Site occupancies in ternary C15 ordered Laves phases
International Nuclear Information System (INIS)
Kotula, P.G.; Chu, F.; Thoma, D.J.; Mitchell, T.E.; Anderson, I.M.; Bentley, J.
1996-01-01
Site occupancies in three C15-structured AB 2 (X) Laves phases have been determined by Atom Location by CHanneling Enhanced MIcroanalysis (ALCHEMI). In NbCr 2 (V), the results were consistent with exclusive site occupancies of Nb for the A sublattice and Cr and V for the B sublattice. The B-site occupancy of V is not expected from atom size effects alone. In NbCr 2 (Ti), the results were consistent with Ti partitioning mostly to the A sites with some anti-site defects likely. In HfV 2 (Nb), the results were consistent with Nb partitioning between the A and B sites. The results of the ALCHEMI analyses of these ternary C15 Laves phase materials will be discussed with respect to previously determined phase diagrams and first-principles total energy and electronic structure calculations
Gabay, A. M.; Hadjipanayis, G. C.
2018-05-01
Recently, Fe-based rare-earth-free compounds with non-cubic crystal structures were proposed as a base for permanent magnets which would not rely on critical elements. In this work, two series of alloys, Zr27Fe73-wSiw (0 ≤ w ≤ 15) and Zr33-xFe52+xSi15 (0 ≤ x ≤ 11), were prepared and characterized after annealing at 1538 K in order to determine the fundamental magnetic properties of the C36 and C14 hexagonal Laves phase compounds. A mixture of the cubic C15 and Zr6Fe23 structures was observed instead of the expected C36 structure. The hexagonal C14 was found in all Zr33-xFe52+xSi15 alloys with its lattice parameters linearly decreasing as the Fe(Si) atoms occupy the Zr sites in the Laves phase crystal structure. The solubility limit of Fe in the C14 structure at 1538 K corresponds to x = 9.5. The Curie temperature of the C14 compounds increases with deviation from the Laves phase stoichiometry from 290 K to 530 K. The room-temperature spontaneous magnetization also increases reaching, after correcting for the non-magnetic impurities, a value of 6.7 kG. The magnetocrystalline anisotropy of the off-stoichiometric C14 Laves phase was found to be uniaxial with the easy magnetization direction parallel to the hexagonal axis. Unfortunately, the anisotropy field, which does not exceed 10 kOe, is not sufficiently high to make the compounds interesting as permanent magnet materials.
Point Defects in Binary Laves-Phase Alloys
Energy Technology Data Exchange (ETDEWEB)
Liaw, P.K.; Liu, C.T.; Pike, L.M.; Zhu, J.H.
1999-01-11
Point defects in the binary C15 NbCrQ and NbCoz, and C 14 NbFe2 systems on both sides of stoichiometry were studied by both bulk density and X-ray Iattiee parameter measurements. It was found that the vacancy concentrations in these systems after quenching from 1000"C are essentially zero. The constitutional defects on both sides of stoichiometry for these systems were found to be of the anti-site type in comparison with the model predictions. Thermal vacancies exhibiting a maximum at the stoichiometric composition were obtained in NbCr2 Laves phase alloys after quenching from 1400"C. However, there are essentially no thermal vacancies in NbFe2 alloys after quenching from 1300oC. Anti-site hardening was found on both sides of stoichiometry for all the tie Laves phase systems studied, while the thermal vacancies in NbCr2 alloys quenched from 1400'C were found to soften the Laves phase. The anti-site hardening of the Laves phases is similar to that of the B2 compounds and the thermal vacancy softening is unique to the Laves phase. Neither the anti-site defects nor the thermal vacancies affect the fracture toughness of the Laves phases significantly.
Electron concentration and phase stability in NbCr2-based Laves phase alloys
Energy Technology Data Exchange (ETDEWEB)
Zhu, J.H.; Liaw, P.K. [Univ. of Tennessee, Knoxville, TN (United States). Dept. of Materials Science and Engineering; Liu, C.T. [Oak Ridge National Lab., TN (United States). Metals and Ceramics Div.
1997-05-12
Phase stability in NbCr{sub 2}-based transition-metal Laves phases was studied, based on the data reported for binary X-Cr, Nb-X, and ternary Nb-Cr-X phase diagrams. It was shown that when the atomic size ratios are kept identical, the average electron concentration factor, e/a, is the dominating factor in controlling the phase stability of NbCr{sub 2}-based transition-metal Laves phases. The e/a ratios for different Laves polytypes were determined as followed: with e/a < 5.76, the C15 structure is stabilized; at an e/a range of 5.88--7.53, the C14 structure is stabilized; with e/a > 7.65, the C15 structure is stabilized again. A further increase in the electron concentration factor (e/a > 8) leads to the disordering of the alloy. The electron concentration effect on the phase stability of Mg-based Laves phases and transition-metal A{sub 3}B intermetallic compounds is also reviewed and compared with the present observations in transition-metal Laves phases. In order to verify the e/a/phase stability relationship experimentally, additions of Cu (with e/a = 11) were selected to replace Cr in the NbCr{sub 2} Laves phase. Experimental results for the ternary Nb-Cr-Cu system are reported and discussed in terms of the correlation between the e/a ratio and phase stability in NbCr{sub 2}-based Laves phases. A new phase was found, which has an average composition of Nb-47Cr-3Cu. Within the solubility limit, the electron concentration and phase stability relationship is obeyed in the Nb-Cr-Cu system.
International Nuclear Information System (INIS)
Morris, D.G.; Muñoz-Morris, M.A.
2012-01-01
Highlights: ► Forged Fe–15%Al–5%Nb has a composite structure of soft matrix with equiaxed Laves phase particles. ► The material shows good strength with excellent ductility at room temperature. ► Good creep strength is maintained to 700 °C. ► The coarse composite microstructure ensures good long term stability at high temperatures. ► High temperature strength depends on load sharing between phases and microstructural refinement. - Abstract: The cast-in network of continuous Laves phase in a Fe–15%Al–5%Nb alloy has been converted to a dispersion of coarse Laves phase particles by high temperature forging, and the room temperature and high temperature deformation behaviour examined. The material shows good room temperature tensile ductility and good creep strength at temperatures up to 700 °C. The good high temperature strength is explained by the refinement of substructure by the dispersion of Laves phase particles and load and strain partitioning between the stiff and hard phase and the softer matrix. The relatively coarse microstructure is expected to be highly stable against coarsening at high temperatures, which should allow retention of creep properties even for long exposure times.
A DFT study of thermodynamic properties of C36 and C14 Fe2Zr Laves phases
Ali, Kawsar; Ghosh, P. S.; Arya, A. K.
2018-04-01
Fe-Zr alloys are promising materials for metallic waste immobilization in nuclear industry. C36 and C14 Fe2Zr Laves phases are frequently observed in Fe-Zr alloys that can host radionuclides. The phonon dispersions of C36 and C14 Fe2Zr Laves phases shows that both intermetallics are dynamically stable. The Helmholtz free energy, vibrational entropy, internal energy and specific heat at constant volume has been calculated. The zero point energies of C36 and C14 phases are 9.23 and 9.91 kJ/mole, respectively. The vibrational free energy becomes negative at 250 K and 270 K. The high temperature specific heat at constant volume of both intermetallics is 74 J/K/mole.
Peculiarities of U-based Laves phases
Energy Technology Data Exchange (ETDEWEB)
Goncalves, A P; Henriques, M S; Waerenborgh, J C; Pereira, L C J; Lopes, E B; Almeida, M [Department of Chemistry, Instituto Tecnologico e Nuclear/CFMCUL, Estrada Nacional 10, 2686-953 Sacavem (Portugal); Maskova, S; Havela, L [Department of Condensed Matter Physics, Faculty of Mathematics and Physics, Charles University, Ke Karlovu 5, 12116, Prague (Czech Republic); Shick, A; Arnold, Z [Institute of Physics, Academy of Sciences of the Czech Republic, Prague 8 (Czech Republic); Berthebaud, D; Tougait, O; Noel, H, E-mail: apg@itn.pt [Sciences Chimiques de Rennes- Equipe Chimie du Solide et Materiaux. UMR CNRS 6226, Universite de Rennes 1, Avenue de General Leclerc, 35042 Rennes (France)
2010-03-15
This contribution focuses on the structural and physical properties of U-based Laves phases. It starts with the structural description of the different type of Laves phases, followed by a brief description of the factors that affect their stability. The majority of the uranium Laves phases show a weakly paramagnetic behaviour. The reason is the compact structure of the phases that leads to small a U-U spacing as well as very high coordination numbers, regarding both the uranium and the ligands sublattices, which brings a strong hybridization with non-f states. However, there are some exceptions of uranium Laves phases that do order magnetically (UFe{sub 2}, UNi{sub 2} and the recently discovered U{sub 2}Fe{sub 3}Ge compound). These exceptions are discussed in more detail in the present manuscript.
Ab initio study of C14 laves phases in Fe-based systems
Directory of Open Access Journals (Sweden)
Pavlu J.
2012-01-01
Full Text Available Structural properties and energetics of Fe-based C14 Laves phases at various compositions (i.e. Fe2Fe, Fe2X, X2Fe, X2X, where X stands for Si, Cr, Mo, W, Ta were investigated using the pseudopotential VASP (Vienna Ab initio Simulation Package code employing the PAW-PBE (Projector Augmented Wave - Perdew Burke-Ernzerhof pseudopotentials. Full relaxation was performed for all structures studied including the reference states of elemental constituents and the equilibrium structure parameters as well as bulk moduli were found. The structure parameters of experimentally found structures were very well reproduced by our calculations. It was also found that the lattice parameters and volumes of the unit cell decrease with increasing molar fraction of iron. Thermodynamic analysis shows that the Fe2X configurations of Laves phases are more stable than the X2Fe ones. Some of the X2Fe configurations are even unstable with respect to the weighted average of the Laves phases of elemental constituents. Our calculations predict the stability of Fe2Ta. On the other hand, Fe2Mo and Fe2W are slightly unstable (3.19 and 0.68 kJ.mol-1, respectively and hypothetical structures Fe2Cr and Fe2Si are found unstable as well.
Energy Technology Data Exchange (ETDEWEB)
Prat, O. [Max Planck Institute fuer Eisenforschung GmbH, Max Planck Strasse 1, 40237 Duesseldorf (Germany)] [Universidad de Concepcion, Departamento de Ingenieria de Materiales, Edmundo Larenas 270, Concepcion (Chile); Garcia, J., E-mail: jose.garcia@helmholtz-berlin.de [Helmholtz-Zentrum Berlin fuer Materialien und Energie GmbH, Hahn-Meitner-Platz 1, 14109 Berlin (Germany); Rojas, D. [Max Planck Institute fuer Eisenforschung GmbH, Max Planck Strasse 1, 40237 Duesseldorf (Germany); Carrasco, C. [Universidad de Concepcion, Departamento de Ingenieria de Materiales, Edmundo Larenas 270, Concepcion (Chile); Inden, G. [Max Planck Institute fuer Eisenforschung GmbH, Max Planck Strasse 1, 40237 Duesseldorf (Germany)
2010-10-15
The growth kinetics of Laves phase precipitates (type Fe{sub 2}W) in the early stage of creep (650 deg. C for 10,000 h) in two 12% Cr ferrite-martensitic steels has been investigated. In one alloy the Laves phase formed on tempering, while in the second alloy the Laves phase precipitated during creep. Kinetic simulations were performed using the software DICTRA. The particle size of the Laves phase was measured on transmission electron microscopy samples. The equilibrium phase fraction of the Laves phase was reached in the first thousand hours. Simulations of particle growth showed good agreement with the experimental results. Competitive growth between M{sub 23}C{sub 6} and the Laves phase showed that M{sub 23}C{sub 6} carbides reached their equilibrium after 12 days, whereas the Laves phase reached equilibrium after 3 months. Simulations of the influence of the interfacial energy and addition of Co, Cu and Si on Laves phase precipitation are presented.
International Nuclear Information System (INIS)
Prat, O.; Garcia, J.; Rojas, D.; Carrasco, C.; Inden, G.
2010-01-01
The growth kinetics of Laves phase precipitates (type Fe 2 W) in the early stage of creep (650 deg. C for 10,000 h) in two 12% Cr ferrite-martensitic steels has been investigated. In one alloy the Laves phase formed on tempering, while in the second alloy the Laves phase precipitated during creep. Kinetic simulations were performed using the software DICTRA. The particle size of the Laves phase was measured on transmission electron microscopy samples. The equilibrium phase fraction of the Laves phase was reached in the first thousand hours. Simulations of particle growth showed good agreement with the experimental results. Competitive growth between M 23 C 6 and the Laves phase showed that M 23 C 6 carbides reached their equilibrium after 12 days, whereas the Laves phase reached equilibrium after 3 months. Simulations of the influence of the interfacial energy and addition of Co, Cu and Si on Laves phase precipitation are presented.
High pressure studies of YMn{sub 2} Laves phase and its deuterides
Energy Technology Data Exchange (ETDEWEB)
Sugiura, H.; Paul-Boncour, V.; Percheron-Guegan, A.; Marchuk, I.; Hirata, T.; Filipek, S.M.; Dorogova, M
2004-03-24
The C15 Laves phase intermetallic YMn{sub 2} and its deuterides containing 1.15, 2, 3.4 and 4 deuterium (D) atoms per formula unit (pfu) (the structure of YMn{sub 2}D{sub 4} is rhombohedral whereas other three deuterides preserve the cubic C15 structure) were compressed up to 31 GPa by using diamond anvil cell (DAC). Parameters of equation of state (EOS) were derived for all phases investigated. The discontinuous change of bulk modulus under high pressure has been revealed for all samples investigated. Two deuterides, YMn{sub 2}D{sub 1.15} and YMn{sub 2}D{sub 2}, decomposed reversibly under pressure into two phases: poor and enriched in deuterium.
Polymorphism in the Laves-phase precipitates of a quinternary Nb-Mo-Cr-Al-Si alloy
International Nuclear Information System (INIS)
Hu Yanling; Vasiliev, Alexandre; Zhang Lichun; Song, Kai; Aindow, Mark
2009-01-01
Transmission electron microscopy has been used to study the precipitates that develop in the A2 phase of an Nb-Mo-Cr-Al-Si alloy upon heat treatment. The precipitates include a Laves-phase that adopts the cubic C15 structure initially and the hexagonal C14 structure in the later stages of precipitation. The morphologies, orientation relationships and defect microstructures indicate that the metastable C15 phase arises due to tensile coherency stresses and that a synchroshear polymorphic transformation to the equilibrium C14 phase occurs as these relax
Alumina-Forming Austenitic Stainless Steels Strengthened by Laves Phase and MC Carbide Precipitates
Yamamoto, Y.; Brady, M. P.; Lu, Z. P.; Liu, C. T.; Takeyama, M.; Maziasz, P. J.; Pint, B. A.
2007-11-01
Creep strengthening of Al-modified austenitic stainless steels by MC carbides or Fe2Nb Laves phase was explored. Fe-20Cr-15Ni-(0-8)Al and Fe-15Cr-20Ni-5Al base alloys (at. pct) with small additions of Nb, Mo, W, Ti, V, C, and B were cast, thermally-processed, and aged. On exposure from 650 °C to 800 °C in air and in air with 10 pct water vapor, the alloys exhibited continuous protective Al2O3 scale formation at an Al level of only 5 at. pct (2.4 wt pct). Matrices of the Fe-20Cr-15Ni-5Al base alloys consisted of γ (fcc) + α (bcc) dual phase due to the strong α-Fe stabilizing effect of the Al addition and exhibited poor creep resistance. However, adjustment of composition to the Fe-15Cr-20Ni-5Al base resulted in alloys that were single-phase γ-Fe and still capable of alumina scale formation. Alloys that relied solely on Fe2Nb Laves phase precipitates for strengthening exhibited relatively low creep resistance, while alloys that also contained MC carbide precipitates exhibited creep resistance comparable to that of commercially available heat-resistant austenitic stainless steels. Phase equilibria studies indicated that NbC precipitates in combination with Fe2Nb were of limited benefit to creep resistance due to the solution limit of NbC within the γ-Fe matrix of the alloys studied. However, when combined with other MC-type strengtheners, such as V4C3 or TiC, higher levels of creep resistance were obtained.
Characterization of Laves phase in Crofer 22 H stainless steel.
Hsiao, Zheng-Wen; Kuhn, Bernd; Chen, Delphic; Singheiser, Lorenz; Kuo, Jui-Chao; Lin, Dong-Yih
2015-07-01
This study investigated the effect of annealing temperature on the precipitation behavior of Crofer(®) 22 H at 600°C, 700°C, and 800°C. The grain size distribution, precipitate phase identification, and microstructure were analyzed using electron backscatter diffraction (EBSD) and energy dispersive X-ray spectroscopy (EDS). The morphology of Laves phase (Fe,Cr,Si)(2)(Nb,W) precipitates having the Cr(2)Nb structure changed from strip-like to needle-shaped as the annealing temperature was increased. The precipitates of the Laves phase also shifted from the grain boundaries to the grain interiors when the temperature was increased. However, the average grain size (150 μm) of the ferritic matrix did not significantly change at 600°C, 700°C, and 800°C for 10 h. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Talik, Michal
2016-01-01
The aim of this work was to design 17 wt%Cr Laves phase strengthened HiperFer (High performance Ferrite) steels and evaluate their properties. This class of steel is supposed to be used in Advanced Ultra Super Critical power plants. Such cycles exhibit higher efficiency and are environmentally friendly, but improved materials with high resistance to reside/steam oxidation and sufficient creep strength are required. The work focused on the characterization of creep properties of 17Cr2.5W0.5Nb0.25Si heat resistant steel. Small batches of steels with nominal compositions of 17Cr3W0.5Nb0.25Si and 17Cr3W0.9Nb0.25Si were used to analyze the influence of chemical composition on the precipitation behaviour in comparison to 17Cr2.5W0.5Nb0.25Si steel. Creep strength of HiperFer steels is ensured by ne dispersion of thermodynamically stable Laves phase particles, while maintaining high corrosion resistance by a relatively high chromium content. Design of HiperFer steels was accomplished by thermodynamic modeling (Thermocalc) with the main tasks of elimination of the unwelcome brittle (Fe,Cr)-σ phase and maximization of the content of the strengthening C14 Fe_2Nb type Laves phase particles. Long term annealing experiments of all HiperFer steels were performed at 650 C in order to evaluate the role of chemical composition and initial thermo-mechanical treatment state on precipitation behaviour. Laves phase particles formed quickly after few hours and the size of precipitates did not change significantly within 1,000 hours. The observed development of Laves phase particles was compared with thermodynamical calculations (TC-Prisma). The creep properties of 17Cr2.5W0.5Nb0.25Si steel in different initial thermo-mechanical treatment states were tested at 650 C. The influence of different cold rolling procedures, and heat treatments was investigated. Increased cold rolling deformation had a positive effect resulting not only from work hardening, but from the acceleration of Laves
DEFF Research Database (Denmark)
Yao, Bing-Yin; Zhou, Rong-Can; Fan, Chang-Xin
2010-01-01
The growth of Laves phase particles in three kinds of P92 steels were investigated. Laves phase particles can be easily separated and distinguished from the matrix and other particles by atom number contrast using comparisons of the backscatter electrons (BSE) images and the secondary electrons (SE......) images in scanning electron microscope (SEM). The smaller Laves phase particle size results in higher creep strength and longer creep exposure time at the same conditions. DICTRA software was used to model the growth and coarsening behavior of Laves phase in the three P92 steels. Good agreements were...... attained between measurements in SEM and modeling by DICTRA. Ostwald ripening should be used for the coarsening calculation of Laves phase in P92 steels for time longer than 20000 h and 50000 h at 650°C and 600°C, respectively. © 2010 Chin. Soc. for Elec. Eng....
Summary of workshop on high temperature materials based on Laves phases
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-08-01
The Offices of Fossil Energy and Basic Energy Sciences of the Department of Energy jointly sponsored the Workshop on High Temperature Materials Based on Laves Phases in conjunction with the Tenth Annual Conference on Fossil Energy Materials held at the Radisson Summit Hill Hotel in Knoxville, Tennessee on May 14-16, 1996. The objective of this workshop was to review the current status and to address critical issues in the development of new-generation high-temperature structural materials based on Laves phases. The one-day workshop included two sessions of overview presentations and a session of discussion on critical scientific and technological issues. The Laves phases represent an abundant class of intermetallic alloys with possible high-temperature structural applications. Laves phases form at or near the AB{sub 2} composition, and there are over 360 binary Laves phases. The ability of these alloys to dissolve considerable amounts of ternary alloying additions provides over 900 combined binary and ternary Laves phases. Many Laves phases have unique properties which make them attractive for high-temperature structural use. At half their homologous temperature, they retain >0.85 of their ambient yield strength, which is higher than all other intermetallics. Many of the Laves phases also have high melting temperatures, excellent creep properties, reasonably low densities, and for alloys containing Cr, Al, Si or Be, good oxidation resistance. Despite these useful properties, the tendency for low-temperature brittleness has limited the potential application of this large class of alloys.
Laves-phase evolution during aging in 9Cr-1.8W-0.5Mo-VNb steel for USC power plants
Energy Technology Data Exchange (ETDEWEB)
Wang, Xue, E-mail: wangxue2011@whu.edu.cn [School of Power and Mechanics, Wuhan University, Wuhan 430072 (China); Xu, Qiang [School of Computing and Engineering, The University of Huddersfield, Huddersfield HD1 3DH, England (United Kingdom); Yu, Shu-min; Hu, Lei [School of Power and Mechanics, Wuhan University, Wuhan 430072 (China); Liu, Hong [DongFang Boiler Group Co.,Ltd., Zigong 643001 (China); Ren, Yao-yao [School of Power and Mechanics, Wuhan University, Wuhan 430072 (China)
2015-08-01
Long term precipitation and coarsening of Laves-phase in tungsten strengthened 9% Cr steel under thermal aging at 923 K was investigated and reported in this paper. It experimentally measured the evolution of mean particle size, the number density, the volume fraction of Laves-phase precipitates, the partition coefficients of W and Mo in the matrix, as well as the change of hardness. Its main conclusions were: 1) Laves-phase nucleates and grows rapidly on grain boundaries and lath boundaries within the first 1500 h of aging time; 2) The two stages characteristics and kinetics of Laves-phase nucleation and growth which were determined experimentally; 3) The coarsening of Laves-phase is much faster than that of M{sub 23}C{sub 6} carbides; 4) The precipitation of Laves-phase produces a pronounced matrix depletion of W and Mo atoms; and 5) The precipitated Laves-phase gives rise to weaker precipitation strengthening in comparison with M{sub 23}C{sub 6} carbides, and causes the loss of hardness due to the depletion of Mo and W from the solid solution. This paper contributes to the knowledge of kinetics of Laves-phase precipitation and coarsening, providing the essential information for comparative investigation of creep damage mechanisms. This paper also contributes to the understanding the creep damage broadly. - Highlights: • The characteristics of precipitation and coarsening of Laves-phase were determined. • The matrix depletion of W and Mo due to Laves-phase precipitation was quantified. • The effect of precipitated Laves-phase on the hardness was evaluated.
Lave phase precipitation in Nb- and Ti-based alloys
International Nuclear Information System (INIS)
Tewari, R.; Vishwanadh, B.; Dey, G.K.
2010-01-01
In multicomponent Nb-based alloys system, which are potential candidate materials for high temperature applications, the presence of Laves phase was noticed along with the silicides in equilibrium with the soft β-matrix. In Ti-Cr alloys, which show a tendency for inverse melting, the formation of the phase was noticed in the β matrix upon aging. The Laves phase being topologically closed pack structure appears to have strong tendency for the formation provided the criterion of atomic size factor is met
International Nuclear Information System (INIS)
Kal, Subhadeep; Stoyanov, Emil; Belieres, Jean-Philippe; Groy, Thomas L.; Norrestam, Rolf; Haeussermann, Ulrich
2008-01-01
High-pressure forms of intermetallic compounds with the composition CaZn 2 , SrZn 2 , SrAl 2 , and BaAl 2 were synthesized from CeCu 2 -type precursors (CaZn 2 , SrZn 2 , SrAl 2 ) and Ba 21 Al 40 by multi-anvil techniques and investigated by X-ray powder diffraction (SrAl 2 and BaAl 2 ), X-ray single-crystal diffraction (CaZn 2 ), and electron microscopy (SrZn 2 ). Their structures correspond to that of Laves phases. Whereas the dialuminides crystallize in the cubic MgCu 2 (C15) structure, the dizincides adopt the hexagonal MgZn 2 (C14) structure. This trend is in agreement with the structural relationship displayed by sp bonded Laves phase systems at ambient conditions. - Graphical abstract: CeCu 2 -type polar intermetallics can be transformed to Laves phases upon simultaneous application of pressure and temperature. The observed structures are controlled by the valence electron concentration
Synthesis, characterization and magnetic properties of selected Laves and MAX phases
International Nuclear Information System (INIS)
Hamm, Christin Maria
2017-01-01
In this work the rare-earth free Laves phases Ti 2 M 3 Si with M = Mn, Fe, Co, Ni were synthesized by microwave heating and were structurally and magnetically characterized. Furthermore, the solid solution Ti 2 (Co 1-x Fe x ) 3 Si was synthesized by arc melting and spark plasma sintering, as well as their magnetic behavior was studied. In addition to the Laves phases, the focus was on the synthesis and characterization of aluminum-based MAX phases. For the first time the ternary carbides were prepared by microwave heating. The phase-pure representation of MAX phases was particularly challenging for synthetic solid-state chemistry. The susceptor-assisted microwave heating allows the synthesis of high-quality samples, which was shown in this work on M 2 AlC (M = Ti, V, Cr) and V 4 AlC 3 . Furthermore, for the first time, the doping of these materials with Mn and Fe was successful. In addition to the structural characterization of the new phases, the microstructure and magnetic properties are discussed in this work. Using these doped compounds as well as the compound V 4 AlC 3 , it has been shown that field-activated synthesis, particularly susceptor-assisted microwave heating, are a very good synthesis method for compounds which are hard or sometimes not synthesized by conventional methods.
Role of copper on Laves phase morphology in 9-12%Cr steels
DEFF Research Database (Denmark)
Danielsen, Hilmar Kjartansson; Liu, Fang
2017-01-01
In this work the Laves phase was found to appear in two different morphologies, namely granular shapes and in an elongated shape. No difference in crystallography could be detected between these morphologies. The Laves phase was only observed in its elongated form in Cu-containing steels, where i...
Electron crystallography applied to the structure determination of Nb(Cu,Al,X) Laves phases.
Gigla, M; Lelatko, J; Krzelowski, M; Morawiec, H
2006-09-01
The presence of primary precipitates of the Laves phases considerably improves the mechanical properties and the resistance to thermal degradation of the high-temperature shape memory Cu-Al-Nb alloys. The structure analysis of the Laves phases was carried out on particles contained in the ternary and quaternary alloys as well on synthesized compounds related to the composition of the Nb(Cu,Al,X)(2) phase, where X = Ni, Co, Cr, Ti and Zr. The precise structure determination of the Laves phases was carried out by the electron crystallography method using the CRISP software.
Yadav, T. P.; Mukhopadhyay, Semanti; Mishra, S. S.; Mukhopadhyay, N. K.; Srivastava, O. N.
2017-12-01
The high-entropy Ti-Zr-V-Cr-Ni (20 at% each) alloy consisting of all five hydride-forming elements was successfully synthesised by the conventional melting and casting as well as by the melt-spinning technique. The as-cast alloy consists entirely of the micron size hexagonal Laves Phase of C14 type; whereas, the melt-spun ribbon exhibits the evolution of nanocrystalline Laves phase. There was no evidence of any amorphous or any other metastable phases in the present processing condition. This is the first report of synthesising a single phase of high-entropy complex intermetallic compound in the equiatomic quinary alloy system. The detailed characterisation by X-ray diffraction, scanning and transmission electron microscopy and energy-dispersive X-ray spectroscopy confirmed the existence of a single-phase multi-component hexagonal C14-type Laves phase in all the as-cast, melt-spun and annealed alloys. The lattice parameter a = 5.08 Å and c = 8.41 Å was determined from the annealed material (annealing at 1173 K). The thermodynamic calculations following the Miedema's approach support the stability of the high-entropy multi-component Laves phase compared to that of the solid solution or glassy phases. The high hardness value (8.92 GPa at 25 g load) has been observed in nanocrystalline high-entropy alloy ribbon without any cracking. It implies that high-yield strength ( 3.00 GPa) and the reasonable fracture toughness can be achieved in this high-entropy material.
International Nuclear Information System (INIS)
Hosoi, Y.; Wade, N.; Kunimitsu, S.; Urita, T.
1986-01-01
This study clarified the relationship between the toughness of a 9Cr-2Mo dual phase steel and precipitates formed during aging, with special attention to the Laves phase (Fe 2 Mo). The ductile-brittle transition temperature (DBTT) is increased and the upper shelf energy decreased when the Laves phase begins to precipitate during aging. Electron microscopy and X-ray diffraction indicate that elimination of Si in the steel reduces the precipitation of the Laves phase and results in maintaining good toughness. It is also noted that the toughness of the steel is controlled by the total amount of precipitates (Laves + carbides) in the aging at 873 K for more than 3.6x10 3 ks. A time-temperature-precipitation diagram for the Laves phase is established and it clearly shows that the precipitation of the Laves phase is markedly retarded by the decrease of Si content. In Si-free steel, no Laves phase is observed in the temperature and time range investigated. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Thoma, D.J.; Chu, F.; Chen, K.C.; Kotula, P.G.; Mitchell, T.E.; Wills, J.M.; Ormeci, A.; Chen, S.P.; Albers, R.C.
1999-06-03
This is the final report of a three-year, Laboratory Directed Research and Development (LDRD) project at Los Alamos National Laboratory (LANL). The goal of the project was to develop methodologies in which to define and improve the properties of NbCr{sub 2} so that the high temperature structural applications of alloys based upon this would not be limited by the low-temperature brittle behavior of the intermetallic. We accomplished this task by (1) understanding the defect structure and deformation mechanisms in Laves phases, (2) electronic and geometric contributions to phase stability and alloying behavior, and (3) novel processing of dual phase (Laves/bcc) structures. As a result alloys with properties that in many cases surpass superalloys were developed. For example, we have tailored alloy design strategies and processing routes in a metal alloy to achieve ambient temperature ultimate strengths of 2.35 GPa as well as ultimate strengths of 1.5 GPa at 1000 C. This results i n one of the strongest metal alloys that currently exist, while still having deformability at room temperature.
Energy Technology Data Exchange (ETDEWEB)
Xiao, X. [College of Electromechanical Engineering, Nanjing University of Aeronautical and Astronautics, Nanjing 210016 (China); School of Materials Science and Engineering, Nanchang Institute of Aeronautical Technology, Nanchang 330063 (China); Lu, S.Q. [School of Materials Science and Engineering, Nanchang Institute of Aeronautical Technology, Nanchang 330063 (China)], E-mail: niatlusq@126.com; Hu, P.; Huang, M.G.; Nie, X.W. [School of Materials Science and Engineering, Nanchang Institute of Aeronautical Technology, Nanchang 330063 (China); Fu, M.W. [Department of Mechanical Engineering, Hong Kong Polytechnic University, Hung Hom, Kowloon, Hong Kong (China)
2008-06-25
The microstructure and properties were investigated on the Laves phase NbCr{sub 2} alloys prepared through 20 h mechanical alloying of niobium and chromium powders and subsequent hot pressing at 1250 deg. C for different time. The results indicate that the Laves phase NbCr{sub 2} alloy with homogeneous microstructure and fine grains and high relative density is obtained. With the increase of hot pressing time, the density, grain size and Vickers hardness increase, the fracture toughness, however, decreases gradually. The alloy fabricated by hot pressing at 1250 deg. C for 30 min has the best overall properties. Its average grain size reaches about 248 nm, the relative density is 97.8% and the fracture toughness at room temperature is more than 4.7 MPa m{sup 1/2}. Compared with the Laves phase NbCr{sub 2} alloy prepared by arc-melting, which has the fracture toughness of 1.2 MPa m{sup 1/2}, the fracture toughness in this research is increased significantly.
Ternary rhombohedral Laves phases RE_2Rh_3Ga (RE = Y, La-Nd, Sm, Gd-Er)
International Nuclear Information System (INIS)
Seidel, Stefan; Benndorf, Christopher; Heletta, Lukas; Poettgen, Rainer; Eckert, Hellmut; Sao Paulo Univ., Sao Carlos
2017-01-01
The ordered Laves phases RE_2Rh_3Ga (RE=Y, La-Nd, Sm, Gd-Er) were synthesized by arc-melting of the elements and subsequent annealing. The samples were characterized by powder X-ray diffraction (XRD). They crystallize with the rhombohedral Mg_2Ni_3Si type structure, space group R3m. Three structures were refined from single crystal X-ray diffractometer data: a=557.1(1), c=1183.1(2), wR2=0.0591, 159 F"2 values, 10 variables for Y_2Rh_3Ga, a=562.5(2), c=1194.4(2) pm, wR2=0.0519, 206 F"2 values, 11 variables for Ce_2Rh_3Ga and a=556.7(2), c=1184.1(3) pm, wR2=0.0396, 176 F"2 values, 11 variables for Tb_2Rh_3Ga. The Rh_3Ga tetrahedra are condensed via common corners and the large cavities left by the network are filled by the rare earth atoms. The RE_2Rh_3Ga Laves phases crystallize with a translationengleiche subgroup of the cubic RERh_2 Laves phases with MgCu_2 type. Magnetic susceptibility measurements reveal Pauli paramagnetism for Y_2Rh_3Ga and La_2Rh_3Ga. Ce_2Rh_3Ga shows intermediate cerium valence while all other RE_2Rh_3Ga phases are Curie-Weiss paramagnets which order magnetically at low temperatures. The "8"9Y and "7"1Ga solid state nuclear magnetic resonance (NMR) spectra of the diamagnetic representative Y_2Rh_3Ga show well-defined single resonances in agreement with an ordered bulk phase. In comparison to the binary Laves phase YRh_2 a strongly increased "8"9Y resonance frequency is observed owing to a higher s-electron spin density at the "8"9Y nuclei as proven by density of states (DOS) calculations.
Stability of Laves Phases in the Cr Zr System
Czech Academy of Sciences Publication Activity Database
Pavlů, Jana; Vřešťál, Jan; Šob, Mojmír
2009-01-01
Roč. 33, č. 2 (2009), s. 382-387 ISSN 0364-5916 R&D Projects: GA ČR GA106/07/1078 Institutional research plan: CEZ:AV0Z20410507 Keywords : ab initio calculations * Laves phases * phase diagrams Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.904, year: 2009
Energy Technology Data Exchange (ETDEWEB)
Prat, O.; Rojas, D. [Max-Planck-Institut fuer Eisenforschung GmbH, Duesseldorf (Germany); Garcia, J.; Kaysser-Pyzalla, A.R. [Helmholtz-Zentrum Berlin fuer Materialien und Energie GmbH, Berlin (Germany); Bochum Univ. (Germany)
2010-07-01
Precipitation phenomena in 12%Cr high alloyed steels have been investigated at creep conditions of 650 and 150 MPa up to 6.500 hours in two different alloys. Growth and coarsening of Laves phase was determined experimentally by measuring the size of Laves phase on crept samples using scanning transmission electron microscopy (STEM). The simulations were performed using the software DICTRA based on the assumption the local equilibrium at the moving phase interface. For equilibrium calculations, the Thermo-Calc software was used. The experimental results were compared with DICTRA simulations, showing good agreement. Both the quantitative metallographic measurements as well as the simulations indicate very low coarsening for Laves Phase. The influence of different elements such as Co, Si and Cu on coarsening for Laves phase was simulated. (orig.)
Hsiao, Z-W; Chen, D; Kuo, J-C; Lin, D-Y
2017-04-01
This study investigated the influence of deformation on precipitation behaviour and microstructure change during annealing. Here, the prior deformation of high-chromium stainless steel was tensile deformation of 3%, 6% and 10%, and the specimens were then annealed at 700˚C for 10 h. The specimens were subsequently analyzed using backscattered electron image and electron backscattering diffraction measurements with SEM. Compared with the deformation microstructure, the grains revealed no preferred orientation. The precipitates of TiN and NbC were formed homogenously in the grain interior and at grain boundaries after annealing. Fine Laves phase precipitates were observed in grains and along subgrain boundaries as the deformation increased. Furthermore, the volume fraction of Laves phase increased, but the average particle diameter of precipitate was reduced as the deformation increased. © 2017 The Authors Journal of Microscopy © 2017 Royal Microscopical Society.
Stacking faults in Zr(Fe, Cr)2 Laves structured secondary phase particle in Zircaloy-4 alloy.
Liu, Chengze; Li, Geping; Yuan, Fusen; Han, Fuzhou; Zhang, Yingdong; Gu, Hengfei
2018-02-01
Stacking faults (SFs) in secondary phase particles (SPPs), which generally crystallize in the Laves phase in Zircaloy-4 (Zr-4) alloy, have been frequently observed by researchers. However, few investigations on the nano-scale structure of SFs have been carried out. In the present study, an SF containing C14 structured SPP, which located at grain boundaries (GBs) in the α-Zr matrix, was chosen to be investigated, for its particular substructure as well as location, aiming to reveal the nature of the SFs in the SPPs in Zr-4 alloy. It was indicated that the SFs in the C14 structured SPP actually existed in the local C36 structured Laves phase, for their similarities in crystallography. The C14 → C36 phase transformation, which was driven by synchroshearing among the (0001) basal planes, was the formation mechanism of the SFs in the SPPs. By analyzing the strained regions near the SPP, a model for understanding the driving force of the synchroshear was proposed: the interaction between SPP and GB resulted in the Zener pinning effect, leading to the shearing parallel to the (0001) basal planes of the C14 structured SPP, and the synchroshear was therefore activated.
Saidi, F.; Sebaa, N.; Mahmoudi, A.; Aourag, H.; Merad, G.; Dergal, M.
2018-06-01
We performed first-principle calculations to investigate structural, phase stability, electronic and mechanical properties for the Laves phases YM2 (M = Mn, Fe, Co) with C15, C14 and C36 structures. We used the density functional theory within the framework of both pseudo-potentials and plane wave basis using VASP (Vienna Ab Initio Software Package). The calculated equilibrium structural parameters are in accordance with available theoretical values. Mechanical properties were calculated, discussed, and analyzed with data mining approach in terms of structure stability. The results reveal that YCo2 is harder than YFe2 and YMn2.
He, Li-Zhi; Zhu, Jun; Zhang, Lin
2018-02-01
Phase transition of TiCr2 in C15 (MgCu2), C36 (MgNi2), C14 (MgZn2) structures have been studied by using the projector augmented wave method. It is found that C15-type is the most stable structure, which agrees with the results of Chen et al. At 0 K, the phase boundary of C15 to C36 is 207.79 GPa, and the phase transition from C36 to C14 is 265.61 GPa. Both the transition pressures decrease with increasing temperature. Phonon dispersion and elastic constants are calculated and found that C15-type TiCr2 is mechanically stable according to the elastic stability criteria and phonon dispersion analysis. Moreover, the pressure and temperature dependence of the specific heat, Debye temperature and thermal expansion coefficient are discussed, among them our calculated Debye temperature is consistent with the report of A. sari et al., however, it is far from the results of B. Mayer et al. and Chen et al.
