolivarian Republic of); Centro de Biofísica y Bioquímica, Instituto Venezolano de Investigaciones Científicas (IVIC), Caracas (Venezuela, Bolivarian Republic of); De Sanctis, Juan B. [Instituto de Inmunología, Universidad Central de Venezuela (UCV), Caracas (Venezuela, Bolivarian Republic of)

    2016-04-29

    The increase in the intracellular Ca{sup 2+} concentration ([Ca{sup 2+}]{sub i}) is the key variable for many different processes, ranging from regulation of cell proliferation to apoptosis. In this work we demonstrated that the sphingolipid sphingosine (Sph) increases the [Ca{sup 2+}]{sub i} by inhibiting the sarco(endo)plasmic reticulum Ca{sup 2+}-ATPase (SERCA), in a similar manner to thapsigargin (Tg), a specific inhibitor of this Ca{sup 2+} pump. The results showed that addition of sphingosine produced a release of Ca{sup 2+} from the endoplasmic reticulum followed by a Ca{sup 2+} entrance from the outside mileu. The results presented in this work support that this sphingolipid could control the activity of the SERCA, and hence sphingosine may participate in the regulation of [Ca{sup 2+}]{sub I} in mammalian cells.

  1. Cytosolic Ca2+, exocytosis, and endocytosis in single melanotrophs of the rat pituitary.

    Science.gov (United States)

    Thomas, P; Surprenant, A; Almers, W

    1990-11-01

    We have monitored cytosolic [Ca2+] with fura-2 and exocytosis by measuring the membrane capacitance, and we have studied the influence of cytosolic [Ca2+] on secretion in single endocrine cells. As in neurons, cytosolic Ca2+ is sufficient to trigger exocytosis. The rate of secretion grows with the fourth or fifth power of cytosolic [Ca2+], and paired stimuli reveal facilitation. Ca2+ influx through voltage-sensitive Ca2+ channels can stimulate secretion 1000-fold over the basal levels measured biochemically. Unlike neurons, however, melanotrophs continue to secrete for seconds afer a depolarizing pulse, while they extrude or sequester the Ca2+ that has entered through Ca2+ channels. Following episodes of secretion, pituitary cells can retrieve membrane with half-times around 30 s at 32 degrees C, even in the absence of cytosolic K+.

  2. Effect of vanadate and of removal of extracellular Ca2+ and Na+ on tension development and 45Ca efflux in rat and frog myocardium

    DEFF Research Database (Denmark)

    Gesser, H; Bonefeld-Jørgensen, Eva Cecilie

    1983-01-01

    Vanadate in the range 0-5 mM has positive inotropic effects on myocardial strips of frog and to a lesser extent on those of rat. Inhibiting the sarcolemmal Na+, Ca2+ exchange by a solution free of Ca2+ and Na+ caused a drop in 45Ca efflux and a transient increase in resting tension. These effects...... were more expressed for the frog than for the rat myocardium, which suggests that the Na+ for Ca2+ exchange across the cell membrane is more important in the frog than in the rat myocardium. A subsequent addition of vanadate at 2 or 5 mM had no effect on 45Ca efflux, while it increased the resting...... tension. This increase was higher for the frog than for the rat myocardium. These results suggest that the inotropic effects of vanadate may be due to an effect on membrane-bound Ca2+-ATPase....

  3. ERK activation by Ca2+ ionophores depends on Ca2+ entry in lymphocytes but not in platelets, and does not conduct membrane scrambling.

    Science.gov (United States)

    Arachiche, A; Badirou, I; Dachary-Prigent, J; Garcin, I; Geldwerth-Feniger, D; Kerbiriou-Nabias, D

    2008-11-01

    Rapid Ca2+-dependent phospholipid (PL) reorganization (scrambling) at the plasma membrane is a mechanism common to hematopoietic cells exposing procoagulant phosphatidylserine (PS). The aim of this research was to determine whether activation of the extracellular signal-regulated kinase (ERK) pathway was required for PL scrambling, based on a single report analyzing both responses induced by Ca2+ ionophores in megakaryoblastic HEL cells. Ca2+ ionophore-stimulated ERK phosphorylation was induced in platelets without external Ca2+, whereas exogenous Ca2+ entry was crucial for ERK activation in Jurkat T cells. In both cells, membrane scrambling only occurred following Ca2+ entry and was not blocked by inhibiting ERK phosphorylation. Furthermore, ERK proteins are strongly phosphorylated in transformed B lymphoblastic cell lines, which do not expose PS in their resting state. Overall, the data demonstrated that ERK activation and membrane scrambling are independent mechanisms.

  4. Distinct roles of two ceramide synthases, CaLag1p and CaLac1p, in the morphogenesis of Candida albicans

    DEFF Research Database (Denmark)

    Cheon, Seon Ah; Bal, Jyotiranjan; Song, Yunkyoung

    2012-01-01

    Lag1p and Lac1p catalyse ceramide synthesis in Saccharomyces cerevisiae. This study shows that Lag1 family proteins are generally required for polarized growth in hemiascomycetous yeast. However, in contrast to S. cerevisiae where these proteins are functionally redundant, C. albicans Lag1p (CaLag1......p) and Lac1p (CaLac1p) are functionally distinct. Lack of CaLag1p, but not CaLac1p, caused severe defects in the growth and hyphal morphogenesis of C. albicans. Deletion of CaLAG1 decreased expression of the hypha-specific HWP1 and ECE1 genes. Moreover, overexpression of CaLAG1 induced pseudohyphal....... albicans....

  5. Ca(2+ release events in cardiac myocytes up close: insights from fast confocal imaging.

    Directory of Open Access Journals (Sweden)

    Vyacheslav M Shkryl

    Full Text Available The spatio-temporal properties of Ca(2+ transients during excitation-contraction coupling and elementary Ca(2+ release events (Ca(2+ sparks were studied in atrial and ventricular myocytes with ultra-fast confocal microscopy using a Zeiss LSM 5 LIVE system that allows sampling rates of up to 60 kHz. Ca(2+ sparks which originated from subsarcolemmal junctional sarcoplasmic reticulum (j-SR release sites in atrial myocytes were anisotropic and elongated in the longitudinal direction of the cell. Ca(2+ sparks in atrial cells originating from non-junctional SR and in ventricular myocytes were symmetrical. Ca(2+ spark recording in line scan mode at 40,000 lines/s uncovered step-like increases of [Ca(2+]i. 2-D imaging of Ca(2+ transients revealed an asynchronous activation of release sites and allowed the sequential recording of Ca(2+ entry through surface membrane Ca(2+ channels and subsequent activation of Ca(2+-induced Ca(2+ release. With a latency of 2.5 ms after application of an electrical stimulus, Ca(2+ entry could be detected that was followed by SR Ca(2+ release after an additional 3 ms delay. Maximum Ca(2+ release was observed 4 ms after the beginning of release. The timing of Ca(2+ entry and release was confirmed by simultaneous [Ca(2+]i and membrane current measurements using the whole cell voltage-clamp technique. In atrial cells activation of discrete individual release sites of the j-SR led to spatially restricted Ca(2+ release events that fused into a peripheral ring of elevated [Ca(2+]i that subsequently propagated in a wave-like fashion towards the center of the cell. In ventricular myocytes asynchronous Ca(2+ release signals from discrete sites with no preferential subcellular location preceded the whole-cell Ca(2+ transient. In summary, ultra-fast confocal imaging allows investigation of Ca(2+ signals with a time resolution similar to patch clamp technique, however in a less invasive fashion.

  6. Ca(2+) release events in cardiac myocytes up close: insights from fast confocal imaging.

    Science.gov (United States)

    Shkryl, Vyacheslav M; Blatter, Lothar A

    2013-01-01

    The spatio-temporal properties of Ca(2+) transients during excitation-contraction coupling and elementary Ca(2+) release events (Ca(2+) sparks) were studied in atrial and ventricular myocytes with ultra-fast confocal microscopy using a Zeiss LSM 5 LIVE system that allows sampling rates of up to 60 kHz. Ca(2+) sparks which originated from subsarcolemmal junctional sarcoplasmic reticulum (j-SR) release sites in atrial myocytes were anisotropic and elongated in the longitudinal direction of the cell. Ca(2+) sparks in atrial cells originating from non-junctional SR and in ventricular myocytes were symmetrical. Ca(2+) spark recording in line scan mode at 40,000 lines/s uncovered step-like increases of [Ca(2+)]i. 2-D imaging of Ca(2+) transients revealed an asynchronous activation of release sites and allowed the sequential recording of Ca(2+) entry through surface membrane Ca(2+) channels and subsequent activation of Ca(2+)-induced Ca(2+) release. With a latency of 2.5 ms after application of an electrical stimulus, Ca(2+) entry could be detected that was followed by SR Ca(2+) release after an additional 3 ms delay. Maximum Ca(2+) release was observed 4 ms after the beginning of release. The timing of Ca(2+) entry and release was confirmed by simultaneous [Ca(2+)]i and membrane current measurements using the whole cell voltage-clamp technique. In atrial cells activation of discrete individual release sites of the j-SR led to spatially restricted Ca(2+) release events that fused into a peripheral ring of elevated [Ca(2+)]i that subsequently propagated in a wave-like fashion towards the center of the cell. In ventricular myocytes asynchronous Ca(2+) release signals from discrete sites with no preferential subcellular location preceded the whole-cell Ca(2+) transient. In summary, ultra-fast confocal imaging allows investigation of Ca(2+) signals with a time resolution similar to patch clamp technique, however in a less invasive fashion.

  7. Data of evolutionary structure change: 1N3CA-2NOZA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available EEAHKALCILPGVGTKVADCICLMALDKPQAVPVNVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQ ...EEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTT--AKGPCPQTNKELGNFFRSLWGPYAGWAFAVLFSADL-- ...> 2NOZA WHPTT--AKGPC -- ...> 1N3CA WHPTTSQAKGPS

  8. Ca2+activity signatures of myelin sheath formation and growth in vivo.

    Science.gov (United States)

    Baraban, Marion; Koudelka, Sigrid; Lyons, David A

    2018-01-01

    During myelination, individual oligodendrocytes initially over-produce short myelin sheaths, which are either retracted or stabilized. By live-imaging oligodendrocyte Ca 2+ activity in vivo, we find that high-amplitude, long-duration Ca 2+ transients in sheaths prefigure retractions, mediated by calpain. Following stabilization, myelin sheaths grow along axons, and we find that higher-frequency Ca 2+ transient activity in sheaths precedes faster elongation. Our data implicate local Ca 2+ signaling in regulating distinct stages of myelination.