Growth Kinetics of Laves Phase and Its Effect on Creep Rupture Behavior in 9Cr Heat Resistant Steel
Institute of Scientific and Technical Information of China (English)
Zhi-xin XIA; Chuan-yang WANG; Chen LEI; Yun-ting LAI; Yan-fen ZHAO; Lu ZHANG
2016-01-01
The effects of Laves phase formation and growth on creep rupture behaviors of P92 steel at 883 K were studied.The microstructural evolution was characterized using scanning electron microscopy and transmission elec-tron microscopy.Kinetic modeling was carried out using the software DICTRA.The results indicated Fe2 (W,Mo) Laves phase has formed during creep with 200 MPa applied stress at 883 K for 243 h.The experimental results showed a good agreement with thermodynamic calculations.The plastic deformation of laths is the main reason of creep rupture under the applied stress beyond 160 MPa,whereas,creep voids initiated by coarser Laves phase play an effective role in creep rupture under the applied stress lower than 160 MPa.Laves phase particles with the mean size of 243 nm lead to the change of creep rupture feature.Microstructures at the vicinity of fracture surface,the gage portion and the threaded ends of creep rupture specimens were also observed,indicating that creep tensile stress enhances the coarsening of Laves phase.
Ternary rhombohedral Laves phases RE{sub 2}Rh{sub 3}Ga (RE = Y, La-Nd, Sm, Gd-Er)
Energy Technology Data Exchange (ETDEWEB)
Seidel, Stefan; Benndorf, Christopher; Heletta, Lukas; Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Janka, Oliver [Oldenburg Univ. (Germany). Inst. fuer Chemie; Mausolf, Bernhard [RWTH Aachen (Germany). Inst. fuer Anorganische Chemie; Haarmann, Frank [RWTH Aachen (Germany). Inst. fuer Anorganische Chemie; Max-Planck-Institut fuer Chemische Physik fester Stoffe, Dresden (Germany); Eckert, Hellmut [Muenster Univ. (Germany). Inst. fuer Physikalische Chemie; Sao Paulo Univ., Sao Carlos (Brazil). Inst. of Physics
2017-06-01
The ordered Laves phases RE{sub 2}Rh{sub 3}Ga (RE=Y, La-Nd, Sm, Gd-Er) were synthesized by arc-melting of the elements and subsequent annealing. The samples were characterized by powder X-ray diffraction (XRD). They crystallize with the rhombohedral Mg{sub 2}Ni{sub 3}Si type structure, space group R3m. Three structures were refined from single crystal X-ray diffractometer data: a=557.1(1), c=1183.1(2), wR2=0.0591, 159 F{sup 2} values, 10 variables for Y{sub 2}Rh{sub 3}Ga, a=562.5(2), c=1194.4(2) pm, wR2=0.0519, 206 F{sup 2} values, 11 variables for Ce{sub 2}Rh{sub 3}Ga and a=556.7(2), c=1184.1(3) pm, wR2=0.0396, 176 F{sup 2} values, 11 variables for Tb{sub 2}Rh{sub 3}Ga. The Rh{sub 3}Ga tetrahedra are condensed via common corners and the large cavities left by the network are filled by the rare earth atoms. The RE{sub 2}Rh{sub 3}Ga Laves phases crystallize with a translationengleiche subgroup of the cubic RERh{sub 2} Laves phases with MgCu{sub 2} type. Magnetic susceptibility measurements reveal Pauli paramagnetism for Y{sub 2}Rh{sub 3}Ga and La{sub 2}Rh{sub 3}Ga. Ce{sub 2}Rh{sub 3}Ga shows intermediate cerium valence while all other RE{sub 2}Rh{sub 3}Ga phases are Curie-Weiss paramagnets which order magnetically at low temperatures. The {sup 89}Y and {sup 71}Ga solid state nuclear magnetic resonance (NMR) spectra of the diamagnetic representative Y{sub 2}Rh{sub 3}Ga show well-defined single resonances in agreement with an ordered bulk phase. In comparison to the binary Laves phase YRh{sub 2} a strongly increased {sup 89}Y resonance frequency is observed owing to a higher s-electron spin density at the {sup 89}Y nuclei as proven by density of states (DOS) calculations.
International Nuclear Information System (INIS)
Mahmoudi, A.; Ghavidel, M.R. Zamanzad; Nedjad, S. Hossein; Heidarzadeh, A.; Ahmadabadi, M. Nili
2011-01-01
Cold rolling and annealing of homogenized Fe-Ni-Mn-Mo-Ti-Cr maraging steels resulted in the formation of submicrocrystalline Fe 2 (Mo,Ti) Laves phase particles. Optical and scanning electron microscopy, X-ray diffraction, tensile and hardness tests were used to study the microstructure, aging behavior and mechanical properties of the annealed steels. The annealed microstructures showed age hardenability during subsequent isothermal aging at 753 K. Ultrahigh fracture stress but poor tensile ductility was obtained after substantial age hardening in the specimens with 2% and 4% chromium. Increasing chromium addition up to 6% toughened the aged microstructure at the expense of the fracture stress by increasing the volume fraction of retained austenite. The Laves phase particles acted as crack nucleation sites during tensile deformation. - Highlights: → Laves phases dispersed in a BCC iron matrix by annealing of cold rolled samples. → The samples showed age hardenability during subsequent isothermal aging at 753 K. → Ultrahigh fracture stress but poor ductility was obtained after age hardening. → Increasing chromium addition toughened the aged microstructure. → Laves phase particles acting as crack nucleation sites during tensile deformation.
Structure and Phase Transformation in the Giant Magnetostriction Laves-Phase SmFe2
Energy Technology Data Exchange (ETDEWEB)
Liu, Xiaonan; Lin, Kun; Gao, Qilong; Zhu, He; Li, Qiang; Cao, Yili; Liu, Zhanning; You, Li; Chen, Jun; Ren, Yang [Argonne National Laboratory, X-Ray Science Division, Argonne, Illinois 60439, United States; Huang, Rongjin [Key Laboratory; Lapidus, Saul H. [Argonne National Laboratory, X-Ray Science Division, Argonne, Illinois 60439, United States; Xing, Xianran
2017-10-13
As one class of the most important intermetallic compounds, the binary Laves-phase is well-known for their abundant magnetic properties. Samarium-iron alloy system, SmFe2, is a prototypical Laves compound that shows strong negative magnetostriction but relatively weak magnetocrystalline anisotropy. SmFe2 has been identified as a cubic Fd$ \\overline{3}\\ $m structure at room temperature, however, the cubic symmetry does not match the spontaneous magnetization along the [111]cubic direction. Here we studied the crystal structure of SmFe2 by high-resolution synchrotron X-ray powder diffraction and X-ray total scattering methods. SmFe2 is found to adopt a centrosymmetric trigonal R$ \\overline{3}\\ $m structure at room temperature, which transforms to an orthorhombic Imma structure at 200 K. This transition is in agreement with the changes of easy magnetization direction from [111]cubic to [110]cubic direction, and is further evidenced by the inflexion of thermal expansion behavior, the sharp decline of the magnetic susceptibility in the FC-ZFC curve, and the anomaly in the specific heat capacity measurement. The revised structure and phase transformation of SmFe2 could be useful to understand the magnetostriction and related physical properties of other RM2-type pseudo-cubic Laves-phase intermetallic compounds.
Laves intermetallics in stainless steel-zirconium alloys
International Nuclear Information System (INIS)
Abraham, D.P.; McDeavitt, S.M.; Richardson, J.W. Jr.
1997-01-01
Laves intermetallics have a significant effect on properties of metal waste forms being developed at Argonne National Laboratory. These waste forms are stainless steel-zirconium alloys that will contain radioactive metal isotopes isolated from spent nuclear fuel by electrometallurgical treatment. The baseline waste form composition for stainless steel-clad fuels is stainless steel-15 wt.% zirconium (SS-15Zr). This article presents results of neutron diffraction measurements, heat-treatment studies and mechanical testing on SS-15Zr alloys. The Laves intermetallics in these alloys, labeled Zr(Fe,Cr,Ni) 2+x , have both C36 and C15 crystal structures. A fraction of these intermetallics transform into (Fe,Cr,Ni) 23 Zr 6 during high-temperature annealing; the authors have proposed a mechanism for this transformation. The SS-15Zr alloys show virtually no elongation in uniaxial tension, but exhibit good strength and ductility in compression tests. This article also presents neutron diffraction and microstructural data for a stainless steel-42 wt.% zirconium (SS-42Zr) alloy
Reaction of hydrogen with the Laves phase (C14) TiCr1.78-xMnx compounds
International Nuclear Information System (INIS)
Agresti, F.; Lo Russo, S.; Maddalena, A.; Principi, G.; Mazzolai, G.; Coluzzi, B.; Biscarini, A.; Mazzolai, F.M.; Tuissi, A.
2009-01-01
The lattice constants a and c of the as cast hexagonal (C14) Laves phase TiCr 1.78-x Mn x (x = 0, 0.4, 0.6 and 0.8) have been measured by X-ray diffraction at room temperature as a function of the Mn content. It has been found that a decreases with increasing x while c remains almost unchanged. Being this alloy interesting as material for solid state hydrogen storage, pressure-composition isotherms have been traced on desorption mode for the H 2 gas pressure and temperature varying from 10 to 0.01 MPa and from 209 to 307 K, respectively. From the temperature dependence of the plateau pressure the molar quantities ΔH-bar H 2 and ΔS-bar H 2 associated with the hydride decomposition have been determined as a function of the Mn content. With increasing x, both ΔH-bar H 2 and ΔS-bar H 2 progressively decrease, and the desorption pressure initially decreases (for x ≤ 0.4) then slightly increases. At the same time, the pseudo-plateaus become flatter.
Energy Technology Data Exchange (ETDEWEB)
Lishi, Ma; Yonghua, Duan, E-mail: duanyh@kmust.edu.cn; Runyue, Li
2017-02-15
The structural and mechanical properties, Debye temperatures and anisotropic sound velocities of the Laves phases Al{sub 2}M (M=Mg, Ca, Sr and Ba) with C14-type structure were investigated using the first-principles corresponding calculations. The corresponding calculated structural parameters and formation enthalpies are in good agreement with the available theoretical values, and Al{sub 2}Ca has the best phase stability. The mechanical properties, including elastic constants, bulk modulus B, shear modulus G, Young’s modulus E, and Poisson ratio ν, were deduced within the Voigt-Reuss-Hill approximation. The brittleness and ductility were estimated by the values of Poisson ratio, B/G and Cauchy pressure. Moreover, the elastic anisotropy was investigated by calculating and discussing several anisotropy indexes. Finally, the electronic structures were used to illustrate the bonding characteristics of C14-Al{sub 2}M (M=Mg, Ca, Sr and Ba) phases.
Energy Technology Data Exchange (ETDEWEB)
Shrivastava, Deepika, E-mail: deepika89shrivastava@gmail.com; Sanyal, Sankar P. [Department of Physics, Barkatullah university, Bhopal, 462026 (India)
2016-05-06
We have performed the first-principles calculations to study the structural, electronic and elastic properties of RERu{sub 2} (RE = Pr and Nd) Laves phase intermetallic compounds using full-potential linearized augmented plane wave (FP-LAPW) method based on density functional theory (DFT) within the generalized gradient approximation (GGA) for exchange and correlation potential. The optimized lattices constant are in reasonable agreement with available experimental data. The electronic properties are analyzed in terms of band structures, total and partial density of states, which confirm their metallic character. The calculated elastic constants infer that these compounds are mechanically stable in C15 (MgCu{sub 2} type) structure and found to be ductile in nature.
Elastic constants of a Laves phase compound: C15 NbCr2
International Nuclear Information System (INIS)
Ormeci, A.; Chu, F.; Wills, J.M.; Chen, S.P.; Albers, R.C.; Thoma, D.J.; Mitchell, T.E.
1997-01-01
The single-crystal elastic constants of C15 NbCr 2 have been computed by using a first-principles, self-consistent, full-potential total energy method. From these single-crystal elastic constants the isotropic elastic moduli are calculated using the Voigt and Reuss averages. The calculated values are in fair agreement with the experimental values. The implications of the results are discussed with regards to Poisson's ratio and the direction dependence of Young's modulus
Laves phase UTi2 stabilized by hydrogen and its magnetic properties
Buturlim, V.; Havela, L.; Sowa, S.; Kim-Ngan, N.-. T. H.; Paukov, M.; Drozdenko, D.; Dopita, M.; Minarik, P.; Mašková, S.
2018-05-01
We describe basic magnetic properties of uranium-based hydrides UTi2Hx, reported in literature as a cubic Laves phase, although the UTi2 binary phase does not exist. Using a high-temperature hydrogenation, we successfully synthesized two types of such hydrides, presumably with different H concentrations, one with a smaller lattice parameter a = 850.3 pm, which is a paramagnet close to the verge of magnetic ordering, the other with a = 858.8 pm, with a ferromagnetic ground state and ordering temperature TC = 54 K.
Bałanda, Maria; Dubiel, Stanisław M.
2018-05-01
A C14 Nb0.975Fe2.025 Laves phase compound was investigated aimed at determining the H-T magnetic phase diagram. Magnetization, M, and AC magnetic susceptibility measurement were performed. Concerning the former field-cooled and zero-field-cooled M-curves were recorded in the temperature range of 2-200 K and in applied magnetic field, H, up to 1000 Oe, isothermal M(H) curves at 2 K, 5 K, 50 K, 80 K and 110 K as well as hysteresis loops at several temperatures over the field range of ±10 kOe were measured. Regarding the AC susceptibility, χ, both real and imaginary components were registered as a function of increasing temperature in the interval of 2 K-150 K at the frequencies of the oscillating field, f, from 3 Hz up to 999 Hz. An influence of the external DC magnetic field on the temperature dependence of χ was investigated, too. The measurements clearly demonstrated that the magnetism of the studied sample is weak, itinerant and has a reentrant character. Based on the obtained results a magnetic phase diagram has been constructed in the H-T coordinates.
Structural, electronic and elastic properties of REIr{sub 2} (RE=La and Ce) Laves phase compounds
Energy Technology Data Exchange (ETDEWEB)
Shrivastava, Deepika, E-mail: deepika89shrivastava@gmail.com; Fatima, Bushra; Sanyal, Sankar P. [Department of Physics, Barkatullah University, Bhopal, 462026 (India)
2016-05-23
REIr{sub 2} (RE = La and Ce) Laves phase intermetallic compounds were investigated with respect to their structural, electronic and elastic properties using full potential linearized augmented plane wave (FP-LAPW) method within generalized gradient approximation (GGA) as implemented in WIEN2k code. The ground state properties such as lattice constants (a{sub 0}), bulk modulus (B), pressure derivative of bulk modulus (B′) and density of state at Fermi level N(E{sub F}) have been obtained by optimization method. The electronic structure (BS, TDOS and PDOS) reveals that these Laves phase compounds are metallic in nature. The calculated elastic constants indicate that these compounds are mechanically stable at ambient pressure and found to be ductile in nature.
The Cr–Fe–Nb ternary system: Experimental isothermal sections at 700 °C, 1050 °C and 1350 °C
Energy Technology Data Exchange (ETDEWEB)
Jacob, Aurélie, E-mail: a.jacob@fz-juelich.de [Forschungszentrum Juelich, IEK-2, 52425 Juelich (Germany); Schmetterer, Clemens [Forschungszentrum Juelich, IEK-2, 52425 Juelich (Germany); Fraunhofer-UMSICHT, 92237 Sulzbach-Rosenberg (Germany); Grüner, Daniel; Wessel, Egbert [Forschungszentrum Juelich, IEK-2, 52425 Juelich (Germany); Hallstedt, Bengt [Institute for Materials Applications in Mechanical Engineering, RWTH Aachen University, Augustinerbach 4, 52062 Aachen (Germany); Singheiser, Lorenz [Forschungszentrum Juelich, IEK-2, 52425 Juelich (Germany)
2015-11-05
The Cr–Fe–Nb system is an important constituent system in the development of Laves-phase reinforced steels. It contains two Laves-phase polytypes, i.e. C14–Fe{sub 2}Nb and C15–Cr{sub 2}Nb. While the first forms a substantial ternary solid solution with Cr, the latter only shows a limited solubility for Fe. The phase equilibria in the Cr–Fe–Nb system are shown in three isothermal sections at 700, 1050 and 1350 °C. Scanning electron microscopy coupled with energy dispersive X-ray analysis (SEM/EDX), X-ray diffraction (XRD) and electron back scatter diffraction (EBSD) were used to determine the phase equilibria from which the isothermal sections were constructed. - Highlights: • Determination of Phase Equilibria in the Cr–Fe–Nb system at 700, 1050 and 1350 °C. • Isothermal sections at 700, 1050 and 1350 °C were established. • Homogeneity range of Laves phases were determined. • Solubility of Fe and Cr and lattice parameter evolution in the ternary phases were determined.
Data on a Laves phase intermetallic matrix composite in situ toughened by ductile precipitates.
Knowles, Alexander J; Bhowmik, Ayan; Purkayastha, Surajit; Jones, Nicholas G; Giuliani, Finn; Clegg, William J; Dye, David; Stone, Howard J
2017-10-01
The data presented in this article are related to the research article entitled "Laves phase intermetallic matrix composite in situ toughened by ductile precipitates" (Knowles et al.) [1]. The composite comprised a Fe 2 (Mo, Ti) matrix with bcc (Mo, Ti) precipitated laths produced in situ by an aging heat treatment, which was shown to confer a toughening effect (Knowles et al.) [1]. Here, details are given on a focused ion beam (FIB) slice and view experiment performed on the composite so as to determine that the 3D morphology of the bcc (Mo, Ti) precipitates were laths rather than needles. Scanning transmission electron microscopy (S(TEM)) micrographs of the microstructure as well as energy dispersive X-ray spectroscopy (EDX) maps are presented that identify the elemental partitioning between the C14 Laves matrix and the bcc laths, with Mo rejected from the matrix into laths. A TEM selected area diffraction pattern (SADP) and key is provided that was used to validate the orientation relation between the matrix and laths identified in (Knowles et al.) [1] along with details of the transformation matrix determined.
Data on a Laves phase intermetallic matrix composite in situ toughened by ductile precipitates
Directory of Open Access Journals (Sweden)
Alexander J. Knowles
2017-10-01
Full Text Available The data presented in this article are related to the research article entitled “Laves phase intermetallic matrix composite in situ toughened by ductile precipitates” (Knowles et al. [1]. The composite comprised a Fe2(Mo, Ti matrix with bcc (Mo, Ti precipitated laths produced in situ by an aging heat treatment, which was shown to confer a toughening effect (Knowles et al. [1]. Here, details are given on a focused ion beam (FIB slice and view experiment performed on the composite so as to determine that the 3D morphology of the bcc (Mo, Ti precipitates were laths rather than needles. Scanning transmission electron microscopy (S(TEM micrographs of the microstructure as well as energy dispersive X-ray spectroscopy (EDX maps are presented that identify the elemental partitioning between the C14 Laves matrix and the bcc laths, with Mo rejected from the matrix into laths. A TEM selected area diffraction pattern (SADP and key is provided that was used to validate the orientation relation between the matrix and laths identified in (Knowles et al. [1] along with details of the transformation matrix determined.
Reaction of hydrogen with the Laves phase (C14) TiCr{sub 1.78-x}Mn{sub x} compounds
Energy Technology Data Exchange (ETDEWEB)
Agresti, F. [Universita di Padova, Dipartimento di Ingegneria Meccanica, Settore Materiali and CNISM, via Marzolo 9, 35131 Padova (Italy); Lo Russo, S. [Universita di Padova, Dipartimento di Fisica and CNISM, via Marzolo 8, 35131 Padova (Italy); Maddalena, A.; Principi, G. [Universita di Padova, Dipartimento di Ingegneria Meccanica, Settore Materiali and CNISM, via Marzolo 9, 35131 Padova (Italy); Mazzolai, G. [Universita di Perugia, Dipartimento di Fisica, Via A. Pascoli 5, 06100 Perugia (Italy); Universita Telematica e-Campus, Via Isimbardi 10, Novedrate (Colombia) (Italy); Coluzzi, B.; Biscarini, A. [Universita di Perugia, Dipartimento di Fisica, Via A. Pascoli 5, 06100 Perugia (Italy); Mazzolai, F.M., E-mail: fabio.mazzolai@fisica.unipg.it [Universita di Perugia, Dipartimento di Fisica, Via A. Pascoli 5, 06100 Perugia (Italy); Tuissi, A. [Istituto per l' Energia e le Interfasi, CNR-IENI, C.so Promessi Sposi, 29, Lecco (Italy)
2009-09-15
The lattice constants a and c of the as cast hexagonal (C14) Laves phase TiCr{sub 1.78-x}Mn{sub x} (x = 0, 0.4, 0.6 and 0.8) have been measured by X-ray diffraction at room temperature as a function of the Mn content. It has been found that a decreases with increasing x while c remains almost unchanged. Being this alloy interesting as material for solid state hydrogen storage, pressure-composition isotherms have been traced on desorption mode for the H{sub 2} gas pressure and temperature varying from 10 to 0.01 MPa and from 209 to 307 K, respectively. From the temperature dependence of the plateau pressure the molar quantities {Delta}H-bar{sub H{sub 2}} and {Delta}S-bar{sub H{sub 2}} associated with the hydride decomposition have been determined as a function of the Mn content. With increasing x, both {Delta}H-bar{sub H{sub 2}} and {Delta}S-bar{sub H{sub 2}} progressively decrease, and the desorption pressure initially decreases (for x {<=} 0.4) then slightly increases. At the same time, the pseudo-plateaus become flatter.
Elastic constants of a Laves phase compound: C15 NbCr{sub 2}
Energy Technology Data Exchange (ETDEWEB)
Ormeci, A. [Koc Univ., Istanbul (Turkey)]|[Los Alamos National Lab., NM (United States); Chu, F.; Wills, J.M.; Chen, S.P.; Albers, R.C.; Thoma, D.J.; Mitchell, T.E. [Los Alamos National Lab., NM (United States)
1997-04-01
The single-crystal elastic constants of C15 NbCr{sub 2} have been computed by using a first-principles, self-consistent, full-potential total energy method. From these single-crystal elastic constants the isotropic elastic moduli are calculated using the Voigt and Reuss averages. The calculated values are in fair agreement with the experimental values. The implications of the results are discussed with regards to Poisson`s ratio and the direction dependence of Young`s modulus.
Elastic constants of the C15 laves phase compound NbCr2
International Nuclear Information System (INIS)
Chu, F.; He, Y.; Thoma, D.J.; Mitchell, T.E.
1995-01-01
Elastic properties of a solid are important because they relate to various fundamental solid-state phenomena such as interatomic potentials, equations of state, and phonon spectra. Elastic properties are also linked thermodynamically with specific heat, thermal expansion, Debye temperature, and Gruneisen parameter. Most important, knowledge of elastic constants is essential for many practical applications related to the mechanical properties of a solid as well: load-deflection, thermoelastic stress, internal strain (residual stress), sound velocities, dislocation core structure, and fracture toughness. In order to understand better the physical properties and deformation behavior of the C15 compound NbCr 2 , the authors have studied its elastic properties in this paper. In Section 2, the experimental methods are described, including the preparation of the sample and the measurement of the elastic constants. In Section 3, the experimental results are presented and the implications of these experimental results are discussed. Conclusions are drawn in Section 4
Hydrogen diffusion in the Laves-phase compound TiCr1.78
International Nuclear Information System (INIS)
Mazzolai, G.; Coluzzi, B.; Biscarini, A.; Mazzolai, F.M.; Tuissi, A.; Agresti, F.; Principi, G.; Lo Russo, S.
2009-01-01
The temperature dependence of the Young's modulus and of the internal friction (IF) has been investigated between 80 and 300 K at acoustical frequencies in the hexagonal (C14) Laves-phase TiCr 1.78 charged with hydrogen. In this compound H occupies tetrahedral interstitial sites which are grouped in interlinked hexagons. A mechanical relaxation has been found at around 120 K (f = 5.4 kHz), which appears to be due to tunnelling transitions of delocalized H from one hexagon to the other. The rate of H absorption has been investigated at high temperature (660-1200 K) and the H diffusion coefficient has been derived from the pressure measurement as a function of time. A cumulative Arrhenius plot of IF and absorption diffusion data exhibits a non-exponential behaviour, which is due to a change in the diffusion mechanism from over-barrier hopping at high temperature to phonon-assisted tunnelling at low temperature.
Czech Academy of Sciences Publication Activity Database
Tereshina, I.; Cwik, J.; Tereshina, Evgeniya; Politova, G.; Burkhanov, G.; Chzhan, V.; Ilyushin, A.; Miller, M.; Zaleski, A.; Nenkov, K.; Schultz, L.
2014-01-01
Roč. 50, č. 11 (2014), s. 2504604 ISSN 0018-9464 Institutional support: RVO:68378271 Keywords : giant magnetostriction * Laves phase structure * magnetic anisotropy * magnetocaloric effect * rare-earth intermetallic Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.386, year: 2014
Hydrogen diffusion in the Laves-phase compound TiCr{sub 1.78}
Energy Technology Data Exchange (ETDEWEB)
Mazzolai, G. [University of Perugia, Department of Physics, Via A. Pascoli 5, 06100 Perugia (Italy); Universita Telematica e-Campus, Via Isimbardi 10, Novedrate (Colombia) (Italy); Coluzzi, B.; Biscarini, A. [University of Perugia, Department of Physics, Via A. Pascoli 5, 06100 Perugia (Italy); Mazzolai, F.M., E-mail: fabio.mazzolai@fisica.unipg.it [University of Perugia, Department of Physics, Via A. Pascoli 5, 06100 Perugia (Italy); Tuissi, A. [Institute for Energy and Interphases, CNR-IENI, C.so Promessi Sposi, 29, Lecco (Italy); Agresti, F.; Principi, G. [University of Padua, Dept. of Mech. Eng., via Marzolo 8, 35131 Padua (Italy); Lo Russo, S. [University of Padua, Physics Dept., via Marzolo 8, 35131 Padua (Italy)
2009-09-15
The temperature dependence of the Young's modulus and of the internal friction (IF) has been investigated between 80 and 300 K at acoustical frequencies in the hexagonal (C14) Laves-phase TiCr{sub 1.78} charged with hydrogen. In this compound H occupies tetrahedral interstitial sites which are grouped in interlinked hexagons. A mechanical relaxation has been found at around 120 K (f = 5.4 kHz), which appears to be due to tunnelling transitions of delocalized H from one hexagon to the other. The rate of H absorption has been investigated at high temperature (660-1200 K) and the H diffusion coefficient has been derived from the pressure measurement as a function of time. A cumulative Arrhenius plot of IF and absorption diffusion data exhibits a non-exponential behaviour, which is due to a change in the diffusion mechanism from over-barrier hopping at high temperature to phonon-assisted tunnelling at low temperature.
Fe-moment instability in Ti{sub 1-x}Sc{sub x}Fe{sub 2} Laves-phase compounds
Energy Technology Data Exchange (ETDEWEB)
Ouladdiaf, B. [Institut Laue-Langevin, BP 156, 38042 GRENOBLE Cedex 09 (France); Deportes, J. [Lab. Louis Neel, CNRS, BP 166, 38042 GRENOBLE Cedex 09 (France); Saoudi, M. [Centre Universitaire de Guelma, GUELMA 24 000 (Algeria)
2002-07-01
The magnetic properties of the pseudo-binary Laves-phase compounds Ti{sub 1-x}Sc{sub x}Fe{sub 2} were investigated by means of magnetisation and high-resolution powder neutron diffraction techniques. For x<0.2 a transition from an antiferromagnetic state to a canted one with a ferromagnetic component in the basal plane is observed, while for 0.2
Energy Technology Data Exchange (ETDEWEB)
Reshak, A.H., E-mail: maalidph@yahoo.co.uk [New Technologies - Research Centre, University of West Bohemia, Univerzitni 8, Pilsen 306 14 (Czech Republic); School of Material Engineering, University Malaysia Perlis, Kangar, Perlis 01007 (Malaysia)
2017-01-15
Thermoelectric properties of materials are intimately related to their electronic band structure. Combining first- and second-principles calculations, we have obtained the transport properties for the spin-up and spin-down electrons of the laves phase TbFe{sub 2} and TbCo{sub 2} compounds. The unique band structure feature and the density of states at Fermi level (E{sub F}) promote the E{sub F} to a point where carriers are in energetic proximity to these features. The non-zero density of states at E{sub F} for the spin-up (↑) and spin-down (↓) electrons leads to unusual transport properties because both the (↑) and (↓) densities contributes to the states at E{sub F}. The parabolic bands in the vicinity of E{sub F} enhance the carriers mobility and hence the transport properties of TbFe{sub 2} and TbCo{sub 2}. Calculations show that the spin-up/down transport coefficients are temperature-dependent. It has been found that TbCo{sub 2} possess larger Seebeck coefficient than that of TbFe{sub 2} and hence the power factor. The calculated Seebeck coefficient of TbCo{sub 2} agree well with the available experimental data. - Highlights: • The transport properties of TbFe{sub 2} and TbCo{sub 2} are obtained. • The non-zero density of states at E{sub F} leads to unusual transport properties. • Spin-up/down transport coefficients are temperature-dependent. • The calculated Seebeck coefficient of TbCo{sub 2} agree with the experimental data. • TbCo{sub 2} possesses larger Seebeck coefficient than that of TbFe{sub 2}.
Energy Technology Data Exchange (ETDEWEB)
Zhu, J.H.; Liaw, P.K. [Univ. of Tennessee, Knoxville, TN (United States). Dept. of Materials Science and Engineering; Liu, C.T. [Oak Ridge National Lab., TN (United States). Metals and Ceramics Div.
1997-12-01
Phase stability in a ternary Nb-Cr-Ni Laves phase system was studied in this paper. Their previous study in NbCr{sub 2}-based transition-metal Laves phases has shown that the average electron concentration factor, e/a, is the dominating factor in controlling the phase stability of NbCr{sub 2}-based Laves phases when the atomic size ratios are kept identical. Since Ni has ten out-shell electrons, the substitution of Ni for Cr in NbCr{sub 2} will increase the average electron concentration of the alloy, thus leading to the change of the crystal structures from C15 to C14. In this paper, a number of pseudo-binary Nb(Cr,Ni){sub 2} alloys were prepared, and the crystal structures of the alloys after a long heat-treatment at 1000 C as a function of the Ni content were determined by the X-ray diffraction technique. The boundaries of the C15/C14 transition were determined and compared to their previous predictions. It was found that the electron concentration and phase stability correlation is obeyed in the Nb-Cr-Ni system. However, the e/a ratio corresponding to the C15/C14 phase transition was found to move to a higher value than the predicted one. The changes in the lattice constant, Vickers hardness and fracture toughness were also determined as a function of the Ni content, which were discussed in light of the phase stability difference of the alloys.
Structural, electronic and elastic properties of heavy fermion YbRh2 Laves phase compound
Pawar, Harsha; Shugani, Mani; Aynyas, Mahendra; Sanyal, Sankar P.
2018-05-01
The structural, electronic and elastic properties of YbRh2 Laves phase intermetallic compound which crystallize in cubic (MgCu2-type) structure have been investigated using ab-initio full potential linearized augmented plane wave (FP- LAPW) method with LDA and LDA+U approximation. The calculated ground state properties such as lattice parameter (a0), bulk modulus (B) and its pressure derivative (B') are in good agreement with available experimental and theoretical data. The electronic properties are analyzed from band structures and density of states. Elastic constants are predicted first time for this compound which obeys the stability criteria for cubic system.
Energy Technology Data Exchange (ETDEWEB)
Rashidi, Masoud, E-mail: masoud.rashidi@chalmers.se [Department of Physics, Chalmers University of Technology, SE-412 96 Gothenburg (Sweden); Johansson, Lennart [Siemens Industrial Turbomachinery AB, SE-612 83 Finspong (Sweden); Andrén, Hans-Olof; Liu, Fang [Department of Physics, Chalmers University of Technology, SE-412 96 Gothenburg (Sweden)
2017-05-10
Z-phase strengthened 12% Cr steels are designed to combine good corrosion and creep resistance for applications in fossil fuel power plants with steam temperatures up to 650 °C. Two trial Z-phase strengthened steels were investigated, Z-steel with ultra-low C content, and ZCuC-steel with relatively high C content and Cu addition. The Z-steel has better creep strength; however, the alloy has low impact toughness due to the formation of continuous Laves-phase films at grain boundaries. Atom probe tomography, transmission electron microscopy, and scanning electron microscopy were employed to study the effects of C and Cu on the microstructure of the two steels in the as-tempered condition, and after ageing for different times. The Z-steel shows a fast transformation from TaN to Z-phase. The relatively high C content in the ZCuC-steel resulted in the formation of two categories of MX: Ta(C, N) and TaN. The phase transformation from Ta(C, N) to Z-phase is slower compared to that from TaN to Z-phase. In addition, precipitation of M{sub 23}C{sub 6} and Cu particles in the ZCuC-steel led to easier nucleation of Laves-phase, and hence a much improved toughness.
Hyperfine spectroscopic study of Laves phase HfFe2
International Nuclear Information System (INIS)
Belosevic-Cavor, J.; Novakovic, N.; Cekic, B.; Ivanovic, N.; Manasijevic, M.
2004-01-01
Hyperfine fields in HfFe 2 were measured at 181 Ta probe using the time-differential perturbed angular correlation method (TDPAC) in the temperature range 78-1200 K. Analysis of the spectra revealed two interactions with hyperfine fields of 13.82(7) T and 8.0(2) T, at 293 K. First is ascribed to the interaction at the 8a position in the cubic C15 structure. The second can be assigned to a minor amount of hexagonal C14 phase, or to an irregular position of the probe in the C15 lattice. Results of calculations using LAPW-WIEN97 are in a good agreement with experiment
Precipitation in AISI 316L(N) during creep tests at 550 and 600 °C up to 10 years
Padilha, A. F.; Escriba, D. M.; Materna-Morris, E.; Rieth, M.; Klimenkov, M.
2007-05-01
The precipitation behaviour in the gauge lengths and in the heads of initially solution annealed type 316L(N) austenitic stainless steel specimens tested in creep at 550 and 600 °C for periods of up to 85 000 h has been studied using several metallographic techniques. Three phases were detected: M 23C 6, Laves, and sigma phase. The volume fraction of the precipitated sigma phase was significantly higher than that of carbides and the Laves phase. M 23C 6 carbide precipitation occurred very rapidly and was followed by the sigma and Laves phases formation in the delta ferrite islands. Sigma and Laves phases precipitated at grain boundaries after longer times. Two different mechanisms of sigma phase precipitation have been proposed, one for delta ferrite decomposition and another for grain boundary precipitation. Small quantities of the Laves phase were detected in delta ferrite, at grain boundaries and inside the grains.
Microstructure of Z-phase strengthened martensitic steels: Meeting the 650°C challenge
DEFF Research Database (Denmark)
Liu, Fang; Rashidi, Masoud; Hald, John
2017-01-01
content in the steels is the governing factor in this transformation. The impact toughness of some test alloys was rather low. This is attributed to the formation of a continuous W-rich film along prior austenite grain boundaries. Cu and C addition to the test alloys changed Laves phase morphology...
International Nuclear Information System (INIS)
Lee, E.H.; Mansur, L.K.
2000-01-01
The precipitate phase stability in Fe-15Ni-13Cr base austenitic alloys was investigated as a function of minor alloying additions after thermally aging at 600 deg. C and 675 deg. C for times ranging from 24 h to one year. Seven major precipitate phases were found in aged specimens, including M 23 C 6 , Laves, Eta (η), TiO, NbC, MC, and M 2 P. The types and amounts of precipitate phases varied with alloying element additions, aging temperature, and aging time. By analyzing the composition of each individual particle, it was possible to determine the essential constituent elements for each phase. From this information, a strategy to promote or suppress certain precipitate phases was developed. Among the seven phases, the most desirable precipitate phases were considered to be MC and M 2 P, because these particles form on a fine scale with a high number density and, therefore, can serve as effective gas atom trap sites under irradiation
Li{sub 12}Cu{sub 12.60}Al{sub 14.37}. A new ternary derivative of the binary Laves phases
Energy Technology Data Exchange (ETDEWEB)
Pavlyuk, Volodymyr [Ivan Franko Lviv National Univ. (Ukraine). Dept. of Inorganic Chemistry; Jan Dlugosz Univ., Czestochowa (Poland). Inst. of Chemistry, Environment Protection and Biotechnology; Dmytriv, Grygoriy; Tarasiuk, Ivan [Ivan Franko Lviv National Univ. (Ukraine). Dept. of Inorganic Chemistry; Chumak, Ihor [IFW Dresden (Germany); Ehrenberg, Helmut [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany). Inorganic Chemistry
2011-12-15
New ternary dodecalithium dodecacopper tetradecaaluminium, Li{sub 12}Cu{sub 12.60}Al{sub 14.37} (trigonal, R anti 3m, hR39), crystallizes as a new structure type and belongs to the structural family that derives from binary Laves phases. The Li atoms are enclosed in 15- and 16-vertex and the Al3 atom in 14-vertex pseudo-Frank-Kasper polyhedra. The polyhedra around the statistical mixtures of (Cu,Al)1 and (Al,Cu)2 are distorted icosahedra. The electronic structure was calculated by the TB- LMTO-ASA (tight-binding linear muffin-tin orbital atomic spheres approximation) method. The electron localization function, which indicates bond formation, is mostly located at the Al atoms. Thus, Al-Al bonding is much stronger than Li-Al or Cu-Al bonding. This indicates that, besides metallic bonding which is dominant in this compound, weak covalent Al-Al interactions also exist. (orig.)
X-Ray diffraction on rare earth-3d Laves phase compound ErCo2 in magnetic field
International Nuclear Information System (INIS)
Yagasaki, Katsuma; Notsu, Shiko; Takaesu, Yoshinao; Nakama, Takao; Sakai, Eijiro; Koyama, Keiichi; Watanabe, Kazuo; Burkov, Alexander T.
2006-01-01
X-Ray powder diffraction method is used to investigate the effect of magnetic ordering and external magnetic field on crystal structure of Laves phase intermetallic compound ErCo 2 . The diffraction patterns were recorded at temperatures from 300K down to 8.5K in magnetic field up to 5T. Distortion of the room-temperature cubic structure was found in magnetically ordered state below 32K. The symmetry at low temperature is rhombohedral in agreement with literature results, or lower symmetry than it. However the symmetry of the unit cell increases to cubic in external magnetic field of 5T
Energy Technology Data Exchange (ETDEWEB)
Yurchenko, N.Yu. [Laboratory of Bulk Nanostructured Materials, Belgorod State University, Belgorod 308015 (Russian Federation); Stepanov, N.D., E-mail: stepanov@bsu.edu.ru [Laboratory of Bulk Nanostructured Materials, Belgorod State University, Belgorod 308015 (Russian Federation); Shaysultanov, D.G. [Laboratory of Bulk Nanostructured Materials, Belgorod State University, Belgorod 308015 (Russian Federation); Tikhonovsky, M.A. [National Science Center “Kharkov Institute of Physics and Technology”, NAS of Ukraine, Kharkov, 61108 (Ukraine); Salishchev, G.A. [Laboratory of Bulk Nanostructured Materials, Belgorod State University, Belgorod 308015 (Russian Federation)
2016-11-15
In present study, structure and mechanical properties of the Al{sub x}CrNbTiVZr (x = 0; 0.25; 0.5; 1) high-entropy alloys after arc melting and annealing at 1200 °C for 24 h are investigated. The CrNbTiVZr alloy is composed of body centered cubic (bcc) and C15 (face centered cubic) Laves phases while the Al{sub x}CrNbTiVZr (x = 0.25; 0.5; 1) alloys consist of bcc and two C14 (hexagonal close packed) Laves phases with different chemical compositions. Thermodynamic modeling predicts existence of two phases – bcc and C15 Laves phase and broadening of single bcc phase field due to Al addition. The density of the alloys decreases with the increase of Al content. The alloys are found to be extremely brittle at room temperature and 600 °C. The alloys have high strength at temperatures of 800–1000 °C. For example, yield strength at 800 °C increases from 440 MPa for the CrNbTiVZr alloy to 1250 MPa for the AlCrNbTiVZr alloy. The experimental phase composition of the Al{sub x}CrNbTiVZr alloys is compared with predicted equilibrium phases and the factors governing the transformation of C15 to C14 Laves phases due to Al addition to the CrNbTiVZr alloy analyzed. Specific properties of the alloys are compared with other high-entropy alloys and commercial Ni-based superalloys. - Highlights: •Al{sub x}CrNbTiVZr (x = 0; 0.25; 0.5; 1) alloys are arc melted and annealed at 1200 °C. •The CrNbTiVZr alloy has bcc and C15 Laves phases. •The Al-containing alloys are composed of bcc and two C14 Laves phases. •The alloys demonstrate high specific strength at temperatures of 800 °C and 1000 °C. •The strength of the alloys increases in proportion with increase of Al content.
Intermetallic phases in the iron-rich region of the Zr-Fe phase diagram
International Nuclear Information System (INIS)
Granovsky, M.S.; Arias, D.
1996-01-01
Intermetallic phases in the Fe-rich region of the Zr-Fe system are studied by X-ray diffraction and optical and electron microscopy. The chemical composition of each phase has been quantitatively measured in a electron microprobe. The stable phases found in this region are ZrFe 2 , Zr 6 Fe 23 and (αFe). ZrFe 2 is identified as a cubic Laves type phase (C15) and the ZrFe 2 /ZrFe 2 +Zr 6 Fe 23 boundary composition is 73±1 at.% Fe. Zr 6 Fe 23 is a cubic phase of the Th 6 Mn 23 type and its composition is 80.0±1.5 at.% Fe. The eutectic L↔Zr 6 Fe 23 +τ-Fe transformation temperature and composition are 1325 C and 91±1 at.% Fe, respectively. The solubility of Zr in τ-Fe at 1012 C is 500±50 appm and 1000±100 appm close to the eutectic temperature. (orig.)
Production and characterization of monocrystals of the cubic Laves phases Se-Al2
International Nuclear Information System (INIS)
Beyss, M.; Uelhoff, W.; Fattah, A.
1977-04-01
The monocrystals of the cubic Laves phases Se-Al 2 have been produced for special measurements. Low-temperature anomalies were measured which were influenced by doping with foreign atoms. These anomalies, also called Kondo effect, were detected in some physical quantities like electric resistance, magnetic resistance, susceptibility, magnetization, specific heat, thermal conductivity and thermoelectric force. For diffuse magnetic neutron scattering, monocrystals with the dimensions 10 mm diameter and 70 mm length were produced. The materials used were La Al 2 , (La Ce) Al 2 , Ce Al 2 , Y Al 2 , and (Y Ce) Al 2 . The monocrystals had to have an exactly cylindrical cross-section which was obtained by stripping by means of spark erosion machines. The measurements were carried out at the reactor of the Laue-Langevin Institute at Grenoble. In the experiments the magnetic behavior was measured by neutron scattering on monocrystals in the temperature range from 2.5 K to 300 K, the energy spectra having been registered. (orig.) [de
International Nuclear Information System (INIS)
Roth, Johannes
2002-01-01
Quasicrystals and ordinary crystals both possess long-range translational order. But quasicrystals are aperiodic since their symmetry is non-crystallographic. The aim of this project is to study the behavior of shock waves in periodic and aperiodic structures and to compare the results. The expectation is that new types of defects are generated in the aperiodic materials. The materials studied are two models of (AlCu)Li quasicrystals and the C15 Laves phase, a low-order approximant of the quasicrystals. An elastic wave is found in the simulations up to a piston velocity of about up < 0.25 cl. Between 0.5 < up/cl < 0.5 the slope of elastic wave velocity slows down, and a new plastic wave is observed. Extended defect are generated, but no simple two-dimensional walls. The defect bands have finite width and a disordered structure. If the crystal is quenched a polycrystalline phase is obtained. For the quasicrystal the transformation is more complex since ring processes occur in the elastic regime already. Starting at about up < 0.5 cl a single plastic shock wave is observed. In this range all structures are destroyed completely
Electron diffraction analysis of an AB{sub 2}-type Laves phase for hydrogen battery applications
Energy Technology Data Exchange (ETDEWEB)
Shi, Z.; Chumbley, S.; Laabs, F.C. [Iowa State Univ., Ames, IA (United States). Ames Lab.
2000-11-16
A multicomponent AB{sub 2} type nickel-metal hydride (Ni-MH) battery alloy prepared by high-pressure gas atomization (HPGA) was investigated by transmission electron microscopy (TEM) in both the as-atomized and heat treated condition. TEM examination showed a heavily faulted dendritic growth structure in as-atomized powder. Selected area diffraction (SAD) showed that this region consisted of both a cubic C15 structure with lattice constant a=7.03 A and an hexagonal C14 structure with lattice parameter a=4.97 A, c=8.11 A. The orientation relationship (OR) between the C14 and C15 structures was determined to be (111)[1 anti 10]{sub C15}//(0001)[11 anti 20]C{sub 14}. An interdendritic phase possessing the C14 structure was also seen. There was also a very fine grain region consisting of the C14 structure. Upon heat treatment, the faulted structure became more defined and appeared as intercalation layers within the grains. Spherical particles rich in Zr and Ni appeared scattered at the grain boundries instead of the C14 interdendritic phase. The polycrystalline region also changed to a mixture of C14 and C15 structures. The phase stability of the C15 and C14 structures based on a consideration of atomic size factor and the average electron concentration is discussed. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Mendez Martin, Francisca [Graz Univ. of Technology (Austria). Inst. for Materials Science and Welding; Panait, Clara Gabriela [MINES ParisTech, UMR CNRS, Evry (France). Centre des Materiaux; V et M France CEV, Aulnoye-Aymeries (France); Bendick, Walter [Salzgitter Mannesmann Forschung GmbH (SZMF), Duisburg (DE)] (and others)
2010-07-01
9-12% Cr heat resistant steels are used for applications at high temperatures and pressures in steam power plants. 12% Cr steels show higher creep strength and higher corrosion resistance compared to 9% Cr steels for short term creep exposure. However, the higher creep strength of 12 %Cr steels drops increasingly after 10,000-20,000 h of creep. This is probably due to a microstructural instability such as the precipitation of new phases (e.g. Laves phases and Z-phases), the growth of the precipitates and the recovery of the matrix. 9% Cr and 12% Cr tempered martensitic steels that have been creep tested for times up to 50,000 h at 600 C and 650 C were investigated using Transmission Electron Microscopy (TEM) on extractive replicas and thin foils together with Backscatter Scanning Electron Microscopy (BSE-SEM) to better understand the different creep behaviour of the two different steels. A significant precipitation of Laves phase and low amounts of Z-phase was observed in the 9% Cr steels after long-term creep exposure. The size distribution of Laves phases was measured by image analysis of SEM-BSE images. In the 12% Cr steel two new phases were identified, Laves phase and Z-phase after almost 30,000 h of creep test. The quantification of the different precipitated phases was studied. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Zhang, Wenxu, E-mail: xwzhang@uestc.edu.cn; Zhang, Wanli
2016-04-15
The electronic structures of four Laves phase iron compounds (e.g. YFe{sub 2}, ZrFe{sub 2}, LuFe{sub 2} and HfFe{sub 2}) have been calculated with a state-of-the-art full potential electronic structure code. Our theoretical work predicted that the magnetic moments collapse under hydrostatic pressure. This feature is found to be universal in these materials. Its electronic origin is provided by the sharp peaks in the density of states near the Fermi level. It is shown that a first order quantum phase transition can be expected under pressure in Y(Zr, or Lu)Fe{sub 2}, while a second order one in HfFe{sub 2}. The bonding characteristics are discussed to elucidate the equilibrium lattice constant variation. The large spontaneous volume magnetostriction gives one of the most important characteristics of these compounds. Invar anomalies in these compounds can be partly explained by the current work when the fast continuous magnetic moment decrease with the decrease of the lattice constant was properly considered. This work may be as a first insight into the rich world of quantum phase transition and Invar mechanism in these Laves phase compounds. - Highlights: • Magnetic moment of YFe{sub 2}, ZrFe{sub 2}, LuFe{sub 2} and HfFe{sub 2} collapses under pressure. • The transition in Y(Zr or Lu) Fe{sub 2} under pressure is first order. • The transition in HfFe{sub 2} under pressure is second order. • The Invar effects in the compounds can be put into the magnetostriction model.
International Nuclear Information System (INIS)
Chaboy, J.; Garcia, J.; Marcelli, A.
1995-08-01
An x-ray absorption spectroscopy (XAS) investigation of the structural changes occurred upon hydriding in the Friauf-Laves phase compounds CeFe 2 , CeRu 2 and LaRu 2 compounds is presented. The analysis of the extended x-ray absorption spectroscopy (EXAFS) spectra at the L-edges of the rare-earth and at the Fe K-edge indicates that the hydrogenation process leads to the suppression of the long-range crystalline order in all the hydride derivates investigated, as well as the different influence of H 2 in both the rare earth and transition metal sublattices. The correlation between the structural and magnetic changes induced by the hydrogen in the lost matrix is discussed in terms of the modification of the electronic properties, i.e., intermediate-valence of Ce, and of the hybridization between the transition metal and rare-earth
Pawar, H.; Shugani, M.; Aynyas, M.; Sanyal, S. P.
2018-02-01
The structural, electronic and elastic properties of YbTM2 (TM = Ir and Pt) Laves phase intermetallic compounds which crystallize in cubic (MgCu2-type) structure, have been investigated using ab-initio full potential linearized augmented plane wave (FP-LAPW) method with LDA and LDA+U approximation. The calculated ground state properties such as lattice parameter (a0), bulk modulus (B) and its pressure derivative (B‧) are in good agreement with available experimental and theoretical data. The electronic properties are analyzed from band structures and density of states. Elastic constants are predicted first time for these compounds which obey the stability criteria for cubic system.
Michalski, Rafał; Zygadło, Jakub
2018-04-01
Recent calculations of properties of TbAl2 GdAl2 and SmAl2 single crystals, performed with our new computation system called ATOMIC MATTERS MFA are presented. We applied localized electron approach to describe the thermal evolution of Fine Electronic Structure of Tb3+, Gd3+ and Sm3+ ions over a wide temperature range and estimate Magnetocaloric Effect (MCE). Thermomagnetic properties of TbAl2, GdAl2 and SmAl2 were calculated based on the fine electronic structure of the 4f8, 4f7 and 4f5 electronic configuration of the Tb3+ and Gd3+ and Sm3+ ions, respectively. Our calculations yielded: magnetic moment value and direction; single-crystalline magnetization curves in zero field and in external magnetic field applied in various directions m(T,Bext); the 4f-electronic components of specific heat c4f(T,Bext); and temperature dependence of the magnetic entropy and isothermal entropy change with external magnetic field - ΔS(T,Bext). The cubic universal CEF parameters values used for all CEF calculations was taken from literature and recalculated for universal cubic parameters set for the RAl2 series: A4 = +7.164 Ka04 and A6 = -1.038 Ka06. Magnetic properties were found to be anisotropic due to cubic Laves phase C15 crystal structure symmetry. These studies reveal the importance of multipolar charge interactions when describing thermomagnetic properties of real 4f electronic systems and the effectiveness of an applied self-consistent molecular field in calculations for magnetic phase transition simulation.
Clean Grain Boundary Found in C14/Body-Center-Cubic Multi-Phase Metal Hydride Alloys
Directory of Open Access Journals (Sweden)
Hao-Ting Shen
2016-06-01
Full Text Available The grain boundaries of three Laves phase-related body-center-cubic (bcc solid-solution, metal hydride (MH alloys with different phase abundances were closely examined by scanning electron microscopy (SEM, transmission electron microscopy (TEM, and more importantly, electron backscatter diffraction (EBSD techniques. By using EBSD, we were able to identify the alignment of the crystallographic orientations of the three major phases in the alloys (C14, bcc, and B2 structures. This finding confirms the presence of crystallographically sharp interfaces between neighboring phases, which is a basic assumption for synergetic effects in a multi-phase MH system.
Directory of Open Access Journals (Sweden)
Fan Zhang
2013-09-01
Full Text Available Microstructure and phase composition of a CrMo0.5NbTa0.5TiZr high entropy alloy were studied in the as-solidified and heat treated conditions. In the as-solidified condition, the alloy consisted of two disordered BCC phases and an ordered cubic Laves phase. The BCC1 phase solidified in the form of dendrites enriched with Mo, Ta and Nb, and its volume fraction was 42%. The BCC2 and Laves phases solidified by the eutectic-type reaction, and their volume fractions were 27% and 31%, respectively. The BCC2 phase was enriched with Ti and Zr and the Laves phase was heavily enriched with Cr. After hot isostatic pressing at 1450 °C for 3 h, the BCC1 dendrites coagulated into round-shaped particles and their volume fraction increased to 67%. The volume fractions of the BCC2 and Laves phases decreased to 16% and 17%, respectively. After subsequent annealing at 1000 °C for 100 h, submicron-sized Laves particles precipitated inside the BCC1 phase, and the alloy consisted of 52% BCC1, 16% BCC2 and 32% Laves phases. Solidification and phase equilibrium simulations were conducted for the CrMo0.5NbTa0.5TiZr alloy using a thermodynamic database developed by CompuTherm LLC. Some discrepancies were found between the calculated and experimental results and the reasons for these discrepancies were discussed.
Investigation Of Temperature Dependent Characteristics Of ...
African Journals Online (AJOL)
The structure, magnetization and magnetostriction of Laves phase compound TbCo2 were investigated by temperature dependent high resolution neutron powder diffraction. The compound crystallizes in the cubic Laves phase C15 structure above its Curie temperature, TC and exhibits a rhombohedral distortion (space ...
Order-disorder phase transition in ZrV2Dsub(3.6)
International Nuclear Information System (INIS)
Didisheim, J.-J.; Yvon, K.; Tissot, P.
1981-01-01
The deuterated C15-type Laves phase ZrV 2 Dsub(3.6) undergoes a structural phase transition near room temperature (T of the order of 325 K). In the cubic high-temperature phase the deuterium atoms are disordered over two types of tetrahedral interstices, the centres of which are 1.3 A apart. In the tetragonal low-temperature phase the D atoms are ordered and occupy only the energetically more favourable interstices. The tetragonal structure is isotypic with the low-temperature phase of HfV 2 D 4 . The shortest D-D distance is 2.1 A. (author)
Phase changes in superaustenitic steels after long-term annealing
Energy Technology Data Exchange (ETDEWEB)
Svoboda, M.; Kroupa, A. [Inst. of Physics of Materials, Academy of Sciences of Czech Republic, Brno (Czech Republic); Sopousek, J.; Vrest' al, J. [Inst. of Theoretical and Physical Chemistry, Masaryk Univ., Brno (Czech Republic); Miodownik, P. [Thermotech Ltd, The Surrey Research Park, Guildford (United Kingdom)
2004-11-01
A structural study was performed on the austenitic steels Avesta 254 SMO and Avesta 654 SMO after annealing at 700 C for 500, 3188, and 6170 h. Both Avesta steels initially show an unexpectedly large amount of the Laves phase, followed by a relatively slow development of the Sigma phase with equilibrium apparently not yet reached after 3188 h. Thermodynamic calculations confirm that the driving forces for alternative precipitates are very similar thus making it easy to form metastable precipitates that only change very slowly to the equilibrium state. TTT calculations also confirm that the Laves phase precipitates earlier than the Sigma phase as the temperature is lowered. (orig.)
International Nuclear Information System (INIS)
Liu, P.; Stigenberg, A.H.; Nilsson, J.O.
1995-01-01
A thorough microstructural investigation has been performed on a high strength maraging steel of the type 12%Cr-9%Ni-4%Mo-2%Cu-1%Ti. The major precipitate formed during isothermal aging at 475 C is a quasicrystalline phase possessing icosahedral symmetry termed R'-phase with a typical chemical composition of 48%Mo-33%Fe-13%Cr-2%Ni-4%Si. At 550 C the major precipitate is trigonal R-phase with a typical composition of 45%Mo-31%Fe-18%Cr-4%Ni-2%Si. At 550 C also Laves phase with a composition of 48%Mo-35%Fe-13%Cr-2%Ni-2%Si could be observed. At both 475 and 550 C an ordered phase termed L-phase precipitated. This minority phase has an ordered face centered cubic (f.c.c.) structure of type L1 0 . Its composition is typically 9%Fe-4%Cr-52%Ni-15%Mo.-16%Ti-4%Al. R'-phase formed at 475 C transformed to R-phase and Laves phase during aging at 550 C. In an analogous manner, R-phase and Laves phase formed at 550 C transformed to R'-phase during subsequent aging at 475 C. This transformation was rationalized by a strong similarity in crystal structure between quasicrystalline R'-phase of icosahedral symmetry and Frank-Kasper phases such as R-phase and Laves phase
International Nuclear Information System (INIS)
Brady, M.P.; Tortorelli, P.F.
1998-01-01
The oxidation behavior of Cr(X) solid solution (Cr ss ) and Cr 2 X Laves phases (X = Nb, Ta) was studied individually and in combination at 950--1,100 C in air. The Cr ss phase was significantly more oxidation resistant than the Cr 2 X Laves phase. At 950 C, two-phase alloys of Cr-Cr 2 Nb and Cr-Cr 2 Ta exhibited in-situ internal oxidation, in which remnants of the Cr 2 X Laves phase were incorporated into a growing chromia scale. At 1,100 C, the Cr-Cr 2 Nb alloys continued to exhibit in-situ internal oxidation, which resulted in extensive O/N penetration into the alloy ahead of the alloy-scale interface and catastrophic failure during cyclic oxidation. IN contrast, the Cr-Cr 2 Ta alloys exhibited a transition to selective Cr oxidation and the formation of a continuous chromia scale. The oxidation mechanism is interpreted in terms of multiphase oxidation theory
Influence of hydrogen absorption on magnetic ordering in some zirconium-based Laves phase compounds
International Nuclear Information System (INIS)
Fujii, H.; Pourarian, F.; Wallace, W.E.
1982-01-01
Magnetization measurements were carried out on several zirconium-based hexagonal Laves phase compounds, i.e. the ZrMnsub(2+delta), (Zr,Ti)Mn 2 , Zr(Mn,Fe) 2 and Zr(Fe,Al) 2 systems and their hydrides. The absorbed hydrogen leads to a large increase (20%-30%) in volume without a change in the crystal structure. ZrMnsub(2+delta) is a weak Pauli paramagnet but becomes a spin glass near-ferromagnet by hydriding, indicating that the manganese moments are subjected to competing ferromagnetic and antiferromagnetic coupling tendencies. In the (Zrsub(1-x)Tisub(x))Mn 2 hydrides, ferromagnetic, spin-glass-like, ferromagnetic and antiferromagnetic behaviors appear at 4.2 K in the sequence of increasing x and/or decrease in hydrogen concentration. In the Zr(Mn,Fe) 2 system, the hydrogen absorption increases both the magnetic moments and the magnetic transition temperatures, while absorbed hydrogen leads to suppression of ferromagnetism in the Zr(Fe,Al) 2 system. These varied and complex magnetic behaviors are attributed to the effects of (1) variations in the interatomic distances, (2) changes in the 3d electron concentration and (3) varying local hydrogen concentrations occurring as a result of statistical fluctuations. (Auth.)
Intermetallic phases in the iron-rich region of the Zr-Fe phase diagram
Energy Technology Data Exchange (ETDEWEB)
Granovsky, M.S. [Comision Nacional de Energia Atomica, Buenos Aires (Argentina). Dept. de Materiales; Arias, D. [Comision Nacional de Energia Atomica, Buenos Aires (Argentina). Dept. de Materiales
1996-04-01
Intermetallic phases in the Fe-rich region of the Zr-Fe system are studied by X-ray diffraction and optical and electron microscopy. The chemical composition of each phase has been quantitatively measured in a electron microprobe. The stable phases found in this region are ZrFe{sub 2}, Zr{sub 6}Fe{sub 23} and ({alpha}Fe). ZrFe{sub 2} is identified as a cubic Laves type phase (C15) and the ZrFe{sub 2}/ZrFe{sub 2}+Zr{sub 6}Fe{sub 23} boundary composition is 73{+-}1 at.% Fe. Zr{sub 6}Fe{sub 23} is a cubic phase of the Th{sub 6}Mn{sub 23} type and its composition is 80.0{+-}1.5 at.% Fe. The eutectic L{r_reversible}Zr{sub 6}Fe{sub 23}+{tau}-Fe transformation temperature and composition are 1325 C and 91{+-}1 at.% Fe, respectively. The solubility of Zr in {tau}-Fe at 1012 C is 500{+-}50 appm and 1000{+-}100 appm close to the eutectic temperature. (orig.).
Magnetic frustration and instability in Dy{sub 1-x}La{sub x}Mn{sub 2}
Energy Technology Data Exchange (ETDEWEB)
Ouladdiaf, B. [Institut Laue-Langevin, BP 156, 38042, Grenoble Cedex 9 (France); Ballou, R. [Laboratoire de Magnetisme Louis Neel , CNRS, BP 166, 38042, Grenoble Cedex 9 (France); Deportes, J. [Laboratoire de Magnetisme Louis Neel , CNRS, BP 166, 38042, Grenoble Cedex 9 (France); Lelievre-Berna, E. [Laboratoire de Magnetisme Louis Neel , CNRS, BP 166, 38042, Grenoble Cedex 9 (France)
1995-02-09
A structural dimorphism exists in the Dy{sub 1-x}La{sub x}Mn{sub 2} (0.05{<=}x{<=}0.25) compounds. When the C15 Laves phase is stabilized, no evidence for a long range order is found although the magnetovolume effect is observed at 34 K. When the C14 Laves phase is stabilized, an antiferromagnetic order sets in below 38 K without any magnetovolume effect. ((orig.)).
International Nuclear Information System (INIS)
Ivanova, T.I.; Nikitin, S.A.; Tskhadadze, G.A.; Koshkid’ko, Yu.S.; Suski, W.; Iwasieczko, W.; Badurski, D.
2014-01-01
Highlights: • The Al influence on magnetic properties of the Ho (Co 1-x Al x ) 2 compounds is analyzed. • The first-order magnetic transition appears in sample with Al concentrations x ≤ 0.06. • The MCE and Curie temperature TC demonstrate complex Al concentration dependences. • The magnetoresistance for sample with Al concentration x = 0.06 (58%) is maximum. • High magnetic fields changes the Curie temperature T c of the Ho (Co 1−x Al x ) 2 compounds. - Abstract: The magnetization, magnetoresistivity and magnetocaloric effect (MCE) of the Ho (Co 1−x Al x ) 2 Laves phase intermetallic compounds for x ⩽ 0.2 have been investigated. Complex measurements have been carried out in order to determine the influence of substitution in the Co sublattice by Al on the Co moment, type of the magnetic transition and related properties of these compounds. A comparative analysis of the magnetic, transport and magnetocaloric properties of Ho (Co 1−x Al x ) 2 alloys under various Al concentration is represented. Substitutions at the Co site by Al are found to result in the appearance of itinerant electron metamagnetism (IEM) at the small Al concentrations and in positive magnetovolume effect, leading to an initial increase in the ordering temperature; on the other hand the magnetic phase transition temperature as well as ΔT (MCE) do not depend in direct way on the Al concentration. The 16% increase of magnetocaloric effect for the alloy with x = 0.02 is detected in relation to maternal HoCo 2 . A giant value of magnetoresistivity (58%) is observed for the alloy with the same Al concentration
Microstructures and mechanical properties of two-phase alloys based on NbCr{sub 2}
Energy Technology Data Exchange (ETDEWEB)
Chen, K.C.; Kotula, P.G.; Cady, C.M.; Mauro, M.E.; Thoma, D.J.
1999-07-01
A two-phase, NbCrTi alloy (bcc + C15 Laves phase) has been developed using several alloy design methodologies. In efforts to understand processing-microstructure-property relationships, different processing routes were employed. The resulting microstructures and mechanical properties are discussed and compared. Plasma arc melted (PAM) samples served to establish baseline, as-cast properties. In addition, a novel processing technique, involving decomposition of a supersaturated and metastable precursor phase during hot isostatic pressing (HIP), was used to produce a refined, equilibrium two-phase microstructure. Quasi-static compression tests as a function of temperature were performed on both alloy types. Different deformation mechanisms were encountered based upon temperature and microstructure.
Neutron irradiation effects in advanced superconductors
International Nuclear Information System (INIS)
Yoshida, H.; Kodaka, H.; Miyata, K.; Hayashi, Y.; Atobe, K.
1988-01-01
This paper reports the effects of neutron irradiation on superconducting transitions studied by susceptibility and resistivity measurements for A15 type compounds, Laves-phase compounds and oxide superconductors. For A15 superconductors, the transition temperature (T c ) decreased with increasing neutron fluence and showed large drop started at about 5 x 10 18 n/cm 2 (E > 0.1 MeV). Post-irradiation annealing gave recovery of T c , but the behaviors were different for the materials with different composition and microstructure. The Laves-phase compounds showed less degradation than the A15 superconductors. For oxide superconductors very sensitive transition change was observed, including the radiation-induced superconductivity
Electronic configurations and energies in some thermodynamically correlated laves compounds
International Nuclear Information System (INIS)
Campbell, G.M.
1979-04-01
The known electronic configurations of simple elements in Laves compounds are correlated with those of the more complex systems to determine their electronic configurations and gaseous state promotion energies
Some new experimental results on the Zr-Nb-Fe system
Energy Technology Data Exchange (ETDEWEB)
Ramos, C. [Departamento de Fisica - CAC - Comision Nacional de Energia Atomica, Av. Gral Paz 1499, (1650) San Martin, Buenos Aires (Argentina)]. E-mail: ciramos@cnea.gov.ar; Saragovi, C. [Departamento de Fisica - CAC - Comision Nacional de Energia Atomica, Av. Gral Paz 1499, (1650) San Martin, Buenos Aires (Argentina); Granovsky, M.S. [Departamento de Materiales - CAC - Comision Nacional de Energia Atomica, Av. Gral Paz 1499, (1650) San Martin, Buenos Aires (Argentina)
2007-06-30
The scope of this study is the identification and characterization of intermetallic phases and their binary and ternary fields in the Zr-Nb-Fe phase diagram. A construction of the central region of the phase diagram at 900 {sup o}C was proposed using new experimental results obtained by optical and scanning electron microscopies, X-ray diffraction and microprobe analysis. In addition to the well-known Laves C15-type (ZrNb)Fe{sub 2} phase (the polytypic C14 and C36 structures were not detected in the studied compositions), another Laves C14-type phase was found (Zr(NbFe){sub 2}). Watson and Bennett maps helped to predict the occurrence of both of these phases. Moreover, the validity of the Pettifor prediction model for Laves phases in pseudobinary systems with transition elements was checked, verifying the obtained experimental results in the Zr-Nb-Fe system. On the other hand it was determined that the Zr-Nb-Fe ternary system at 900 {sup o}C, as it happens in the binary Zr-Nb system, would have a miscibility gap ({beta}-Zr + {beta}-Nb) in the 25-70 at.% Nb composition range, accepting up to 3 at.% Fe approximately.
Det særlige ved at lave et projekt i Nationalt Videncenter for Læsning
DEFF Research Database (Denmark)
Lund, Henriette Romme
2009-01-01
Nationalt Videncenter for Læsnings kommunikationskonsulent har interviewet projektdeltagere om, hvor de så det særlige i at lave et projekt i regi af Nationalt Videncenter for Læsning......Nationalt Videncenter for Læsnings kommunikationskonsulent har interviewet projektdeltagere om, hvor de så det særlige i at lave et projekt i regi af Nationalt Videncenter for Læsning...
Constitution of the ternary system Cr–Ni–Ti
International Nuclear Information System (INIS)
Krendelsberger, Natalja; Weitzer, Franz; Du, Yong; Schuster, Julius C.
2013-01-01
Highlights: •Reaction scheme and liquidus surface for Cr-Ni-Ti are given. •In the ternary the C14-type Laves phase coexists with the liquid phase. •Two ternary eutectics are identified. -- Abstract: The nature of solid–liquid phase equilibria in the ternary system Cr–Ni–Ti was investigated using electron microscopy, energy dispersive spectroscopy, X-ray diffraction, and differential thermal analysis. Literature data on solid state phase equilibria are confirmed. The Cr 2 Ti Laves phase modifications coexisting with Ni–Ti phases are clarified to be hexagonal C14-type and cubic C15-type. The C14-type Laves phase γCr 2 Ti is found to coexist with the liquid phase. It forms in the pseudobinary peritectic reaction p max1 from L + β(Cr,Ti) at 1389 °C. On further cooling γCr 2 Ti + NiTi solidify at 1202 °C in the pseudobinary eutectic e max2 . In the Cr-rich part of the system ternary eutectics occur at 1216 °C (E 1 : L = Ni 3 Ti + (Ni) + β(Cr,Ti)) and 1100 °C (E 2 : L = NiTi + Ni 3 Ti + β(Cr,Ti)), respectively. No ternary eutectic is found in the Ti-rich part. Rather the eutectic trough ends in the binary eutectic L = NiTi 2 + β(Ti)
DEFF Research Database (Denmark)
Tokairin, Tsuyoshi; Dahl, Kristian Vinter; Danielsen, Hilmar Kjartansson
2013-01-01
Long-term creep rupture properties and microstructural stability of Fe–Ni based alloy Ni–23Cr–7W (HR6W, ASME Code Case 2684) were experimentally investigated. Crept specimens at 700 °C for durations up to 37,667 h were chosen, the microstructure evolution during creep was characterized. Besides...... for the main strengthening precipitate, Laves phase. The alloy was proven to have good microstructural stability without observable coarsening of strengthening precipitates during long-term creep up to around 37,667 h. It was also verified that the growth kinetics of Laves phase can be well described...
Energy Technology Data Exchange (ETDEWEB)
Sahlberg, Martin, E-mail: Martin.sahlberg@kemi.uu.se [Department of Chemistry, The Angstroem Laboratory, Uppsala University, Box 538, SE-751 21 Uppsala (Sweden); Angstroem, Jonas, E-mail: jonas.angstrom@kemi.uu.se [Department of Chemistry, The Angstroem Laboratory, Uppsala University, Box 538, SE-751 21 Uppsala (Sweden); Zlotea, Claudia, E-mail: claudia.zlotea@icmpe.cnrs.fr [Chimie Metallurgique des Terres Rares, Institut de Chimie et des Materiaux de Paris Est, UMR 7182, CNRS, 2-8 rue Henri Dunant, 94320 Thiais Cedex (France); Beran, Premysl, E-mail: pberan@ujf.cas.cz [Nuclear Physics Institute, Academy of Sciences of the Czech Republic, 25068 Rez (Czech Republic); Latroche, Michel, E-mail: michel.latroche@glvt-cnrs.fr [Chimie Metallurgique des Terres Rares, Institut de Chimie et des Materiaux de Paris Est, UMR 7182, CNRS, 2-8 rue Henri Dunant, 94320 Thiais Cedex (France); Pay Gomez, Cesar, E-mail: Cesar.paygomez@kemi.uu.se [Department of Chemistry, The Angstroem Laboratory, Uppsala University, Box 538, SE-751 21 Uppsala (Sweden)
2012-12-15
The crystal structures of hydrogenated and unhydrogenated Sc(Al{sub 1-x}Ni{sub x}){sub 2} Laves phases have been studied by combining several diffraction techniques and it is shown that hydrogen is situated interstitially in the A{sub 2}B{sub 2}-sites, which have the maximum number of scandium neighbours. The hydrogen absorption/desorption behaviour has also been investigated. It is shown that a solid solution of hydrogen forms in the mother compound. The hydrogen storage capacity exceeds 1.7 H/f.u. at 374 K, and the activation energy of hydrogen desorption was determined to 4.6 kJ/mol H{sub 2}. It is shown that these compounds share the same local coordination as Frank-Kasper-type approximants and quasicrystals, which opens up the possibility of finding many new hydride phases with these types of crystal structures. - Graphical abstract: The structure of ScNiAlDx, Sc atoms are shown in purple and Ni/Al atoms in blue and the iso-surfaces of deuterium in yellow. Revealed from refinements of neutron powder diffraction data. Highlights: Black-Right-Pointing-Pointer The crystal structure of ScNiAl and ScNiAlDx is reported. Black-Right-Pointing-Pointer We show the hydrogen storage properties of Sc(Al{sub 1-x}Ni{sub x}){sub 2}. Black-Right-Pointing-Pointer We discuss the possibility to store hydrogen in quasicrystals.
Microstructural evolution of ASTM P91 after 100,000 hours exposure at 550 C and 600 C
Energy Technology Data Exchange (ETDEWEB)
Cipolla, L.; Venditti, D.; Di Gianfrancesco, A. [Centro Sviluppo Materiali SpA, Rome (Italy); Caminada, S. [TenarisDalmine, Dalmine (Italy); Danielsen, H.K. [Technical Univ. of Denmark, Lyngby (Denmark)
2010-07-01
ASTM A335 P91 samples were investigated after creep testing at 550 C and 600 C for over 10{sup 5} h. X-Ray Diffraction, Scanning and Transmission Electron Microscopy were adopted to assess the microstructural evolution of the material in terms of precipitation changes during high temperature exposure. Mean equivalent diameters and average chemical compositions of MX and M{sub 23}C{sub 6} precipitates and Laves phases were assessed through the analysis of a large number of particles. Their growth and coarsening kinetics were determined at 600 C on many samples with increasing exposure times up to 100,000 hours. Also the presence of modified Z-phase, Cr(V, Nb)N, was investigated. The high microstructural stability of Grade 91 is related to the presence of fine and distributed MX carbonitrides, always present even after very long term temperature exposure. The mean size of MX carbonitrides remains almost constant and stays below 45 nm after 10{sup 5} h at 600 C. Although MX particles exhibit a Cr enrichment with increasing ageing times, indicating that they are absorbing Cr atoms from the surrounding matrix, their transformation into Z-phase is still at a very preliminary stage: only a few hybrid MX/Z particles and a few Z-phase precipitates were identified in the most aged sample after 10{sup 5} at 600 C. Coarsening of M{sub 23}C{sub 6} occurs during thermal exposure, but their average equivalent diameter, initially of 140 nm in the as-treated material, remains below 200 nm after 10{sup 5} h at 600 C. Laves particles form at grain boundaries after a relatively short time and soon become the largest precipitates. (orig.)
International Nuclear Information System (INIS)
Rodak, Kinga; Hernas, Adam; Vodarek, Vlastimil
2015-01-01
Microstructural changes in high alloy (9-12% Cr) creep resistant martensitic X10CrMoVNb9-1 and 12CrMoW . CuVNb steels after 100 000 h of steam exposure at 550 C have been studied using scanning transmission electron microscopy. Precipitates were identified using electron diffraction patterns and energy dispersive X-ray spectroscopy analysis. After long time exposure, a significant coarsening of M 23 C 6 carbides, and intensive precipitation of the coarse Laves phase were observed. Moreover, in the 12CrMoW . CuVNb steel, a low amount of the modified Z-phase particles was detected. The microstructures of the X10Cr . MoVNb9-1 and 12CrMoWCuVNb steels after 100 000 h of exposure differ in several aspects.
Energy Technology Data Exchange (ETDEWEB)
Rodak, Kinga; Hernas, Adam [Silesian Univ. of Technology, Inst. of Materials Science, Katowice (Poland); Vodarek, Vlastimil [VSB-Technical Univ. of Ostrava (Czech Republic)
2015-07-15
Microstructural changes in high alloy (9-12% Cr) creep resistant martensitic X10CrMoVNb9-1 and 12CrMoW . CuVNb steels after 100 000 h of steam exposure at 550 C have been studied using scanning transmission electron microscopy. Precipitates were identified using electron diffraction patterns and energy dispersive X-ray spectroscopy analysis. After long time exposure, a significant coarsening of M{sub 23}C{sub 6} carbides, and intensive precipitation of the coarse Laves phase were observed. Moreover, in the 12CrMoW . CuVNb steel, a low amount of the modified Z-phase particles was detected. The microstructures of the X10Cr . MoVNb9-1 and 12CrMoWCuVNb steels after 100 000 h of exposure differ in several aspects.
TEM characterization of microstructure evolution of 12%Cr heat resistant steels
Energy Technology Data Exchange (ETDEWEB)
Rojas, D.; Prat, O.; Sauthoff, G. [Max-Planck-Institut fuer Eisenforschung GmbH, Duesseldorf (Germany); Garcia, J. [Helmholtz-Zentrum Berlin fuer Materialien und Energie GmbH, Berlin (Germany); Kaysser-Pyzalla, A.R. [Helmholtz-Zentrum Berlin fuer Materialien und Energie GmbH, Berlin (Germany); Bochum Univ. (Germany)
2010-07-01
A detailed characterization of the microstructure evolution of 12%Cr heat resistant steels at different creep times (100 MPa / 650 C / 8000 h) were carried out by scanning transmission electron microscopy (STEM). The results of the microstructure analysis are correlated with the mechanical properties in order to investigate the influence of different precipitates (especially M{sub 23}C{sub 6}) on the creep strength of the alloys. Precipitation of Laves phase and Z-phase was observed after several hours creep time. Very few Z-phase of the type Cr(V,Ta)N nucleating from existing (V,Ta)(C,N) was observed. Both alloys show growth and coarsening of Laves phase, meanwhile the MX carbonitrides present a very slow growth and coarsening rate. Alloys containing Laves phase, MX and M{sub 23}C{sub 6} precipitates show best creep properties. (orig.)
Analysis of PTA hardfacing with CoCrWC and CoCrMoSi alloys
Directory of Open Access Journals (Sweden)
Adriano Scheid
2013-12-01
Full Text Available CoCrWC alloys are widely used to protect components that operate under wear and high temperature environments. Enhanced performance has been achieved with the CoCrMoSi alloys but processing this alloy system is still a challenge due to the presence of the brittle Laves phase, particularly when welding is involved. This work evaluated Plasma Transferred Arc coatings processed with the Co-based alloy CoMoCrSi - Tribaloy T400, reinforced with Laves phase, comparing its weldability to the CoCrWC - Stellite 6, reinforced with carbides. Coatings were also analyzed regarding the response to temperature exposure at 600°C for 7 days and subsequent effect on microstructure and sliding abrasive wear. Coatings characterization was carried out by light and scanning electron microscopy, X-ray diffraction and Vickers hardness. CoCrWC coatings exhibited a Cobalt solid solution dendritic microstructure and a thin interdendritic region with eutectic carbides, while CoCrMoSi deposits exhibit a large lamellar eutectic region of Laves phase and Cobalt solid solution and a small fraction of primary Laves phase. Although phase stability was observed by X-ray diffraction, coarsening of the microstructure occurred for both alloys. CoCrMoSi showed thicker lamellar Laves phase and CoCrWC coarser eutectic carbides. Coatings stability assessed by wear tests revealed that although the wear rate of the as-deposited CoCrMoSi alloy was lower than that of CoCrWC alloy its increase after temperature exposure was more significant, 22% against 15%. Results were discussed regarding the protection of industrial components in particular, bearings in 55AlZn hot dip galvanizing components.