  9. Hypothalamic and Other Connections with the Dorsal CA2 Area of the Mouse Hippocampus

    Science.gov (United States)

    Cui, Zhenzhong; Gerfen, Charles R.; Young, W. Scott

    2013-01-01

    The CA2 area is an important, although relatively unexplored, component of the hippocampus. We used various tracers to provide a comprehensive analysis of CA2 connections in C57BL/6J mice. Using various adeno-associated viruses that express fluorescent proteins, we found a vasopressinergic projection from the paraventricular nuclei of the hypothalamus (PVN) to the CA2, as well as a projection from pyramidal neurons of the CA2 to the supramammillary nuclei. These projections were confirmed by retrograde tracing. As expected, we observed CA2 afferent projections from neurons in ipsilateral entorhinal cortical layer II as well as from bilateral dorsal CA2 and CA3 using retrograde tracers. Additionally, we saw CA2 neuronal input from bilateral medial septal nuclei, vertical and horizontal limbs of the nucleus of diagonal band of Broca, supramammillary nuclei (SUM) and median raphe nucleus. Dorsal CA2 injections of adeno-associated virus expressing green fluorescent protein revealed axonal projections primarily to dorsal CA1, CA2 and CA3 bilaterally. No projection was detected to the entorhinal cortex from the dorsal CA2. These results are consistent with recent observations that the dorsal CA2 forms disynaptic connections with the entorhinal cortex to influence dynamic memory processing. Mouse dorsal CA2 neurons send bilateral projections to the medial and lateral septal nuclei, vertical and horizontal limbs of the diagonal band of Broca and the SUM. Novel connections from the PVN and to the SUM suggest important regulatory roles for CA2 in mediating social and emotional input for memory processing. PMID:23172108

  10. Protein phylogenetic analysis of Ca2+/cation antiporters and insights into their evolution in plants

    Directory of Open Access Journals (Sweden)

    Laura eEmery

    2012-01-01

    Full Text Available Cation transport is a critical process in all organisms and is essential for mineral nutrition, ion stress tolerance, and signal transduction. Transporters that are members of the Ca2+/Cation Antiporter (CaCA superfamily are involved in the transport of Ca2+ and/or other cations using the counter exchange of another ion such as H+ or Na+. The CaCA superfamily has been previously divided into five transporter families: the YRBG, NCX, NCKX, CAX and CCX families, which include the well-characterized Na+/Ca2+ exchanger (NCX and H+/cation exchanger (CAX transporters. To examine the evolution of CaCA transporters within higher plants and the green plant lineage, CaCA genes were identified from the genomes of sequenced flowering plants, a bryophyte, lycophyte, and freshwater and marine algae, and compared with those from non-plant species. We found evidence of the expansion and increased diversity of flowering plant genes within the CAX and CCX families. Genes related to the NCX family are present in land plant though they encode distinct MHX homologs which probably have an altered transport function. In contrast, the NCX and NCKX genes which are absent in land plants have been retained in many species of algae, especially the marine algae, indicating that these organisms may share ‘animal-like’ characteristics of Ca2+ homeostasis and signaling. A group of genes encoding novel CAX-like proteins containing an EF hand domain were identified from plants and selected algae but appeared to be lacking in any other species. Lack of functional data for most of the CaCA proteins make it impossible to reliably predict substrate specificity and function for many of the groups or individual proteins. The abundance and diversity of CaCA genes throughout all branches of life indicates the importance of this class of cation transporter, and that many transporters with novel functions are waiting to be discovered.

  11. Targeting the CaMKII/ERK Interaction in the Heart Prevents Cardiac Hypertrophy.

    Science.gov (United States)

    Cipolletta, Ersilia; Rusciano, Maria Rosaria; Maione, Angela Serena; Santulli, Gaetano; Sorriento, Daniela; Del Giudice, Carmine; Ciccarelli, Michele; Franco, Antonietta; Crola, Catherine; Campiglia, Pietro; Sala, Marina; Gomez-Monterrey, Isabel; De Luca, Nicola; Trimarco, Bruno; Iaccarino, Guido; Illario, Maddalena

    2015-01-01

    Activation of Ca2+/Calmodulin protein kinase II (CaMKII) is an important step in signaling of cardiac hypertrophy. The molecular mechanisms by which CaMKII integrates with other pathways in the heart are incompletely understood. We hypothesize that CaMKII association with extracellular regulated kinase (ERK), promotes cardiac hypertrophy through ERK nuclear localization. In H9C2 cardiomyoblasts, the selective CaMKII peptide inhibitor AntCaNtide, its penetratin conjugated minimal inhibitory sequence analog tat-CN17β, and the MEK/ERK inhibitor UO126 all reduce phenylephrine (PE)-mediated ERK and CaMKII activation and their interaction. Moreover, AntCaNtide or tat-CN17β pretreatment prevented PE induced CaMKII and ERK nuclear accumulation in H9C2s and reduced the hypertrophy responses. To determine the role of CaMKII in cardiac hypertrophy in vivo, spontaneously hypertensive rats were subjected to intramyocardial injections of AntCaNtide or tat-CN17β. Left ventricular hypertrophy was evaluated weekly for 3 weeks by cardiac ultrasounds. We observed that the treatment with CaMKII inhibitors induced similar but significant reduction of cardiac size, left ventricular mass, and thickness of cardiac wall. The treatment with CaMKII inhibitors caused a significant reduction of CaMKII and ERK phosphorylation levels and their nuclear localization in the heart. These results indicate that CaMKII and ERK interact to promote activation in hypertrophy; the inhibition of CaMKII-ERK interaction offers a novel therapeutic approach to limit cardiac hypertrophy.

  12. Chemical UV Filters Mimic the Effect of Progesterone on Ca(2+) Signaling in Human Sperm Cells

    DEFF Research Database (Denmark)

    Rehfeld, A; Dissing, S; Skakkebæk, N E

    2016-01-01

    Progesterone released by cumulus cells surrounding the egg induces a Ca(2+) influx into human sperm cells via the cationic channel of sperm (CatSper) Ca(2+) channel and controls multiple Ca(2+)-dependent responses essential for fertilization. We hypothesized that chemical UV filters may mimic...... competitively inhibited progesterone-induced Ca(2+) signals. In vivo exposure studies are needed to investigate whether UV filter exposure affects human fertility....

  13. Environmental and cortisol-mediated control of Ca(2+) uptake in tilapia (Oreochromis mossambicus).

    Science.gov (United States)

    Lin, Chia-Hao; Kuan, Wei-Chun; Liao, Bo-Kai; Deng, Ang-Ni; Tseng, Deng-Yu; Hwang, Pung-Pung

    2016-04-01

    Ca(2+) is a vital element for many physiological processes in vertebrates, including teleosts, which live in aquatic environments and acquire Ca(2+) from their surroundings. Ionocytes within the adult gills or larval skin are critical sites for transcellular Ca(2+) uptake in teleosts. The ionocytes of zebrafish were found to contain transcellular Ca(2+) transporters, epithelial Ca(2+) channel (ECaC), plasma membrane Ca(2+)-ATPase 2 (PMCA2), and Na(+)/Ca(2+) exchanger 1b (NCX1b), providing information about the molecular mechanism of transcellular Ca(2+) transports mediated by ionocytes in fish. However, more evidence is required to establish whether or not a similar mechanism of transcellular Ca(2+) transport also exists in others teleosts. In the present study, ecac, pmca2, and ncx1 were found to be expressed in the branchial ionocytes of tilapia, thereby providing further support for the mechanism of transcellular Ca(2+) transport through ionocytes previously proposed for zebrafish. In addition, we also reveal that low Ca(2+) water treatment of tilapia stimulates Ca(2+) uptake and expression of ecac and cyp11b (the latter encodes a cortisol-synthesis enzyme). Treatment of tilapia with exogenous cortisol (20 mg/l) enhanced both Ca(2+) influx and ecac expression. Therefore, increased cyp11b expression is suggested to enhance Ca(2+) uptake capacity in tilapia exposed to low Ca(2+) water. Furthermore, the application of cortisol receptor antagonists revealed that cortisol may regulate Ca(2+) uptake through glucocorticoid and/or mineralocorticoid receptor (GR and/or MR) in tilapia. Taken together, the data suggest that cortisol may activate GR and/or MR to execute its hypercalcemic action by stimulating ecac expression in tilapia.

  14. [Ca2+]i rise at in vitro maturation in bovine cumulus-oocyte complexes.

    Science.gov (United States)

    Silvestre, Francesco; Fissore, Rafael A; Tosti, Elisabetta; Boni, Raffaele

    2012-06-01

    An intracellular calcium ([Ca(2+)]i) rise has been described in cumulus-oocyte complexes (COCs) following luteinizing hormone (LH) exposure. Together with cAMP, Ca(2+) is a candidate signal for resumption of meiosis. Here, we analyzed if the most common hormones involved in oocyte maturation can induce the same Ca(2+) signal. In addition, we characterized the source of this signal. Immature, in vitro-matured, and roscovitine-meiotically arrested COCs were loaded with Fluo-4 AM, stimulated with hormones/growth factors, and tested for [Ca(2+)](i) variations in cumulus cells. Reagents known to inhibit or stimulate [Ca(2+)](i) rises were used to characterize these [Ca(2+)](i) dynamics. Finally, expression of LH receptors (LHRs) in COCs was analyzed by immunofluorescence. In immature COCs, follicle-stimulating hormone (FSH) elicited a single [Ca(2+)](i) rise that was higher than those induced by LH and growth hormone (GH), whereas epithelial growth factor failed to induce any changes in [Ca(2+)](i). The [Ca(2+)](i) rise induced by FSH was higher in immature COCs; was reduced in roscovitine-arrested, immature COCs; and was negligible in gonadotropin-induced, in vitro-matured COCs. In the case of spontaneous- and GH-matured COCs, however, FSH stimulation caused a lower [Ca(2+)](i) rise. The hormone-induced [Ca(2+)](i) rise was due to: (i) external Ca(2+) entry; (ii) intercellular communication; and (iii) intracellular Ca(2+) stores. Immunofluorescence revealed that LHRs were expressed throughout the cumulus cells. The above results show that: (i) gonadotropins and GH cause a [Ca(2+)](i) rise in cumulus cells; (ii) this [Ca(2+)](i) rise results from extra-, inter-, and intra-cellular cumulative Ca(2+) fluxes; and (iii) LHRs are distributed on either outer or inner cumulus cells. Copyright © 2012 Wiley Periodicals, Inc.

  15. Gray Matter NG2 Cells Display Multiple Ca2+-Signaling Pathways and Highly Motile Processes

    OpenAIRE

    Haberlandt, Christian; Derouiche, Amin; Wyczynski, Alexandra; Haseleu, Julia; Pohle, Jörg; Karram, Khalad; Trotter, Jacqueline; Seifert, Gerald; Frotscher, Michael; Steinhäuser, Christian; Jabs, Ronald

    2011-01-01

    NG2 cells, the fourth type of glia in the mammalian CNS, receive synaptic input from neurons. The function of this innervation is unknown yet. Postsynaptic changes in intracellular Ca(2+)-concentration ([Ca(2+)](i)) might be a possible consequence. We employed transgenic mice with fluorescently labeled NG2 cells to address this issue. To identify Ca(2+)-signaling pathways we combined patch-clamp recordings, Ca(2+)-imaging, mRNA-transcript analysis and focal pressure-application of various sub...

  16. Effect of rabdosia rubescens combined with new assistant chemotherapy on serum CA199, CEA, CA15-3 and T lymphocyte subsets in patients with breast cancer

    Directory of Open Access Journals (Sweden)

    Lei Xi

    2018-07-01

    Full Text Available Objective: To study the effects of Rabdosia rubescens combined with neoadjuvant chemotherapy on serum CA199, CEA, CA15-3 levels and T lymphocyte subsets in patients with breast cancer. Methods: A total of 70 patients with breast cancer in our hospital were enrolled as the subjects of this study. The subjects were divided into control group (n=35 and treatment group (n=35 randomly. Patients in the control group were treated with new assistant chemotherapy, while those who were in the treatment group were treated with rabdosia rubescens combined with new assistant chemotherapy. The two groups of patients were treated for 3 periods. The serum CA199, CEA, CA15-3 levels and peripheral blood CD4+, CD8+, CD4+/CD8+ cells of the two groups before and after treatment were compared. Results: There were no significantly differences among the serum CA199, CEA, CA15-3 levels and peripheral blood CD4+, CD8+, CD4+/CD8+ cells of the two groups before treatment. The serum CA199, CEA and CA15-3 levels of the two groups after treatment were significantly lower than those before treatment, besides, the serum CA199, CEA and CA15-3 levels of the treatment group were significantly lower than those of the control group. The peripheral blood CD4+, CD4+/ CD8+ cells of the control group after treatment were significantly lower than before treatment, and the peripheral blood CD4+, CD4+/CD8+ cells of the treatment group after treatment were significantly higher than those of the control group. Conclusion: Rabdosia rubescens combined with new assistant chemotherapycan can significantly reduce the serum CA199, CEA and CA15-3 levels, and improve peripheral blood CD4+, CD8+, CD4+/CD8+ levels of patients with breast cancer. It is worthy of clinical application.

  17. Phosphoinositide-3-kinase/akt - dependent signaling is required for maintenance of [Ca2+]i,ICa, and Ca2+ transients in HL-1 cardiomyocytes

    Directory of Open Access Journals (Sweden)

    Graves Bridget M

    2012-06-01

    Full Text Available Abstract The phosphoinositide 3-kinases (PI3K/Akt dependent signaling pathway plays an important role in cardiac function, specifically cardiac contractility. We have reported that sepsis decreases myocardial Akt activation, which correlates with cardiac dysfunction in sepsis. We also reported that preventing sepsis induced changes in myocardial Akt activation ameliorates cardiovascular dysfunction. In this study we investigated the role of PI3K/Akt on cardiomyocyte function by examining the role of PI3K/Akt-dependent signaling on [Ca2+]i, Ca2+ transients and membrane Ca2+ current, ICa, in cultured murine HL-1 cardiomyocytes. LY294002 (1–20 μM, a specific PI3K inhibitor, dramatically decreased HL-1 [Ca2+]i, Ca2+ transients and ICa. We also examined the effect of PI3K isoform specific inhibitors, i.e. α (PI3-kinase α inhibitor 2; 2–8 nM; β (TGX-221; 100 nM and γ (AS-252424; 100 nM, to determine the contribution of specific isoforms to HL-1 [Ca2+]i regulation. Pharmacologic inhibition of each of the individual PI3K isoforms significantly decreased [Ca2+]i, and inhibited Ca2+ transients. Triciribine (1–20 μM, which inhibits AKT downstream of the PI3K pathway, also inhibited [Ca2+]i, and Ca2+ transients and ICa. We conclude that the PI3K/Akt pathway is required for normal maintenance of [Ca2+]i in HL-1 cardiomyocytes. Thus, myocardial PI3K/Akt-PKB signaling sustains [Ca2+]i required for excitation-contraction coupling in cardiomyoctyes.

  18. Ca2+-activated Cl- channels of the ClCa family express in the cilia of a subset of rat olfactory sensory neurons.

    Science.gov (United States)

    Gonzalez-Silva, Carolina; Vera, Jorge; Bono, María Rosa; González-Billault, Christian; Baxter, Brooke; Hansen, Anne; Lopez, Robert; Gibson, Emily A; Restrepo, Diego; Bacigalupo, Juan

    2013-01-01

    The Ca(2+)-activated Cl(-) channel is considered a key constituent of odor transduction. Odorant binding to a specific receptor in the cilia of olfactory sensory neurons (OSNs) triggers a cAMP cascade that mediates the opening of a cationic cyclic nucleotide-gated channel (CNG), allowing Ca(2+) influx. Ca(2+) ions activate Cl(-) channels, generating a significant Cl(-) efflux, with a large contribution to the receptor potential. The Anoctamin 2 channel (ANO2) is a major constituent of the Cl(-) conductance, but its knock-out has no impairment of behavior and only slightly reduces field potential odorant responses of the olfactory epithelium. Likely, an additional Ca(2+)-activated Cl(-) channel of unknown molecular identity is also involved. In addition to ANO2, we detected two members of the ClCa family of Ca(2+)-activated Cl(-) channels in the rat olfactory epithelium, ClCa4l and ClCa2. These channels, also expressed in the central nervous system, may correspond to odorant transduction channels. Whole Sprague Dawley olfactory epithelium nested RT-PCR and single OSNs established that the mRNAs of both channels are expressed in OSNs. Real time RT-PCR and full length sequencing of amplified ClCa expressed in rat olfactory epithelium indicated that ClCa4l is the most abundant. Immunoblotting with an antibody recognizing both channels revealed immunoreactivity in the ciliary membrane. Immunochemistry of olfactory epithelium and OSNs confirmed their ciliary presence in a subset of olfactory sensory neurons. The evidence suggests that ClCa4l and ClCa2 might play a role in odorant transduction in rat olfactory cilia.

  19. Ablation of Ca(V2.1 voltage-gated Ca²⁺ channels in mouse forebrain generates multiple cognitive impairments.

    Directory of Open Access Journals (Sweden)

    Robert Theodor Mallmann

    Full Text Available Voltage-gated Ca(V2.1 (P/Q-type Ca²⁺ channels located at the presynaptic membrane are known to control a multitude of Ca²⁺-dependent cellular processes such as neurotransmitter release and synaptic plasticity. Our knowledge about their contributions to complex cognitive functions, however, is restricted by the limited adequacy of existing transgenic Ca(V2.1 mouse models. Global Ca(V2.1 knock-out mice lacking the α1 subunit Cacna1a gene product exhibit early postnatal lethality which makes them unsuitable to analyse the relevance of Ca(V2.1 Ca²⁺ channels for complex behaviour in adult mice. Consequently we established a forebrain specific Ca(V2.1 knock-out model by crossing mice with a floxed Cacna1a gene with mice expressing Cre-recombinase under the control of the NEX promoter. This novel mouse model enabled us to investigate the contribution of Ca(V2.1 to complex cognitive functions, particularly learning and memory. Electrophysiological analysis allowed us to test the specificity of our conditional knock-out model and revealed an impaired synaptic transmission at hippocampal glutamatergic synapses. At the behavioural level, the forebrain-specific Ca(V2.1 knock-out resulted in deficits in spatial learning and reference memory, reduced recognition memory, increased exploratory behaviour and a strong attenuation of circadian rhythmicity. In summary, we present a novel conditional Ca(V2.1 knock-out model that is most suitable for analysing the in vivo functions of Ca(V2.1 in the adult murine forebrain.

  20. A new post-treatment system for anaerobic effluents containing a high Ca2+ content

    NARCIS (Netherlands)

    Vogelaar, J.C.T.; Wal, van der F.; Lettinga, G.

    2002-01-01

    A novel reactor concept has been developed that combines Ca2 removal and BOD conversion under mesophilic (30 °C ) as well as under thermophilic (55 °C ) conditions. Soluble Ca2 , present in many industrial wastewaters, precipitates as a result of forced aeration in the aerobic bioreactor. The CaCO3

  1. Elevation dependent sensitivity of northern hardwoods to Ca addition at Hubbard Brook Experimental Forest, NH USA

    Science.gov (United States)

    Rakesh Minocha; Stephanie Long; Palaniswamy Thangavel; Subhash C. Minocha; Christopher Eagar; Charles T. Driscoll

    2010-01-01

    Acidic deposition has caused a depletion of calcium (Ca) in the northeastern forest soils. Wollastonite (Ca silicate) was added to watershed 1 (WS1) at the Hubbard Brook Experimental Forest (HBEF) in 1999 to evaluate its effects on various functions of the HBEF ecosystem. The effects of Ca addition on foliar soluble (extractable in 5% HClO4) ions...