15C-15F Charge Symmetry and the 14C(n,γ)15C Reaction Puzzle
International Nuclear Information System (INIS)
Timofeyuk, N.K.; Thompson, I.J.; Baye, D.; Descouvemont, P.; Kamouni, R.
2006-01-01
The low-energy reaction 14 C(n,γ) 15 C provides a rare opportunity to test indirect methods for the determination of neutron capture cross sections by radioactive isotopes versus direct measurements. It is also important for various astrophysical scenarios. Currently, puzzling disagreements exist between the 14 C(n,γ) 15 C cross sections measured directly, determined indirectly, and calculated theoretically. To solve this puzzle, we offer a strong test based on a novel idea that the amplitudes for the virtual 15 C→ 14 C+n and the real 15 F→ 14 O+p decays are related. Our study of this relation, performed in a microscopic model, shows that existing direct and some indirect measurements strongly contradict charge symmetry in the 15 C and 15 F mirror pair. This brings into question the experimental determinations of the astrophysically important (n,γ) cross sections for short-lived radioactive targets
Energy Technology Data Exchange (ETDEWEB)
Sikirica, M.; Ban, Z. [Rudjer Bokovic Institute, Zagreb, Yugoslavia (Croatia)
1963-11-15
During the investigation of the ternary system uranium-molybdenum-silicon, a new phase with the composition U{sub 4}Mo{sub 5}-Si{sub 3} was formed. Structure determination exclusively based on the powder data showed that the particular phase belongs to the hexagonal system. Space group P6/mmc or one of the sub-groups is indicated. Unit cell dimensions were found to be a = 5.37{sub 0}A, c = 8 . 58{sub 2}A. A comparison of calculated and observed intensities shows close resemblance to the structure of the Laves phases of the C14-type. (author) [French] Au cours de recherches sur le systeme ternaire uranium-molybdene-silicium, on a constate la formation d'une nouvelle phase, de composition U{sub 4}Mo{sub 5}Si{sub 3}. Une determination de la structure, exclusivement fondee sur des donnees relatives a la poudre, a revele que cette phase particuliere appartenait au systeme hexagonal. Les auteurs indiquent un groupe spatial P6/mmc ou un des sous-groupes. Les dimensions d'une maille individuelle sont donnees par a = 5,37{sub 0}A, c = 8,58{sub 2}A. La comparaison entre l'intensite calculee et Tintensite observee montre une ressemblance etroite avec la structure des phases de Laves du type C-14. (author) [Spanish] En-el curso del estudio del sistema temario uranio-molibdeno-silicio, los autores observaron la formacion de una fase cuya composicion responde a la formula U{sub 4}Mo{sub 5}Si{sub 3}. La determinacion de la estructura, basada exclusivamente en los datos referentes al material en polvo, demuestra que esa fase pertenece al sistema hexagonal. Se senalo la existencia de un grupo especial P6/mmc y se comprobo que las dimensiones de la celda elemental son a = 5,37{sub 0}A, c = 8,58{sub 2}A. La comparacion de las intensidades calculadas con las observadas indica que existe una analogia estrecha con la estructura de la fase de Laves del tipo C 14. (author) [Russian] Pri izuchenii trojnoj sistemy uran - molibden - kremnij obrazovalas' novaya faza sostava U{sub 4}Mo{sub 5
Last fra kornede materialer på begrænsningsvægge i lave lagerbygninger
DEFF Research Database (Denmark)
Møller, S.
Rapporten indeholder forudsætninger og retningslinier for den statiske beregning af lave lagerbygninger, fx. plansiloer i landbruget. I to hovedkapitler gives data og formler til lastbestemmelse som grundlag for brudundersøgelse og deformationsundersøgelse, samt et eksempel på lastberegning....
Volume dependence of T/sub c/ of Ternary A-15 Phases
International Nuclear Information System (INIS)
Shamrai, V.
1984-01-01
Results are presented of measurements of the superconducting transition temperature T/sub c/, lattice constant a, magnetic susceptibility /sub chi/, and critical field H/sub c/ 2 for many Nb 3 Al and V 3 Si-based ternary phases and Nb 3 SnH/sub x/. For V 3 Si-based ternary systems and Nb 3 SnH/sub x/ the density of states at the Fermi level N(epsilon/sub F/) sharply decreases with the concentration of the alloying element. The variation of N(epsilon/sub F/) in these ternary systems cannot be explained by the variation of a. In ternary phases Nb 3 (Al/sub 1-x/dY/sub x/), where Y can be Ge, Ga, Sb, or Se, a quite clear correlation is revealed between T/sub c/ and a. The dependence of T/sub c/ on V in these systems is due to the variation of the matrix element of the electron-phonon interaction 2 >
Fan Zhang; Oleg N. Senkov; Jonathan D. Miller
2013-01-01
Microstructure and phase composition of a CrMo0.5NbTa0.5TiZr high entropy alloy were studied in the as-solidified and heat treated conditions. In the as-solidified condition, the alloy consisted of two disordered BCC phases and an ordered cubic Laves phase. The BCC1 phase solidified in the form of dendrites enriched with Mo, Ta and Nb, and its volume fraction was 42%. The BCC2 and Laves phases solidified by the eutectic-type reaction, and their volume fractions were 27% and 31%, respectively....
International Nuclear Information System (INIS)
Rojas Jara, David
2011-01-01
This work was carried out aiming to design and characterise 9-12% Cr steels with tailormade microstructures for applications in fossil fuel fired power plants. The investigations concentrated in the design and characterisation of heat resistant steels for applications in high oxidising atmospheres (12% Cr) and 9% Cr alloys for components such as rotors (P91). ThermoCalc calculations showed to be a reliable tool for alloy development. The modeling also provided valuable information for the adjustment of the processing parameters (austenisation and tempering temperatures). Two 12% Cr heat resistant steels with a fine dispersion of nano precipitates were designed and produced supported by thermodynamic modeling (ThermoCalc). A detailed characterisation of the microstructure evolution at different creep times (100 MPa / 650 C / 8000 h) was carried out by scanning transmission electron microscopy (STEM). The results of the microstructure analysis were correlated with the mechanical properties in order to investigate the influence of different precipitates (especially M 23 C 6 carbides) on the creep strength of the alloys. Precipitation of Laves phase and Z-phase was observed after several hundred hours creep time. Very few Z-phase of the type Cr(V,Ta)N nucleating from existing (V,Ta)(C,N) was observed. Both alloys show growth and coarsening of Laves phase, meanwhile the MX carbonitrides present a very slow growth and coarsening rate. Alloys containing Laves phase, MX and M 23 C 6 precipitates show best creep properties. The influence of hot-deformation and tempering temperature on the microstructure evolution on one of the designed 12% Cr alloys was studied during short-term creep at 80-250 MPa and 650 C. Quantitative determination of dislocation density and sub-grain size in the initial microstructure and after creep was investigated by STEM combined with the high-angle annular dark-field detector (HAADF). A correlation between microstructure evolution and creep
Energy Technology Data Exchange (ETDEWEB)
Rojas Jara, David
2011-03-21
This work was carried out aiming to design and characterise 9-12% Cr steels with tailormade microstructures for applications in fossil fuel fired power plants. The investigations concentrated in the design and characterisation of heat resistant steels for applications in high oxidising atmospheres (12% Cr) and 9% Cr alloys for components such as rotors (P91). ThermoCalc calculations showed to be a reliable tool for alloy development. The modeling also provided valuable information for the adjustment of the processing parameters (austenisation and tempering temperatures). Two 12% Cr heat resistant steels with a fine dispersion of nano precipitates were designed and produced supported by thermodynamic modeling (ThermoCalc). A detailed characterisation of the microstructure evolution at different creep times (100 MPa / 650 C / 8000 h) was carried out by scanning transmission electron microscopy (STEM). The results of the microstructure analysis were correlated with the mechanical properties in order to investigate the influence of different precipitates (especially M{sub 23}C{sub 6} carbides) on the creep strength of the alloys. Precipitation of Laves phase and Z-phase was observed after several hundred hours creep time. Very few Z-phase of the type Cr(V,Ta)N nucleating from existing (V,Ta)(C,N) was observed. Both alloys show growth and coarsening of Laves phase, meanwhile the MX carbonitrides present a very slow growth and coarsening rate. Alloys containing Laves phase, MX and M{sub 23}C{sub 6} precipitates show best creep properties. The influence of hot-deformation and tempering temperature on the microstructure evolution on one of the designed 12% Cr alloys was studied during short-term creep at 80-250 MPa and 650 C. Quantitative determination of dislocation density and sub-grain size in the initial microstructure and after creep was investigated by STEM combined with the high-angle annular dark-field detector (HAADF). A correlation between microstructure
International Nuclear Information System (INIS)
Abraham, D. P.; Dietz, N.; Finnegan, N.
2000-01-01
The release of radioactive elements from the stainless steel-15 wt% zirconium (SS-15Zr) metal waste form will be governed by the corrosion behavior of ZrFe 2 -type intermetallics phases present in the alloy. In this article, oxidation products that formed on a ZrFe 2 -type intermetallic sample exposed to 200 C steam were characterized by Auger Electron Spectroscopy (AES) and Transmission Electron Microscopy (TEM). The data revealed two oxide layers on the sample surface: an outer crystalline iron-oxide layer and an inner amorphous zirconium-rich layer believed to be zirconium oxide. Thermodynamic considerations indicate that the zirconium-rich layer formed first. The iron-oxide layer appears to have resulted from the diffusion of iron through the zirconium-rich layer to the oxide-vapor interface
Verma, Anand Mohan; Kishore, Nanda
2017-02-01
The hydrolysis of cellulose fraction of biomass yields C6 glucose which further can be transformed into long-chain hydrocarbons by C-C coupling. In this study, C6 glucose is transformed into three chain alkanes, namely, C9, C12 and C15 using C-C coupling reactions under the gas and aqueous phase milieus. The geometry optimisation and vibrational frequency calculations are carried out at well-known hybrid-GGA functional, B3LYP with the basis set of 6-31+g(d,p) under the density functional theory framework. The single point energetics are calculated at M05-2X/6-311+g(3df,2p) level of theory. All thermochemical properties are calculated over a wide range of temperature between 300 and 900 K at an interval of 100 K. The thermochemistry suggested that the aqueous phase behaviour is suitable for the hydrolysis of sugar into long-chain alkanes compared to gas-phase environment. The hydrodeoxygenation reactions under each reaction pathway are found as most favourable reactions in both phases; however, aqueous phase dominates over gas phase in all discussed thermodynamic parameters.
The crystal structure of the mixed-layer Aurivillius phase Bi 5Ti 1.5W 1.5O 15
Tellier, J.; Boullay, Ph.; Créon, N.; Mercurio, D.
2005-09-01
The crystal structure of the 1+2 mixed-layer Aurivillius phase Bi 5Ti 1.5W 1.5O 15 (SG I2cm n o 46: -cba, Z=4, a=5.4092(3) Å, b=5.3843(3) Å and c=41.529(3) Å) consisting of the ordered intergrowth of one and two octahedra thick perovskite-type blocks separated by [Bi 2O 2] 2+ slabs is reported. Supported by an electron diffraction investigation and, using the Rietveld analysis, it is shown that this compound should be described using a I-centering lattice in agreement with the generalised structural model of the Aurivillius type compounds recently presented by the authors. The structure of this Bi 5Ti 1.5W 1.5O 15 phase is analyzed in comparison with the related simple members (Bi 2WO 6 and Bi 3Ti 1.5W 0.5O 9). The crystal structure of Bi 3Ti 1.5W 0.5O 9 is also reported.
Czech Academy of Sciences Publication Activity Database
Šob, Mojmír; Kroupa, Aleš; Pavlů, Jana; Vřešťál, Jan
2009-01-01
Roč. 150, č. 1 (2009), s. 1-28 ISSN 1012-0394 R&D Projects: GA MŠk OC 147; GA ČR GA106/07/1078 Institutional research plan: CEZ:AV0Z20410507 Keywords : Ab initio calculations * CALPHAD method * Laves phases * sigma phase * ternary systems * super-austenitic steels Subject RIV: BM - Solid Matter Physics ; Magnetism
Segregation effects and phase developments during solidification of alloy 625
DEFF Research Database (Denmark)
Højerslev, Christian; Tiedje, Niels Skat; Hald, John
2006-01-01
contained gamma-phase, Laves phase and, if carbon was dissolved in the liquid, niobium rich carbides formed. Molybdenum and niobium showed strong tendencies to segregate. Their segregation was balanced by inverse segregation of nickel and iron. The chromium concentration remained almost constant in gamma...
International Nuclear Information System (INIS)
Nagasaka, Takuya; Hishinuma, Yoshimitsu; Muroga, Takeo; Li, Yanfen; Watanabe, Hideo; Tanigawa, Hiroyasu; Sakasegawa, Hideo; Ando, Masami
2011-01-01
Extraction residue analysis was conducted on reduced activation ferritic/martensitic steels, such as F82H-BA07 heat, F82H-IEA heat, JLF-1 JOYO heat and CLAM steel. M 23 C 6 type precipitates, TaC precipitates and Fe 2 W Laves phase were identified in the present analyses. M 23 C 6 precipitates were coarsened in F82H-BA07 compared with the other steels at as-normalized and tempered (NT) condition. TaC precipitate formation was enhanced in JLF-1 and CLAM compared with F82H-BA07 and F82H-IEA at as-NT condition. Laves phase were detected in F82H-IEA after aging above 550 o C, where solid solution W was significantly decreased. F82H-IEA exhibited hardening after aging at 400 and 500 o C for 100 khr, whereas softening at 600 and 650 o C. This behavior is similar to JLF-1 and CLAM, and can be understood by precipitation of TaC and Laves phase.
Murtaza, Adil; Yang, Sen; Chang, Tieyan; Ghani, Awais; Khan, Muhammad Tahir; Zhang, Rui; Zhou, Chao; Song, Xiaoping; Suchomel, Matthew; Ren, Yang
2018-03-01
The spin reorientation (SR) and magnetoelastic properties of pseudobinary ferromagnetic T b1 -xN dxC o2 (0 ≤x ≤1.0 ) systems involving a morphotropic phase boundary (MPB) were studied by high-resolution synchrotron x-ray diffraction (XRD), magnetization, and magnetostriction measurements. The easy magnetization direction of the Laves phase lies along the 〈111 〉 axis with x 0.65 below Curie temperature (TC). The temperature-dependent magnetization curves showed SR; this can be explained by a two-sublattice model. Based on the synchrotron (XRD) and magnetization measurements, the SR phase diagram for a MPB composition of T b0.35N d0.65C o2 was obtained. Contrary to previously reported ferromagnetic systems involving MPB, the MPB composition of T b0.35N d0.65C o2 exhibits a low saturation magnetization (MS), indicating a compensation of the Tb and Nd magnetic moments at MPB. The anisotropic magnetostriction (λS) first decreased until x =0.8 and then continuously increased in the negative direction with further increase of Nd concentration. The decrease in magnetostriction can be attributed to the decrease of spontaneous magnetostriction λ111 and increase of λ100 with opposite sign to λ111. This paper indicates an anomalous type of MPB in the ferromagnetic T b1 -xN dxC o2 system and provides an active way to design novel functional materials with exotic properties.
Hosseini, Seyed Ali; Abbasi, Seyed Mehdi; Madar, Karim Zangeneh
2018-04-01
The effects of boron and zirconium on cast structure, hardness, and tensile properties of the nickel-based superalloy 718Plus were investigated. For this purpose, five alloys with different contents of boron and zirconium were cast via vacuum induction melting and then purified via vacuum arc remelting. Microstructural analysis by light-optical microscope and scanning electron microscope equipped with energy-dispersive x-ray spectroscopy and phase studies by x-ray diffraction analysis were performed. The results showed that boron and zirconium tend to significantly reduce dendritic arm spacing and increase the amount of Laves, Laves/gamma eutectic, and carbide phases. It was also found that boron led to the formation of B4C and (Cr, Fe, Mo, Ni, Ti)3B2 phases and zirconium led to the formation of intermetallic phases and ZrC carbide. In the presence of boron and zirconium, the hardness and its difference between dendritic branches and inter-dendritic spaces increased by concentrating such phases as Laves in the inter-dendritic spaces. These elements had a negative effect on tensile properties of the alloy, including ductility and strength, mainly because of the increase in the Laves phase. It should be noted that the largest degradation of the tensile properties occurred in the alloys containing the maximum amount of zirconium.
International Nuclear Information System (INIS)
Yagasaki, K; Nakama, T; Takaesu, Y; Hedo, M; Uchima, K; Uwatoko, Y; Burkov, A
2009-01-01
The electrical resistivity ν of the Laves phase Y 1-x R x Co 2 compound system has been measured in magnetic fields up to 10 T and under pressures up to 8 GPa at temperatures from 1.5 to 300 K. The anomalous behavior of residual resistivity has been observed in a region x a , where x a is a critical concentration between inhomogeneously and homogeneously ordered phases, and which has a maximum at x c where T c ∼ 0 with a mean field acting on Co sub-lattice is equal to the itinerant Co metamagnetic critical field B c . In x c a , the magneto-resistivity and pressure resistivity are anomalously large with positive sign. However, in the paramagnetic region for x c , they are anomalously large but with negative sign. The anomalous behavior is attributed to the s-d scattering of conduction electrons due to statistically disordered Co magnetization. Those phenomena can be explained by a new scattering model of [Two magnetization Nordheim model for randomly distributed Co sites] introduced by us.
Energy Technology Data Exchange (ETDEWEB)
Luan, B.F., E-mail: bfluan@cqu.edu.cn [College of Materials Science and Engineering, Chongqing University, Chongqing 400044 (China); Wang, J.M.; Qiu, R.S.; Tao, B.R.; He, W.J. [College of Materials Science and Engineering, Chongqing University, Chongqing 400044 (China); Zhang, X.Y.; Liu, R.P. [State Key Laboratory of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China); Liu, Q., E-mail: qingliu@cqu.edu.cn [College of Materials Science and Engineering, Chongqing University, Chongqing 400044 (China)
2016-09-05
Energy dispersive X-ray spectroscopy in scanning transmission electron microscope (STEM-EDS) technique and first-principles calculation are jointly utilized to investigate the distribution trends and site preferences of alloying elements in the precipitates within Zr-1.0Cr-0.4Fe-0.4Mo-0.4Bi alloy. Based on selected area electron diffraction (SAED) and energy dispersive X-ray spectroscopy (EDS) results, the precipitates within the studied alloy are confirmed to be ZrCr{sub 2}-based Laves phase with FCC (C15) type structure. The STEM-EDS elemental mapping is acquired to clarify the distribution trends of alloying elements in precipitates, i.e. Fe>Mo>Bi. To better verify this distribution behavior, substitutional formation energies and equilibrium concentrations of ternary alloying elements in ZrCr{sub 2} Laves phase are calculated by first-principles. The calculated results show a good consistence with the STEM-EDS results. In addition, the site preferences of ternary alloying elements in ZrCr{sub 2} Laves phase are predicted by the calculation of transfer energies. Finally, the reasons accounting for different distribution trends and site preferences of alloying elements in ZrCr{sub 2} Laves phase are discussed in terms of density of states, which attributed to the pseudogap effect and hybridizations between atoms. - Highlights: • Clarified the distribution trends of Fe>Mo>Bi in precipitates by STEM-EDS. • Verified the experimental results by first-principles calculation. • Predicted the site preferences of alloying elements by first-principles calculation. • Hybridization and pseudogap lead to the strong distribution and site preferences.
International Nuclear Information System (INIS)
Eremenko, V.N.; Velikanova, T.Ya.; Gordijchuk, O.V.
1988-01-01
Results of the X-ray phase, metallographic and high-temperature differential thermal analysis are used for the first time to plot a diagram of the Pr-C system state. Carbides are formed in the system: Pr 2 C 3 with the bcc-structure of the Pu 2 C 3 type and with the period a 0 = 0.85722+-0.00026 within the phase region + 2 C 3 >, a 0 0.86078+-0.00016 nm - within the region 2 C 3 >+α-PrC 2 ; dimorphous PrC 2 : α-PrC 2 with the bct-structure of the CaC 2 type and periods a 0.38517+-0.00011, c 0 = 0.64337+-0.00019 nm; β-PrC 2 with the fcc-structure, probably, of KCN type. Dicarbide melts congruently at 2320 grad. C, forming eutectics with graphite at 2254+-6 grad. C and composition of 71.5% (at.)C. It is polymorphously transformed in the phase region 2 C 3 > + 2 > at 1145+-4 grad. C, and in the region 2 >+C at 1134+-4 grad. C. Sesquicarbide melts incongruently at 1545+-4 grad. C. The eutectic reaction L ↔ + 2 C 3 > occurs at 800+-4 grad. C, the eutectic composition ∼ 15% (at.)C. The temperature of the eutectoid reaction ↔ + 2 C 3 > is 675+-6 grad C. The limiting carbon solubility in β-Pr is about 8 and in α-Pr it is about 5% (at.)
Creep and precipitation behaviors of AL6XN austenitic steel at elevated temperatures
Meng, L. J.; Sun, J.; Xing, H.
2012-08-01
Creep behaviors of the solution-treated AL6XN austenitic stainless steel have been investigated at 873-1023 K and 120-260 MPa. The results showed that the creep stress exponent and activation energy of the AL6XN steel are 5 and 395.4 kJ/mol, respectively in the power-law breakdown regime. TEM observations revealed that dislocations distributed homogenously in grains. The creep deformation mechanism is mainly attributed to viscous dislocation glide. Precipitates in the steel after creep deformation were additionally analyzed by TEM, and the results showed that there are four different types of precipitates, such as M23C6, M6C, σ phase and Laves phase. The M23C6 carbides were observed at grain boundaries in the steel after creep at 873 K. The M6C, σ phase and Laves phase precipitates were found when the creep temperature increases to 923-1023 K. Although the AL6XN steel exhibited low steady state creep rates, a high volume fraction of brittle precipitates of σ and Laves phases reduced the creep lifetime of the steel at elevated temperatures.
Creep and precipitation behaviors of AL6XN austenitic steel at elevated temperatures
Energy Technology Data Exchange (ETDEWEB)
Meng, L.J. [School of Materials Science and Engineering, Shanghai Jiaotong University, Dongchuan Road 800, Shanghai 200240 (China); Sun, J., E-mail: jsun@sjtu.edu.cn [School of Materials Science and Engineering, Shanghai Jiaotong University, Dongchuan Road 800, Shanghai 200240 (China); Xing, H. [School of Materials Science and Engineering, Shanghai Jiaotong University, Dongchuan Road 800, Shanghai 200240 (China)
2012-08-15
Creep behaviors of the solution-treated AL6XN austenitic stainless steel have been investigated at 873-1023 K and 120-260 MPa. The results showed that the creep stress exponent and activation energy of the AL6XN steel are 5 and 395.4 kJ/mol, respectively in the power-law breakdown regime. TEM observations revealed that dislocations distributed homogenously in grains. The creep deformation mechanism is mainly attributed to viscous dislocation glide. Precipitates in the steel after creep deformation were additionally analyzed by TEM, and the results showed that there are four different types of precipitates, such as M{sub 23}C{sub 6}, M{sub 6}C, {sigma} phase and Laves phase. The M{sub 23}C{sub 6} carbides were observed at grain boundaries in the steel after creep at 873 K. The M{sub 6}C, {sigma} phase and Laves phase precipitates were found when the creep temperature increases to 923-1023 K. Although the AL6XN steel exhibited low steady state creep rates, a high volume fraction of brittle precipitates of {sigma} and Laves phases reduced the creep lifetime of the steel at elevated temperatures.
Phase Transformation in Cast Superaustenitic Stainless Steels
Energy Technology Data Exchange (ETDEWEB)
Lee Phillips, Nathaniel Steven [Iowa State Univ., Ames, IA (United States)
2006-01-01
Superaustenitic stainless steels constitute a group of Fe-based alloys that are compositionally balanced to have a purely austenitic matrix and exhibit favorable pitting and crevice corrosion resistant properties and mechanical strength. However, intermetallic precipitates such as sigma and Laves can form during casting or exposure to high-temperature processing, which degrade the corrosion and mechanical properties of the material. The goal of this study was to accurately characterize the solid-solid phase transformations seen in cast superaustenitic stainless steels. Heat treatments were performed to understand the time and temperature ranges for intermetallic phase formations in alloys CN3MN and CK3MCuN. Microstructures were characterized using scanning electron microscopy (SEM), transmission electron microscopy (TEM), and energy and wavelength dispersive spectroscopy (EDS, WDS). The equilibrium microstructures, composed primarily of sigma and Laves within purely austenitic matrices, showed slow transformation kinetics. Factors that determine the extent of transformation, including diffusion, nucleation, and growth, are discussed.
Influence of annealing on structure and magnetic properties of Laves phase HfFe2
International Nuclear Information System (INIS)
Belosevic-Cavor, J.; Cekic, B.; Novakovic, N.; Ivanovic, N.; Manasijevic, M.
2004-01-01
Hyperfine fields (HFF) in a polycrystalline HfFe 2 binary compound were measured at 181 Ta probe ion sites using the time differential perturbed angular correlation (TDPAC) method. Analysis of TDPAC spectra obtained in measurements revealed two components. One of them corresponded to the magnetic perturbation with the value B hf1 (Ta) = 13.82(7) T at room temperature and it was ascribed to the interaction at the regular position of Hf in the cubic C15 (MgCu 2 -type) structure of the HfFe 2 compound. The second component with hyperfine field value of B hf2 (Ta) = 8.0(2) T is probably due to the presence of a minor amount of the hexagonal C14 (MgZn 2 -type) structure. Measurements showed that it had come to a change in the ratio of different components of TDPAC spectra with annealing, but the values for hyperfine fields for both components have not changed significantly. The origin of the hyperfine magnetic field and its difference in the two structures (C14 and C15) were discussed taking into account crystal structure effects. (orig.)
Nuclear magnetic relaxation and origins of RMN signals from GdAl2
International Nuclear Information System (INIS)
Santos Oliveira Junior, I. dos.
1988-12-01
The intermetallic compound GdAl 2 crystallizes in the cubic Laves phase C15. It is a simple ferromagnet below 176K. The easy direction of magnetization in this compound is such that the Al ions are distributed among two magnetically inequivalent sites. The pulsed NMR technique was used to study the origin of the signals from these two sites and the nuclear magnetic relaxation. (author) [pt
Characterization of laves phases in the pseudobinary Zr Cr2-Zr Fe2 system by Moessbauer spectroscopy
International Nuclear Information System (INIS)
Kanter, F.L. de; Badler, C.S.; Granovski, M.; Arias, D.
1988-01-01
57 Fe Moessbauer spectroscopy together with XRD and optical metallography were used to verify the two phase boundaries of the ZrCr 2 -ZrFe 2 pseudobinary phase diagram. Samples with adequate ternary and binary composition, treated at 1450 0 C, were studied. Experimental results indicate that in some cases the two phase boundaries should be modified. (author)
Initial study on Z-phase strengthened 9-12% Cr steels by atom probe tomography
Energy Technology Data Exchange (ETDEWEB)
Liu, Fang; Andren, Hans-Olof [Chalmers Univ. of Technology, Goeteborg (Sweden). Dept. of Applied Physics
2010-07-01
The microstructure of two different types of Z-phase strengthened experimental steels, CrNbN-based or CrTaN-based, was investigated. Both steels underwent aging at 650 C for relatively short period of time, 24 hours or 1005 hours. Atom probe tomography was used to study the chemical composition of the matrix and precipitates, and the size and number density of the small precipitates. Both steels contain Laves phase at prior austenite grain boundaries and martensitic lath boundaries. The CrTaN-based steel was found more promising due to its finer and more densely distributed precipitates after 1005 hour aging. (orig.)
Sahlaoui, Habib; Sidhom, Habib
2013-07-01
The phase precipitation in industrial AISI 316L stainless steel during aging for up to 80,000 hours between 823 K and 1073 K (550 °C and 800 °C) has been studied using transmission electron microscopy, scanning transmission electron microscopy, and carbon replica energy-dispersive X-ray microanalysis. Three phases were identified: Chromium carbides (M23C6), Laves phase ( η), and σ-phase (Fe-Cr). M23C6 carbide precipitation occurred firstly and was followed by the η and σ-phases at grain boundaries when the aging temperature is higher than 873 K (600 °C). Precipitation and growth of M23C6 create chromium depletion zones at the grain boundaries and also retard the σ-phase formation. Thus, the σ-phase is controlled by the kinetic of chromium bulk diffusion and can appear only when the chromium reaches, at grain boundaries and at the M23C6/ γ and M23C6/ η/ γ interfaces, content higher than a critical value obtained by self-healing. An analytical model, based on equivalent chromium content, has been established in this study and successfully validated to predict the time-temperature-precipitation diagram of the σ-phase. The obtained diagram is in good agreement with the experimental results.
The Zr-Ti-Cr system. Equilibria at 900 and 1100 C degrees
International Nuclear Information System (INIS)
Arico, Sergio F.; Gribaudo, Luis M.
2003-01-01
Main contributions to the knowledge of the ternary system Zr-Ti-Cr were published in the sixties. Stability domains of phases at temperatures between 500 and 1400 C degrees were there presented. Here, results related to the phase diagram at 900 and 1100 C degrees are informed. Three alloys with 40 at.% Cr and different Zr/Ti ratios and one more, richer in Cr, were elaborated. Specimens of the alloys were heat treated 1000 and 800 h at 900 and 1100 C degrees respectively. Phase characterizations were performed by optic metallography and X-ray diffraction analysis. Compositions were determined by microprobe. Alloys with 40 at.% Cr at both temperatures have biphasic equilibria between the intermetallic Laves phase AB 2 and the body-centered cubic solid solution containing principally zirconium and titanium. The Cr-rich alloy presents equilibrium of the AB 2 compound and the Cr-rich solid solution. Results of the present and previous works are used in order to propose new isothermal sections at 900 and 1100 C degrees. (author)
Microstructure and mechanical properties of a novel near-α titanium alloy Ti6.0Al4.5Cr1.5Mn
International Nuclear Information System (INIS)
Wang, Hong-bin; Wang, Shu-sen; Gao, Peng-yue; Jiang, Tao; Lu, Xiong-gang; Li, Chong-he
2016-01-01
Based on previous Ti-Al-Cr-Mn quaternary system thermodynamic database, a novel near-α titanium alloy Ti-6.0Al-4.5Cr-1.5Mn alloy was designed and successfully prepared by the water-cooled copper crucible. Microscopic observation showed that both as-cast and annealing status consist of α phase, which coincides with the theoretical expectation. The mechanical properties at room temperature were measured and this alloy possesses good mechanical properties, its average yield-strength reaches 1051.5 MPa and tensile-strength is up to 1091.2 MPa while its average elongation is just 8.3%. Compared with the TA15, it has better mechanical strength and worse elongation. In the new alloy Laves phase Cr 2 Ti were detected by XRD pattern and TEM, which may cause the alloy's poor plasticity.
Microstructure and mechanical properties of a novel near-α titanium alloy Ti6.0Al4.5Cr1.5Mn
Energy Technology Data Exchange (ETDEWEB)
Wang, Hong-bin [State Key Laboratory of Advanced Special Steel & Shanghai Key Laboratory of Advanced Ferrometallurgy & School of Materials Science and Engineering, Shanghai University, Shanghai 200072 (China); Shanghai Special Casting Engineering Technology Research Center, Shanghai 201605 (China); Wang, Shu-sen; Gao, Peng-yue; Jiang, Tao [State Key Laboratory of Advanced Special Steel & Shanghai Key Laboratory of Advanced Ferrometallurgy & School of Materials Science and Engineering, Shanghai University, Shanghai 200072 (China); Lu, Xiong-gang; Li, Chong-he [State Key Laboratory of Advanced Special Steel & Shanghai Key Laboratory of Advanced Ferrometallurgy & School of Materials Science and Engineering, Shanghai University, Shanghai 200072 (China); Shanghai Special Casting Engineering Technology Research Center, Shanghai 201605 (China)
2016-08-30
Based on previous Ti-Al-Cr-Mn quaternary system thermodynamic database, a novel near-α titanium alloy Ti-6.0Al-4.5Cr-1.5Mn alloy was designed and successfully prepared by the water-cooled copper crucible. Microscopic observation showed that both as-cast and annealing status consist of α phase, which coincides with the theoretical expectation. The mechanical properties at room temperature were measured and this alloy possesses good mechanical properties, its average yield-strength reaches 1051.5 MPa and tensile-strength is up to 1091.2 MPa while its average elongation is just 8.3%. Compared with the TA15, it has better mechanical strength and worse elongation. In the new alloy Laves phase Cr{sub 2}Ti were detected by XRD pattern and TEM, which may cause the alloy's poor plasticity.
Phase Evolution in and Creep Properties of Nb-Rich Nb-Si-Cr Eutectics
Gang, Florian; Kauffmann, Alexander; Heilmaier, Martin
2018-03-01
In this work, the Nb-rich ternary eutectic in the Nb-Si-Cr system has been experimentally determined to be Nb-10.9Si-28.4Cr (in at. pct). The eutectic is composed of three main phases: Nb solid solution (Nbss), β-Cr2Nb, and Nb9(Si,Cr)5. The ternary eutectic microstructure remains stable for several hundred hours at a temperature up to 1473 K (1200 °C). At 1573 K (1300 °C) and above, the silicide phase Nb9(Si,Cr)5 decomposes into α-Nb5Si3, Nbss, and β-Cr2Nb. Under creep conditions at 1473 K (1200 °C), the alloy deforms by dislocation creep while the major creep resistance is provided by the silicide matrix. If the silicide phase is fragmented and, thus, its matrix character is destroyed by prior heat treatment [ e.g., at 1773 K (1500 °C) for 100 hours], creep is mainly controlled by the Laves phase β-Cr2Nb, resulting in increased minimum strain rates. Compared to state of the art Ni-based superalloys, the creep resistance of this three-phase eutectic alloy is significantly higher.
Thermal stability and phase transformation in fully indium oxide (InO{sub 1.5}) stabilized zirconia
Energy Technology Data Exchange (ETDEWEB)
Piva, R.H., E-mail: honorato.piva@ua.pt; Piva, D.H.; Morelli, M.R.
2017-01-15
Indium oxide (InO{sub 1.5}) stabilized zirconia (InSZ) is an attractive material as electrolyte, or electrode, in solid oxide fuel cells (SOFCs), and as corrosion resistant top coat in thermal barrier coatings. However, little is known about the phase stability of cubic InSZ at temperatures that simulate the conditions in an operating SOFC or turbine. This article provides an investigation of the phase stability and phase transformations in cubic InSZ after heat treatments at 800, 1000, and 1200 °C for periods up to 2000 h. The results revealed that cubic InSZ is not stable during annealing at 1000 and 1200 °C, owing to a fast destabilization of the initial cubic phase to tetragonal, and eventually to monoclinic (c → t → m). The c → t → m transition in InSZ is intimately associated with the indium volatilization. On the other hand, cubic InSZ remained stable for 2000 h at 800 °C, although the partial formation of the tetragonal phase was observed along with a 0.25% contraction in the unit cell volume of the cubic phase, caused by short-range ordering. These results demonstrate that technological applications of cubic InSZ are restricted to temperatures at which the volatilization of the InO{sub 1.5} stabilizer does not occur. - Highlights: •Phase stability of fully InO{sub 1.5} stabilized zirconia (cubic InSZ) was evaluated. •Cubic InSZ is instable at temperatures ≥ 1000 °C, owing to the cubic-to-tetragonal-to-monoclinic destabilization. •Cubic InSZ undergoes the cubic-to-tetragonal transformation at ~ 800 °C. •Owing to the low phase stability, applications of cubic InSZ in TBCs or SOFCs are restricted.
Kinetic study of the formation of the superconducting A15 phase in the Nb-Al-Si system
International Nuclear Information System (INIS)
Binh-Phung.
1978-12-01
So far, aluminum-containing superconductors showed excellent critical fields and temperatures. Powder Metallurgy shows the most promise in producing these particular kinds of superconductors in the near future. The scope of this research is to apply a kinetic study to observe the behavior of the Nb(Al,Si) system at elevated temperatures. From such observations, an optimized method of obtaining the A15 superconducting phase can be achieved. This study has resulted in a two step heat treatment to obtain the A15 phase. For the primary heat treatment of infiltrated rods, 600 0 C for 11 hours or 650 0 C for 1 hour was found suitable to form a barrier of intermetallic compound around the pores. For the secondary heat treatment, 1700 0 C for 15 seconds resulted in the formation of the A15 superconducting phase with a critical temperature of 18.25 0 K. A15 formation for wires is similar to infiltrated rods. The only difference is the diffusion path which is now much shorter. 600 0 C for 1 hour was found suitable for the primary heat treatment and 1700 0 C for 15 seconds was the most suitable for the secondary heat treatment. The highest critical temperature found thus far was 18.78 0 K
Modelling of Phase Equlibria in the Hf-V System\
Czech Academy of Sciences Publication Activity Database
Vřešťál, Jan; Pavlů, Jana; Wdowik, U. D.; Šob, Mojmír
2017-01-01
Roč. 53, č. 3 (2017), s. 239-247 ISSN 1450-5339 R&D Projects: GA ČR GA14-15576S; GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 Keywords : Laves phases * Hf-V system * Ab initio calculations * Phase diagram * Zero Kelvin * CALPHAD method Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 0.804, year: 2016
Yao, Xiling; Moon, Seung Ki; Lee, Bing Yang; Bi, Guijun
2018-03-01
The purpose of this paper is to investigate the effects of TiC nanoparticle content on microstructures and tensile properties of the IN718/TiC nanocomposites fabricated by selective laser melting (SLM). 0.5wt%, 1.0wt%, and 2.0wt% of TiC nanoparticles are added to the IN718 powders. The bulk-form IN718/TiC nanocomposites with different TiC contents are fabricated in-situ by SLM using the same process settings. The evolution of microstructures and tensile properties as the effect of changing the TiC content is studied using the optical microscopy, scanning electron microscopy, X-ray diffraction analysis, and tensile testing. The increase of TiC content refines the microstructure, promotes the formation of the cellular morphology, and reduces the size and continuity of Laves precipitates. Increasing the TiC content improves the yield strength and ultimate tensile strength but decreases the ductility. The grain refinement, dislocation bowing, dislocation punching, and the reduction in Laves precipitate contribute to the strengthening effect in the IN718/TiC nanocomposites.
Quasicrystalline and crystalline phases in Al65Cu20(Fe, Cr)15 alloys
International Nuclear Information System (INIS)
Liu, W.; Koester, U.; Mueller, F.; Rosenberg, M.