  2. Control mechanisms of mitochondrial Ca(2+) uptake - feed-forward modulation of aldosterone secretion.

    Science.gov (United States)

    Szanda, Gergö; Rajki, Anikó; Spät, András

    2012-04-28

    Mitochondrial Ca(2+) signal activates metabolism by boosting pyridine nucleotide reduction and ATP synthesis or, if Ca(2+) sequestration is supraphysiological, may even lead to apoptosis. Although the molecular background of mitochondrial Ca(2+) uptake has recently been elucidated, the regulation of Ca(2+) handling is still not properly clarified. In human adrenocortical H295R cells we found a regulatory mechanism involving p38 MAPK and novel-type PKC isoforms. Upon stimulation with angiotensin II (AII) these kinases are activated typically prior to the release of Ca(2+) and - most probably by reducing the Ca(2+) permeation through the outer mitochondrial membrane - attenuate mitochondrial Ca(2+) uptake in a feed-forward manner. The biologic significance of the kinase-mediated reduction of mitochondrial Ca(2+) signal is also reflected by the attenuation of AII-mediated aldosterone secretion. As another feed-forward mechanism, we found in HEK-293T and H295R cells that Ca(2+) signal evoked either by IP(3) or by voltage-gated influx is accompanied by a concomitant cytosolic Mg(2+) signal. In permeabilized HEK-293T cells Mg(2+) was found to be a potent inhibitor of mitochondrial Ca(2+) uptake in the physiologic [Mg(2+)] and [Ca(2+)] range. Thus, these inhibitory mechanisms may serve not only as protection against mitochondrial Ca(2+) overload and subsequent apoptosis but also have the potential to substantially alter physiological responses. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  3. 77 FR 25739 - Notice of Inventory Completion: Fowler Museum at UCLA, Los Angeles, CA

    Science.gov (United States)

    2012-05-01

    ... Coso Junction Ranch Site, Inyo County, CA. This notice is published as part of the National Park... the Coso Junction Ranch Site (CA-INY-2284), located at the south end of Inyo County, CA. No known... UCLA Field School conducted in the summer of 1983 under the supervision of David Whitley. The Coso...

  4. Inhibitory effect of lidocaine on the sarcoplasmic reticulum Ca2+-dependent atpase from temporalis muscle.

    Science.gov (United States)

    Sánchez, Gabriel A; Casadoumecq, Ana C; Alonso, Guillermo L; Takara, Delia

    2010-01-01

    Myotoxic effects of local anesthetics on skeletal musclefibers involve the inhibition ofsarcoplasmic reticulum Ca2+ -dependent ATPase activity and Ca2 transport. Lidocaine is a local anesthetic frequently used to relieve the symptoms of trigeminal neuralgia. The aim of this work was to test the inhibitory and/or stimulatory effect of lidocaine on sarcoplasmic reticulum Ca2+ -dependent ATPase isolated from rabbit temporalis muscle. Ca2+ -dependent ATPase activity was determined by a colorimetric method Calcium-binding to the Ca dependent ATPase, Ca2+ transport, and phosphorylation of the enzyme by ATP were determined with radioisotopic techniques. Lidocaine inhibited the Ca2+ -dependent ATPase activity in a concentration-dependent manner. The preincubation of the sarcoplasmic reticulum membranes with lidocaine enhanced the Ca2+ dependent ATPase activity in the absence of calcium ionophore. Lidocaine also inhibited both Ca2+ uptake and enzyme phosphorylation by ATP but had no effect on Ca2+ -binding to the enzyme. We conclude that the effect of lidocaine on the sarcoplasmic reticulum Ca2+ -dependent ATPase from temporalis muscle is due to the drug's direct interaction with the enzyme and the increased permeability of the sarcoplasmic reticulum membrane to Ca.

  5. Epigenetic Methylation of Parathyroid CaR and VDR Promoters in Experimental Secondary Hyperparathyroidism

    DEFF Research Database (Denmark)

    Hofman-Bang, Jacob; Gravesen, Eva; Olgaard, Klaus

    2012-01-01

    Secondary hyperparathyroidism (s-HPT) in uremia is characterized by decreased expression in the parathyroids of calcium sensing (CaR) and vitamin D receptors (VDR). Parathyroid hormone (PTH) is normalized despite low levels of CaR and VDR after experimental reversal of uremia. The expression of Ca...

  6. Age-dependent alterations in Ca2+ homeostasis: Role of TRPV5 and TRPV6

    NARCIS (Netherlands)

    M. van Abel (Monique); S. Huybers (Sylvie); J.G. Hoenderop (Joost); A.W.C.M. Kemp (Annemiete); J.P.T.M. van Leeuwen (Hans); R.J.M. Bindels (René)

    2006-01-01

    textabstractAging is associated with alterations in Ca2+ homeostasis, which predisposes elder people to hyperparathyroidism and osteoporosis. Intestinal Ca2+ absorption decreases with aging and, in particular, active transport of Ca2+ by the duodenum. In addition, there are age-related changes in

  7. Coordinated regulation of TRPV5-mediated Ca(2)(+) transport in primary distal convolution cultures.

    NARCIS (Netherlands)

    Hagen, E.A.E. van der; Lavrijsen, M.; Zeeland, F. van; Praetorius, J.; Bonny, O.; Bindels, R.J.M.; Hoenderop, J.G.J.

    2014-01-01

    Fine-tuning of renal calcium ion (Ca(2+)) reabsorption takes place in the distal convoluted and connecting tubules (distal convolution) of the kidney via transcellular Ca(2+) transport, a process controlled by the epithelial Ca(2+) channel Transient Receptor Potential Vanilloid 5 (TRPV5). Studies to

  8. Microstructure and Mechanical Properties of Mg-8Li-(0, 1, 2)Ca-(0, 2)Gd Alloys

    Science.gov (United States)

    Miao, Wei; Che, Chunbo; Fu, Kunning; Wu, Ruizhi; Hou, Legan; Zhang, Jinghuai; Zhang, Milin

    2017-09-01

    A series of new Mg-8Li-xCa-yGd (x = 0, 1, 2; y = 0, 2; wt.%) alloys were prepared, and the microstructure and mechanical properties were investigated. The mechanical properties were characterized by tensile, compression and bending tests at room temperature. The results show that Mg-8Li-1Ca alloy is composed of alpha(Mg), beta(Li) and CaMg2 phases. In addition to the same phases in Mg-8Li-1Ca, there also exists CaLi2 phase in Mg-8Li-2Ca. In addition to the same phases in Mg-8Li-2Ca, GdMg5 phase is also formed in Mg-8Li-1Ca-2Gd alloy due to the addition of Gd. Both Ca and Gd have refining effect in the alloys, and the refining effect of Ca is better than that of Gd. The additions of Ca and Gd can improve the tensile strength and yield strength, but decrease the elongation and the bending strength. Comparing the mechanical properties of the investigated alloys, Mg-8Li-1Ca-2Gd possesses the best mechanical properties.

  9. Hereditary tubular transport disorders: implications for renal handling of Ca2+ and Mg2+.

    NARCIS (Netherlands)

    Dimke, H.; Hoenderop, J.G.J.; Bindels, R.J.M.

    2010-01-01

    The kidney plays an important role in maintaining the systemic Ca2+ and Mg2+ balance. Thus the renal reabsorptive capacity of these cations can be amended to adapt to disturbances in plasma Ca2+ and Mg2+ concentrations. The reabsorption of Ca2+ and Mg2+ is driven by transport of other electrolytes,

  10. CaMKII content affects contractile, but not mitochondrial, characteristics in regenerating skeletal muscle

    NARCIS (Netherlands)

    Eilers, W.; Jaspers, R.T.; de Haan, A.; Ferrié, C.; Valdivieso, P.; Flueck, M.

    2014-01-01

    Background: The multi-meric calcium/calmodulin-dependent protein kinase II (CaMKII) is the main CaMK in skeletal muscle and its expression increases with endurance training. CaMK family members are implicated in contraction-induced regulation of calcium handling, fast myosin type IIA expression and

  11. ARRHYTHMOGENIC CALMODULIN MUTATIONS AFFECT THE ACTIVATION AND TERMINATION OF CARDIAC RYANODINE RECEPTOR MEDIATED CA2+ RELEASE

    DEFF Research Database (Denmark)

    Søndergaard, Mads Toft; Chazin, Walter J.; Chen, Wayne S.R.

    long QT syndrome (LQTS) (D95V and D129G)2, on spontaneous Ca2+ release in HEK293 cells expressing the RyR2 channel. Furthermore, we studied the impact of these mutations on the interactions between CaM and a peptide corresponding to the RyR2 CaM binding domain (CaMBD) residue number 3581......M in the presence of RyR2 CaMBD. The D95V, N97S and D129G mutations lowered the affinity of Ca2+ binding of the C-lobe of CaM, to apparent KDs of ~ 140, 150, and 4000 nM, respectively, consistent with the critical role of these residues in Ca2+ binding to the C-lobe. Thus, we suggest that these mutations may shift...... in the other two CaM genes (CALM2 and CALM3). All CaM mutations are associated with severe ventricular arrhythmias. CaM regulates several key proteins governing cardiac excitation-contraction coupling (ECC), including the cardiac ryanodine receptor (RyR2) Ca2+ release channel. RyR2 mutations also dominantly...

  12. Ca 2+ and reactive oxygen species are involved in the defense ...

    African Journals Online (AJOL)

    When ethyleneglycoltetraacetic acid (Ca2+ chelator) or LaCl3 (Ca2+channel blocker) was added, the necrotic response of calli to elicitor treatment was also significantly weakened, implying the involvement of Ca2+ in the defense response. Key Words: Oryza sativa, Magnaporthe grisea, hypersensitive response, reactive ...

  13. 75 FR 65985 - Safety Zone: Epic Roasthouse Private Party Firework Display, San Francisco, CA

    Science.gov (United States)

    2010-10-27

    ... off Epic Roasthouse Restaurant, San Francisco, CA during a fireworks display in support of the Epic... Restaurant, San Francisco, CA. The fireworks display is meant for entertainment purposes. This safety zone is... Epic Roasthouse Restaurant, San Francisco, CA. The fireworks launch site will be located in position 37...

  14. Physiology of Ca2+ signalling in stem cells of different origins and differentiation stages

    Czech Academy of Sciences Publication Activity Database

    Forostyak, O.; Forostyak, S.; Kortus, Štěpán; Syková, E.; Verkhratsky, A.; Dayanithi, G.

    2016-01-01

    Roč. 59, 2-3 (2016), s. 57-66 ISSN 0143-4160 R&D Projects: GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:67985823 Keywords : stem cells * Ca2+ channels * Ca2+ signalling * spontaneous Ca2+ oscillations Subject RIV: FH - Neurology Impact factor: 3.707, year: 2016

  15. Fusion-activated Ca(2+ entry: an "active zone" of elevated Ca(2+ during the postfusion stage of lamellar body exocytosis in rat type II pneumocytes.

    Directory of Open Access Journals (Sweden)

    Pika Miklavc

    2010-06-01

    Full Text Available Ca(2+ is essential for vesicle fusion with the plasma membrane in virtually all types of regulated exocytoses. However, in contrast to the well-known effects of a high cytoplasmic Ca(2+ concentration ([Ca(2+](c in the prefusion phase, the occurrence and significance of Ca(2+ signals in the postfusion phase have not been described before.We studied isolated rat alveolar type II cells using previously developed imaging techniques. These cells release pulmonary surfactant, a complex of lipids and proteins, from secretory vesicles (lamellar bodies in an exceptionally slow, Ca(2+- and actin-dependent process. Measurements of fusion pore formation by darkfield scattered light intensity decrease or FM 1-43 fluorescence intensity increase were combined with analysis of [Ca(2+](c by ratiometric Fura-2 or Fluo-4 fluorescence measurements. We found that the majority of single lamellar body fusion events were followed by a transient (t(1/2 of decay = 3.2 s rise of localized [Ca(2+](c originating at the site of lamellar body fusion. [Ca(2+](c increase followed with a delay of approximately 0.2-0.5 s (method-dependent and in the majority of cases this signal propagated throughout the cell (at approximately 10 microm/s. Removal of Ca(2+ from, or addition of Ni(2+ to the extracellular solution, strongly inhibited these [Ca(2+](c transients, whereas Ca(2+ store depletion with thapsigargin had no effect. Actin-GFP fluorescence around fused LBs increased several seconds after the rise of [Ca(2+](c. Both effects were reduced by the non-specific Ca(2+ channel blocker SKF96365.Fusion-activated Ca(2+entry (FACE is a new mechanism that leads to [Ca(2+](c transients at the site of vesicle fusion. Substantial evidence from this and previous studies indicates that fusion-activated Ca(2+ entry enhances localized surfactant release from type II cells, but it may also play a role for compensatory endocytosis and other cellular functions.

  16. Simultaneous decontamination of cross-polluted soils with heavy metals and PCBs using a nano-metallic Ca/CaO dispersion mixture.

    Science.gov (United States)

    Mallampati, Srinivasa Reddy; Mitoma, Yoshiharu; Okuda, Tetsuji; Sakita, Shogo; Simion, Cristian

    2014-01-01

    In the present work, we investigated the use of nano-metallic calcium (Ca) and calcium oxide (CaO) dispersion mixture for the simultaneous remediation of contaminated soils with both heavy metals (As, Cd, Cr, and Pb) and polychlorinated biphenyls (PCBs). Regardless of soil moisture content, nano-metallic Ca/CaO dispersion mixture achieved about 95-99% of heavy metal immobilization by a simple grinding process. During the same treatment, reasonable PCB hydrodechlorination efficiencies were obtained (up to 97%), though higher hydrodechlorination efficiency by preliminary drying of soil was observed.

  17. Stapled Voltage-Gated Calcium Channel (CaV) α-Interaction Domain (AID) Peptides Act As Selective Protein-Protein Interaction Inhibitors of CaV Function.

    Science.gov (United States)

    Findeisen, Felix; Campiglio, Marta; Jo, Hyunil; Abderemane-Ali, Fayal; Rumpf, Christine H; Pope, Lianne; Rossen, Nathan D; Flucher, Bernhard E; DeGrado, William F; Minor, Daniel L

    2017-06-21

    For many voltage-gated ion channels (VGICs), creation of a properly functioning ion channel requires the formation of specific protein-protein interactions between the transmembrane pore-forming subunits and cystoplasmic accessory subunits. Despite the importance of such protein-protein interactions in VGIC function and assembly, their potential as sites for VGIC modulator development has been largely overlooked. Here, we develop meta-xylyl (m-xylyl) stapled peptides that target a prototypic VGIC high affinity protein-protein interaction, the interaction between the voltage-gated calcium channel (CaV) pore-forming subunit α-interaction domain (AID) and cytoplasmic β-subunit (CaVβ). We show using circular dichroism spectroscopy, X-ray crystallography, and isothermal titration calorimetry that the m-xylyl staples enhance AID helix formation are structurally compatible with native-like AID:CaVβ interactions and reduce the entropic penalty associated with AID binding to CaVβ. Importantly, electrophysiological studies reveal that stapled AID peptides act as effective inhibitors of the CaVα1:CaVβ interaction that modulate CaV function in an CaVβ isoform-selective manner. Together, our studies provide a proof-of-concept demonstration of the use of protein-protein interaction inhibitors to control VGIC function and point to strategies for improved AID-based CaV modulator design.

  18. Flavonoid Myricetin Modulates G A B A A Receptor Activity through Activation of Ca 2+ Channels and CaMK-II Pathway

    Science.gov (United States)

    Zhang, Xiao Hu; Ma, Ze Gang; Rowlands, Dewi Kenneth; Gou, Yu Lin; Fok, Kin Lam; Wong, Hau Yan; Yu, Mei Kuen; Tsang, Lai Ling; Mu, Li; Chen, Lei; Yung, Wing Ho; Chung, Yiu Wa; Zhang, Bei Lin; Zhao, Hua; Chan, Hsiao Chang

    2012-01-01

    The flavonoid myricetin is found in several sedative herbs, for example, the St. John's Wort, but its influence on sedation and its possible mechanism of action are unknown. Using patch-clamp technique on a brain slice preparation, the present study found that myricetin promoted GABAergic activity in the neurons of hypothalamic paraventricular nucleus (PVN) by increasing the decay time and frequency of the inhibitory currents mediated by GABAA receptor. This effect of myricetin was not blocked by the GABAA receptor benzodiazepine- (BZ-) binding site antagonist flumazenil, but by KN-62, a specific inhibitor of the Ca2+/calmodulin-stimulated protein kinase II (CaMK-II). Patch clamp and live Ca2+ imaging studies found that myricetin could increase Ca2+ current and intracellular Ca2+ concentration, respectively, via T- and L-type Ca2+ channels in rat PVN neurons and hypothalamic primary culture neurons. Immunofluorescence staining showed increased phosphorylation of CaMK-II after myricetin incubation in primary culture of rat hypothalamic neurons, and the myricetin-induced CaMK-II phosphorylation was further confirmed by Western blotting in PC-12 cells. The present results suggest that myricetin enhances GABAA receptor activity via calcium channel/CaMK-II dependent mechanism, which is distinctively different from that of most existing BZ-binding site agonists of GABAA receptor. PMID:23258999

  19. Genetic deletion of calcium/calmodulin-dependent protein kinase kinase β (CaMKK β) or CaMK IV exacerbates stroke outcomes in ovariectomized (OVXed) female mice.

    Science.gov (United States)

    Liu, Lin; McCullough, Louise; Li, Jun

    2014-10-21

    Stroke is the primary cause of long-term disability in the United States. Interestingly, mounting evidence has suggested potential sex differences in the response to stroke treatment in patients as, at least in part, distinct cell death programs may be triggered in females and males following stroke. The NIH has recognized that females are strikingly under-represented in pre-clinical trials. Calcium/calmodulin-dependent protein kinase kinase (CaMKK) is a major kinase that is activated by elevated intracellular calcium. It has recently been suggested that CaMKK and CaMK IV, a downstream target molecule, are neuroprotective in stroke in males. In this study, we examined stroke outcomes in ovariectomized CaMKK β and CaMK IV deficient females. Cell death/survival signaling and inflammatory responses were assessed. Our results demonstrated that CaMKK β or CaMK IV KO exacerbated both ischemic injury and behavioral deficits in female mice. Genetic deletion of CaMKK β or CaMK IV increased hemorrhagic transformation after stroke, and this was associated with both increased MMP9 activity and loss of the blood brain barrier (BBB) protein collagen IV. Transcriptional inactivation was observed in mice lacking either CaMKK β or CaMK IV, as indicated by reduced levels of phosphorylated cAMP response element-binding protein (p-CREB) and B-cell lymphoma 2 (BCL-2) proteins. Finally, inhibiting this pathway exacerbated the inflammatory response to stroke as CaMKK β or CaMK IV KO mice had increased levels of the pro-inflammatory serum cytokines tumor necrosis factor alpha (TNFα) and interleukin 6 (IL-6) after stroke. This suggests that the CaMKK pathway is involved in the immune response to brain injury. Inhibition of CaMKK signaling exacerbated stroke outcome and increased BBB impairment, transcriptional inactivation and inflammatory responses in females after stroke. Therefore, CaMKK signaling may be a potential target for stroke treatment in both males and females.