1992-01-01
Two types of icosahedral quasicrystals are observed in Al 65 Cu 20 Fe 15-x Cr x (0 ≤ x ≤ 15) alloys, the face-centred AlCuFe-type icosahedral phase with dissoluted Cr and the primitive AlCuCr-type icosahedral phase with dissoluted Fe. In the vicinity of Al 65 Cu 20 Fe 8 Cr 7 a stable decagonal phase (a=0.45 nm and c=1.23 nm) forms competitively with the icosahedral quasicrystals. All these three quasicrystalline phases can be regarded as Hume-Rothery phases stabilized by the energy band factor. The density is measured to be 4.57, 4.44, and 4.11 g/cm 3 for the icosahedral Al 65 Cu 20 Fe 15 , the decagonal Al 65 Cu 20 Fe 8 Cr 7 , and the icosahedral Al 65 Cu 20 Cr 15 alloys, respectively. Depending on the composition in the range between Al 65 Cu 20 Fe 8 Cr 7 and Al 65 Cu 20 Cr 15 , several crystalline phases are observed during the transormation of the AlCuCr-type icosahedral phase: the 1/1-3/2-type orthorhombic (o) and the 1/0-3/2-type tetragonal (t) approximants of the decagonal phase, a hexagonal (h) phase, as well as a long-range vacancy ordered τ 3 -phase derived from a CsCl-type structure with a=0.2923 nm. The structures of all the crystalline phases are closely related to those of the icosahedral (i) and decagonal (d) quasicrystals, which leads to a definite orientation relationship as follows: i5 parallel d10 parallel o[100] parallel t[100] parallel h[001] parallel τ 3 [110]. (orig.)
The effect of alloying elements on the creep and impact properties of high Cr steels
International Nuclear Information System (INIS)
Kim, S. H.; Song, B. J.; Ryu, W. S.
2000-01-01
The effect of minor alloying elements on the creep and impact properties in high Cr steels has been studied. The addition of W and N in creased the creep rupture strength without the decrease of the impact toughness. During deformation, growth of lath width and agglomeration of precipitates and precipitation of Laves phase occurred. These microstructural changes made the steels soften. The degree of softening was delayed by the addition of W and N. In W added steel, the Laves phase had a important role in increasing the creep rupture strength. But the impact toughness was rapidly degraded by the addition of W after aging at 600 .deg. C for 5000 hours. So it needs to evaluate more accurately the effect of Laves phase on creep and impact properties. In N added steel, V(C,N) was precipitated in lath boundary and interior of lath. The size of the precipitates was 20-50nm. The increase of creep rupture strength in N added steel may be due to the precipitate of the V(C,N). So it needs more test to clarify the effect of N on the creep and impact properties
C18, C8, and perfluoro reversed phases on diamond for solid-phase extraction.
Saini, Gaurav; Wiest, Landon A; Herbert, David; Biggs, Katherine N; Dadson, Andrew; Vail, Michael A; Linford, Matthew R
2009-04-17
In spite of advances in solid-phase extraction (SPE) technology there are certain disadvantages to current SPE silica-based, column packings. The pH range over which extraction can occur is limited and each column is generally only used once. New diamond-based reversed SPE phases (C(18), C(8), and perfluorinated) were developed in our laboratories. Studies were done which show that these phases do not have the same limitations as traditional silica-based stationary phases. The synthesis and properties of these diamond-based phases are presented, and the stability, percent recovery, and column capacity are given for the C(18) phase.
Energy Technology Data Exchange (ETDEWEB)
Yadav, Thakur Prasad; Tiwari, Radhey Shyam; Srivastava, Onkar Nath [Department of Physics, Banaras Hindu University, Varanasi-221 005 (India); Mukhopadhyay, Nilay Krishna, E-mail: hepons@yahoo.co, E-mail: yadavtp@gmail.co [Department of Metallurgical Engineering, Institute of Technology, Banaras Hindu University, Varanasi-221 005 (India)
2010-04-01
A nano {tau}{sub 3} vacancy-ordered phase in the Al-Cu-Ni alloy system has been synthesized with a composition close to Al{sub 70}Cu{sub 15}Ni{sub 15} by mechanical alloying a mixture of elemental powder in a high-energy ball mill by varying milling time from 10 to 100 hours. The stability of nano-crystalline {tau}{sub 3} vacancy-ordered phase has been studied under thermal annealing in vacuum as well as in air. The x-ray diffraction and transmission electron microscopy techniques were employed for characterization of the milled and annealed samples. The powder after 100 h of milling was found to contain mostly nano {tau}{sub 3} phase with the partial ordering, and with crystallite sizes in the range of 10-20 nm along with a lattice strain of {approx}0.67 %. The milled powder, after annealing in vacuum at 700 {sup 0}C for 60 h, revealed the formation of a strain-free and ordered {tau}{sub 3} phase with a crystallite size of 80 nm, indicating grain coarsening. It is interesting to note that the milled powder annealed in air at 700 {sup 0}C for 60 h showed the formation of (Cu,Ni)Al{sub 2}O{sub 4} type spinel phase with the lattice parameter of 8.1 A and the lattice strain as 0.52 %. The average grain size of spinel phase was found to be {approx} 40 nm.
Effective Exploration of New 760°C-Capability Steels for Coal Energy
Energy Technology Data Exchange (ETDEWEB)
Clark, Williams [The Ohio State Univ., Columbus, OH (United States); Zhao, Ji-Cheng [The Ohio State Univ., Columbus, OH (United States)
2016-09-17
Cost effective and high performance alloys that are capable of operating at 760 °C or higher for extended periods of time under a very aggressive environment are critically required for the design and development of advanced ultrasupercritical (AUSC) boilers and steam turbines. Finely dispersed Laves phase precipitates have been shown by Takeyama and co-workers to be a viable strengthening mechanism in high temperature austenitic steels. There is currently no straightforward theory that can predict what other intermetallic phases can serve as potent precipitation-strengthening phases for steels; thus we employed a highly effective dual-anneal diffusion multiple (DADM) approach to screen for viable strengthening precipitates over a wide range of compositions. From the Fe-Co-Cr-Ni-Mo DADMs, the Fe-Cr-Mo based Chi phase was identified as a new strengthening phase for high temperature ferritic steels; and from the Fe-Mn-Cr-Nb-Ni-Mo-FeAl DADMs, the Laves phase was identified as a viable strengthening precipitate in Fe-Mn and Fe-Ni based austenitic steels. After identification of viable strengthening phases from the DADMs that covered compositions in the basic ternary and quaternary systems, we employed computation thermodynamics to perform multicomponent alloy design and optimization. For the new the Chi-phase strengthened steels, we performed thermodynamic calculations to vary the volume fraction of the Chi phase and introduced Nb and carbon to promote the formation of stable carbides for grain size control during solution heat treatment. For the Fe-Ni-Mn based austenitic steels, we performed extensive parametric optimization of compositions in order to reduce the expensive Ni content, add Cr and Al for oxidation resistance, and balance the alloying contents (Ni, Mn, Cr, Al, Mo) to suppress the ferritic phase and promote the austenitic matrix phase. Four steels (two ferritic + two austenitic) were designed and tested. The two Chi-phase strengthened ferritic steels
Zhang, Mina; Zhou, Xianglin; Zhu, Wuzhi; Li, Jinghao
2018-04-01
A novel refractory CoCrMoNbTi0.4 high-entropy alloy (HEA) was prepared via vacuum arc melting. After annealing treatment at different temperatures, the microstructure evolution, phase stability, and mechanical properties of the alloy were investigated. The alloy was composed of two primary body-centered cubic structures (BCC1 and BCC2) and a small amount of (Co, Cr)2Nb-type Laves phase under different annealing conditions. The microhardness and compressive strength of the heat-treated alloy was significantly enhanced by the solid-solution strengthening of the BCC phase matrix and newborn Laves phase. Especially, the alloy annealed at 1473 K (1200 °C) achieved the maximum hardness and compressive strength values of 959 ± 2 HV0.5 and 1790 MPa, respectively, owing to the enhanced volume fraction of the dispersed Laves phase. In particular, the HEAs exhibited promising high-temperature mechanical performance, when heated to an elevated temperature of 1473 K (1200 °C), with a compressive fracture strength higher than 580 MPa without fracture at a strain of more than 20 pct. This study suggests that the present refractory HEAs have immense potential for engineering applications as a new class of high-temperature structural materials.
Moessbauer spectroscopy characterization of Zr-Nb-Fe phases
Energy Technology Data Exchange (ETDEWEB)
Ramos, C.P. [CONICET, Av. Gral. Paz 1499, 1650 Buenos Aires (Argentina)]. E-mail: ciramos@cnea.gov.ar; Granovsky, M.S. [CAC-CNEA, Av. Gral. Paz 1499, 1650 Buenos Aires (Argentina); Saragovi, C. [CAC-CNEA, Av. Gral. Paz 1499, 1650 Buenos Aires (Argentina)
2007-02-01
The aim of this work was the characterization of the ternary phases and of those coming from the corresponding binary systems in the Zr-Nb-Fe diagram by means of Moessbauer spectroscopy. This is part of a complete study involving a tentative isothermal section at 900 deg. C of the center of the Zr-Nb-Fe diagram which will be published elsewhere. Zr-Nb-Fe alloys with Nb contents between 5 and 50 at% and Fe contents between 10 and 60 at% were analyzed after a heat treatment at 900 deg. C for 4 month. Moessbauer characterization of the phases was complemented by optical and scanning electron microscopies, X-ray diffraction and electron microprobe analysis. From the obtained results it can be inferred that Fe in both of the Laves phases present in this system (Zr(FeNb){sub 2} and (ZrNb)Fe{sub 2}) sees different environments, producing quadrupole splitting and hyperfine field distributions, respectively. Two types of body centered cubic {beta} phases (Zr-rich and Nb-rich) were found having noticeable differences in their Moessbauer parameters. Furthermore it was shown that the ternary Fe(NbZr){sub 2} compound would show magnetic character at low temperatures. Concentration dependence of the hyperfine parameters and their relations with the lattice parameters contributed to the structural characterization of the phases.
Moessbauer spectroscopy characterization of Zr-Nb-Fe phases
International Nuclear Information System (INIS)
Ramos, C.P.; Granovsky, M.S.; Saragovi, C.
2007-01-01
The aim of this work was the characterization of the ternary phases and of those coming from the corresponding binary systems in the Zr-Nb-Fe diagram by means of Moessbauer spectroscopy. This is part of a complete study involving a tentative isothermal section at 900 deg. C of the center of the Zr-Nb-Fe diagram which will be published elsewhere. Zr-Nb-Fe alloys with Nb contents between 5 and 50 at% and Fe contents between 10 and 60 at% were analyzed after a heat treatment at 900 deg. C for 4 month. Moessbauer characterization of the phases was complemented by optical and scanning electron microscopies, X-ray diffraction and electron microprobe analysis. From the obtained results it can be inferred that Fe in both of the Laves phases present in this system (Zr(FeNb) 2 and (ZrNb)Fe 2 ) sees different environments, producing quadrupole splitting and hyperfine field distributions, respectively. Two types of body centered cubic β phases (Zr-rich and Nb-rich) were found having noticeable differences in their Moessbauer parameters. Furthermore it was shown that the ternary Fe(NbZr) 2 compound would show magnetic character at low temperatures. Concentration dependence of the hyperfine parameters and their relations with the lattice parameters contributed to the structural characterization of the phases
Oliynyk, Anton O; Lomnytska, Yaroslava F; Dzevenko, Mariya V; Stoyko, Stanislav S; Mar, Arthur
2013-01-18
Construction of the isothermal section in the metal-rich portion (ternary phases: (Mo(1-x)Fe(x))(2)P (x = 0.30-0.82) and (Mo(1-x)Fe(x))(3)P (x = 0.10-0.15). The occurrence of a Co(2)Si-type ternary phase (Mo(1-x)Fe(x))(2)P, which straddles the equiatomic composition MoFeP, is common to other ternary transition-metal phosphide systems. However, the ternary phase (Mo(1-x)Fe(x))(3)P is unusual because it is distinct from the binary phase Mo(3)P, notwithstanding their similar compositions and structures. The relationship has been clarified through single-crystal X-ray diffraction studies on Mo(3)P (α-V(3)S-type, space group I42m, a = 9.7925(11) Å, c = 4.8246(6) Å) and (Mo(0.85)Fe(0.15))(3)P (Ni(3)P-type, space group I4, a = 9.6982(8) Å, c = 4.7590(4) Å) at -100 °C. Representation in terms of nets containing fused triangles provides a pathway to transform these closely related structures through twisting. Band structure calculations support the adoption of these structure types and the site preference of Fe atoms. Electrical resistivity measurements on (Mo(0.85)Fe(0.15))(3)P reveal metallic behavior but no superconducting transition.
Identification of sigma and OMEGA phases in AA2009/SiC composites
Energy Technology Data Exchange (ETDEWEB)
Rodrigo, P., E-mail: pilar.rodrigo@urjc.e [Departamento de Ciencia e Ingenieria de Materiales, Escuela Superior de Ciencias Experimentales y Tecnologia, Universidad Rey Juan Carlos, c/Tulipan s/n, 28933 Mostoles, Madrid (Spain); Poza, P.; Utrilla, M.V.; Urena, A. [Departamento de Ciencia e Ingenieria de Materiales, Escuela Superior de Ciencias Experimentales y Tecnologia, Universidad Rey Juan Carlos, c/Tulipan s/n, 28933 Mostoles, Madrid (Spain)
2009-08-12
The microstructure evolution during ageing treatment at 170 and 190 deg. C of AA2009/SiC composites, reinforced with 15 vol.% particulates and whiskers, was studied by transmission electron microscopy. Besides theta' and S' phases, the typical hardening precipitates on Al-Cu-Mg alloys, it was found the presence of OMEGA and sigma (Al{sub 5}Cu{sub 6}Mg{sub 2}) phases in the matrix. sigma phase was only found in the matrix of particulate composite, while OMEGA phase appeared in both. This phase has not been previously observed in Al matrix composites based on conventional Al-Cu-Mg alloys.
The Effect of Nb Addition on the Microstructure and the High-Temperature Strength of Fe3Al Aluminide
Kratochvíl, Petr; Švec, Martin; Král, Robert; Veselý, Jozef; Lukáč, Pavel; Vlasák, Tomáš
2018-02-01
The microstructural and high-temperature mechanical properties of Fe-26Al-xNb (x = 3 and 5 at. pct) are compared. The alloys were investigated "as cast" and after hot rolling at 1473 K (1200 °C). Scanning electron microscopes equipped with EDS and EBSD were used for the microstructure and phase identification. The addition of 3 at. pct of Nb into the Fe3Al matrix leads to the formation of C14 λ—Laves phase (Fe,Al)2Nb (LP) particles spread in the Fe3Al matrix, while an eutectic with thin lamellae of LP C14 λ—Laves phase (Fe,Al)2Nb and matrix is also formed in the iron aluminide with 5 at. pct of Nb. The presence of incoherent precipitates is connected with the enhancement of the high-temperature strength and creep resistance.
Zr - based alloys as hydride electrodes in Ni-MH batteries
International Nuclear Information System (INIS)
Biris, A.R.; Biris, A.S.; Misan, I.; Lupu, D.
1999-01-01
Hydrogen storage alloys, MH, are already used in Ni-MH alkaline batteries conquering an important share of the rechargeable nickel-cadmium battery market. This remarkable success is due not only to the replacement of the toxic material, cadmium, by metal hydrides but also to an increased specific energy, which makes them attractive for electric vehicles. Many research groups are concerned in the improvement of the hydride electrode characteristics: hydrogen storage capacity, high-rate discharge ability, increased cycle life. These properties can be modified by substitution of the base components of a given alloy. A comparison of two types of alloys suitable for MH electrodes LaNi 5 able to store 1.36 w/o hydrogen with Zr(Ti)-Ni alloys of the AB 2 Laves phase type structure showed that the latter could absorb higher amounts of hydrogen. We report part of studies on Zr-V-Cr-Ni of the 15 C type Laves phase structure using our original procedure for pasted electrodes. The substitution of Cr for V atoms in ZrV 0.5 Ni 1 . 5 did not increase the discharge capacity. However, it proved to have a remarkable effect on the discharge capacity C at low temperatures. C at - 12 deg. C as compared to 20 deg.C increases up to ∼ 65 % for Cr containing alloys. (authors)
International Nuclear Information System (INIS)
Maziasz, P.J.
1979-01-01
The precipitation response of 20%-cold-worked type 316 stainless steel has been examined after irradiation in HFIR at 380-600 0 C, after irradiation in EBR-II at 500 0 C, and after thermal aging at 600 to 750 0 C. Eta phase forms during exposure to all environments. It constitutes a major portion of the precipitation response, and is rich in Ni, Si and Mo relative to M 23 C 6 after thermal aging. It is not normally reported in 20%-cold-worked type 316 stainless steel. The eta, M 23 C 6 , Laves, sigma, and chi precipitate phases appear at similar temperatures after HFIR, EBR-II, or thermal exposure. There are, however, some differences in relative amounts, size, and distribution of phases among the various environments. Eta phase is the only carbide-type phase observed after irradiation in HFIR from 380-550 0 C. The large cavities associated with it at 380 0 C contribute significantly to swelling. Re-solution of fine M 23 C 6 , eta, and Laves particles and re-precipitation of massive particles of sigma, M 23 C 6 and chi are observed after recrystallization in HFIR. (orig.)
Interaction of stress with the martensitic phase transition in A15 compounds
International Nuclear Information System (INIS)
Welch, D.O.
1981-01-01
Recently there has been a resurgence of interest in the effect of the martensitic phase transition which occurs in many A15 compounds on superconductivity and on elastic and anelastic behavior. Since in many practical applications, A15 compounds are subject to considerable stress and strain, it is of interest to examine the interaction of stress with the martensitic transition; this paper is an examination of the effects of stress predicted by a simple Landau model which successfully describes many features of the transition and the related temperature dependence of the elastic modulus (c 11 -c 12 )/2. The effect of stress on the temperature ranges of stability and metastability of various types of martensitic domain is discussed. The non-linearity of the stress-strain relation in a polycrystalline A15 is studied
Energy Technology Data Exchange (ETDEWEB)
Hosseini, Seyed Ali, E-mail: saliho3ini@gmail.com; Madar, Karim Zangeneh; Abbasi, Seyed Mehdi
2017-03-24
The effect of homogenization heat treatment on cast structure, hardness, and tensile properties of the nickel-based superalloy 718plus in the presence of boron and zirconium additives were investigated. For this purpose, five alloys with different contents of boron (0.00–0.016 wt%) and zirconium (0.0–0.1 wt%) were cast by double vacuum process VIM/VAR and then were homogenized at 1075–1175 °C for 5–25 h. Microstructural investigation by OM and SEM and phase analysis by XRD were done and then hardness and high temperature tensile tests were performed on the homogenized alloys. The results show that the amount of the Laves phase is reduced by increases in time and temperature of homogenization. It was also found that increases in duration of homogenization at 1075 °C results in improving strength and ductility, while duration increase at 1175 °C is accompanied with degradation of them, which caused the reduction of needle-like delta phase on grain boundaries. Boron and zirconium had negative effects on the strength and ductility of the alloy by increasing the amount of Laves in the cast structure. By increasing these elements in alloy composition, more time is needed in order to fully eliminate the Laves by homogenization treatment.
Progress in 15N and 13C separation by isotopic exchange
International Nuclear Information System (INIS)
Axente, D.
2004-01-01
An experimental study of 15 N separation by isotopic exchange in NO, NO 2 - HNO 3 system under pressure is presented. The pressure increase in 15 N separation plant improved the isotopic transport between the two phases circulated in counter-current in the packed column according to a better kinetics of isotopic exchange at higher pressures. The operation of 15 N separation plant at a pressure of 1.8 atm (absolute) will permit doubling of 10 M nitric acid flow rate and of 15 N production of a given column. The improved performance at a higher pressure is significant for large scale 15 N production, which would be utilized for uranium nitride fuels for FBRs. Enrichment of 13 C by chemical exchange between CO 2 and amine carbamate in nonaqueous solvent has been modelled. For process optimization the steady state separation and the height equivalent to a theoretical plate (HETP) have been determined for different experimental conditions and simulated for higher pressures than atmospheric one. At lower temperature (5 deg C) as the pressure increases the quantity of CO 2 dissolved in amine solution increases. For process analysis at higher pressures and lower temperatures, the two steps model has been considered. At 0.9 MPa pressure and 5 deg C the reaction rate is higher than at 25 deg C and atmospheric pressure, the value of HETP being lower with more than 100% than at 25 deg C. (author)
Energy Technology Data Exchange (ETDEWEB)
Young, K., E-mail: kwo.young@basf.com [BASF/Battery Materials-Ovonic, 2983 Waterview Drive, Rochester Hills, MI 48309 (United States); Wong, D.F. [BASF/Battery Materials-Ovonic, 2983 Waterview Drive, Rochester Hills, MI 48309 (United States); Department of Chemical Engineering and Materials Science, Wayne State University, MI 48202 (United States); Wang, L. [BASF/Battery Materials-Ovonic, 2983 Waterview Drive, Rochester Hills, MI 48309 (United States)
2015-02-15
Highlights: • Influences of Ti/Cr to BCC to hydrogen storage properties were reported. • A new activation using hydrogen pressure at 5 MPa was developed. • A discharge capacity of 463 mA h g{sup −1} was reported on a C14(36%)/BCC(64%) alloy. • Increase in Ti/Cr increases storage capacity and decreases high-rate performance. • The high-rate performance was dominated by the surface reaction. - Abstract: A series of BCC/C14 mixed phase alloys with the chemical composition of Ti{sub 13.6+x}Zr{sub 2.1}V{sub 44}Cr{sub 13.2−x}Mn{sub 6.9}Fe{sub 2.7}Co{sub 1.4}Ni{sub 15.7}Al{sub 0.3}, x = 0, 2, 4, 6, 8, 10, and 12, was fabricated, and their structural, gaseous phase and electrochemical hydrogen storage properties were studied. Raising the maximum pressure for measuring the gaseous hydrogen storage capacity allowed these alloys to reach full activation, and the maximum discharge capacities ranged from 375 to 463 mA h g{sup −1}. As the Ti/Cr ratio in the alloy composition increased, the maximum gaseous hydrogen storage capacity improved due to the expansion in both BCC and C14 unit cells. However, reversibility decreased due to the higher stability of the hydride phase, as indicated by the lower equilibrium pressures measured for these alloys. As with most other metal hydride alloys, the electrochemical capacities measured at 50 and 4 mA g{sup −1} fell between the boundaries set by the maximum and reversible gaseous hydrogen storage capacities. The poorer high-rate dischargeability observed with higher Ti/Cr ratios was attributed to the lower surface exchange current (less catalytic). Two other negative impacts observed with higher Ti/Cr ratios in the alloy composition are poorer cycle stability and lower open-circuit voltage.
On the crystallography and composition of topologically close-packed phases in ATI 718Plus®
International Nuclear Information System (INIS)
Krakow, Robert; Johnstone, Duncan N.; Eggeman, Alexander S.; Hünert, Daniela; Hardy, Mark C.; Rae, Catherine M.F.; Midgley, Paul A.
2017-01-01
ATI 718Plus ® is a nickel-based superalloy developed to replace Inconel 718 in aero engines for static and rotating applications. Here, the long-term stability of the alloy was studied and it was found that topologically close-packed (TCP) phases can form at the γ-η interface or, less frequently, at grain boundaries. Conventional and scanning transmission electron microscopy techniques were applied to elucidate the crystal structure and composition of these TCP precipitates. The precipitates were found to be tetragonal sigma phase and hexagonal C14 Laves phase, both being enriched in Cr, Co, Fe and Mo though sigma has a higher Cr and lower Nb content. The precipitates were observed to be heavily faulted along multiple planes. In addition, the disorientations between the TCP phases and neighbouring η/γ were determined using scanning precession electron diffraction and evaluated in axis-angle space. This work therefore provides a series of compositional and crystallographic insights that may be used to guide future alloy design.
Shields, Beverley M; McDonald, Timothy J; Oram, Richard; Hill, Anita; Hudson, Michelle; Leete, Pia; Pearson, Ewan R; Richardson, Sarah J; Morgan, Noel G; Hattersley, Andrew T
2018-06-07
The decline in C-peptide in the 5 years after diagnosis of type 1 diabetes has been well studied, but little is known about the longer-term trajectory. We aimed to examine the association between log-transformed C-peptide levels and the duration of diabetes up to 40 years after diagnosis. We assessed the pattern of association between urinary C-peptide/creatinine ratio (UCPCR) and duration of diabetes in cross-sectional data from 1,549 individuals with type 1 diabetes using nonlinear regression approaches. Findings were replicated in longitudinal follow-up data for both UCPCR ( n = 161 individuals, 326 observations) and plasma C-peptide ( n = 93 individuals, 473 observations). We identified two clear phases of C-peptide decline: an initial exponential fall over 7 years (47% decrease/year [95% CI -51%, -43%]) followed by a stable period thereafter (+0.07%/year [-1.3, +1.5]). The two phases had similar durations and slopes in patients above and below the median age at diagnosis (10.8 years), although levels were lower in the younger patients irrespective of duration. Patterns were consistent in both longitudinal UCPCR ( n = 162; ≤7 years duration: -48%/year [-55%, -38%]; >7 years duration -0.1% [-4.1%, +3.9%]) and plasma C-peptide ( n = 93; >7 years duration only: -2.6% [-6.7%, +1.5%]). These data support two clear phases of C-peptide decline: an initial exponential fall over a 7-year period, followed by a prolonged stabilization where C-peptide levels no longer decline. Understanding the pathophysiological and immunological differences between these two phases will give crucial insights into understanding β-cell survival. © 2018 by the American Diabetes Association.
Induced 3d and 4f magnetism in Gd{sub 1-x}Pr{sub x}Ni{sub 2} Laves phase alloys
Energy Technology Data Exchange (ETDEWEB)
Bouziane, K [Department of Physics, College of Science, Sultan Qaboos University, PO Box 36, Al-Khodh 123 (Oman); Carboni, C [Department of Physics, College of Science, Sultan Qaboos University, PO Box 36, Al-Khodh 123 (Oman); Morrison, C [School of Physics and Astronomy, University of Southampton, Highfield, Southampton SO17 1BJ (United Kingdom)
2008-01-16
The series of Gd{sub 1-x}Pr{sub x}Ni{sub 2} (x = 0.25, 0.40, and 0.60) polycrystalline samples has been investigated using x-ray diffraction and magnetometry. The x-ray diffraction measurements showed that the lattice constant and the relative intensities of the C15 superstructure I{sub 511}/I{sub 440} and I{sub 511}/I{sub 220} increase with the praseodymium content, reflecting an increasing number of ordered vacancies at the 4a sites. The temperature dependences of the zero-field cooled (M{sub ZFC}(T)) and field cooled (M{sub FC}(T)) magnetizations show that a moment is induced by the gadolinium on the Pr{sup 3+} ion and on the nickel subsystem. In the ordered phase both induced moments are antiparallel to that of the Gd{sup 3+} ion. A cusp is observed at a temperature T{sub max} in the M{sub ZFC}(T) curve. Both critical temperatures T{sub c} and T{sub max} are found to decrease with increasing praseodymium content, indicating a reduction in strength of the antiparallel coupling for Gd-Pr and Gd-Ni pairs.
Microstructure of a SiC/Ti-15-3 composite
Lerch, B. A.; Hull, D. R.; Leonhardt, T. A.
1990-01-01
A continuous SiC-fiber-reinforced titanium (Ti-15V-3Cr-3Sn-3A1) composite was metallographically examined. Several methods for examining composite materials were investigated and documented. Polishing techniques for this material are described. An interference layering method was developed to reveal the structure of the fiber, the reaction zone, and various phases within the matrix. Microprobe and TEM analyses were performed on the fiber-matrix interface. Detailed descriptions of the fiber distribution and the microstructure of the fiber and matrix are presented.
Bertolaccini, Maria Laura; Sciascia, Savino; Murru, Veronica; Garcia-Fernandez, Cesar; Sanna, Giovanni; Khamashta, Munther A
2013-02-01
Antibodies to prothrombin in solid phase (aPT) and those to phosphatidiyserine-prothrombin complex (aPS/PT) have been suggested to strongly correlate with the presence of lupus anticoagulant (LA). As their clinical diagnostic value and true relationship with the LA remains elusive, we designed this study to evaluate the prevalence and significance of aPT and aPS/PT in a large cohort of patients with and without LA. Samples from 257 patients were included. aPT and aPS/PT were tested by ELISA. LA was tested as per the current criteria from the ISTH Subcommittee on LA-Phospholipid-dependent antibodies. aPS/PT and aPT were found in 51% and 32% of LA-positive (LA+ve) patients and in 22% and 28% of LA-negative (LA-ve) patients, respectively. Thrombosis, particularly venous thrombosis was associated with IgG aPT in the LA+ve group (p=0.0006) and in the LA-ve group (p=0.017). Antibodies to phosphatidylserine-prothrombin, either IgG and IgM were associated with thrombosis in general (p=0.0003) in particularly with venous thrombosis in the LA+ve group (paPS/PT were independent risk factors for thrombosis and pregnancy loss. In conclusion, aPS/PT, but not aPT, are more frequently found in patients with LA. Their association with thrombosis seems to be independent of the presence of LA.
40 CFR 721.6505 - Polymers of C13C15 oxoalcohol ethoxolates.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polymers of C13C15 oxoalcohol... Specific Chemical Substances § 721.6505 Polymers of C13C15 oxoalcohol ethoxolates. (a) Chemical substance... polymers of C13C15 oxoalcohol ethoxolates (PMNs P-96-950/951) are subject to reporting under this section...
Phase diagrams for pseudo-binary carbide systems TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC and HfC-TaC
International Nuclear Information System (INIS)
Gusev, A.I.
1985-01-01
Parameters of interaction and energy of mutual exchange in the liquid and solid phases of pseudobinary TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC, HfC-TaC systems are calculated with account of dependence on composition and temperature. Positions of liquidus-solidus phase boundaries on the phase diagrams of the mentioned systems are calculated on the basis of the determined mutual exchange energies in approximati.on of subregular solutions. The existance of latent decomposition ranges in the solid phase on the phase diagrams of the investgated systems is established
Experimental investigation of the Zr corner of the ternary Zr-Nb-Fe phase diagram
Energy Technology Data Exchange (ETDEWEB)
Granovsky, M.S. E-mail: granovsk@cnea.gov.ar; Canay, M.; Lena, E.; Arias, D
2002-04-01
Intermediate phases in the Zr-rich region of the Zr-Nb-Fe system have been investigated by X-ray diffraction, optical and electron microscopy and electron microprobe analysis. The chemical composition ranges covered by the alloys studied here are: (41-97) at.% Zr, (32-0.9) at.% Nb and (0.6-38) at.% Fe. The phases found in this region were: the solid solutions {alpha}-Zr and {beta}-Zr, the intermetallic Zr{sub 3}Fe with less than 0.2 at.% Nb in solution, two new ternary intermetallic compounds (Zr+Nb){sub 2}Fe '{lambda}{sub 1}' with a cubic Ti{sub 2}Ni-type structure in the composition range (2.4-13) at.% Nb and (31-33) at.% Fe, and (Fe+Nb){sub 2}Zr '{lambda}{sub 2}' indexed as hexagonal Laves phase MgZn{sub 2} type (C14) with a wide range of compositions close to (35-37) at.% Zr, (12-31) at.% Nb and (32-53) at.% Fe.
Experimental investigation of the Zr corner of the ternary Zr-Nb-Fe phase diagram
International Nuclear Information System (INIS)
Granovsky, M.S.; Canay, M.; Lena, E.; Arias, D.
2002-01-01
Intermediate phases in the Zr-rich region of the Zr-Nb-Fe system have been investigated by X-ray diffraction, optical and electron microscopy and electron microprobe analysis. The chemical composition ranges covered by the alloys studied here are: (41-97) at.% Zr, (32-0.9) at.% Nb and (0.6-38) at.% Fe. The phases found in this region were: the solid solutions α-Zr and β-Zr, the intermetallic Zr 3 Fe with less than 0.2 at.% Nb in solution, two new ternary intermetallic compounds (Zr+Nb) 2 Fe 'λ 1 ' with a cubic Ti 2 Ni-type structure in the composition range (2.4-13) at.% Nb and (31-33) at.% Fe, and (Fe+Nb) 2 Zr 'λ 2 ' indexed as hexagonal Laves phase MgZn 2 type (C14) with a wide range of compositions close to (35-37) at.% Zr, (12-31) at.% Nb and (32-53) at.% Fe
Investigation of phases obtained from the Ce.sub.20./sub.Ru.sub.60./sub.Si.sub.20./sub. composition
Czech Academy of Sciences Publication Activity Database
Vejpravová, J.; Sechovský, V.; Prokleška, J.; Daniš, S.; Jurek, Karel
2008-01-01
Roč. 466, 1-2 (2008), s. 17-25 ISSN 0925-8388 Institutional research plan: CEZ:AV0Z10100521 Keywords : rare earth compounds * laves phase * superconductivity * ternary Ce-Ru-Si system Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.510, year: 2008
DEFF Research Database (Denmark)
Chatzichristodoulou, Christodoulos; Chen, Ming; Bowen, Jacob R.
2010-01-01
The phase relation in the ZrO2–LaO1.5–MnOx system has been experimentally determined at 1200° and 1400°C in air and at 1200°C in N2 (∼100 Pa). Tie lines between LaMnO3 and t-ZrO2 and between LaMnO3 and La2Zr2O7 are observed at 1200°C in air. The geometry of the phase diagram changes at 1400°C in ...
Directory of Open Access Journals (Sweden)
Raiyan Seede
2018-05-01
Full Text Available In this work, the microstructure, texture, phases, and microhardness of 45° printed (with respect to the build direction homogenized, and hot isostatically pressed (HIP cylindrical IN718 specimens are investigated. Phase morphology, grain size, microhardness, and crystallographic texture at the bottom of each specimen differ from those of the top due to changes in cooling rate. High cooling rates during the printing process generated a columnar grain structure parallel to the building direction in the as-printed condition with a texture transition from (001 orientation at the bottom of the specimen to (111 orientation towards the specimen top based on EBSD analysis. A mixed columnar and equiaxed grain structure associated with about a 15% reduction in texture is achieved after homogenization treatment. HIP treatment caused significant grain coarsening, and engendered equiaxed grains with an average diameter of 154.8 µm. These treatments promoted the growth of δ-phase (Ni3Nb and MC-type brittle (Ti, NbC carbides at grain boundaries. Laves phase (Fe2Nb was also observed in the as-printed and homogenized specimens. Ostwald ripening of (Ti, NbC carbides caused excessive grain growth at the bottom of the HIPed IN718 specimens, while smaller grains were observed at their top. Microhardness in the as-fabricated specimens was 236.9 HV and increased in the homogenized specimens by 19.3% to 282.6 HV due to more even distribution of secondary precipitates, and the nucleation of smaller grains. A 36.1% reduction in microhardness to 180.5 HV was found in the HIPed condition due to γ ″ phase dissolution and differences in grain morphology.
Liu, Min; Li, Xiaolin; Bie, Wei; Wang, Minglin; Feng, Qian
2011-02-01
A new method was established for the determination of 15 industrial synthetic dyes in condiment by solid phase extraction-high performance liquid chromatography (SPE-HPLC). The samples were extracted by methanol-water (1:1, v/v) and purified by a solid phase extraction column. Then, the chromatographic separation was achieved on a Luna C18 column by linear gradient elution. The mobile phase was 10 mmol/L ammonium acetate-acetonitrile (containing 1% acetic acid). The results showed that the 15 industrial synthetic dyes can be separated efficiently. The recoveries of the 15 industrial synthetic dyes spiked in condiment were between 84.6% and 114.2% with the relative standard deviations of 0.9% - 10.3%. The limits of detection of this method was 0.05 - 0.18 mg/kg for the 15 industrial synthetic dyes. The method is simple, sensitive, accurate, repeatable and can be used for simultaneous determination of the 15 illegally added industrial synthetic dyes.
Spheroidization behavior of dendritic b.c.c. phase in Zr-based モ-phase composite
Directory of Open Access Journals (Sweden)
Sun Guoyuan
2013-03-01
Full Text Available The spheroidization behavior of the dendritic b.c.c. phase dispersed in a bulk metallic glass (BMG matrix was investigated through applying semi-solid isothermal processing and a subsequent rapid quenching procedure to a Zr-based モ-phase composite. The Zr-based composite with the composition of Zr56.2Ti13.8Nb5.0Cu6.9Ni5.6Be12.5 was prefabricated by a water-cooled copper mold-casting method and characterized by X-ray diffraction (XRD and scanning electron microscope (SEM. The results show that the composite consists of a glassy matrix and uniformly distributed fine dendrites of the モ-Zr solid solution with the body-centered-cubic (b.c.c. structure. Based on the differential scanning calorimeter (DSC examination results, and in view of the b.c.c. モ-Zr to h.c.p. メ-Zr phase transition temperature, a semi-solid holding temperature of 900 ìC was determined. After reheating the prefabricated composite to the semi-solid temperature, followed by an isothermal holding process at this temperature for 5 min, and then quenching the semi-solid mixture into iced-water; the two-phase microstructure composed of a BMG matrix and uniformly dispersed spherical b.c.c. モ-Zr particles with a high degree of sphericity was achieved. The present spheroidization transition is a thermodynamically autonomic behavior, and essentially a diffusion process controlled by kinetic factors; and the formation of the BMG matrix should be attributed to the rapid quenching of the semi-solid mixture as well as the large glass-forming ability of the remaining melt in the semi-solid mixture.
The Al-rich region of the Al-Mn-Ni alloy system. Part II. Phase equilibria at 620-1000 oC
International Nuclear Information System (INIS)
Balanetskyy, S.; Meisterernst, G.; Grushko, B.; Feuerbacher, M.
2011-01-01
Research highlights: → Phase equilibria in the Al-rich region of the Al-Mn-Ni alloy system were studied at 1000, 950, 850, 750, 700, 645 and 620 deg. C by means of SEM, TEM, powder XRD and DTA. → Three ternary thermodynamically stable intermetallics, the φ-phase (Al 5 Co 2 -type, hP26, P63/mmc; a = 0.76632(16), c = 0.78296(15) nm), the κ-phase (κ-Al 14.4 Cr 3.4 Ni l.1 -type, hP227, P63/m; a = 1.7625(10), c = 1.2516(10) nm), and the O-phase (O-Al 77 Cr 14 Pd 9 -type, Pmmn, oP650,: a = 2.3316(16), b = 1.2424(15), c = 3.2648(14) nm), as well as three ternary metastable phases, the decagonal D 3 -phase with periodicity about 1.25 nm, the Al 9 (Mn,Ni) 2 -phase (Al 9 Co 2 -type, P1121/a, mP22; a = 0.8585(16), b = 0.6269(9), c = 0.6205(11) nm, β = 95.34(10) o ) and the O 1 -phase (basecentered orthorhombic, a ∼ 23.8, b ∼ 12.4, c ∼ 32.2 nm) were revealed. → The existence of a thermodynamically stable R-phase of stoichiometry Al 60 Mn 11 Ni 4 , reported earlier in literature, was not confirmed in the present study. - Abstract: Phase equilibria in the Al-rich region of the Al-Mn-Ni alloy system were studied at 1000, 950, 850, 750, 700, 645 and 620 o C. Three ternary thermodynamically stable intermetallics, the φ-phase (Al 5 Co 2 -type, hP26, P6 3 /mmc; a = 0.76632(16), c = 0.78296(15) nm), the κ-phase (κ-Al 14.4 Cr 3.4 Ni l.1 -type, hP227, P6 3 /m; a = 1.7625(10), c = 1.2516(10) nm), and the O-phase (O-Al 77 Cr 14 Pd 9 -type, Pmmn, oP650,: a = 2.3316(16), b = 1.2424(15), c = 3.2648(14) nm), as well as three ternary metastable phases, the decagonal D 3 -phase with periodicity about 1.25 nm, the Al 9 (Mn,Ni) 2 -phase (Al 9 Co 2 -type, P112 1 /a, mP22; a = 0.8585(16), b = 0.6269(9), c = 0.6205(11) nm, β = 95.34(10) o ) and the O 1 -phase (base-centered orthorhombic, a ∼ 23.8, b ∼ 12.4, c ∼ 32.2 nm) were revealed. Their physicochemical behaviour in the Al-Mn-Ni alloy system was studied.