  20. Development of novel antibacterial active, HaCaT biocompatible and biodegradable CA-g-P(3HB-EC biocomposites with caffeic acid as a functional entity

    Directory of Open Access Journals (Sweden)

    H. M. N. Iqbal

    2015-09-01

    Full Text Available We have developed novel composites by grafting caffeic acid (CA onto the P(3HB-EC based material and laccase from Trametes versicolor was used for grafting purposes. The resulting composites were designated as CA-g-P(3HB-EC i.e., P(3HB-EC (control, 5CA-g-P(3HB-EC, 10CA-g-P(3HB-EC, 15CA-g-P(3HB-EC and 20CA-g-P(3HB-EC. FT-IR (Fourier-transform infrared spectroscopy was used to examine the functional and elemental groups of the control and laccase-assisted graft composites. Evidently, 15CA-g-P(3HB-EC composite exhibited resilient antibacterial activity against Gram-positive and Gram-negative bacterial strains. Moreover, a significant level of biocompatibility and biodegradability of the CA-g-P(3HB-EC composites was also achieved with the human keratinocytes-like HaCaT cells and soil burial evaluation, respectively. In conclusion, the newly developed novel composites with multi characteristics could well represent the new wave of biomaterials for medical applications, and more specifically have promising future in the infection free would dressings, burn and/or skin regeneration field due to their sophisticated characteristics.

  1. Inhibition of the sarco/endoplasmic reticulum (ER) Ca2+-ATPase by thapsigargin analogs induces cell death via ER Ca2+ depletion and the unfolded protein response

    DEFF Research Database (Denmark)

    Sehgal, Pankaj; Szalai, Paula; Olesen, Claus

    2017-01-01

    Calcium (Ca2+) is a fundamental regulator of cell signaling and function. Thapsigargin (Tg) blocks the sarco/endoplasmic reticulum (ER) Ca2+-ATPase (SERCA), disrupts Ca2+ homeostasis, and causes cell death. However, the exact mechanisms whereby SERCA-inhibition induces cell death are incompletely...... and their detrimental effects on cell viability. Furthermore, caspase activation and cell death were associated with a sustained unfolded protein response (UPR). We conclude that ER Ca2+ drainage and sustained UPR activation are key for initiation of apoptosis at low concentrations of Tg and Tg analogs, whereas high...

  2. Preoperative sensitivity and specificity for early-stage ovarian cancer when combining cancer antigen CA-125II, CA 15-3, CA 72-4, and macrophage colony-stimulating factor using mixtures of multivariate normal distributions

    NARCIS (Netherlands)

    Skates, S.J.; Horick, N.; Yu, Y.H.; Xu, F.J.; Berchuck, A.; Havrilesky, L.J.; de Bruijn, H.W.A.; van der Zee, A.G.J.; Woolas, R.P.; Jacobs, I.J.; Zhang, 27727; Bast, R.C.; Zhang, Z

    2004-01-01

    Purpose In CA-125–based ovarian cancer screening trials, overall specificity and screening sensitivity of ultrasound after an elevated CA-125 exceeded 99.6% and 70%, respectively, thereby yielding a positive predictive value (PPV) exceeding 10%. However, sensitivity for early-stage disease was only

  3. Competitive tuning: Competition's role in setting the frequency-dependence of Ca2+-dependent proteins.

    Directory of Open Access Journals (Sweden)

    Daniel R Romano

    2017-11-01

    Full Text Available A number of neurological disorders arise from perturbations in biochemical signaling and protein complex formation within neurons. Normally, proteins form networks that when activated produce persistent changes in a synapse's molecular composition. In hippocampal neurons, calcium ion (Ca2+ flux through N-methyl-D-aspartate (NMDA receptors activates Ca2+/calmodulin signal transduction networks that either increase or decrease the strength of the neuronal synapse, phenomena known as long-term potentiation (LTP or long-term depression (LTD, respectively. The calcium-sensor calmodulin (CaM acts as a common activator of the networks responsible for both LTP and LTD. This is possible, in part, because CaM binding proteins are "tuned" to different Ca2+ flux signals by their unique binding and activation dynamics. Computational modeling is used to describe the binding and activation dynamics of Ca2+/CaM signal transduction and can be used to guide focused experimental studies. Although CaM binds over 100 proteins, practical limitations cause many models to include only one or two CaM-activated proteins. In this work, we view Ca2+/CaM as a limiting resource in the signal transduction pathway owing to its low abundance relative to its binding partners. With this view, we investigate the effect of competitive binding on the dynamics of CaM binding partner activation. Using an explicit model of Ca2+, CaM, and seven highly-expressed hippocampal CaM binding proteins, we find that competition for CaM binding serves as a tuning mechanism: the presence of competitors shifts and sharpens the Ca2+ frequency-dependence of CaM binding proteins. Notably, we find that simulated competition may be sufficient to recreate the in vivo frequency dependence of the CaM-dependent phosphatase calcineurin. Additionally, competition alone (without feedback mechanisms or spatial parameters could replicate counter-intuitive experimental observations of decreased activation of Ca2

  4. High-pressure behavior of CaMo O4

    Science.gov (United States)

    Panchal, V.; Garg, N.; Poswal, H. K.; Errandonea, D.; Rodríguez-Hernández, P.; Muñoz, A.; Cavalli, E.

    2017-09-01

    We report a high-pressure study of tetragonal scheelite-type CaMo O4 up to 29 GPa. In order to characterize its high-pressure behavior, we have combined Raman and optical-absorption measurements with density functional theory calculations. We have found evidence of a pressure-induced phase transition near 15 GPa. Experiments and calculations agree in assigning the high-pressure phase to a monoclinic fergusonite-type structure. The reported results are consistent with previous powder x-ray-diffraction experiments, but are in contradiction with the conclusions obtained from earlier Raman measurements, which support the existence of more than one phase transition in the pressure range covered by our studies. The observed scheelite-fergusonite transition induces significant changes in the electronic band gap and phonon spectrum of CaMo O4 . We have determined the pressure evolution of the band gap for the low- and high-pressure phases as well as the frequencies and pressure dependencies of the Raman-active and infrared-active modes. In addition, based on calculations of the phonon dispersion of the scheelite phase, carried out at a pressure higher than the transition pressure, we propose a possible mechanism for the reported phase transition. Furthermore, from the calculations we determined the pressure dependence of the unit-cell parameters and atomic positions of the different phases and their room-temperature equations of state. These results are compared with previous experiments showing a very good agreement. Finally, information on bond compressibility is reported and correlated with the macroscopic compressibility of CaMo O4 . The reported results are of interest for the many technological applications of this oxide.

  5. Biophysical analysis of the dynamics of calmodulin interactions with neurogranin and Ca(2+) /calmodulin-dependent kinase II.

    Science.gov (United States)

    Seeger, Christian; Talibov, Vladimir O; Danielson, U Helena

    2017-08-01

    Calmodulin (CaM) functions depend on interactions with CaM-binding proteins, regulated by Ca2+. Induced structural changes influence the affinity, kinetics, and specificities of the interactions. The dynamics of CaM interactions with neurogranin (Ng) and the CaM-binding region of Ca2+/calmodulin-dependent kinase II (CaMKII290-309 ) have been studied using biophysical methods. These proteins have opposite Ca2+ dependencies for CaM binding. Surface plasmon resonance biosensor analysis confirmed that Ca2+ and CaM interact very rapidly, and with moderate affinity ( KDSPR=3μM). Calmodulin-CaMKII290-309 interactions were only detected in the presence of Ca2+, exhibiting fast kinetics and nanomolar affinity ( KDSPR=7.1nM). The CaM-Ng interaction had higher affinity under Ca2+-depleted ( KDSPR=480nM,k1=3.4×105M-1s-1 and k-1 = 1.6 × 10(-1) s(-1) ) than Ca2+-saturated conditions ( KDSPR=19μM). The IQ motif of Ng (Ng27-50 ) had similar affinity for CaM as Ng under Ca2+-saturated conditions ( KDSPR=14μM), but no interaction was seen under Ca2+-depleted conditions. Microscale thermophoresis using fluorescently labeled CaM confirmed the surface plasmon resonance results qualitatively, but estimated lower affinities for the Ng ( KDMST=890nM) and CaMKII290-309 ( KDMST=190nM) interactions. Although CaMKII290-309 showed expected interaction characteristics, they may be different for full-length CaMKII. The data for full-length Ng, but not Ng27-50 , agree with the current model on Ng regulation of Ca2+/CaM signaling. © 2017 The Authors Journal of Molecular Recognition Published by John Wiley & Sons Ltd.

  6. Lipid membranes loaded with Ca2+ and Zn2+ cations

    Science.gov (United States)

    Kučerka, N.; Dushanov, E.; Kholmurodov, K. T.; Katsaras, J.; Uhríková, D.

    2017-05-01

    We have studied the interactions of calcium and zinc with the biomimetic membrane made of dipalmitoyl-phosphatidylcholine (DPPC). The small angle neutron experiment on oriented multilamellar samples showed clearly differences in the effects of the two cations. For both, a bilayer thickness increases due to divalent metal ion (Me2+) binding, reaching the maximum at stoichiometry Me2+:DPPC∼1:7 mol/mol. However, while the further increase in Ca2+ results in a bilayer thinning down to the level of pure DPPC, the Zn2+ binding indicates the behaviour of a typical isotherm, reaching a level of saturation.

  7. Mora y Cañas: su vida y destino

    OpenAIRE

    Obregón Loría, Rafael

    2013-01-01

    Se resaltan los vínculos entre Juan Rafael Mora Porras y José María CañasEscamilla, tanto en sus relaciones familiares y comerciales como en su condición de máximos líderes de la Campaña Nacional contra el ejército filibustero. Además, víctimas de los mismos enemigos políticos, morirían fusilados en Puntarenas, Costa Rica, en 1860

  8. Characterization of Precipitated CaCO3 Synthesized from Dolomite

    Science.gov (United States)

    Arifin, Zaenal; Fitria Apriliani, Nurul; Zainuri, Mochamad; Darminto, dan

    2017-05-01

    The precipitated CaCO3 has successfully been synthesized from dolomite. The influence of various temperature and carbonation rate on the morphology, crystal size, phase and structure of the carbonation products were studied. The particles resulted from this process have the crystal size 400-800 nm. The calcite phase wasformed inthe synthesis at 30°C with carbonation rate of 2 and 7 SCFH, and synthesis at 80 °C and 2 SCFH also produces calcite phase. Observations by SEM shows morphology of calcite as so-called schalenohedral.

  9. La mise en patrimoine sur ONF.ca

    Directory of Open Access Journals (Sweden)

    Michèle Garneau

    2015-05-01

    Full Text Available Résumé Ce texte propose une approche à la fois descriptive, analytique et critique de la très active production patrimoniale actuellement en cours sur ONF.ca. En se donnant comme mission de rendre accessible son patrimoine audiovisuel, l’Office se soucie d’en orienter la réception, de proposer aux internautes l’histoire de son action audiovisuelle depuis sa fondation en 1939. Par le relevé d’un certain nombre de valeurs exhibées (authenticité, représentativité, renommée et proximité, et de registres privilégiés (dont celui de la commémoration, l’auteur tente de circonscrire une axiologie du patrimoine sur ONF.ca. Dans sa seconde partie, le texte se consacre à la question de l’articulation (et de l’écart entre mémoire patrimoniale et mémoires particulières (des films afin de mieux cerner les contours politiques et les enjeux idéologiques de l’encadrement discursif des collections. Abstract This article offers a descriptive, analytical and critical approach to the very active production of audiovisual heritage currently underway at NFB.ca. Designed to make the National Film Board (NFB’s audiovisual heritage more accessible, the website carefully guides its users through the history-memory of audiovisual production at the Film Board from its foundation in 1939 through to the present. By analyzing how the website showcases its films, endorsing specific values (authenticity, representativeness, recognition and proximity and privileging certain registers (such as commemoration, the article first attempts to define an axiology of heritage in NFB.ca. The article then focuses on questions of the articulation of (and the variation between history-memory and particular memories (of films in order to better outline the political contours and ideological stakes of the discursive framework of the NFB’s collections.

  10. Differential Somatic Ca2+ Channel Profile in Midbrain Dopaminergic Neurons.

    Science.gov (United States)

    Philippart, Fabian; Destreel, Geoffrey; Merino-Sepúlveda, Paulina; Henny, Pablo; Engel, Dominique; Seutin, Vincent

    2016-07-06

    Dopaminergic (DA) neurons located in the ventral midbrain continuously generate a slow endogenous pacemaker activity, the mechanism of which is still debated. It has been suggested that, in the substantia nigra pars compacta (SNc), the pacemaking relies more on Ca(2+) channels and that the density of L-type Ca(2+) channels is higher in these DA neurons than in those located in the ventral tegmental area (VTA). This might lead to a higher Ca(2+) load in SNc DA neurons and explain their higher susceptibility to degeneration. However, direct evidence for this hypothesis is lacking. We found that the L-type current and channel density are indeed higher in the somata of rat SNc DA neurons and that this current undergoes less inactivation in this region. Nonstationary fluctuation analysis measurements showed a much higher number of L-type channels in the soma of SNc DA neurons, as well as a smaller single-channel conductance, pointing to a possible different molecular identity of L-type channels in DA neurons from the two areas. A major consequence of this is that pacemaking and, even more so, bursting are associated with a larger Ca(2+) entry through L-type channels in SNc DA neurons than in their VTA counterparts. Our results establish a molecular and functional difference between two populations of midbrain DA neurons that may contribute to their differential sensitivity to neurodegeneration. Dopamine neurons from the substantia nigra pars compacta (SNc) and ventral tegmental area (VTA) are involved in various brain functions, such as movement initiation and goal directed behavior, respectively. This work shows that, although both neurons fire in a similar regular and slow pacemaker mode, this firing activity is supported by different calcium channel landscapes. Indeed, the L-type calcium current is larger in the soma of dopamine neurons of the SNc, leading to a higher charge transfer through L-type channels during pacemaking and bursting. Therefore, these neurons may

  11. 45Ca distribution and transport in saponin skinned vascular smooth muscle.

    Science.gov (United States)

    Stout, M A; Diecke, F P

    1983-04-01

    45Ca distribution and transport were studied in chemically skinned strips of caudal artery from Kyoto Wistar rats. Sarcolemmal membranes were made hyperpermeable by exposure for 60 min to solutions containing 0.1 mg/ml of saponin. Skinned helical strips responded with graded contractions to changes in ethylene glycol bis-(beta-aminoethyl ether)-N,N'-tetraacetic acid buffered free Ca solutions (10(-7) to 10(-5) M) and were sensitive to the Mg-ATP concentration. Tissues loaded in the presence of 10(-7) M Ca contracted in response to 10 mM caffeine. These experiments indicate the strips are skinned and possess a functional regulatory and contractile system and an intact Ca sequestering system. 45Ca distributes in three compartments in skinned caudal artery strips. The Ca contents of two components are linear functions of the Ca-ethylene glycol bis-(beta-aminoethyl ether)-N,N'-tetraacetic acid concentration and desaturate at rapid rates. They correspond to the extracellular and cytoplasmic spaces. A significantly smaller component releases Ca at comparatively slower rates. 45Ca uptake by the slow component consists of an ATP-dependent and an ATP-independent fraction. The 45Ca content of the ATP-dependent fraction is a function of the free Ca concentration and is independent of the Ca-ethylene glycol bis-(beta-aminoethyl ether)-N,N'-tetraacetic acid concentration. Its content was enhanced by oxalate and was abolished by Triton X-100 skinning solutions. The ATP-independent component was not affected by Triton X-100 skinning and may represent Ca binding to cytoplasmic molecules and structures. The sequestered Ca was released with caffeine or Ca but not by epinephrine. The observations indicate that the sarcoplasmic reticulum and mitochondria of vascular smooth muscle strips skinned with saponin retain their functional integrity after saponin skinning.

  12. Co-Effect of Histamine on Ca2+-Dependent Signaling Pathways in Rat Conjunctival Goblet Cells

    Science.gov (United States)

    Li, Dayu; Carozza, Richard B.; Shatos, Marie A.; Hodges, Robin R.; Dartt, Darlene A.

    2012-01-01

    Purpose. The purpose of this study was to determine the Ca2+-dependent cellular signaling pathways used by histamine to stimulate conjunctival goblet cell secretion. Methods. Cultured rat goblet cells were grown in RPMI 1640. Goblet cell secretion of high molecular weight glycoconjugates was measured by an enzyme-linked lectin assay. Intracellular [Ca2+] ([Ca2+]i) was measured by loading cultured cells with the Ca2+ sensitive dye fura-2. The level of [Ca2+]i was measured using fluorescence microscopy. Extracellular regulated kinase (ERK) 2 was depleted using small interfering RNA (siRNA). Results. Histamine-stimulated conjunctival goblet cell secretion of high molecular weight glycoproteins was blocked by removal of extracellular Ca2+ and depletion of ERK2 by siRNA. Histamine increase in [Ca2+]i was desensitized by repeated addition of agonist and blocked by a phospholipase C antagonist. Histamine at higher doses increased [Ca2+]i by stimulating influx of extracellular Ca2+, but at a lower dose released Ca2+ from intracellular stores. Activation of each histamine receptor subtype (H1–H4) increased [Ca2+]i and histamine stimulation was blocked by antagonists of each receptor subtype. The H2 receptor subtype increase in [Ca2+]i was cAMP dependent. Conclusions. We conclude that histamine activates phospholipase C to release intracellular Ca2+ that induces the influx of extracellular Ca2+ and activates ERK1/2 to stimulate conjunctival goblet cell mucous secretion, and that activation of all four histamine receptor subtypes can increase [Ca2+]i. PMID:22956601

  13. Characterization of the ER-Targeted Low Affinity Ca2+ Probe D4ER

    Directory of Open Access Journals (Sweden)

    Elisa Greotti

    2016-09-01

    Full Text Available Calcium ion (Ca2+ is a ubiquitous intracellular messenger and changes in its concentration impact on nearly every aspect of cell life. Endoplasmic reticulum (ER represents the major intracellular Ca2+ store and the free Ca2+ concentration ([Ca2+] within its lumen ([Ca2+]ER can reach levels higher than 1 mM. Several genetically-encoded ER-targeted Ca2+ sensors have been developed over the last years. However, most of them are non-ratiometric and, thus, their signal is difficult to calibrate in live cells and is affected by shifts in the focal plane and artifactual movements of the sample. On the other hand, existing ratiometric Ca2+ probes are plagued by different drawbacks, such as a double dissociation constant (Kd for Ca2+, low dynamic range, and an affinity for the cation that is too high for the levels of [Ca2+] in the ER lumen. Here, we report the characterization of a recently generated ER-targeted, Förster resonance energy transfer (FRET-based, Cameleon probe, named D4ER, characterized by suitable Ca2+ affinity and dynamic range for monitoring [Ca2+] variations within the ER. As an example, resting [Ca2+]ER have been evaluated in a known paradigm of altered ER Ca2+ homeostasis, i.e., in cells expressing a mutated form of the familial Alzheimer’s Disease-linked protein Presenilin 2 (PS2. The lower Ca2+ affinity of the D4ER probe, compared to that of the previously generated D1ER, allowed the detection of a conspicuous, more clear-cut, reduction in ER Ca2+ content in cells expressing mutated PS2, compared to controls.

  14. Ca(2+) clearance by plasmalemmal NCLX, Li(+)-permeable Na(+)/Ca(2+) exchanger, is required for the sustained exocytosis in rat insulinoma INS-1 cells.

    Science.gov (United States)

    Han, Young-Eun; Ryu, Shin-Young; Park, Sun-Hyun; Lee, Kyu-Hee; Lee, Suk-Ho; Ho, Won-Kyung

    2015-12-01

    Na(+)/Ca(2+) exchangers are key players for Ca(2+) clearance in pancreatic β-cells, but their molecular determinants and roles in insulin secretion are not fully understood. In the present study, we newly discovered that the Li(+)-permeable Na(+)/Ca(2+) exchangers (NCLX), which were known as mitochondrial Na(+)/Ca(2+) exchangers, contributed to the Na(+)-dependent Ca(2+) movement across the plasma membrane in rat INS-1 insulinoma cells. Na(+)/Ca(2+) exchange activity by NCLX was comparable to that by the Na(+)/Ca(2+) exchanger, NCX. We also confirmed the presence of NCLX proteins on the plasma membrane using immunocytochemistry and cell surface biotinylation experiments. We further investigated the role of NCLX on exocytosis function by measuring the capacitance increase in response to repetitive depolarization. Small interfering (si)RNA-mediated downregulation of NCLX did not affect the initial exocytosis, but significantly suppressed sustained exocytosis and recovery of exocytosis. XIP (NCX inhibitory peptide) or Na(+) replacement for inhibiting Na(+)-dependent Ca(2+) clearance also selectively suppressed sustained exocytosis. Consistent with the idea that sustained exocytosis requires ATP-dependent vesicle recruitment, mitochondrial function, assessed by mitochondrial membrane potential (ΔΨ), was impaired by siNCLX or XIP. However, depolarization-induced exocytosis was hardly affected by changes in intracellular Na(+) concentration, suggesting a negligible contribution of mitochondrial Na(+)/Ca(2+) exchanger. Taken together, our data indicate that Na(+)/Ca(2+) exchanger-mediated Ca(2+) clearance mediated by NCLX and NCX is crucial for optimizing mitochondrial function, which in turn contributes to vesicle recruitment for sustained exocytosis in pancreatic β-cells.