A new f.c.c. phase in yttrium films
International Nuclear Information System (INIS)
Kaul, V.K.; Srivastava, O.N.
1976-01-01
A new polymorphic phase characterised by a face-centered cubic structure, with lattice parameter 5.83 +- 0.02A, has been identified in thin films of yttrium. Electron diffraction evidence and electrical resistivity measurements have been carried out in order to detect the new f.c.c. phase. (Auth.)
International Nuclear Information System (INIS)
Liu, J.
2012-01-01
This study focuses on the effects of phase transformations on crack propagation. We want to understand the changes of fracture toughness during welding. In this work, fracture toughness is expressed by J-integral. There are many experimental methods to obtain the critical toughness JIC but they are impractical for our investigation during phase transformation. That is the reason why we have proposed a method coupling mechanical tests, digital image correlation and finite element simulation. The fracture tests are implemented on pre-cracked single edge notched plate sample which is easy for machining and heat conduct during phase transformation. The tests are conducted at different temperatures until rupture. Digital image correlation gives us the displacement information on every sample. Each test is then simulated by finite element where the fracture toughness is evaluated by the method G-Theta at the crack propagation starting moment found by potential drop method and digital image correlation technical. Two materials have been studied, 15Cr-5Ni martensitic precipitation hardening stainless steel and 16MND5 ferritic low carbon steel. For these two materials, different test temperatures were chosen before, during and after phase transformation for testing and failure characterization of the mechanical behavior. Investigation result shows that metallurgical phase transformation has an influence on fracture toughness and further crack propagation. For 15-5PH, the result of J1C shows that the as received 15-5PH has higher fracture toughness than the one at 200 C. The toughness is also higher than the original material after one cycle heat treatment probably due to some residual austenite. Meanwhile, pure austenite 15-5PH at 200 C has higher fracture toughness than pure martensitic 15-5PH at 200 C. For 16MND5, the result also proves that the phase transformation affects fracture toughness. The as received material has bigger J1C than the situation where it was heated
Energy Technology Data Exchange (ETDEWEB)
Conze, S., E-mail: susan.conze@ikts.fraunhofer.de [Fraunhofer Institute for Ceramic Technologies and Systems IKTS, Winterbergstr. 28, 01277 Dresden (Germany); Veremchuk, I. [Max-Planck-Institut für Chemische Physik fester Stoffe, Nöthnitzer Straße 40, 01187 Dresden (Germany); Reibold, M. [Technical University of Dresden, Zum Triebenberg 50, 01328 Dresden (Zaschendorf) (Germany); Matthey, B.; Michaelis, A. [Fraunhofer Institute for Ceramic Technologies and Systems IKTS, Winterbergstr. 28, 01277 Dresden (Germany); Grin, Yu. [Max-Planck-Institut für Chemische Physik fester Stoffe, Nöthnitzer Straße 40, 01187 Dresden (Germany); Kinski, I. [Fraunhofer Institute for Ceramic Technologies and Systems IKTS, Winterbergstr. 28, 01277 Dresden (Germany)
2015-09-15
A new synthetic approach for producing nano-powders of the Magnéli phases Ti{sub 4}O{sub 7}, Ti{sub 8}O{sub 15} and their carbon nanocomposites by thermal decomposition-precursor route is proposed. The formation mechanism of the single-phase carbon nanocomposites (Ti{sub 4}O{sub 7}/C and Ti{sub 8}O{sub 15}/C) from metal–organic precursors is studied using FT-IR, elemental analysis, TG, STA-MS and others. The synthesis parameters and conditions were optimized to prepare the target oxides with the desired microstructure and physical properties. The electrical and transport properties of Ti{sub 4}O{sub 7}/C and Ti{sub 8}O{sub 15}/C are investigated. These nano-materials are n-type semiconductors with relatively low thermal conductivity in contrast to the bulk species. The nanostructured carbon nanocomposites of Magnéli phases achieve a low thermal conductivity close to 1 W/m K at RT. The maximum ZT{sub 570} {sub °C} values are 0.04 for Ti{sub 4}O{sub 7}/C powder nanocomposite and 0.01 for Ti{sub 8}O{sub 15}/C bulk nanocomposite. - Graphical abstract: From the precursor to the produced titanium oxide pellet and its microstructure (SEM, TEM micrographs) as well as results of phase and thermoelectric analyses. - Highlights: • Magnéli phases Ti{sub 4}O{sub 7}/Ti{sub 8}O{sub 15} via thermal decomposition-precursor route is proposed. • The formation mechanism of the nanocomposites Ti{sub 4}O{sub 7}/C and Ti{sub 8}O{sub 15}/C are investigated. • Microstructure of Ti{sub 4}O{sub 7}/C and Ti{sub 8}O{sub 15}/C are examined. • The electrical and transport properties of Ti{sub 4}O{sub 7}/C and Ti{sub 8}O{sub 15}/C are investigated. • The maximum figure of mertit ZT{sub 570} {sub °C} of Ti{sub 4}O{sub 7}/C and Ti{sub 8}O{sub 15}/C are 0.01 and 0.04.
International Nuclear Information System (INIS)
Prat Borquez, Orlando
2011-01-01
The objective of this work was to simulate diffusion-controlled transformations on engineering alloys designed by the author and his colleagues. The main challenge of the work is to adapt the existing DICTRA models to the experimental processing and working conditions investigated, as well as to find the adequate boundary conditions for the description of the diffusion-controlled transformations governing the microstructure formation and evolution, in order to obtain reliable simulation results. The simulations were compared with experimental results of the microstructure evolution by scanning electron microscopy and scanning transmission electron microscopy (STEM). Two groups of materials were investigated. The first group was 9-12% Cr heat resistant alloys. These alloys are particularly interesting because the microstructure evolves during working conditions. Different compositions were designed in order to form different kinds and amounts of precipitates. For the designed 9-12% Cr creep steels the coarsening of MX and M 23 C 6 particles was modeled by applying the coarsening model implemented in DICTRA. The cell method of DICTRA was applied to investigate the kinetics of the Laves phase growth on 9-12% Cr alloys. The particular objectives of these investigations were: a) to determine the coarsening rate of precipitates, b) to investigate the influence of alloying element on the growth rate of the Laves phase, c) to determine the influence of the M 23 C 6 formation on the growth kinetics of the Laves phase, d) to determine the growth mechanism at the interface of the Laves phase (i.e. up-hill diffusion), e) to investigate the effect of the cell size on the simulation kinetics of Laves phase. The second group of materials was cemented carbides. They are used as cutting tools or wear parts in the automotive, aircraft and mining industry among others. The wear performance of cemented carbides (hardmetals and cermets) can be largely improved by applying wear
Kerma factors and reaction cross sections for n + 12C between 15 and 18 MeV
International Nuclear Information System (INIS)
Tornow, W.; Chen, Z.M.; Baird, K.; Walter, R.L.
1988-01-01
Differential elastic and inelastic (4.44 MeV) neutron scattering cross sections from 12 C are presented at 15.6, 16.8 and 17.3 MeV. The existing 18.2 MeV differential cross-section data were combined with newly measured analysing power data to parametrise neutron scattering at this energy. The 12 C recoil kerma factors were calculated and reaction cross sections were obtained from a phase-shift analysis and coupled channel analyses in the 15.6-18.2 MeV energy range. (author)
Thermal processing of diblock copolymer melts mimics metallurgy
Kim, Kyungtae; Schulze, Morgan W.; Arora, Akash; Lewis, Ronald M.; Hillmyer, Marc A.; Dorfman, Kevin D.; Bates, Frank S.
2017-05-01
Small-angle x-ray scattering experiments conducted with compositionally asymmetric low molar mass poly(isoprene)-b-poly(lactide) diblock copolymers reveal an extraordinary thermal history dependence. The development of distinct periodic crystalline or aperiodic quasicrystalline states depends on how specimens are cooled from the disordered state to temperatures below the order-disorder transition temperature. Whereas direct cooling leads to the formation of documented morphologies, rapidly quenched samples that are then heated from low temperature form the hexagonal C14 and cubic C15 Laves phases commonly found in metal alloys. Self-consistent mean-field theory calculations show that these, and other associated Frank-Kasper phases, have nearly degenerate free energies, suggesting that processing history drives the material into long-lived metastable states defined by self-assembled particles with discrete populations of volumes and polyhedral shapes.
He, Chunyong; Chang, Shiyong; Huang, Xiangdong; Wang, Qingquan; Mei, Ao; Shen, Pei Kang
2015-02-01
The Magnéli phase Ti8O15 nanowires (NWs) have been grown directly on a Ti substrate by a facile one-step evaporation-deposition synthesis method under a hydrogen atmosphere. The Ti8O15 NWs exhibit an outstanding electrical conductivity at room temperature. The electrical conductivity of a single Ti8O15 nanowire is 20.6 S cm-1 at 300 K. Theoretical calculations manifest that the existence of a large number of oxygen vacancies changes the band structure, resulting in the reduction of the electronic resistance. The Magnéli phase Ti8O15 nanowires have been used as conductive carbon-free supports to load Pt nanoparticles for direct methanol oxidation reaction (MOR). The Pt/Ti8O15 NWs show an enhanced activity and extremely high durability compared with commercial Pt/C catalysts.The Magnéli phase Ti8O15 nanowires (NWs) have been grown directly on a Ti substrate by a facile one-step evaporation-deposition synthesis method under a hydrogen atmosphere. The Ti8O15 NWs exhibit an outstanding electrical conductivity at room temperature. The electrical conductivity of a single Ti8O15 nanowire is 20.6 S cm-1 at 300 K. Theoretical calculations manifest that the existence of a large number of oxygen vacancies changes the band structure, resulting in the reduction of the electronic resistance. The Magnéli phase Ti8O15 nanowires have been used as conductive carbon-free supports to load Pt nanoparticles for direct methanol oxidation reaction (MOR). The Pt/Ti8O15 NWs show an enhanced activity and extremely high durability compared with commercial Pt/C catalysts. Electronic supplementary information (ESI) available: Additional data for the characterization and experimental details see DOI: 10.1039/c4nr05806b
Cumulative carbon emissions budgets consistent with 1.5 °C global warming
Tokarska, Katarzyna B.; Gillett, Nathan P.
2018-04-01
The Paris Agreement1 commits ratifying parties to pursue efforts to limit the global temperature increase to 1.5 °C relative to pre-industrial levels. Carbon budgets2-5 consistent with remaining below 1.5 °C warming, reported in the IPCC Fifth Assessment Report (AR5)2,6,8, are directly based on Earth system model (Coupled Model Intercomparison Project Phase 5)7 responses, which, on average, warm more than observations in response to historical CO2 emissions and other forcings8,9. These models indicate a median remaining budget of 55 PgC (ref. 10, base period: year 1870) left to emit from January 2016, the equivalent to approximately five years of emissions at the 2015 rate11,12. Here we calculate warming and carbon budgets relative to the decade 2006-2015, which eliminates model-observation differences in the climate-carbon response over the historical period9, and increases the median remaining carbon budget to 208 PgC (33-66% range of 130-255 PgC) from January 2016 (with mean warming of 0.89 °C for 2006-2015 relative to 1861-188013-18). There is little sensitivity to the observational data set used to infer warming that has occurred, and no significant dependence on the choice of emissions scenario. Thus, although limiting median projected global warming to below 1.5 °C is undoubtedly challenging19-21, our results indicate it is not impossible, as might be inferred from the IPCC AR5 carbon budgets2,8.
Morphology, deformation, and defect structures of TiCr2 in Ti-Cr alloys
International Nuclear Information System (INIS)
Chen, K.C.; Allen, S.M.; Livingston, J.D.
1992-01-01
The morphologies and defect structures of TiCr 2 in several Ti-Cr alloys have been examined by optical metallography, x-ray diffraction, and transmission electron microscopy (TEM), in order to explore the room-temperature deformability of the Laves phase TiCr 2 . The morphology of the Laves phase was found to be dependent upon alloy composition and annealing temperature. Samples deformed by compression have also been studied using TEM. Comparisons of microstructures before and after deformation suggest an increase in twin, stacking fault, and dislocation density within the Laves phase, indicating some but not extensive room-temperature deformability
Retention behavior of resorcinarene-based cavitands on C8 and C18 stationary phases.
Bartó, Endre; Prauda, Ibolya; Kilár, Ferenc; Kiss, Ibolya; Felinger, Attila
2015-09-01
The understanding of the retention behavior of large molecules is an area of interest in liquid chromatography. Resorcinarene-based cavitands are cavity-shaped cyclic oligomers that can create host-guest interactions. We have investigated the chromatographic behavior of two types of cyclic tetramers as analytes in high-performance liquid chromatography. The experiments were performed at four different temperatures (15, 25, 35, 45°C) on two types of reversed stationary phases (C8 and C18 ) from two different manufacturers. We have found a huge difference between the retention of resorcinarenes and cavitands. In some cases, the retention factor of cavitands was even a hundred times larger than the retention factor of resorcinarenes. The retention of methylated derivates was two to four times larger compared to that of demethylated compounds on every column. The opposite retention behavior of the resorcinarenes and cavitands on the two types of stationary phases showed well the difference of the selectivity of the XTerra and BDS Hypersil columns. The retention mechanism was studied by the thermodynamic parameters calculated from the van't Hoff equation. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Pokam Mba, Wilfried; Longandjo, Georges-Noel T.; Moufouma-Okia, Wilfran; Bell, Jean-Pierre; James, Rachel; Vondou, Derbetini A.; Haensler, Andreas; Fotso-Nguemo, Thierry C.; Merlin Guenang, Guy; Djiotang Tchotchou, Angennes Lucie; Kamsu-Tamo, Pierre H.; Takong, Ridick R.; Nikulin, Grigory; Lennard, Christopher J.; Dosio, Alessandro
2018-05-01
Discriminating climate impacts between 1.5 °C and 2 °C warming levels is particularly important for Central Africa, a vulnerable region where multiple biophysical, political, and socioeconomic stresses interact to constrain the region’s adaptive capacity. This study uses an ensemble of 25 transient Regional Climate Model (RCM) simulations from the CORDEX initiative, forced with the Representative Concentration Pathway (RCP) 8.5, to investigate the potential temperature and precipitation changes in Central Africa corresponding to 1.5 °C and 2 °C global warming levels. Global climate model simulations from the Coupled Model Intercomparison Project phase 5 (CMIP5) are used to drive the RCMs and determine timing of the targeted global warming levels. The regional warming differs over Central Africa between 1.5 °C and 2 °C global warming levels. Whilst there are large uncertainties associated with projections at 1.5 °C and 2 °C, the 0.5 °C increase in global temperature is associated with larger regional warming response. Compared to changes in temperature, changes in precipitation are more heterogeneous and climate model simulations indicate a lack of consensus across the region, though there is a tendency towards decreasing seasonal precipitation in March–May, and a reduction of consecutive wet days. As a drought indicator, a significant increase in consecutive dry days was found. Consistent changes of maximum 5 day rainfall are also detected between 1.5 °C vs. 2 °C global warming levels.
Phase equilibria, phases and compounds in the Ti-C system
International Nuclear Information System (INIS)
Gusev, Aleksandr I
2002-01-01
The results of experimental and theoretical investigations of the phase equilibria in the titanium-carbon system are generalised. The generalised thermodynamic characteristics of disordered titanium carbide TiC y , are reported. Peculiarities of the crystal structures of all the known and hypothetical compounds of titanium with carbon are considered in detail. The X-ray diffraction patterns which allow identification of all these compounds are presented. The phase diagrams of the Ti-C system constructed with allowance for atomic ordering of non-stoichio metric carbide, TiC y , and for the existence of the molecular cluster-like compounds Ti 8 C 12 and Ti 13 C 22 (TiC 2 ) are discussed. The bibliography includes 142 references.
Phase equilibria, phases and compounds in the Ti-C system
International Nuclear Information System (INIS)
Gusev, A.I.
2002-01-01
The results of experimental and theoretical investigations related to the phase equilibria in the titanium-carbon system are generalized. The generalized thermodynamic characteristics of the disordered titanium carbide TiC y are given. The crystal structure of all the discovered and hypothetical compounds of titanium with carbon are considered in detail. The x-ray diffraction patterns which allow one to identify all these compounds are given. The phase diagrams of the Ti-C system constructed with allowance for atomic ordering of non-stoichiometric TiC y carbide and for the existence of the compounds Ti 8 C 12 and Ti 13 C 22 (TiC 2 ) of the molecule cluster type are discussed [ru
Acree, William; Chickos, James S.
2016-09-01
A compendium of phase change enthalpies published in 2010 is updated to include the period 1880-2015. Phase change enthalpies including fusion, vaporization, and sublimation enthalpies are included for organic, organometallic, and a few inorganic compounds. Part 1 of this compendium includes organic compounds from C1 to C10. Part 2 of this compendium, to be published separately, will include organic and organometallic compounds from C11 to C192. Sufficient data are presently available to permit thermodynamic cycles to be constructed as an independent means of evaluating the reliability of the data. Temperature adjustments of phase change enthalpies from the temperature of measurement to the standard reference temperature, T = 298.15 K, and a protocol for doing so are briefly discussed.
Kerma factors and reaction cross sections for n + /sup 12/C between 15 and 18 MeV
Energy Technology Data Exchange (ETDEWEB)
Tornow, W.; Chen, Z.M.; Baird, K.; Walter, R.L.
1988-07-01
Differential elastic and inelastic (4.44 MeV) neutron scattering cross sections from /sup 12/C are presented at 15.6, 16.8 and 17.3 MeV. The existing 18.2 MeV differential cross-section data were combined with newly measured analysing power data to parametrise neutron scattering at this energy. The /sup 12/C recoil kerma factors were calculated and reaction cross sections were obtained from a phase-shift analysis and coupled channel analyses in the 15.6-18.2 MeV energy range.
Metastable and stable magnetic phases in as-cast and annealed Pr80Fe15(B1-xCx)5 alloys (0.0≤x≤1.0)
International Nuclear Information System (INIS)
Sanchez Llamazares, J.L.; Lopez, G.; Fidler, J.
1998-01-01
In as-cast Pr 80 Fe 15 (B 1-x C x ) 5 , samples metastable A 1 (T c =225 C) was the predominant magnetic phase in the whole composition range, with intrinsic properties that were not affected with increasing C content. Up to x=0.75 this phase coexists with an additional minor magnetic phase having T c =263 C which has been labelled by us to as A 3 . Upon annealing at 600 C A 1 dissolves and the following stable phases were observed: (a) Pr 2 Fe 14 B and A 3 for 0.0≤x≤0.75, and; (b) an unknown stable phase D 1 with coercivity around 2.1 kOe and Curie temperature of 230 C for x=1.0. D 1 is the predominant phase for annealing times less than 8 h while for 8 and 16 h annealing an additional phase with T c =17 C appears. The latter has been tentatively identified as Pr 2 Fe 17 . SEM and X-ray microanalysis studies were performed on Pr 80 Fe 15 C 5 samples in the as-cast state and after 16 h of annealing. The as-cast sample shows large Pr-rich grains immersed in a fine eutectic microstructure consisting of Pr and Fe. In annealed samples, both large square or polygonal grains and a needle-like phase are formed. The latter is believed to be D 1 . (orig.)
Comparison of halo of 11Be, 15C, and 19C
Kharab, R.; Kumar, R.; Singh, P.; Sharma, H. C.
2007-12-01
We have compared the halo of 11Be, 15C, and 19C nuclei by analyzing the one-neutron stripping reaction data on the Be target at 60-, 54-, and 57-MeV/ A beam energies, respectively, within the framework of the eikonal approximation approach. The determination of effective range through the comparison of the total cross section data and prediction has revealed that the halo of 19C is the well developed, while that of 15C is the least and that of 11Be lies in between these two. The longitudinal momentum distribution data also strengthen these observations.
Phase transformations and mechanical properties in heat treated superaustenitic stainless steels
International Nuclear Information System (INIS)
Koutsoukis, T.; Redjaïmia, A.; Fourlaris, G.
2013-01-01
A microstructure–properties relationship study in two superaustenitic stainless steels (S31254 and S32654) was carried out, following exposure at elevated temperatures for various ageing times. Due to high temperature ageing, most stainless steel grades suffer the formation of various precipitates, directly affecting their properties. The full characterization of those precipitates and the correlation with the mechanical behavior of the steels is the primary aim of this study. Samples of the steel grades studied, were exposed to isothermal heat treatments within the temperature range of 650–950 °C, for ageing times varying between 0.5 h and 3000 h, followed by water quenching at room temperature. Microstructural examination indicated the formation of four different secondary phases, sigma phase (σ), chi phase (χ), Laves phase and β-Cr 2 N nitride, which were characterized by transmission electron microscopy (TEM) and electron diffraction. The results obtained permitted the construction of the time–temperature–precipitation (TTP) plots. In addition, tensile and Vickers hardness testing were utilized and the modulus of toughness was calculated. The kinetics of the formation of various precipitates with increasing temperature and aging duration was also observed. It was found that various precipitates had a significant effect on all mechanical properties studied.
Indirect phase transition of TiC, ZrC, and HfC crystal structures
Energy Technology Data Exchange (ETDEWEB)
Abavare, Eric K.K.; Dodoo, Samuel N.A. [Department of Physics, Kwame Nkrumah University of Science and Technology, Kumasi (Ghana); Uchida, Kazuyuki; Oshiyama, Atsushi [Department of Applied Physics, The University of Tokyo, Hongo, Tokyo (Japan); Nkurumah-Buandoh, George K.; Yaya, Abu [Department of Physics, University of Ghana, Legon (Ghana)
2016-06-15
We have performed first-principles calculations to analyze the electronic structures, static, and dynamical structural stabilities of the pressure-induced phase transformation of refractory compounds (transition-metal carbides) from NaCl-type (B1) to CsCl-type (B2) via zinc-blende phase using the plane-wave pseudopotential approach in the framework of the generalized gradient approximation (GGA) for the exchange and correlation functional. The ground-state properties, equilibrium lattice constant, bulk moduli, and band structures are determined for the stoichiometry of the compounds and compared with known experimental and theoretical values. We find that the phase-transition pressure for the indirect phase transition from B1→B2 via zinc-blende structure is about 17-fold for TiC, 12-fold for both ZrC and HfC, respectively, when compared with the direct phase transition. Calculated phonon instability exists for the CsCl-B2 phase, which can prevent the structures from forming and contrary to the zinc-blende and the NaCl-B1 phases. The band dispersion and electronic density of states for B1 and B2 crystal phases were explored and found to indicate metallic character in contrast with the zinc-blende phase, which has a pseudogap opening in the bandgap region suggesting a semiconducting property and also a frequency gap in the phonon spectrum. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Analysis of A-15 phase in the system Nb-Au
International Nuclear Information System (INIS)
Silveira, M.F. da.
1982-01-01
The Nb-Au system contains a A-15 structure with a superconducting critical temperature of the order of 11 K. According to the actually available phase diagrams there is some incertainty, whether the stoichiometric composition Nb 3 Au (75% at. Nb and 25% at. Au) occurs within the limits of stability. In the present work the samples (alloys of Nb and Au) are produced using a technique of melting by condenser discharge. The advantage of this technique consists in the possibility to obtain samples with compositions exceeding the limits of stability, as shown by lattice parameter analyses of the phase A-2 (Nb - solid solution) samples. The A-15 phase is obtained by heat treatments of samples crystallized originally in the A-2 structure. The inductively determined critical temperatures are close to the highest reported in the literature for this compound (11,5 K). Further we show by lattice parameter analyses that we are able to obtain the A-15 phase also with metastable compositions, very probably inclusively with the stoichiometric composition. (author) [pt
Microstructural evolution and creep of Fe-Al-Ta alloys
Energy Technology Data Exchange (ETDEWEB)
Prokopcakova, Petra; Svec, Martin [Technical University of Liberec (Czech Republic). Dept. of Material Science; Palm, Martin [Max-Planck-Institut fuer Eisenforschung GmbH, Duesseldorf (Germany). Structure and Nano-/Micromechanics of Materials
2016-05-15
The microstructural evolution in Fe-Al-Ta alloys containing 23 - 31 at.% Al and 1.5 - 2.2 at.% Ta has been studied in the temperature range 650 - 750 C by annealing for 1, 10, 100 and 1 000 h. The experiments confirm that in this temperature range the precipitation of the stable hexagonal C14 Laves phase is preceded by formation of coherent, metastable L2{sub 1} Heusler phase precipitates within the Fe-Al matrix. However, precipitates of C14 are observed after much shorter annealing times than previously assumed. Creep strength increases substantially with increasing Al content of the alloys because the solid solubility for Ta in the Fe-Al matrix increases with increasing Al content and solid-solution hardening contributes substantially to the observed high creep strength. It may therefore be that the microstructural changes during creep have no noticeable effect on creep strength.
Microstructural evolution and creep of Fe-Al-Ta alloys
International Nuclear Information System (INIS)
Prokopcakova, Petra; Svec, Martin; Palm, Martin
2016-01-01
The microstructural evolution in Fe-Al-Ta alloys containing 23 - 31 at.% Al and 1.5 - 2.2 at.% Ta has been studied in the temperature range 650 - 750 C by annealing for 1, 10, 100 and 1 000 h. The experiments confirm that in this temperature range the precipitation of the stable hexagonal C14 Laves phase is preceded by formation of coherent, metastable L2 1 Heusler phase precipitates within the Fe-Al matrix. However, precipitates of C14 are observed after much shorter annealing times than previously assumed. Creep strength increases substantially with increasing Al content of the alloys because the solid solubility for Ta in the Fe-Al matrix increases with increasing Al content and solid-solution hardening contributes substantially to the observed high creep strength. It may therefore be that the microstructural changes during creep have no noticeable effect on creep strength.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Employment. 8c.40 Section 8c.40... BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF COMMERCE § 8c.40 Employment... discrimination in employment under any program or activity conducted by the agency. The definitions, requirements...
On the nature of phase transitions in the tetragonal tungsten bronze GdK2Nb5O15 ceramics
International Nuclear Information System (INIS)
Gagou, Y.; Lukyanchuk, I.; El Marssi, M.; Amira, Y.; Mezzane, D.; Courty, M.; Masquelier, C.; Yuzyuk, Yu. I.
2014-01-01
Phase transitions in gadolinium potassium niobate GdK 2 Nb 5 O 15 (GKN) ceramics have been investigated by x-ray diffraction, dielectric susceptibility, differential scanning calorimetry, and Raman scattering. The results of our complementary studies show that GKN exhibits two phase transitions at T c1 = 238 °C and T c2 = 375 °C attributed to the ferroelectric-antiferroelectric-paraelectric (FE-AFE-PE) phase transitions. According to the x-ray diffraction analysis, the FE and PE phases were refined in the polar P4bm and centrosymmetric P4/mbm space groups. For the intermediate phase, the structure is refined in the space group P4nc with doubling of the c unit cell parameter, which is compatible with an AFE phase. This result was confirmed by Raman spectroscopy since new low-frequency lines are activated in the AFE phase due to the Brillouin zone-folding effect, typical for the modulated phases. The presence of the AFE phase between the FE and PE phases and the complex nature of tetragonal tungsten bronze crystal structure can explain the large thermal hysteresis observed at the FE-AFE transition between heating and cooling cycle and the strong depression of the Curie-Weiss temperature T 0 . The semi-phenomenological Ising-like model based on the obtained experimental data is proposed to account for the observed FE-AFE-PE transition sequence
Effects of SiC amount on phase compositions and properties of Ti3SiC2-based composites
Institute of Scientific and Technical Information of China (English)
蔡艳芝; 殷小玮; 尹洪峰
2015-01-01
The phase compositions and properties of Ti3SiC2-based composites with SiC addition of 5%−30% in mass fraction fabricated by in-situ reaction and hot pressing sintering were studied. SiC addition effectively prevented TiC synthesis but facilitated SiC synthesis. The Ti3SiC2/TiC−SiC composite had better oxidation resistance when SiC added quantity reached 20% but poorer oxidation resistance with SiC addition under 15%than Ti3SiC2/TiC composite at higher temperatures. There were more than half of the original SiC and a few Ti3SiC2 remaining in Ti3SiC2/TiC−SiC with 20% SiC addition, but all constituents in Ti3Si2/TiC composite were oxidized after 12 h in air at 1500 °C. The oxidation scale thickness of TS30, 1505.78μm, was near a half of that of T, 2715μm, at 1500 °C for 20 h. Ti3SiC2/TiC composite had a flexural strength of 474 MPa, which was surpassed by Ti3SiC2/TiC−SiC composites when SiC added amount reached 15%. The strength reached the peak of 518 MPa at 20%SiC added amount.
International Nuclear Information System (INIS)
Slattery, G.F.; O'Riordan, P.; Lambert, M.E.; Green, S.M.
1981-01-01
A sequential and integrated metallographic procedure has been developed and successfully employed to differentiate between carbide, sigma, chi, Laves and ferrite phases which are commonly encountered in type 316 austenitic steel. The experimental techniques of optical and electron microscopy to identify these phases have been outlined and provide a rapid and convenient method of characterizing the microstructure of the steel. The techniques sequence involves selective metallographic etching, Nomarski interference microscopy, scanning electron microscopy, energy dispersive microanalysis, transmission electron microscopy and electron diffraction. (author)
Energy Technology Data Exchange (ETDEWEB)
Wang, Man [School of Materials Science and Engineering, University of Science and Technology Beijing, Beijing 10083 (China); Nuclear Materials Development Division, Korean Atomic Energy Research Institute, Daejeon 305-353 (Korea, Republic of); Sun, Hongying [School of Mechanical Engineering, Anyang Institute of Technology, Anyang 455002 (China); Phaniraj, Madakashira P.; Han, Heung Nam [Department of Materials Science and Engineering and Research Institute of Advanced Materials, Seoul National University, Seoul 151-744 (Korea, Republic of); Jang, Jinsung [Nuclear Materials Development Division, Korean Atomic Energy Research Institute, Daejeon 305-353 (Korea, Republic of); Zhou, Zhangjian, E-mail: zhouzhj@mater.ustb.edu.cn [School of Materials Science and Engineering, University of Science and Technology Beijing, Beijing 10083 (China)
2016-08-30
The effects of aging at 700 °C on the microstructure and tensile properties of an alumina-forming austenitic (AFA) stainless steel were investigated. With increasing aging time, B2-NiAl and Laves phase precipitated first on grain boundaries (GB) and then in the grain interior. The GB precipitate coverage reached 74% after aging for 1000 h. The GB precipitates not only suppressed grain coarsening during aging, but also influenced the tensile fracture mode at 700 °C by partitioning stress concentration on triple junctions. Moreover plate-like and spherical NbC particles precipitated during aging. Spherical NbC with size of around 5 nm were stable, while plate-like NbC grew to 89 nm after aging for 1000 h. These precipitates played an important role on the tensile strength. Age hardening contributed to the increasing tensile strength at RT with aging time, while the softening mechanism of dynamic recovery dominated the tensile tests at 700 °C.
Atomic ordering, phase stability and superconductivity in bulk and filamentary A15 type compounds
International Nuclear Information System (INIS)
Fluekiger, R.
1987-05-01
The influence of atomic ordering effects and ordering kinetics on the superconducting and metallurgical properties of A15 type compounds are critically discussed based on own and literature data. First, the techniques for determining the order parameter are reviewed. The dependence of T c vs. S in various A15 type compounds as a function of the quenching temperature and of the high energy particle irradiation fluence is discussed. A model for the disordering mechanism in A15 compounds is established, based on the new concept of the virtual lattice site. It is shown that the disordering mechanism is the same in both cases, high temperature heat treatment and high energy particle irradiation. The very complete representation of ordering effects also contains the variation of other properties, e.g. γ, θ D , ρ o and B c2 (0). Furthermore, it allows to draw empirical correlations between atomic ordering and A15 phase stability. Finally, it is shown on selected examples that the optimization of the critical current density at high fields in Nb 3 Sn wires by alloying is nothing else than a consequence of the occurrence of perfect atomic ordering in binary Nb 3 Sn. (orig.)
Synthesis and phase transformation mechanism of Nb{sub 2}C carbide phases
Energy Technology Data Exchange (ETDEWEB)
Vishwanadh, B., E-mail: visubathula@gmail.com [Materials Science Division, Bhabha Atomic Research Centre, Mumbai 400 094 (India); Murthy, T.S.R.Ch. [Materials Processing Division, Bhabha Atomic Research Centre, Mumbai 400 094 (India); Arya, A.; Tewari, R.; Dey, G.K. [Materials Science Division, Bhabha Atomic Research Centre, Mumbai 400 094 (India)
2016-06-25
In the present work, Niobium carbide samples were prepared through powder metallurgy route using spark plasma sintering technique. Some of these samples were heat treated at 900 °C up to 7 days. In order to investigate the phase transformation in Nb{sub 2}C carbide, the as-prepared and heat treated samples were characterized by X-ray diffraction, scanning electron microscopy and electron back scattered diffraction (EBSD) and transmission electron microscopy techniques. EBSD could index the same area of the sample in terms of any of the three allotropes of Nb{sub 2}C carbide phases (γ-Nb{sub 2}C, β-Nb{sub 2}C and α-Nb{sub 2}C) with good confidence index. From the EBSD patterns orientation relationships (OR) among γ, β and α-Nb{sub 2}C have been determined. Based on this OR when crystals of the three allotropes were superimposed, it has revealed that the basic Nb metal atom lattice (hcp lattice) in all the Nb{sub 2}C phases is same. The only difference exists in the carbides is the ordering of carbon atoms and vacancies in the octahedral positions of the hcp Nb metal atom lattice. Crystallographic analysis showed that for the transformation of γ-Nb{sub 2}C → β-Nb{sub 2}C → α-Nb{sub 2}C, large movement of Nb atoms is not required; but only by ordering of carbon atoms ensues the phase transformation. Literature shows that in the Nb–C system formation of the α-Nb{sub 2}C is not well established. Therefore, first principle calculations were carried out on these carbides. It revealed that the formation energy for α-Nb{sub 2}C is lower than the β and γ-Nb{sub 2}C carbides which indicate that the formation of α-Nb{sub 2}C is thermodynamically feasible. - Highlights: • Nb{sub 2}C carbide was produced by Spark Plasma Sintering in a single process. • Phase transformation mechanism of different Nb{sub 2}C carbide phases is studied. • In all the three Nb{sub 2}C carbides (γ, β, α), the base Nb lattice remains same. • Among γ, β and α-Nb{sub 2}C
Phase C commissioning-Cernavoda Unit 2
International Nuclear Information System (INIS)
Munro, Robert
2007-01-01
Phase C commissioning program includes over 500 individual tests and checks which are carefully planned and scheduled at the correct power level. Some of the major tests are the following: - heat transport thermosyphoning test at 3% Full Power (FP); - dual computer failure test at 15% FP; - turbine overspeed test and generator first synchronization; - load rejection tests at 25, 50, 75 and 100% FP; - loss of Class IV Power test at 25% FP; - shutdown system (SDS nr. 1 and SDS nr. 2) tests at >60% FP; - condensate extraction and boiler feedwater pump trip tests at 100% FP; - power cycling through reactor setback from 100 to 10 and back to 100% FP; - condenser steam discharge valve tests with reactor at 100% FP and turbine at 60% output; - low pressure and high pressure heater box-up tests at 100% FP. Progress through the Phase C program is controlled at six specific Commissioning Control Points (CCPs) which meet the Romanian Regulatory Authority (CNCAN) and Management requirements. These CCPs are the following: PI - Approval for Power increase to 5% FP; PP1 - Approval for Power increase to 25% FP; PP2 - Approval for Power increase to 50% FP; PP3 - Approval for Power increase to 75% FP; PP4 - Approval for Power increase to 100% FP. Prior to releasing each of these CCPs both Management and CNCAN complete an assessment of the 'Readiness' to proceed to the next power plateau. The readiness includes a review of the plant material condition, results of previous tests, documentation status, and operability maintainability issues. (author)
Mechanical Properties and Microstructural Characterization of Aged Nickel-based Alloy 625 Weld Metal
Silva, Cleiton Carvalho; de Albuquerque, Victor Hugo C.; Miná, Emerson Mendonça; Moura, Elineudo P.; Tavares, João Manuel R. S.
2018-03-01
The aim of this work was to evaluate the different phases formed during solidification and after thermal aging of the as-welded 625 nickel-based alloy, as well as the influence of microstructural changes on the mechanical properties. The experiments addressed aging temperatures of 650 and 950 °C for 10, 100, and 200 hours. The samples were analyzed by electron microscopy, microanalysis, and X-ray diffraction in order to identify the secondary phases. Mechanical tests such as hardness, microhardness, and Charpy-V impact test were performed. Nondestructive ultrasonic inspection was also conducted to correlate the acquired signals with mechanical and microstructural properties. The results show that the alloy under study experienced microstructural changes when aged at 650 °C. The aging was responsible by the dissolution of the Laves phase formed during the solidification and the appearance of γ″ phase within interdendritic region and fine carbides along the solidification grain boundaries. However, when it was aged at 950 °C, the Laves phase was continuously dissolved and the excess Nb caused the precipitation of the δ-phase (Ni3Nb), which was intensified at 10 hours of aging, with subsequent dissolution for longer periods such as 200 hours. Even when subjected to significant microstructural changes, the mechanical properties, especially toughness, were not sensitive to the dissolution and/or precipitation of the secondary phases.
International Nuclear Information System (INIS)
Nikulin, I.; Kipelova, A.; Kaibyshev, R.
2012-01-01
Highlights: ► Niobium stabilized 18Cr–8Ni austenitic steel was subjected to long-time aging. ► The main phases precipitated during aging are Z-phase and Laves-phase. ► Intragranular phases and solid solution are responsible for tensile strength. ► Intergranular particles affect impact toughness. - Abstract: The change in the mechanical properties of 18Cr–8Ni–W–Nb–V–N austenitic stainless steel due to aging was investigated at room temperature and 650 °C. It was shown that long-term aging decreases strength characteristics despite increasing hardness. The impact toughness decreases from 255 J/cm 2 for an un-aged steel to 135 J/cm 2 for the steel aged for 3000 h. However, evidence of ductile fracture was found even after long-term aging. This study suggests that the reduction in impact toughness occurs due to the precipitation of Z-phase and Laves-phase particles at the grain boundaries. The degradation of impact toughness and mechanical properties with aging is discussed in terms of microstructure evolution, secondary phase precipitations and fracture mechanisms.
Structural evolution of Fe-18Ni-16Cr-4Al steel during aging at 950 .deg. C
Energy Technology Data Exchange (ETDEWEB)
Wang, Man; Jang, Jinsung [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Zhou, Zhangjian [School of Materials Science and Engineering, USTB, Beijing (China)
2015-05-15
Austenitic stainless steels are also among important structural materials for in-core components of nuclear reactors, and the performance, the oxidation resistance as well as the mechanical strength at high temperature are further expected after Fukushima accident. Alumina-forming austenitic (AFA) steel was first developed by Y. Yamamoto et al. , which showed a good combination of oxidation resistance and creep resistance. The strengthening is achieved through nano-sized MX and Laves. Microstructural evolution of Fe-18Ni-16Cr-4Al during aging at 950 .deg. C was studied. This steel consists of two phases of austenite and ferrite. During aging, needle-shaped NiAl precipitates in austenite, while round shaped NiAl form in ferrite, which is supposed to be due to different crystal structural parameters.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT
On the differences between 1.5oC and 2oC of global warming
King, A.
2017-12-01
The Paris Agreement of 2015 has resulted in a drive to limit global warming to 2oC with an aim for a lower 1.5oC target. It is therefore vital that we understand some of the differences we would expect between these two levels of global warming. My research uses coupled climate model projections to investigate where and for what variables we can differentiate between worlds of 1.5oC and 2oC global warming. I place a particular focus on climate extremes and population exposure to those extremes. I have found that there are perceptible benefits in limiting global warming to 1.5oC as opposed to 2oC through reduced frequency and intensity of heat extremes, both over land and in ocean areas where thermal stress on coral has resulted in bleaching. Differences in high and low precipitation extremes between the 1.5oC and 2oC global warming levels are projected for some regions. I have also examined how "scalable" changes from the 1.5oC to 2oC level are. In areas of the world such as Eastern China I find that changes in anthropogenic aerosol concentrations will influence the level of change projected at 1.5oC and 2oC, such that past warming is likely to be a poor indicator of future changes. Overall, my research finds clear benefits to limiting global warming to 1.5oC relative to higher levels.
Influence of 5f electrons on structure and bonding in the actinide-hydrogen intermetallics
International Nuclear Information System (INIS)
Ward, J.W.
1984-01-01
Complexa phases form for the Th + H and U + H systems that are found with no other metals. In the Pa + H system, simple bcc C15 Laves and A15 phases can form, dependent on temperature and composition. The phase transformations appear to b magnetically driven, as a resutl of the decoupling of the metallic 5f electron bonding that occurs during hydriding; the C15 phases contain two kinds of Pa atoms-the one sublattice being still fully f-bonded and the other magnetic. This is a unique situation in solid state physics which defies a valence description. A similar situation obtains for A15 β - UH 3 structure. The parent metals themselves exhibit electronegativities not unlike those of the mid-3d transition metals (e.g., Fe) because the valence electrons re tied up in metallic bonding. However, under the driving force for hydriding, the lattices can open up, decoupling the f-bonding and inducing magnetism. The systems then aggressively form very stable hydrides typical of highly-electropositive metals. Beyond uranium the trivalent metallic state is favored and rare-earth-like hydrides are found for Np + H and Pu + H. Nevertheless, the solid-state and transport properties are markedly different than for the rare-earth hydrides, showing that the latent influence of the 5f electrons is still strong
Lithium insertion in the two crystallographic forms of the binary-phase Mo15Se19
Tarascon, J. M.; Murphy, D. W.
1986-02-01
Compounds which can undergo topotactic insertion of lithium are of potential technological importance in secondary lithium batteries. In this paper we present the chemical and electrochemical insertion of lithium into the binary-phase Mo15Se19, which can exist in two crystallographic forms, denoted AA and BB, when prepared from In3Mo15Se19 and In2Mo15Se19, respectively. We show that both forms can reversibly accommodate up to eight lithium atoms, yielding two new series of compounds of formula LixMo15Se19. This behavior is consistent with the electronic structure of the host material predicted from band-structure calculations. The room-temperature phase diagram of both LixMo15Se19 systems as a function of x has been established using electrochemical test cells (based on Mo15Se19 as the cathode), and in situ x-ray measurements as the cells discharge. Both LixMo15Se19 systems contain three single-phase domains as a function of x: two hexagonal phases and an orthorhombic phase. The nature of the transitions between these single phases and the variation of the lattice parameters within a single-phase domain are reported. While the mechanism of intercalation of lithium is similar for both Mo15Se19 forms, there is a drastic difference in Li intercalation behavior for the parent indium phases In2Mo15Se19 and In3Mo15Se19. We found that In2Mo15Se19 can reversibly incorporate 6.4 lithium atoms while In3Mo15Se19 does not react. This behavior is explained on the basis of structural considerations.
Waseem, Owais Ahmed; Ryu, Ho Jin
2017-05-16
The W x TaTiVCr high-entropy alloy with 32at.% of tungsten (W) and its derivative alloys with 42 to 90at.% of W with in-situ TiC were prepared via the mixing of elemental W, Ta, Ti, V and Cr powders followed by spark plasma sintering for the development of reduced-activation alloys for fusion plasma-facing materials. Characterization of the sintered samples revealed a BCC lattice and a multi-phase structure. The selected-area diffraction patterns confirmed the formation of TiC in the high-entropy alloy and its derivative alloys. It revealed the development of C15 (cubic) Laves phases as well in alloys with 71 to 90at.% W. A mechanical examination of the samples revealed a more than twofold improvement in the hardness and strength due to solid-solution strengthening and dispersion strengthening. This study explored the potential of powder metallurgy processing for the fabrication of a high-entropy alloy and other derived compositions with enhanced hardness and strength.
Hydrogen absorption/desorption characteristics of room temperature ZrMn2-xNix system (x = 1.25-1.50)
International Nuclear Information System (INIS)
Kumar, Vinod; Pukazhselvan, D.; Singh, S.K.; Tyagi, A.K.
2014-01-01
The present communication deals with the hydrogen storage characteristics of C15 laves phase ZrMn 2-x Ni x system tailored within the x values of 1.25 to 1.50. Drastic variations in thermodynamics of the hydride phase is observed for any little changes of concentration x within this narrow range. The most promising room temperature hydrogen storage materials are found to be formed within the range of 1.35 to 1.45 where ∼ 2.5 to 2.9 H/F.U. can be reversibly stored under the ideal operating conditions. The heat of the reaction is found to be ∼ 17 kJ/mol, which means these are promising candidates for stationary and short range mobile applications. The phase structural features and the thermodynamic aspects of all the materials are discussed in detail. (author)
17 CFR 240.15c3-1d - Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1).
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Satisfactory Subordination...-Counter Markets § 240.15c3-1d Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1). (a) Introduction. (1) This Appendix sets forth minimum and non-exclusive requirements for satisfactory...
Creep characteristics of precipitation hardened carbon free martensitic alloys
International Nuclear Information System (INIS)
Muneki, S.; Igarashi, M.; Abe, F.
2000-01-01
A new attempt has been demonstrated using carbon free Fe-Ni-Co martensitic alloys strengthened by Laves phase such as Fe 2 W or Fe 2 Mo to achieve homogeneous creep deformation at high temperatures under low stress levels. Creep behavior of the alloys is found to be completely different from that of the conventional high-Cr ferritic steels. The alloys exhibit gradual change in the creep rate with strain both in the transient and acceleration creep regions, and give a larger strain for the minimum creep rate. In these alloys the creep deformation takes place very homogeneously and no heterogeneous creep deformation is enhanced even at low stress levels. The minimum creep rates of the Fe-Ni-Co alloys at 700 C are found to be much lower than that of the conventional steel, which is due to fine dispersion strengthening useful even at 700 C in these alloys. It is thus concluded that the Fe-Ni-Co martensite strengthened by Laves phase is very useful to increase the creep resistance at elevated temperatures over 650 C. (orig.)
Experimental study of the oxide film structural phase state in the E635 and E110 alloys
International Nuclear Information System (INIS)
Shevyakov, A. Yu.; Shishov, V. N.; Novikov, V. V.
2013-01-01
The microstructure, phase and element compositions of oxide films of E110 (Zr-1%Nb) and E635 (Zr-1%Nb-0,35%Fe-1,2%Sn) alloys after autoclave tests in pure water had been studied by the method of transmission electron microscopy (TEM) with energy dispersive X-ray spectroscopy (EDS). TEM investigations of oxide film structure were carried on different oxide layers according to their thickness (near interface of “metal-oxide”, in central part of the oxide film and near outer surface) and in cross-section. The results of the tests show that oxide films of the alloys have different microstructure (grain size, fraction of tetragonal phase, content of defects, etc) and the phase compositions. The crystal structure of oxide films is mainly monoclinic, however, at the “metal-oxide” interface there are a significant fraction of the tetragonal phase. Researching of oxides on different stages of oxidation allow us to determine the kinetics of the second phase precipitate structure change: a) in E635 alloy at early oxidation stages of the amorphization process of the Laves phase precipitates begins with decreasing the content of iron and niobium; b) in E110 alloy the amorphization process of β-Nb precipitates begins at a later stage of oxidation. The influence of changes of the crystal structure and the chemical composition of the second phase precipitates on protective properties of the oxides had been determined. Researching of alloying element redistribution in E635 alloy oxide film shows that iron and niobium are concentrated in pores. Increased porosity of the E635 alloy oxide films at a later oxidation stage, in comparison with the E110 alloy, shows the influence of change composition and subsequent dissolution of the Laves phase particles on the pore formation in the oxide. (authors)
Directory of Open Access Journals (Sweden)
J. H. Park
2016-02-01
Full Text Available The lower cyclic endurance of Phase Change Memory (PCM devices limits the spread of its applications for reliable memory. The findings reported here show that micro-voids and excess vacancies that are produced during the deposition process and the subsequent growth in sputtered carbon-doped GeSbTe films is one of the major causes of device failure in PCM with cycling. We found that the size of voids in C15(Ge21Sb36Te43 films increased with increasing annealing temperature and the activation energy for the growth rate of voids was determined to be 2.22 eV. The film density, which is closely related to voids, varies with the deposition temperature and sputtering power used. The lower heat of vaporization of elemental Sb and Te compared to that for elemental Ge and C is a major cause of the low density of the film. It was possible to suppress void formation to a considerable extent by optimizing the deposition conditions, which leads to a dramatic enhancement in cyclic endurance by 2 orders of magnitude in PCM devices prepared at 300oC-300W compared to one prepared at 240oC-500W without change of compositions.
Lithium insertion in the two crystallographic forms of the binary-phase Mo15Se19
International Nuclear Information System (INIS)
Tarascon, J.M.; Murphy, D.W.
1986-01-01
Compounds which can undergo topotactic insertion of lithium are of potential technological importance in secondary lithium batteries. In this paper we present the chemical and electrochemical insertion of lithium into the binary-phase Mo 15 Se 19 , which can exist in two crystallographic forms, denoted AA and BB, when prepared from In 3 Mo 15 Se 19 and In 2 Mo 15 Se 19 , respectively. We show that both forms can reversibly accommodate up to eight lithium atoms, yielding two new series of compounds of formula Li/sub x/Mo 15 Se 19 . This behavior is consistent with the electronic structure of the host material predicted from band-structure calculations. The room-temperature phase diagram of both Li/sub x/Mo 15 Se 19 systems as a function of x has been established using electrochemical test cells (based on Mo 15 Se 19 as the cathode), and in situ x-ray measurements as the cells discharge. Both Li/sub x/Mo 15 Se 19 systems contain three single-phase domains as a function of x: two hexagonal phases and an orthorhombic phase. The nature of the transitions between these single phases and the variation of the lattice parameters within a single-phase domain are reported. While the mechanism of intercalation of lithium is similar for both Mo 15 Se 19 forms, there is a drastic difference in Li intercalation behavior for the parent indium phases In''Mo 15 Se 19 and In 3 Mo 15 Se 19 . We found that In 2 Mo 15 Se 19 can reversibly incorporate 6.4 lithium atoms while In 3 Mo 15 Se 19 does not react. This behavior is explained on the basis of structural considerations
Ma, Xiaojing; Hao, Yaping; Hu, Xiang; Luo, Yuqi; Deng, Zixuan; Zhou, Jian; Bao, Yuqian; Jia, Weiping
2015-05-01
The goal of the present study was to explore the correlations of 1,5-anhydroglucitol (l,5-AG), glycated hemoglobin (HbA1c), and glycated albumin (GA) with insulin sensitivity and secretion. In total, 302 patients with newly diagnosed type 2 diabetes mellitus (166 men, 136 women) were enrolled in this study. The homeostasis model assessment for insulin resistance (HOMA-IR) and homeostasis model assessment for β-cell function (HOMA-β) were calculated to determine the basal insulin sensitivity and secretion. The insulinogenic index (IGI) was used to evaluate early-phase insulin secretion. 1,5-AG and GA were assayed via the enzymatic method, and HbA1c was detected by high-pressure liquid chromatography. Among all 302 subjects, the serum 1,5-AG level was 13.1±7.2 μg/mL, and the HbA1c and GA levels [median (interquartile range)] were 6.7% (6.2-7.3%) and 17.7% (16.0-19.5%), respectively. Increased 1,5-AG quartiles were accompanied by trends toward a decreased HOMA-IR and an increased HOMA-β and IGI (for all trends, P1). 1,5-AG was negatively associated with HOMA-IR (r=-0.200, P1) and positively associated with HOMA-β and IGI (r=0.210 and 0.413, respectively; both P1). 1,5-AG was independently related to HOMA-IR and HOMA-β and exhibited an independent positive association with IGI (standardized β=0.242, P1). Additionally, both HbA1c and GA were independently correlated with HOMA-IR and HOMA-β. 1,5-AG is not only correlated with basal insulin sensitivity and secretion, but also closely associated with early-phase insulin secretion in Chinese patients with newly diagnosed type 2 diabetes mellitus.
Preparation of 15N-13C-fulminic acid
International Nuclear Information System (INIS)
Wilmes, R.; Winnewisser, M.
1993-01-01
The precursor for the title compound was prepared in a three-step synthesis. The 13 C-label was incorporated in the first step employing 2- 13 C-ethyl acetate and the 15 N-label in the last step, using 15 N-sodium nitrite. Upon pyrolysis the precursor forms three fragments, one of them being the title compound. (Author)
SiC-SiC and C-SiC Honeycomb for Advanced Flight Structures, Phase II
National Aeronautics and Space Administration — The proposed project builds upon the work done in Phase I with the development of a C-SiC CMC honeycomb material that was successfully tested for mechanical...
Energy Technology Data Exchange (ETDEWEB)
Tanigawa, H. [Japan Atomic Energy Agency, Tokai-mura, Naga-gun, Ibaraki-ken (Japan); Klueh, R.L. [Oak Ridge Noational Laboratory, TN (United States); Hashimoto, N. [Hokkaido Univ., Materials Science and Engineering Div., Graduate School of Engineering, Sapporo (Japan); Sokolov, M. [Oak Ridge National Laboratory, Materials Science and Technology Div., TN (United States)
2007-07-01
Full text of publication follows: It has been reported that reduced-activation ferritic/martensitic steels (RAFMs), such as F82H, ORNL9Cr-2WVTa, and JLF-1, showed a variety of changes in ductile-brittle transition temperature and yield stress after irradiation at 573 K up to 5 dpa, and those differences could not be interpreted solely by the difference of dislocation microstructure induced by irradiation. To investigate the impact of other microstructural feature, i.e. precipitates, the precipitation behavior of F82H, ORNL 9Cr-2WVTa, and JLF-1 was examined. It was revealed that irradiation-induced precipitation and amorphization of precipitates partly occurred and caused the different precipitation on block, packet and prior austenitic grain boundaries. In addition to these phenomena, irradiation-induced nano-size precipitates were also observed in the matrix. It was also revealed that the chemical compositions of precipitates approached the calculated thermal equilibrium state of M{sub 23}C{sub 6} at an irradiation temperature of 573 K. The calculation also suggests the presence of Laves phase at 573 K, which is usually not observed at this temperature, but the ion irradiation on aged F82H with Laves phase suggests that Laves phase becomes amorphous and could not be stable under irradiation at 573 K. This observation indicates the possibility that the irradiation-induced nano-size precipitation could be the consequence of the conflict between precipitation and amorphization of Laves phase. Over all, these observations suggests that the variety of embrittlement and hardening of RAFMs observed at 573 K irradiation up to 5 dpa might be the consequence of the transition phenomena that occur as the microstructure approaches thermal equilibrium during irradiation at 573 K. (authors)
Phase stability of oxide dispersion-strengthened ferritic steels in neutron irradiation
International Nuclear Information System (INIS)
Yamashita, S.; Oka, K.; Ohnuki, S.; Akasaka, N.; Ukai, S.
2002-01-01
Oxide dispersion-strengthened ferritic steels were irradiated by neutrons up to 21 dpa and studied by microstructural observation and microchemical analysis. The original high dislocation density did not change after neutron irradiation, indicating that the dispersed oxide particles have high stability under neutron irradiation. However, there is potential for recoil resolution of the oxide particles due to ballistic ejection at high dose. From the microchemical analysis, it was implied that some of the complex oxides have a double-layer structure, such that TiO 2 occupied the core region and Y 2 O 3 the outer layer. Such a structure may be more stable than the simple mono-oxides. Under high-temperature irradiation, Laves phase was the predominant precipitate occurring at grain boundaries α phase and χ phase were not observed in this study
Thermodynamic modeling of the Mg-Al-Ca system
Energy Technology Data Exchange (ETDEWEB)
Janz, A.; Groebner, J. [Clausthal University of Technology, Institute of Metallurgy, Robert-Koch-Str. 42, D-38678 Clausthal-Zellerfeld (Germany); Cao, H.; Zhu, J.; Chang, Y.A. [Department of Materials Science and Engineering, University of Wisconsin, 1509 University Ave., Madison, WI 53706 (United States); Schmid-Fetzer, R. [Clausthal University of Technology, Institute of Metallurgy, Robert-Koch-Str. 42, D-38678 Clausthal-Zellerfeld (Germany)], E-mail: schmid-fetzer@tu-clausthal.de
2009-02-15
A thermodynamic model has been developed that provides a quantitative description for a wide area of the Mg-Al-Ca system. All available experimental data plus new key experiments using differential scanning calorimetry/differential thermal analysis have been considered to create a dataset which reproduces the primary crystallizing phases, the extensive ternary solubilities of binary phases and the ternary C36 Laves phase. This enables validated thermodynamic calculations in various areas of this ternary system.
17 CFR 240.15c1-2 - Fraud and misrepresentation.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fraud and misrepresentation. 240.15c1-2 Section 240.15c1-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-2 Fraud and...
Microstructural characterisation of Inconel 718 gas tungsten arc welds
International Nuclear Information System (INIS)
Ram, G.D.J.; Reddy, A.V.; Rao, K.P.
2005-01-01
The presence of Nb-rich, brittle, intermetallic Laves phase in Inconel 718 weld fusion zones is detrimental to weld mechanical properties. In the current work, autogenous bead-on-plate gas tungsten-arc welds were deposited in 2 mm thick IN 718 sheets. The welds were subjected to the following heat treatments: i) direct aging, ii) solution treatment at 980 C followed by aging, and iii) solution treatment at 1080 C followed by aging. Detailed microstructural characterisation was carried out using optical, scanning electron and transmission electron microscopes and electron probe microanalysis. The microstructural features in as-welded and post-weld heat treated conditions are discussed. The results show that post-weld heat treatments alone cannot provide satisfactory solution to the Laves problem in Inconel 718 gas tungsten-arc welds
International Nuclear Information System (INIS)
Loganathan, Archana; Gandhi, Ashutosh S.
2010-01-01
Thermal Barrier coatings (TBC's) protect the gas turbine blades at high temperature exposure. The t' phase is metastable and slowly transforms to the high-temperature equilibrium state consisting of tetragonal (t) and cubic (c) during high temperature exposure. Nanometric grain size also influences the fracture toughness and t' stability. A comparative study of the phase stability and fracture toughness evolution of Yb and Gd stabilized zirconia with composition 8 mol%MO 1.5 . The t' ZrO 2 -8mol% MO 1.5 (M = Yb and Gd) were prepared by co-precipitation method with crystallite size ∼ 20nm. Spark plasma sintering at 1250 deg C for 10 min was carried out to produce compacts with ∼ 96% relative density for fracture toughness measurements. The dense compacts were heat treated at 1250 deg C upto 192h. XRD studies revealed the partitioning of t' to t+c. No spontaneous monoclinic phase formed during cooling, except after 192h exposure. The fracture toughness of the sintered pellets with various time intervals of thermal exposure was measured. The results were analysed in terms of the effect of phase constitution on fracture toughness. The role of ferroelastic toughening in these materials was explored. (author)
A phase one AR/C system design
Kachmar, Peter M.; Polutchko, Robert J.; Matusky, Martin; Chu, William; Jackson, William; Montez, Moises
1991-01-01
The Phase One AR&C System Design integrates an evolutionary design based on the legacy of previous mission successes, flight tested components from manned Rendezvous and Proximity Operations (RPO) space programs, and additional AR&C components validated using proven methods. The Phase One system has a modular, open architecture with the standardized interfaces proposed for Space Station Freedom system architecture.
International Nuclear Information System (INIS)
Liu, Hongwei; Liu, Jiangwen; Luo, Chengping; Liu, Zhijian
2016-01-01
The microstructure and crystallographic features of a semi-austenitic precipitation hardening steel PH 15-7Mo during solution treatment, roddrawing and aging were investigated by means of optical microscope, X-ray diffraction analyzer and transmission electron microscope. It was found that the microstructure of the steel was consist of dominant austenite, small amount of martensite and 10–15 vol.% δ-ferrite after solution treatment at 1050 °C followed by cooling in water at room temperature. The austenite transformed into lath martensite during tensile roddrawing about 60% deforming companied with some coherent fine β-NiAl particles precipitated within martensite. With higher aging temperature and longer holding time, tiny carbide M_2_3C_6 particles precipitated from martensite, which kept the cubic–cubic orientation relationship (OR) with austenite and G-T OR with martensite which is different with all the reported orientations. The OR between tiny carbide M_2_3C_6 particles G-T OR with martensite was discussed in terms of crystallography of phase transformations. - Highlights: • Microstructure changes of austenitic steel PH15-7Mo were due to alloying elements, service condition and carbide M_2_3C_6. • Lath-shape martensitic laths keep pseudo {112} twinning relationship. • β-NiAl particles hold a typical cubic-to-cubic orientation relationship with martensite. • M_2_3C_6 carbide kept a cubic–cubic orientation relationship (OR) with austenite and an unusual G-T OR with martensite. • Multiple orientation relationship between M_2_3C_6 and austenite is correlative with their structural similarity.
Experimental evidence for rhombohedral phase of C70 after irradiation
International Nuclear Information System (INIS)
Misof, K.; Fratzl, P.; Vogl, G.
1993-01-01
Purely f.c.c. C 70 was irradiated with high-energy heavy ions at low temperature. This led to the appearance of additional Bragg peaks attributed to an irradiation-induced f.c.c.-to-rhombohedral phase transition. On heating to about 570 K the retrasition to the pure f.c.c. phase occurred. Since no irradiation-induced phase transition was obsered in C 60 , the rhombohedral phase appears to be connected with the ''rugby-ball shape'' of C 70 which favours the alignment of the molecules. We propose that irradiation provides the agitation enabling the C 70 molecules to overcome the small energy barriers which otherwise prevent the alignment of the rugby balls over larger regions. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Ang, Caen, E-mail: angck@ornl.gov [Oak Ridge National Laboratory, Oak Ridge, TN 37830 (United States); Zinkle, Steven [Oak Ridge National Laboratory, Oak Ridge, TN 37830 (United States); University of Tennessee, Knoxville, TN 37996 (United States); Shih, Chunghao; Silva, Chinthaka; Cetiner, Nesrin; Katoh, Yutai [Oak Ridge National Laboratory, Oak Ridge, TN 37830 (United States)
2017-01-15
M{sub n+1}AX{sub n} (MAX) phase Ti{sub 3}SiC{sub 2} materials were neutron irradiated at ∼400, ∼630, and 700 °C to a fluence of ∼2 × 10{sup 25} n/m{sup 2} (E > 0.1 MeV). After irradiation at ∼400 °C, anisotropic c-axis dilation of ∼1.5% was observed. Room temperature strength was reduced from 445 ± 29 MPa to 315 ± 33 MPa and the fracture surfaces showed flat facets and transgranular cracks instead of typical kink-band deformation and bridging ligaments. XRD phase analysis indicated an increase of 10–15 wt% TiC. After irradiation at ∼700 °C there were no lattice parameter changes, ∼5 wt% decomposition to TiC occurred, and strength was 391 ± 71 MPa and 378 ± 31 MPa. The fracture surfaces indicated kink-band based deformation but with lesser extent of delamination than as-received samples. Ti{sub 3}SiC{sub 2} appears to be radiation tolerant at ∼400 °C, and increasingly radiation resistant at ∼630–700 °C, but a higher temperature may be necessary for full recovery. - Highlights: • Ti{sub 3}SiC{sub 2} candidate nuclear material for intrinsic toughness. • Neutron irradiation to 2 dpa complete (∼equivalent to a few months in LWR core). • First reported fracture strengths of Ti{sub 3}SiC{sub 2} after irradiation. • All toughening mechanisms in Ti{sub 3}SiC{sub 2} observed to be operational during irradiation at 700 °C. • Swelling recovery dominated by threshold migration in TiC (or TiC{sub 6}).
Single-shot quantitative phase microscopy with color-multiplexed differential phase contrast (cDPC.
Directory of Open Access Journals (Sweden)
Zachary F Phillips
Full Text Available We present a new technique for quantitative phase and amplitude microscopy from a single color image with coded illumination. Our system consists of a commercial brightfield microscope with one hardware modification-an inexpensive 3D printed condenser insert. The method, color-multiplexed Differential Phase Contrast (cDPC, is a single-shot variant of Differential Phase Contrast (DPC, which recovers the phase of a sample from images with asymmetric illumination. We employ partially coherent illumination to achieve resolution corresponding to 2× the objective NA. Quantitative phase can then be used to synthesize DIC and phase contrast images or extract shape and density. We demonstrate amplitude and phase recovery at camera-limited frame rates (50 fps for various in vitro cell samples and c. elegans in a micro-fluidic channel.
Solid Phase Characterization Of Heel Samples From Tank 241-C-110
International Nuclear Information System (INIS)
Page, J.S.; Cooke, G.A.; Pestovich, J.A.; Huber, H.J.
2011-01-01
During sluicing operations of tank 241-C-110, a significant amount of solids were unable to be retrieved. These solids (often referred to as the tank 'heel') were sampled in 2010 and chemically and mineralogically analyzed in the 222-S Laboratory. Additionally, dissolution tests were performed to identify the amount of undissolvable material after using multiple water contacts. This report covers the solid phase characterization of six samples from these tests using scanning electron microscopy, polarized light microscopy, and X-ray diffraction. The chemical analyses, particle size distribution analysis, and dissolution test results are reported separately. Two of the samples were from composites created from as-received material - Composite A and Composite B. The main phase in these samples was sodium-fluoride-phosphate hydrate (natrophosphate) - in the X-ray diffraction spectra, this phase was the only phase identifiable. Polarized light microscopy showed the presence of minor amounts of gibbsite and other phases. These phases were identified by scanning electron microscopy - energy dispersive X-ray spectroscopy as sodium aluminosilicates, sodium diuranate, and sodium strontium phosphate hydrate (nastrophite) crystals. The natrophosphate crystals in the scanning electron microscopy analysis showed a variety of erosive and dissolution features from perfectly shaped octahedral to well-rounded appearance. Two samples were from water-washed Composites A and B, with no change in mineralogy compared to the as-received samples. This is not surprising, since the water wash had only a short period of water contact with the material as opposed to the water dissolution tests. The last two samples were residual solids from the water dissolution tests. These tests included multiple additions of water at 15 C and 45 C. The samples were sieved to separate a coarser fraction of > 710 μm and a finer fraction of < 710 μm. These two fractions were analyzed separately. The coarser
Results from the BRACE 1.5 study: Climate change impacts of 1.5 C and 2 C warming
O'Neill, B. C.; Anderson, B.; Monaghan, A. J.; Ren, X.; Sanderson, B.; Tebaldi, C.
2017-12-01
In 2015, 195 countries negotiated the Paris Agreement on climate change, which set long-term goals of limiting global mean warming to well below 2 C and possibly 1.5 C. This event stimulated substantial scientific interest in climate outcomes and impacts on society associated with those levels of warming. Recently, the first set of global climate model simulations explicitly designed to meet those targets were undertaken with the Community Earth System Model (CESM) for use by the research community (Sanderson et al, accepted). The BRACE 1.5 project models societal impacts from these climate outcomes, combined with assumptions about future socioeconomic conditions according to the Shared Socioeconomic Pathways. These analyses build on a recently completed study of the Benefits of Reduced Anthropogenic Climate changE (BRACE), published as a set of 20 papers in Climatic Change, which examined the difference in impacts between two higher scenarios resulting in about 2.5 C and 3.7 C warming by late this century. BRACE 1.5 consists of a set of six papers to be submitted to a special collection in Environmental Research Letters that takes a similar approach but focuses on impacts at 1.5 and 2 C warming. We ask whether impacts differ substantially between the two climate scenarios, accounting for uncertainty in climate outcomes through the use of initial condition ensembles of CESM simulations, and in societal conditions by using alternative SSP-based development pathways. Impact assessment focuses on the health and agricultural sectors; modeling approaches include the use of a global mutli-region CGE model for economic analysis, both a process-based and an empirical crop model, a model of spatial population change, a model of climatic suitability for the aedes aegypti mosquito, and an epidemiological model of heat-related mortality. A methodological analysis also evaluates the use of climate model emulation techniques for providing climate information sufficient to
Energy Technology Data Exchange (ETDEWEB)
Gagou, Y.; Lukyanchuk, I.; El Marssi, M., E-mail: mimoun.elmarssi@u-picardie.fr [Laboratoire de Physique de la Matière Condensée, Université de Picardie Jules Verne, 33 rue Saint-Leu, 80039 Amiens Cedex (France); Amira, Y. [Laboratoire de Physique de la Matière Condensée, Université de Picardie Jules Verne, 33 rue Saint-Leu, 80039 Amiens Cedex (France); Laboratoire de la Matière Condensée et Nanostructures, FSTG, Université Cadi Ayyad Marrakech, Maroc (Morocco); Mezzane, D. [Laboratoire de la Matière Condensée et Nanostructures, FSTG, Université Cadi Ayyad Marrakech, Maroc (Morocco); Courty, M.; Masquelier, C. [Laboratoire de Réactivité et Chimie des Solides, UMR 7314, Université de Picardie Jules Verne, Pôle Scientifique, 33 rue Saint-Leu, 80039 Amiens Cedex 1 (France); Yuzyuk, Yu. I. [Faculty of Physics, Southern Federal University, 5, Zorge Str. Rostov-on-Don 344090 (Russian Federation)
2014-02-14
Phase transitions in gadolinium potassium niobate GdK{sub 2}Nb{sub 5}O{sub 15} (GKN) ceramics have been investigated by x-ray diffraction, dielectric susceptibility, differential scanning calorimetry, and Raman scattering. The results of our complementary studies show that GKN exhibits two phase transitions at T{sub c1} = 238 °C and T{sub c2} = 375 °C attributed to the ferroelectric-antiferroelectric-paraelectric (FE-AFE-PE) phase transitions. According to the x-ray diffraction analysis, the FE and PE phases were refined in the polar P4bm and centrosymmetric P4/mbm space groups. For the intermediate phase, the structure is refined in the space group P4nc with doubling of the c unit cell parameter, which is compatible with an AFE phase. This result was confirmed by Raman spectroscopy since new low-frequency lines are activated in the AFE phase due to the Brillouin zone-folding effect, typical for the modulated phases. The presence of the AFE phase between the FE and PE phases and the complex nature of tetragonal tungsten bronze crystal structure can explain the large thermal hysteresis observed at the FE-AFE transition between heating and cooling cycle and the strong depression of the Curie-Weiss temperature T{sub 0}. The semi-phenomenological Ising-like model based on the obtained experimental data is proposed to account for the observed FE-AFE-PE transition sequence.
Global drought and severe drought-affected populations in 1.5 and 2 °C warmer worlds
Liu, Wenbin; Sun, Fubao; Lim, Wee Ho; Zhang, Jie; Wang, Hong; Shiogama, Hideo; Zhang, Yuqing
2018-03-01
The 2015 Paris Agreement proposed a more ambitious climate change mitigation target on limiting global warming to 1.5 °C instead of 2 °C above preindustrial levels. Scientific investigations on environmental risks associated with these warming targets are necessary to inform climate policymaking. Based on the Coupled Model Intercomparison Project phase 5 (CMIP5) climate models, we present the first risk-based assessment of changes in global drought and the impact of severe drought on populations from additional 1.5 and 2 °C warming conditions. Our results highlight the risk of drought on a global scale and in several hotspot regions such as the Amazon, northeastern Brazil, southern Africa and Central Europe at both 1.5 and 2 °C global warming relative to the historical period, showing increases in drought durations from 2.9 to 3.2 months. Correspondingly, more total and urban populations would be exposed to severe droughts globally (+132.5 ± 216.2 million and +194.5 ± 276.5 million total population and +350.2 ± 158.8 million and +410.7 ± 213.5 million urban populations in 1.5 and 2 °C warmer worlds) and regionally (e.g., East Africa, West Africa and South Asia). Less rural populations (-217.7 ± 79.2 million and -216.2 ± 82.4 million rural populations in 1.5 and 2 °C warmer worlds) would be exposed to severe drought globally under climate warming, population growth and especially the urbanization-induced population migration. By keeping global warming at 1.5 °C above the preindustrial levels instead of 2 °C, there is a decrease in drought risks (i.e., less drought duration, less drought intensity and severity but relatively more frequent drought) and the affected total, urban and rural populations would decrease globally and in most regions. While challenging for both East Africa and South Asia, the benefits of limiting warming to below 1.5 °C in terms of global drought risk and impact reduction are significant.
Mechanical and tribological properties of newly developed Tribaloy alloys
International Nuclear Information System (INIS)
Xu, W.; Liu, R.; Patnaik, P.C.; Yao, M.X.; Wu, X.J.
2007-01-01
Outstanding combination of mechanical, wear and corrosion performance has been achieved in Laves intermetallic materials, termed Tribaloy alloys. In these two-phase alloys the solid solution provides high mechanical strength and fracture toughness while the Laves intermetallic phase offers excellent wear resistance. However, conventional Tribaloy alloys usually have low tensile strength and fracture toughness compared with ductile materials due to the large volume fraction of Laves phase, which has limited their application in many cases. The present research is aimed at developing advanced Tribaloy alloys with increasing ductility. Two new cobalt base alloys were developed in this research. The specimens were fabricated with a centrifugal casting technique. The material characterization was performed using the differential scanning calorimetry (DSC), scanning electron microscope (SEM), indentation and ball-on-disc tribological techniques
Preparation and sintering of Zr(C,N,O) phases
International Nuclear Information System (INIS)
Tamborenea, S.; Mazzoni, A.D.; Aglietti, E.F.
2003-01-01
The Zr(C,O,N) compounds form a great mono-phase zone belonging to the pseudoternary ZrO-ZrN-ZrC system.Theses phases have cubic crystalline structure with a o parameter depending on the C, O 2 and N 2 content.These phases have many potential applications in the manufacture of ceramic pieces utilizable as electronic conductors.The Zr (C,O,N) phases can be obtained from ZrO 2 by carbonitriding reactions: that is carbothermal reduction and simultaneous nitriding.In this work a series of experiences of carbonitriding of zirconia under different conditions (temperatures between 1400 and 1600degC, times of 120 min, carbon content between 20 and 40%) in order to obtain suitable powders to be sintered.The XRD analysis shows the Zr(C,O,N) as the main products and β -ZrON as the only secondary product in proportions depending on the obtaining conditions.The variables employed were the C content and the reaction temperature.The Zr(C,O,N) content varies between 40 and 90% and tends to increase with the temperature and the carbon content whereas the β -ZrON phase varies between the 40 and 10 % decreasing its proportion with temperature and the carbon content.The oxidation resistance of these phases was studied by DTA-TG tests in air.Results show complete oxidation reaction at ∼500degC in air.The sintering of these materials was made on disks obtained by pressing of powders of Zr(C,N,O) contents higher than 90%.Sintering was performed in nitrogen atmosphere and temperatures between 1450 and 1620degC.Disks were characterized by pycnometry and Hg volumeter.The densities obtained were between 5 and 6,6g/cm 3 with a tendency to increase with the Zr(C,N,O) phase content, the temperature and the sintering time.Sintered disks were characterized by dilatometry in N 2
Coordinating AgMIP data and models across global and regional scales for 1.5°C and 2.0°C assessments
Rosenzweig, Cynthia; Ruane, Alex C.; Antle, John; Elliott, Joshua; Ashfaq, Muhammad; Chatta, Ashfaq Ahmad; Ewert, Frank; Folberth, Christian; Hathie, Ibrahima; Havlik, Petr; Hoogenboom, Gerrit; Lotze-Campen, Hermann; MacCarthy, Dilys S.; Mason-D'Croz, Daniel; Contreras, Erik Mencos; Müller, Christoph; Perez-Dominguez, Ignacio; Phillips, Meridel; Porter, Cheryl; Raymundo, Rubi M.; Sands, Ronald D.; Schleussner, Carl-Friedrich; Valdivia, Roberto O.; Valin, Hugo; Wiebe, Keith
2018-05-01
The Agricultural Model Intercomparison and Improvement Project (AgMIP) has developed novel methods for Coordinated Global and Regional Assessments (CGRA) of agriculture and food security in a changing world. The present study aims to perform a proof of concept of the CGRA to demonstrate advantages and challenges of the proposed framework. This effort responds to the request by the UN Framework Convention on Climate Change (UNFCCC) for the implications of limiting global temperature increases to 1.5°C and 2.0°C above pre-industrial conditions. The protocols for the 1.5°C/2.0°C assessment establish explicit and testable linkages across disciplines and scales, connecting outputs and inputs from the Shared Socio-economic Pathways (SSPs), Representative Agricultural Pathways (RAPs), Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) and Coupled Model Intercomparison Project Phase 5 (CMIP5) ensemble scenarios, global gridded crop models, global agricultural economics models, site-based crop models and within-country regional economics models. The CGRA consistently links disciplines, models and scales in order to track the complex chain of climate impacts and identify key vulnerabilities, feedbacks and uncertainties in managing future risk. CGRA proof-of-concept results show that, at the global scale, there are mixed areas of positive and negative simulated wheat and maize yield changes, with declines in some breadbasket regions, at both 1.5°C and 2.0°C. Declines are especially evident in simulations that do not take into account direct CO2 effects on crops. These projected global yield changes mostly resulted in increases in prices and areas of wheat and maize in two global economics models. Regional simulations for 1.5°C and 2.0°C using site-based crop models had mixed results depending on the region and the crop. In conjunction with price changes from the global economics models, productivity declines in the Punjab, Pakistan, resulted in
Rosenzweig, Cynthia; Ruane, Alex C; Antle, John; Elliott, Joshua; Ashfaq, Muhammad; Chatta, Ashfaq Ahmad; Ewert, Frank; Folberth, Christian; Hathie, Ibrahima; Havlik, Petr; Hoogenboom, Gerrit; Lotze-Campen, Hermann; MacCarthy, Dilys S; Mason-D'Croz, Daniel; Contreras, Erik Mencos; Müller, Christoph; Perez-Dominguez, Ignacio; Phillips, Meridel; Porter, Cheryl; Raymundo, Rubi M; Sands, Ronald D; Schleussner, Carl-Friedrich; Valdivia, Roberto O; Valin, Hugo; Wiebe, Keith
2018-05-13
The Agricultural Model Intercomparison and Improvement Project (AgMIP) has developed novel methods for Coordinated Global and Regional Assessments (CGRA) of agriculture and food security in a changing world. The present study aims to perform a proof of concept of the CGRA to demonstrate advantages and challenges of the proposed framework. This effort responds to the request by the UN Framework Convention on Climate Change (UNFCCC) for the implications of limiting global temperature increases to 1.5°C and 2.0°C above pre-industrial conditions. The protocols for the 1.5°C/2.0°C assessment establish explicit and testable linkages across disciplines and scales, connecting outputs and inputs from the Shared Socio-economic Pathways (SSPs), Representative Agricultural Pathways (RAPs), Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) and Coupled Model Intercomparison Project Phase 5 (CMIP5) ensemble scenarios, global gridded crop models, global agricultural economics models, site-based crop models and within-country regional economics models. The CGRA consistently links disciplines, models and scales in order to track the complex chain of climate impacts and identify key vulnerabilities, feedbacks and uncertainties in managing future risk. CGRA proof-of-concept results show that, at the global scale, there are mixed areas of positive and negative simulated wheat and maize yield changes, with declines in some breadbasket regions, at both 1.5°C and 2.0°C. Declines are especially evident in simulations that do not take into account direct CO 2 effects on crops. These projected global yield changes mostly resulted in increases in prices and areas of wheat and maize in two global economics models. Regional simulations for 1.5°C and 2.0°C using site-based crop models had mixed results depending on the region and the crop. In conjunction with price changes from the global economics models, productivity declines in the Punjab, Pakistan, resulted in
Energy Technology Data Exchange (ETDEWEB)
Liu, Hongwei [The Australia Centre Microscopy and Microanalysis, The University of Sydney, NSW, 2006 (Australia); Liu, Jiangwen, E-mail: mejwliu@scut.edu.cn [School of Materials Science and Engineering, South China University of Technology, Guangzhou, 510640 (China); Luo, Chengping [School of Materials Science and Engineering, South China University of Technology, Guangzhou, 510640 (China); Liu, Zhijian [Guangdong Research Institute of Iron and Steel, Guangzhou, 510640 (China)
2016-07-05
The microstructure and crystallographic features of a semi-austenitic precipitation hardening steel PH 15-7Mo during solution treatment, roddrawing and aging were investigated by means of optical microscope, X-ray diffraction analyzer and transmission electron microscope. It was found that the microstructure of the steel was consist of dominant austenite, small amount of martensite and 10–15 vol.% δ-ferrite after solution treatment at 1050 °C followed by cooling in water at room temperature. The austenite transformed into lath martensite during tensile roddrawing about 60% deforming companied with some coherent fine β-NiAl particles precipitated within martensite. With higher aging temperature and longer holding time, tiny carbide M{sub 23}C{sub 6} particles precipitated from martensite, which kept the cubic–cubic orientation relationship (OR) with austenite and G-T OR with martensite which is different with all the reported orientations. The OR between tiny carbide M{sub 23}C{sub 6} particles G-T OR with martensite was discussed in terms of crystallography of phase transformations. - Highlights: • Microstructure changes of austenitic steel PH15-7Mo were due to alloying elements, service condition and carbide M{sub 23}C{sub 6}. • Lath-shape martensitic laths keep pseudo {112} twinning relationship. • β-NiAl particles hold a typical cubic-to-cubic orientation relationship with martensite. • M{sub 23}C{sub 6} carbide kept a cubic–cubic orientation relationship (OR) with austenite and an unusual G-T OR with martensite. • Multiple orientation relationship between M{sub 23}C{sub 6} and austenite is correlative with their structural similarity.