  15. Leptin facilitates learning and memory performance and enhances hippocampal CA1 long-term potentiation and CaMK II phosphorylation in rats.

    Science.gov (United States)

    Oomura, Y; Hori, N; Shiraishi, T; Fukunaga, K; Takeda, H; Tsuji, M; Matsumiya, T; Ishibashi, M; Aou, S; Li, X L; Kohno, D; Uramura, K; Sougawa, H; Yada, T; Wayner, M J; Sasaki, K

    2006-11-01

    Leptin, an adipocytokine encoded by an obesity gene and expressed in adipose tissue, affects feeding behavior, thermogenesis, and neuroendocrine status via leptin receptors distributed in the brain, especially in the hypothalamus. Leptin may also modulate the synaptic plasticity and behavioral performance related to learning and memory since: leptin receptors are found in the hippocampus, and both leptin and its receptor share structural and functional similarities with the interleukin-6 family of cytokines that modulate long-term potentiation (LTP) in the hippocampus. We therefore examined the effect of leptin on (1) behavioral performance in emotional and spatial learning tasks, (2) LTP at Schaffer collateral-CA1 synapses, (3) presynaptic and postsynaptic activities in hippocampal CA1 neurons, (4) the intracellular Ca(2+) concentration ([Ca(2+)](i)) in CA1 neurons, and (5) the activity of Ca(2+)/calmodulin protein kinase II (CaMK II) in the hippocampal CA1 tissue that exhibits LTP. Intravenous injection of 5 and/or 50mug/kg, but not of 500mug/kg leptin, facilitated behavioral performance in passive avoidance and Morris water-maze tasks. Bath application of 10(-12)M leptin in slice experiments enhanced LTP and increased the presynaptic transmitter release, whereas 10(-10)M leptin suppressed LTP and reduced the postsynaptic receptor sensitivity to N-methyl-d-aspartic acid. The increase in the [Ca(2+)](i) induced by 10(-10)M leptin was two times greater than that induced by 10(-12)M leptin. In addition, the facilitation (10(-12)M) and suppression (10(-10)M) of LTP by leptin was closely associated with an increase and decrease in Ca(2+)-independent activity of CaMK II. Our results show that leptin not only affects hypothalamic functions (such as feeding, thermogenesis, and neuroendocrine status), but also modulates higher nervous functions, such as the behavioral performance related to learning and memory and hippocampal synaptic plasticity.

  16. Prenatal nicotine and maternal deprivation stress de-regulate the development of CA1, CA3, and dentate gyrus neurons in hippocampus of infant rats.

    Directory of Open Access Journals (Sweden)

    Hong Wang

    Full Text Available Adverse experiences by the developing fetus and in early childhood are associated with profound effects on learning, emotional behavior, and cognition as a whole. In this study we investigated the effects of prenatal nicotine exposure (NIC, postnatal maternal deprivation (MD or the combination of the two (NIC+MD to determine if hippocampal neuron development is modulated by exposure to drugs of abuse and/or stress. Growth of rat offspring exposed to MD alone or NIC+MD was repressed until after weaning. In CA1 but not CA3 of postnatal day 14 (P14 pups, MD increased pyramidal neurons, however, in dentate gyrus (DG, decreased granule neurons. NIC had no effect on neuron number in CA1, CA3 or DG. Unexpectedly, NIC plus MD combined caused a synergistic increase in the number of CA1 or CA3 neurons. Neuron density in CA regions was unaffected by treatment, but in the DG, granule neurons had a looser packing density after NIC, MD or NIC+MD exposure. When septotemporal axes were analyzed, the synergism of stress and drug exposure in CA1 and CA3 was associated with rostral, whereas MD effects were predominantly associated with caudal neurons. TUNEL labeling suggests no active apoptosis at P14, and doublecortin positive neurons and mossy fibers were diminished in NIC+MD relative to controls. The laterality of the effect of nicotine and/or maternal deprivation in right versus left hippocampus was also analyzed and found to be insiginificant. We report for the first time that early life stressors such as postnatal MD and prenatal NIC exposure, when combined, may exhibit synergistic consequences for CA1 and CA3 pyramidal neuron development, and a potential antagonistic influence on developing DG neurons. These results suggest that early stressors may modulate neurogenesis, apoptosis, or maturation of glutamatergic neurons in the hippocampus in a region-specific manner during critical periods of neurodevelopment.

  17. New roles for icosahedral clusters in intermetallic phases: micelle-like segregation of Ca-Cd and Cu-Cd interactions in Ca10Cd27Cu2.

    Science.gov (United States)

    Hadler, Amelia B; Harris, Nicholas A; Fredrickson, Daniel C

    2013-11-20

    Despite significant progress in the structural characterization of the quasicrystalline state, the chemical origins of long- and short-range icosahedral order remain mysterious and a subject of debate. In this Article, we present the crystal structure of a new complex intermetallic phase, Ca10Cd27Cu2 (mC234.24), whose geometrical features offer clues to the driving forces underlying the icosahedral clusters that occur in Bergman-type quasicrystals. Ca10Cd27Cu2 adopts a C-centered monoclinic superstructure of the 1/1 Bergman approximant structure, in which [110] layers of Bergman clusters in the 1/1 structure are separated through the insertion of additional atoms (accompanied by substantial positional disorder). An examination of the coordination environments of Ca and Cu (in the ordered regions) reveals that the structure can be viewed as a combination of coordination polyhedra present in the nearest binary phases in the Ca-Cd-Cu compositional space. A notable feature is the separation of Ca-Cd and Cu-Cd interactions, with Bergman clusters emerging as Ca-Cd Friauf polyhedra (derived from the MgZn2-type CaCd2 phase) encapsulate a Cu-Cd icosahedron similar to those appearing in Cu2Cd5. DFT chemical pressure calculations on nearby binary phases point to the importance of this segregation of Ca-Cd and Cu-Cd interactions. The mismatch in atomic size between Cu and Cd leads to an inability to satisfy Ca-Cu and Ca-Cd interactions simultaneously in the Friauf polyhedra of the nearby Laves phase CaCd2. The relegation of the Cu atoms to icosahedra prevents this frustration while nucleating the formation of Bergman clusters.

  18. Sustained increase of spontaneous input and spike transfer in the CA3-CA1 pathway following long term potentiation in vivo

    Directory of Open Access Journals (Sweden)

    Oscar eHerreras

    2012-10-01

    Full Text Available Long term potentiation (LTP is commonly used to study synaptic plasticity but the associated changes in the spontaneous activity of individual neurons or the computational properties of neural networks in vivo remain largely unclear. The multisynaptic origin of spontaneous spikes makes difficult estimating the impact of a particular potentiated input. Accordingly, we adopted an approach that isolates pathway-specific postsynaptic activity from raw local field potentials (LFPs in the rat hippocampus in order to study the effects of LTP on ongoing spike transfer between cell pairs in the CA3-CA1 pathway. CA1 Schaffer-specific LFPs elicited by spontaneous clustered firing of CA3 pyramidal cells involved a regular succession of elementary micro-field-EPSPs (gamma-frequency that fired spikes in CA1 units. LTP increased the amplitude but not the frequency of these ongoing excitatory quanta. Also, the proportion of Schaffer-driven spikes in both CA1 pyramidal cells and interneurons increased in a cell-specific manner only in previously connected CA3-CA1 cell pairs, i.e., when the CA3 pyramidal cell had shown pre-LTP significant correlation with firing of a CA1 unit and potentiated spike-triggered average of Schaffer LFPs following LTP. Moreover, LTP produced subtle reorganization of presynaptic CA3 cell assemblies. These findings show effective enhancement of pathway specific ongoing activity which leads to increased spike transfer in potentiated segments of a network. These indicate that plastic phenomena induced by external protocols may intensify spontaneous information flow across specific channels as proposed in transsynaptic propagation of plasticity and synfire chain hypotheses that may be the substrate for different types of memory involving multiple brain structures.

  19. Measurements of the free luminal ER Ca(2+) concentration with targeted "cameleon" fluorescent proteins

    OpenAIRE

    Demaurex, Nicolas; Frieden, Maud

    2003-01-01

    The free ER Ca(2+) concentration, [Ca(2+)](ER), is a key parameter that determines both the spatio-temporal pattern of Ca(2+) signals as well as the activity of ER-resident enzymes. Obtaining accurate, time-resolved measurements of the Ca(2+) activity within the ER is thus critical for our understanding of cell signaling. Such measurements, however, are particularly challenging given the highly dynamic nature of Ca(2+) signals, the complex architecture of the ER, and the difficulty of address...

  20. Essentiality of Ca Supplement to White Fish Meal Diet for Tiger Puffer

    OpenAIRE

    Furuichi, Masayuki; Furusho, Yasuyuki; Hossain, M. Amzad; Matsui, Seiichi; Azuma, Ryusuke

    1997-01-01

    The essentiality of Calcium (Ca) supplement to a white fish meal diet for tiger puffer Takifugu rubripes was investigated with two rearing experiments. Fish were fed on a white fish meal diet with or without Ca supplement for 12 weeks and 14 weeks in experiments 1 and 2, respectively. Poorer growth and feed efficiency were found in the Ca non-supplemented group. A deletion of Ca from the diet increased the bone lipid, Zn, and Cu contents. The present study suggests that Ca supplement to a whi...