Capture cross-section and rate of the 14 C (n, γ) 15 C reaction from ...
Indian Academy of Sciences (India)
We calculate the Coulomb dissociation of 15C on a Pb target at 68 MeV/u incident beam energy within the fully quantum mechanical distorted wave Born approximation formalism of breakup reactions. The capture cross-section and the subsequent rate of the 14C(, )15C reaction are calculated from the ...
International Nuclear Information System (INIS)
Stein, F.; He, C.; Wossack, I.
2014-01-01
Highlights: • Liquidus surface and reaction scheme of the Cr–Al–Nb system experimentally determined. • Solidification paths of the ternary alloys derived from as-cast microstructures. • Compositions and temperatures of the invariant points. • Revised versions of the phase diagrams of the Cr–Nb and Al–Cr boundary systems. - Abstract: The liquidus surface and corresponding reaction scheme of the ternary Cr–Al–Nb system were determined experimentally. The solidification paths of a series of more than 40 ternary alloys were deduced from investigation of their as-cast microstructures and measurement of all reaction temperatures applying scanning electron microscopy (SEM), electron probe microanalysis (EPMA), X-ray diffraction (XRD), and differential thermal analysis (DTA). The hexagonal C14-type Laves phase Nb(Cr,Al) 2 , which is not stable in any of the binary boundary systems and which is the only ternary compound, forms the most extended primary crystallization field of the ternary system dominating the centre of the liquidus surface. A ternary eutectic was found near the Al–Nb boundary composed of the three intermetallic phases C14 + Nb 2 Al + NbAl 3 . Besides the ternary liquidus surface, the solidus and liquidus curves of the Cr–Nb boundary system and of the Cr-rich part of the Al–Cr system were determined resulting in revised binary phase diagrams
Arctic sea ice at 1.5 and 2 °C
Screen, James A.
2018-05-01
In the Paris Agreement, nations committed to a more ambitious climate policy target, aiming to limit global warming to 1.5 °C rather than 2 °C above pre-industrial levels. Climate models now show that achieving the 1.5 °C goal would make a big difference for Arctic sea ice.
Final Report of Tank 241-C-105 Dissolution, the Phase 2 Study
International Nuclear Information System (INIS)
Meznarich, Huei K.; Bolling, Stacey D.; Cooke, Gary A.; Ely, Thomas M.; Herting, Daniel L.; Lachut, James S.; LaMothe, Margaret E.
2016-01-01
Three clamshell grab samples were taken from Tank 241-C-105 in October 2015 in accordance with RPP-PLAN-60011. Analytical results of those samples were issued in the report RPP-RPT-59115 by Wastren Advantage, Inc., Hanford Laboratory. Solid phase characterization results were reported separately in LAB-RPT-15-00011 and in RPP-RPT-59147. The major solid phases reported to be present were dawsonite [NaAlCO 3 (OH) 2 ], trona [Na 3 (HCO 3 )(CO 3 )⋅2H 2 O], cejkaite [Na 4 (UO 2 )(CO 3 ) 3 ], and an unidentified organic solid, with minor amounts of gibbsite [Al(OH) 3 ], natrophosphate [Na 7 F(PO 4 ) 2 ⋅19H 2 O], and traces of unidentified iron-rich and manganese-rich phases. Note that the presence of dawsonite, trona, and cejkaite requires a relatively low pH, likely around pH 9 to 10. One aliquot of each grab sample was provided to 222-S Laboratory Process Chemistry for dissolution studies. Phase 1 of the dissolution testing followed the approved test plan, WRPS-1404813, Rev. 3, and examined the behavior of the Tank 241-C-105 solids treated with water, 19M sodium hydroxide, 2M nitric acid, and 0.5M oxalic acid/2M nitric acid. Phase 2 of the testing was conducted in accordance with instructions from the client and emphasized treatment with 19M sodium hydroxide followed by water washing. This is the report of the Phase 2 testing.
Precise zero-sound velocity measurements in the A and A1 phases of 3He near T/sub c/
International Nuclear Information System (INIS)
Berg, R.F.; Ihas, G.G.
1983-01-01
The authors have made phase-velocity change measurements for 5 and 15 MHz zero sound within a few microkelvin of the 3 He superfluid transition, T/sub c/, at 31.1 bar. The results show no marked feature at homega = 2Δ(T). However, there is a marked reduction in the slope of dc/dT upon passing from the A-phase into the Al-phase. 2 references
Global drought and severe drought-affected populations in 1.5 and 2 °C warmer worlds
W. Liu; F. Sun; F. Sun; F. Sun; F. Sun; W. H. Lim; W. H. Lim; J. Zhang; H. Wang; H. Shiogama; Y. Zhang
2018-01-01
The 2015 Paris Agreement proposed a more ambitious climate change mitigation target on limiting global warming to 1.5 °C instead of 2 °C above preindustrial levels. Scientific investigations on environmental risks associated with these warming targets are necessary to inform climate policymaking. Based on the Coupled Model Intercomparison Project phase 5 (CMIP5) climate models, we present the first risk-based assessment of changes in global drought and the impact of severe drou...
Extreme heat waves under 1.5 °C and 2 °C global warming
Dosio, Alessandro; Mentaschi, Lorenzo; Fischer, Erich M.; Wyser, Klaus
2018-05-01
Severe, extreme, and exceptional heat waves, such as those that occurred over the Balkans (2007), France (2003), or Russia (2010), are associated with increased mortality, human discomfort and reduced labour productivity. Based on the results of a very high-resolution global model, we show that, even at 1.5 °C warming, a significant increase in heat wave magnitude is expected over Africa, South America, and Southeast Asia. Compared to a 1.5 °C world, under 2 °C warming the frequency of extreme heat waves would double over most of the globe. In a 1.5 °C world, 13.8% of the world population will be exposed to severe heat waves at least once every 5 years. This fraction becomes nearly three times larger (36.9%) under 2 °C warming, i.e. a difference of around 1.7 billion people. Limiting global warming to 1.5 °C will also result in around 420 million fewer people being frequently exposed to extreme heat waves, and ~65 million to exceptional heat waves. Nearly 700 million people (9.0% of world population) will be exposed to extreme heat waves at least once every 20 years in a 1.5 °C world, but more than 2 billion people (28.2%) in a 2 °C world. With current emission trends threatening even the 2 °C target, our study is helpful to identify regions where limiting the warming to 1.5 °C would have the strongest benefits in reducing population exposure to extreme heat.
International Nuclear Information System (INIS)
Sun, Song; Ye, Rongchang; Long, Yi
2013-01-01
Graphical abstract: M–T curves show that all the compounds undergo a ferromagnetic–paramagnetic magnetic phase transition process. Besides, the Curie temperature T c of La(Fe 1−x Ni x ) 11.5 Si 1.5 (x = 0, 0.01, 0.02, 0.03) compounds increase monotonously from 195 K to 219 K when Ni content x varies from 0 to 0.03. Highlights: ► We substituted Fe by new element Ni in La(Fe 1−x Ni x ) 11.5 Si 1.5 compounds. ► The microstructure evolution, magnetic phase transition and Curie temperature of La(Fe 1−x Ni x ) 11.5 Si 1.5 compounds were investigated. ► The small substitution of Ni for Fe in La(Fe 1−x Ni x ) 11.5 Si 1.5 compounds enhances the formation of 1:13 phase and helps the elimination of impurity phase significantly. ► The Curie temperature T C of La(Fe 1−x Ni x ) 11.5 Si 1.5 compounds increase monotonously from 195 K to 219 K when x varies from 0 to 0.03. - Abstract: The influence of Ni substitution on the microstructure evolution and magnetic phase transition has been investigated in La(Fe 1−x Ni x ) 11.5 Si 1.5 (x = 0, 0.01, 0.02, 0.03) compounds. Results show that partial substitution of Ni for Fe in La(Fe 1−x Ni x ) 11.5 Si 1.5 (x = 0, 0.01, 0.02, 0.03) alloys promotes fining of the as-cast microstructure. Besides, the formation of 1:13 phase and the elimination of impurity phases is facilitated significantly when annealed at 1373 K for 5 days. Large amounts of inhomogeneities are present in the annealed LaFe 11.5 Si 1.5 alloy. While almost single 1:13 phase is obtained in La(Fe 1−x Ni x ) 11.5 Si 1.5 (x = 0.02, 0.03) alloys. Moreover, the Curie temperature T C of La(Fe 1−x Ni x ) 11.5 Si 1.5 (x = 0, 0.01, 0.02, 0.03) compounds increase monotonously from 195 K to 219 K when Ni content x varies from 0 to 0.03.
Martin, Gary E; Hilton, Bruce D; Irish, Patrick A; Blinov, Kirill A; Williams, Antony J
2007-10-01
Utilization of long-range (1)H--(15)N heteronuclear chemical shift correlation has continually grown in importance since the first applications were reported in 1995. More recently, indirect covariance NMR methods have been introduced followed by the development of unsymmetrical indirect covariance processing methods. The latter technique has been shown to allow the calculation of hyphenated 2D NMR data matrices from more readily acquired nonhyphenated 2D NMR spectra. We recently reported the use of unsymmetrical indirect covariance processing to combine (1)H--(13)C GHSQC and (1)H--(15)N GHMBC long-range spectra to yield a (13)C--(15)N HSQC-HMBC chemical shift correlation spectrum that could not be acquired in a reasonable period of time without resorting to (15)N-labeled molecules. We now report the unsymmetrical indirect covariance processing of (1)H--(13)C GHMBC and (1)H--(15)N IMPEACH spectra to afford a (13)C--(15)N HMBC-IMPEACH spectrum that has the potential to span as many as six to eight bonds. Correlations for carbon resonances long-range coupled to a protonated carbon in the (1)H--(13)C HMBC spectrum are transferred via the long-range (1)H--(15)N coupling pathway in the (1)H--(15)N IMPEACH spectrum to afford a much broader range of correlation possibilities in the (13)C--(15)N HMBC-IMPEACH correlation spectrum. The indole alkaloid vincamine is used as a model compound to illustrate the application of the method. (c) 2007 John Wiley & Sons, Ltd.
International Nuclear Information System (INIS)
Gonzalez-Perez, A.; Ruso, J.M.; Nimo, J.; Rodriguez, J.R.
2003-01-01
Density measurements of dodecyl- (C 12 DBACl), tetradecyl- (C 14 DBACl), hexadecyldimethylbenzylammonium chloride (C 16 DBACl) and of decyl- (C 10 DBABr) and dodecyldimethylbenzylammonium bromide (C 12 DBABr) in aqueous solutions at T=15 deg. C and T=25 deg. C have been carried out. From these results, apparent and partial molar volumes were calculated. Positive deviations from the Debye-Hueckel limiting law provide evidence for limited association at concentrations below the critical micelle concentration. The change of the apparent molar volume upon micellization was calculated. The relevant parameters have been presented in function of the alkyl chain length. Apparent molar volumes of the present compounds in the micellar phase, V phi m , and the change upon micellization, ΔV phi m , have been discussed in terms of temperature and type of counterion
Directory of Open Access Journals (Sweden)
Wayan Bebas
2015-08-01
Full Text Available The aims of this study were to determine the viability and motility of Landrace pig’sspermatozoa in the Beltsville Thawing Solution (BTS diluent with addition vitamin C which werestored at a temperature of 15ºC. During the storage process, metabolic activity of spermatozoaproduce free radicals that can reduce the viability and motility of spermatozoa thus it needs theaddition of antioxidants. Vitamin C is an antioxidant that can be used to scavengethe free radicals.This study used vitamin C added into the BTS diluent with scavenge dose is 0.1 mg/ml, 0.2 mg/mland a dose of 0.3 mg/ml. The results showed that a dose of 0.1 mg/ml is the best dose to maintainthe viability and motility of Landrace pigs spermatozoa were storage at a temperature of 15ºC.
Isotopic separation of nitrogen 15. Influence of the gaseous phase composition
International Nuclear Information System (INIS)
Lacoste, Germain; Routie, Rene; Mahenc, Jean
1977-01-01
A study has been made on the gas phase composition effect on the isotopic separation of nitrogen 15 for the two HNO 3 -NO and N 2 O 3 -NO systems. It was shown that the changes in composition of the gas phases could account for the increase in the overall separation; most accuracy, measurements of isotopic concentration along the separation column and of total enrichment exhibit how important are the reactions of oxydo-reduction between the two phases in such process [fr
High-energy neutron irradiation of superconducting compounds
International Nuclear Information System (INIS)
Sweedler, A.R.; Snead, C.L.; Newkirk, L.; Valencia, F.; Geballe, T.H.; Schwall, R.H.; Matthias, B.T.; Corenswit, E.
1975-01-01
The effect of high-energy neutron irradiation (E greater than 1 MeV) at ambient reactor temperatures on the superconducting properties of a variety of superconducting compounds is reported. The materials studied include the A-15 compounds Nb 3 Sn, Nb 3 Al, Nb 3 Ga, Nb 3 Ge and V 3 Si, the C-15 Laves phase HfV 2 , the ternary molybdenum sulfide Mo 3 Pb 0 . 5 S 4 and the layered dichalcogenide NbSe 2 . The superconducting transition temperature has been measured for all of the above materials for neutron fluences up to 5 x 10 19 n/cm 2 . The critical current for multifilamentary Nb 3 Sn has also been determined for fields up to 16 T and fluences between 3 x 10 17 n/cm 2 and 1.1 x 10 19 n/cm 2
Acoustic emission during R-phase and martensitic transformations in a Ti50.2Ni48.3Fe1.5 alloy
International Nuclear Information System (INIS)
Takashima, K.; Nishida, M.
1995-01-01
Acoustic emission (AE) signals generated during phase transformations in a Ti 50.2 Ni 48.3 Fe 1.5 shape memory alloy have been measured, and the AE parameters have been correlated with the phase transformation events. The AE count rate curve during cooling of the specimen was found to have two distinct peaks at temperatures of approximately 8 and -30 C. These peaks were confirmed by both optical microscopy and differential scanning calorimetry to correspond to the B2 to R phase transformation (at 8 C) and the R to B19' transformation (at -30 C) respectively. This is the first detection of the AE events associated with the R-phase transformation in Ti-Ni shape memory alloys. Although the amplitude distributions during both transformations were almost identical, both the duration and the rise time of AE events during the B2 to R phase transformation were larger than those during the R to B19' transformation. These observations suggest that the transformation velocity of the R-phase transformation is slower than that of the martensitic transformation, and are consistent with the nature of both these transformations. It is concluded that the AE technique can be applied to the determination of transformation temperatures of Ti-Ni alloys on cooling as well as DSC and electrical resistivity measurement. (orig.)
Final Report of Tank 241-C-105 Dissolution, the Phase 2 Study
Energy Technology Data Exchange (ETDEWEB)
Meznarich, Huei K. [Washington River Protection Solutions LLC., Richland, WA (United States); bolling, Stacey D. [Washington River Protection Solutions LLC., Richland, WA (United States); Cooke, Gary A. [Washington River Protection Solutions LLC., Richland, WA (United States); Ely, Thomas M. [Washington River Protection Solutions LLC., Richland, WA (United States); Herting, Daniel L. [Washington River Protection Solutions LLC., Richland, WA (United States); Lachut, James S. [Washington River Protection Solutions LLC., Richland, WA (United States); LaMothe, Margaret E. [Washington River Protection Solutions LLC., Richland, WA (United States)
2016-10-01
Three clamshell grab samples were taken from Tank 241-C-105 in October 2015 in accordance with RPP-PLAN-60011. Analytical results of those samples were issued in the report RPP-RPT-59115 by Wastren Advantage, Inc., Hanford Laboratory. Solid phase characterization results were reported separately in LAB-RPT-15-00011 and in RPP-RPT-59147. The major solid phases reported to be present were dawsonite [NaAlCO3(OH)2], trona [Na3(HCO3)(CO3)·2H2O], cejkaite [Na4(UO2)(CO3)3], and an unidentified organic solid, with minor amounts of gibbsite [Al(OH)3], natrophosphate [Na7F(PO4)2·19H2O], and traces of unidentified iron-rich and manganese-rich phases. Note that the presence of dawsonite, trona, and cejkaite requires a relatively low pH, likely around pH 9 to 10. One aliquot of each grab sample was provided to 222-S Laboratory Process Chemistry for dissolution studies. Phase 1 of the dissolution testing followed the approved test plan, WRPS-1404813, Rev. 3, and examined the behavior of the Tank 241-C-105 solids treated with water, 19M sodium hydroxide, 2M nitric acid, and 0.5M oxalic acid/2M nitric acid. Phase 2 of the testing was conducted in accordance with instructions from the client and emphasized treatment with 19M sodium hydroxide followed by water washing. This is the report of the Phase 2 testing.
Distribution of spin dipole transition strength in the 15N(n,p)15C reaction
International Nuclear Information System (INIS)
Cellar, A.; Alford, W.P.; Helmer, R.; Abegg, R.; Frekers, D.; Haeusser, O.; Henderson, R.S.; Jackson, K.P.; Vetterli, M.; Yen, S.; Jeppesen, R.; Larson, B.; Mildenberger, J.; Pointon, B.W.; Trudel, A.
1990-08-01
The reaction 15 N(n,p) 15 C was studied at a neutron energy of 288 MeV using the TRIUMF (n,p) charge exchange facility and a high pressure gas target. The angular distributions for spin dipole (ΔL=1) transitions to the states in 15 C at energies 0 MeV and 0.740 MeV, as well as for higher excitation energies, were measured and the results were compared with DWIA calculations. The measured distribution of the spin dipole strength agrees well with shell model predictions, indicating that a rather simple model provides a satisfactory description of the 15 N ground state, and of positive parity states in 15 C up to about 18 MeV excitation. The magnitude of the peak cross sections (at ≅ 7 degrees) is described well by the calculations when the theoretical cross section is renormalized by a factor 0.7. The calculated cross sections near zero degrees are generally smaller than experimental data. It this is a general feature of ΔL=1 transitions, it suggests that estimates of GT strength based on a multipole decomposition of measured cross sections may be too high. (Author) (41 refs., 3 tabs., 14 figs.)
Xing, Jia; Wei, Yinghui; Hou, Lifeng
2018-04-01
In this review, the influences of alloying elements on the phase constitution, density, and stacking fault energy of Fe-(15-35) Mn-(5-12) Al-(0.3-1.2) C lightweight steel are discussed. The mechanical properties of austenite single-phase and austenite-ferrite dual-phase Fe-Mn-Al-C steels processed by different procedures are also statistically analyzed. The austenite single-phase steel was found to possess superior strength and plasticity. Three reasonable explanations for the mechanism of plastic deformation are presented, namely, shear band-induced plasticity, microband-induced plasticity, and slip band refinement-induced plasticity.
Australian climate extremes at 1.5 °C and 2 °C of global warming
King, Andrew D.; Karoly, David J.; Henley, Benjamin J.
2017-06-01
To avoid more severe impacts from climate change, there is international agreement to strive to limit warming to below 1.5 °C. However, there is a lack of literature assessing climate change at 1.5 °C and the potential benefits in terms of reduced frequency of extreme events. Here, we demonstrate that existing model simulations provide a basis for rapid and rigorous analysis of the effects of different levels of warming on large-scale climate extremes, using Australia as a case study. We show that limiting warming to 1.5 °C, relative to 2 °C, would perceptibly reduce the frequency of extreme heat events in Australia. The Australian continent experiences a variety of high-impact climate extremes that result in loss of life, and economic and environmental damage. Events similar to the record-hot summer of 2012-2013 and warm seas associated with bleaching of the Great Barrier Reef in 2016 would be substantially less likely, by about 25% in both cases, if warming is kept to lower levels. The benefits of limiting warming on hydrometeorological extremes are less clear. This study provides a framework for analysing climate extremes at 1.5 °C global warming.
Synthesis of (+-)-[1,1'-15N2, 2'-13C]-trans-3'-methylnicotine
International Nuclear Information System (INIS)
Sirimanne, S.R.; Maggio, V.L.; Patterson, D.G. Jr.
1992-01-01
The synthesis of (±)- [1,1'- 15 N 2 , 2'- 13 C]-trans-3'-methylnicotine is reported. 15 N-3-Bromopyridine obtained from bromination of pyridine was formylated with nBuLi/[carbonyl- 13 C]-methyl formate. The resulting 15 n-Pyridine-3-[ 13 C-carbonyl]-carboxaldehyde was reacted with 15 N-methylamine and then the resulting Schiff's base was condensed with succinic anhydride to give (±)- [1,1'- 15 N 2 , 5'- 13 C]-trans-4'-carboxycotinine. Reduction with lithium aluminum hydride and mesylation followed by reduction with Zn/NaI gave (±)-[1,1'- 15 N 2 , 2'- 13 C]-trans-3'-methylnicotine. (Author)
The effect of phase constituent on the magnetic properties for melt-spun Nd15Fe77B8 ribbons
International Nuclear Information System (INIS)
Sun Wensheng; Li Shandong; Quan Mingxiu
1997-01-01
Some acicular Nd 2 Fe 14 B grains are precipitated from Nd-rich phase near-coarse grains in melt-spun Nd 15 Fe 77 B 8 alloy, as confirmed by SEM energy spectral analysis. The Nd-rich phase plays an important role in enhancing magnetic properties on annealing. This result suggests that the melted Nd-rich phase may act as a sink for free iron to be captured within Nd-rich phase regions resulting in the decreased iron constituent and enhanced magnetic properties at the annealing temperature at which the Nd-rich phase is melted. After an optimized heat treatment, the higher magnetic properties with ultrahigh coercivity H c , 1400 kAm -1 , and maximum energy product (BH) max , 89 kJm -3 , are obtained. The initial magnetization curves of melt-spun samples are composed of multi-domain and single-domain magnetization processes. (orig.)
Second phase in steel AISI 316 tested at 8000C
International Nuclear Information System (INIS)
Silveira, V.L.A.; Monteiro, S.N.
The nature of second phases in type 316 stainless steel samples tested in creep to rupture at 800 0 C has been discussed. These phases were identified by experimental techniques completed with the available information in the literature. The role of these phases in the creep properties of the type 316 steel at 800 0 C is analysed [pt
Experimental investigation of densification of powdered A15 phase in the system Nb--Al--Ge
International Nuclear Information System (INIS)
Modi, D.P.
1976-02-01
An investigation of the densification of precompounded powder of the A15 phase Nb 3 (Al,Ge) was made. The influence of various parameters such as additives, temperature, pressure and time in sintering of this material was studied. Since cold pressing followed by sintering did not produce sufficient density, the hot pressing technique was used. By hot pressing at 1450 0 C for 1 / 2 hour under 6 ksi pressure, about 95 percent densification was achieved. Results provide information that could lead to the development of a viable process for producing superconductors based on this compound. 14 figures, 17 references
Arctic Sea Ice in a 1.5°C Warmer World
Niederdrenk, Anne Laura; Notz, Dirk
2018-02-01
We examine the seasonal cycle of Arctic sea ice in scenarios with limited future global warming. To do so, we analyze two sets of observational records that cover the observational uncertainty of Arctic sea ice loss per degree of global warming. The observations are combined with 100 simulations of historical and future climate evolution from the Max Planck Institute Earth System Model Grand Ensemble. Based on the high-sensitivity observations, we find that Arctic September sea ice is lost with low probability (P≈ 10%) for global warming of +1.5°C above preindustrial levels and with very high probability (P> 99%) for global warming of +2°C above preindustrial levels. For the low-sensitivity observations, September sea ice is extremely unlikely to disappear for +1.5°C warming (P≪ 1%) and has low likelihood (P≈ 10%) to disappear even for +2°C global warming. For March, both observational records suggest a loss of 15% to 20% of Arctic sea ice area for 1.5°C to 2°C global warming.
Intermetallic Strengthened Alumina-Forming Austenitic Steels for Energy Applications
Energy Technology Data Exchange (ETDEWEB)
Hu, Bin [Dartmouth College, Hanover, NH (United States); Baker, Ian [Dartmouth College, Hanover, NH (United States)
2016-03-31
In order to achieve energy conversion efficiencies of >50 % for steam turbines/boilers in power generation systems, the materials required must be strong, corrosion-resistant at high temperatures (>700°C), and economically viable. Austenitic steels strengthened with Laves phase and L12 precipitates, and alloyed with aluminum to improve oxidation resistance, are potential candidate materials for these applications. The creep resistance of these alloys is significantly improved through intermetallic strengthening (Laves-Fe2Nb + L12-Ni3Al precipitates) without harmful effects on oxidation resistance. Microstructural and microchemical analyses of the recently developed alumina-forming austenitic (AFA) steels (Fe-14Cr-32Ni-3Nb-3Al-2Ti-based) indicated they are strengthened by Ni3Al(Ti) L12, NiAl B2, Fe2Nb Laves phase and MC carbide precipitates. Different thermomechanical treatments (TMTs) were performed on these stainless steels in an attempt to further improve their mechanical properties. The thermo-mechanical processing produced nanocrystalline grains in AFA alloys and dramatically increased their yield strength at room temperature. Unfortunately, the TMTs didn’t increase the yield strengths of AFA alloys at ≥700ºC. At these temperatures, dislocation climb is the dominant mechanism for deformation of TMT alloys according to strain rate jump tests. After the characterization of aged AFA alloys, we found that the largest strengthening effect from L12 precipitates can be obtained by aging for less than 24 h. The coarsening behavior of the L12 precipitates was not influenced by carbon and boron additions. Failure analysis and post-mortem TEM analysis were performed to study the creep failure mechanisms of these AFA steels after creep tests. Though the Laves and B2-NiAl phase precipitated along the boundaries can improve the creep properties, cracks were
A comparative study of the Aurivillius phase ferroelectrics CaBi 4Ti 4O 15 and BaBi 4Ti 4O 15
Tellier, J.; Boullay, Ph.; Manier, M.; Mercurio, D.
2004-06-01
The room temperature structures of the four-layer Aurivillius phase ferroelectrics CaBi 4Ti 4O 15 and BaBi 4Ti 4O 15 are determined by means of single crystal X-ray diffraction. Regarding the CaBi 4Ti 4O 15 phase, in agreement with the tolerance factor, a significant deformation of the perovskite blocks is observed. The rotation system of the octahedra is typical from even layer Aurivillius phases and leads to the use of the space group A2 1am. For the BaBi 4Ti 4O 15 phase, only a weak variation with respect to the F2 mm space group can be suggested from single crystal X-ray diffraction. A significant presence of Ba atoms in the [ M2O 2] slabs is confirmed in agreement with the previous works but specific Ba 2+ and Bi 3+ sites have to be considered due to the large difference in bounding requirement of these cations. Possible origins for the ferroelectric relaxor behavior of the Ba-based compound are discussed in view of the presented structural analyses.
Projected drought risk in 1.5°C and 2°C warmer climates
Lehner, F.; Coats, S.; Stocker, T. F.; Pendergrass, A. G.; Sanderson, B. M.; Raible, C.; Smerdon, J. E.
2017-12-01
The large socioeconomic costs of droughts make them a crucial target for impact assessments of climate change scenarios. Using multiple drought metrics and a set of simulations with the Community Earth System Model (CESM) targeting 1.5°C and 2°C above preindustrial global mean temperatures, we investigate changes in aridity and the risk of consecutive drought years. The latter metric is motivated by recent droughts in California and the US Southwest in general, where consecutive years of moderate precipitation deficit can quickly lead to significant drought and elevated pressure on water resources. If warming is limited to 2°C, these simulations suggest little change in drought risk for the U.S. Southwest and Central Plains compared to present day, an interesting result that arises from a delicate balance between increases in evaporative demand and precipitation in CESM in that region. In the Mediterranean, central Europe, and a number of other regions across the globe, however, drought risk increases significantly for both 1.5°C and 2°C warming targets, and the additional 0.5°C of the 2°C climate leads to significantly higher drought risk. Our study suggests that limiting anthropogenic warming to 1.5°C rather than 2°C, as aspired to by the Paris Climate Agreement, may have benefits for future drought risk but that such benefits may be regional and in some cases highly uncertain. We will therefore also discuss the robustness of results across different drought metrics as well as the model uncertainties associated with drought projections for low warming targets.
Elasticity of phase-Pi (Al3Si2O7(OH)3) - A hydrous aluminosilicate phase
Peng, Ye; Mookherjee, Mainak; Hermann, Andreas; Bajgain, Suraj; Liu, Songlin; Wunder, Bernd
2017-08-01
Phase-Pi (Al3Si2O7(OH)3) is an aluminosilicate hydrous mineral and is likely to be stable in hydrated sedimentary layers of subducting slabs. Phase-Pi is likely to be stable between the depths of 60 and 200 km and is likely to transport water into the Earth's interior. Here, we use first principles simulations based on density functional theory to explore the crystal structure at high-pressure, equation of state, and full elastic stiffness tensor as a function of pressure. We find that the pressure volume results could be described by a finite strain fit with V0 , K0 , and K0‧ being 310.3 Å3, 133 GPa, and 3.6 respectively. At zero pressure, the full elastic stiffness tensor shows significant anisotropy with the diagonal principal components C11 , C22 , and C33 being 235, 292, 266 GPa respectively, the diagonal shear C44 , C55 , and C66 being 86, 92, and 87 GPa respectively, and the off-diagonal stiffness C12 , C13 , C14 ,C15 , C16 , C23 , C24 , C25 , C26 , C34 , C35 , C36 , C45 , C46 , and C56 being 73, 78, 6, -30, 15, 61, 17, 2, 1, -13, -15, 6, 3, 1, and 3 GPa respectively. The zero pressure, shear modulus, G0 and its pressure derivative, G0 ‧ are 90 GPa and 1.9 respectively. Upon compression, hydrogen bonding in phase-Pi shows distinct behavior, with some hydrogen bonds weakening and others strengthening. The latter eventually undergo symmetrization, at pressure greater (>40 GPa) than the thermodynamic stability of phase-Pi. Full elastic constant tensors indicate that phase-Pi is very anisotropic with AVP ∼22.4% and AVS ∼23.7% at 0 GPa. Our results also indicate that the bulk sound velocity of phase-Pi is slower than that of the high-pressure hydrous aluminosilicate phase, topaz-OH.
Crystal structure of the binder phase in a model HfC-TiC-Ni material
International Nuclear Information System (INIS)
Heiligers, Christiane; Neethling, Johannes H.
2008-01-01
The crystal structure of the binder phase in a model HfC-TiC-Ni sample produced by hot pressing is investigated. The nature of the binder depends on the amount of Hf and Ti that remains in solution with Ni after cooling. Four different crystal structures are identified by analysis of electron diffraction patterns obtained using transmission electron microscopy techniques and the composition of the phases determined by energy dispersive X-ray spectrometry. Three of the phases are cubic; Ni, Ni 3 (Ti,Hf) and Ni 23 (Ti,Hf) 6 with lattice parameters of 3.52 ± 0.05, 3.52 ± 0.03 and 10.70 ± 0.40 A, respectively. The hexagonal phase is an intermetallic Ni 3 Ti phase, with lattice parameters of a = b = 5.00 ± 0.20 A and c = 8.16 ± 0.20 A. The crystal structures are confirmed by simulations of the electron diffraction patterns using JEMS software
Complete fusion of the 12C+12O, 14N+12C and 15N+12C systems
International Nuclear Information System (INIS)
Conjeaud, M.; Gary, S.; Harar, S.; Wieleczko, J.P.
1978-01-01
Cross sections for evaporation residues following the complete fusion of the 12 C+ 12 C, 14 N+ 12 C and 15 N+ 12 C systems have been measured with a E-ΔE counter telescope in a wide range of incident energies. They are fairly well reproduced by evaporation calculations based on the statistical theory. The total fusion excitation function of the 12 C+ 12 C system shows strong structure, which is compared to the predictions of the reaction cross sections derived from coupled channel calculations and to the integrated inelastic cross sections. Critical angular momenta have been obtained from the fusion cross-section data and these values are discussed in the framework of compound nucleus and entrance channel effects. A striking difference is observed between the fusion cross sections of the 14 N+ 12 C and 15 N+ 12 C systems and shows the importance of the valence nucleons of colliding ions in the fusion process. A possible interpretation might be the influence of the yrast line of the compound nuclei. (Auth.)
Ta4AlC3: Phase determination, polymorphism and deformation
International Nuclear Information System (INIS)
Eklund, P.; Palmquist, J.-P.; Hoewing, J.; Trinh, D.H.; El-Raghy, T.; Hoegberg, H.; Hultman, L.
2007-01-01
Ta 4 AlC 3 , a new member of the M n+1 AX n -phase family, has been synthesized and characterized (n = 1-3; M = early transition metal; A A-group element; and X = C and/or N). Phase determination by Rietveld refinement of synchrotron X-ray diffraction data shows that Ta 4 AlC 3 belongs to the P6 3 /mmc space group with a and c lattice parameters of 3.10884 ± 0.00004 A and 24.0776 ± 0.0004 A, respectively. This is shown to be the α-polymorph of Ta 4 AlC 3 , with the same structure as Ti 4 AlN 3 . Lattice imaging by high-resolution transmission electron microscopy demonstrates the characteristic MAX-phase stacking of α-Ta 4 AlC 3 . Three modes of mechanical deformation of α-Ta 4 AlC 3 are observed: lattice bending, kinking and delamination
Deformation-induced phase transformation in 4H–SiC nanopillars
International Nuclear Information System (INIS)
Chen, Bin; Wang, Jun; Zhu, Yiwei; Liao, Xiaozhou; Lu, Chunsheng; Mai, Yiu-Wing; Ringer, Simon P.; Ke, Fujiu; Shen, Yaogen
2014-01-01
The deformation behaviour of single-crystal SiC nanopillars was studied by a combination of in situ deformation transmission electron microscopy and molecular dynamics simulations. An unexpected deformation-induced phase transformation from the 4H hexagonal structure to the 3C face-centred cubic structure was observed in these nanopillars at room temperature. Atomistic simulations revealed that the 4H to 3C phase transformation follows a stick–slip process with initiation and end stresses of 12.1–14.0 and 7.9–9.0 GPa, respectively. The experimentally measured stress of 9–10 GPa for the phase transformation falls within the range of these theoretical upper and lower stresses. The reasons for the phase transformation are discussed. The finding sheds light on the understanding of phase transformation in polytypic materials at low temperature
The Cu-Sb-Se phase system at temperatures between 350 and 700 degree C
DEFF Research Database (Denmark)
Karup-Møller, Sven
1999-01-01
Phase relations were determined in the Cu-Sb-Se phase system at 300o, 400o, 450o, 500o, 600o and 700oC. Five three-component phases are present at 300oC: permingeatite (Cu3SbSe4), phase A (Cu3SbSe3, the Se-equivalent to skinnerite Cu3SbS3), phase B (CuSbSe2, the Se-equivalent to chalcostibite Cu......SbS2), phase C (Cu5.04Sb35.9Se59.1) and phase D (Cu38.8Sb6.10Se55.1). An X-ray crystallographic study is currently in progress on phase C. Phase D is present in insufficient amounts for such a study. At 400oC phase C and D does not exist and at 500oC all solid ternary phase are absent. At 450oC two...
Energy Technology Data Exchange (ETDEWEB)
McCleskey, M; Mukhamedzhanov, A M; Trache, L; Tribble, R E; Banu, A; Eremenko, V; Goldberg, V Z; Lui, Y W; McCleskey, E; Roeder, B T; Spiridon, A; Carstoiu, F; Burjan, V; Hons, Z; Thompson, I J
2014-04-17
The 14C + n <--> 15C system has been used as a test case in the evaluation of a new method to determine spectroscopic factors that uses the asymptotic normalization coefficient (ANC). The method proved to be unsuccessful for this case. As part of this experimental program, the ANCs for the 15C ground state and first excited state were determined using a heavy-ion neutron transfer reaction as well as the inverse kinematics (d,p) reaction, measured at the Texas A&M Cyclotron Institute. The ANCs were used to evaluate the astrophysical direct neutron capture rate on 14C, which was then compared with the most recent direct measurement and found to be in good agreement. A study of the 15C SF via its mirror nucleus 15F and a new insight into deuteron stripping theory are also presented.
Schleussner, C. F.
2016-12-01
Robust appraisals of climate impacts at different levels of global-mean temperature increase are vital to guide assessments of dangerous anthropogenic interference with the climate system. By establishing 1.5°C as the long term temperature limit for global average temperature increase and inviting a special report of the IPCC on the impacts of 1.5°C, the Paris Agreement has put such assessments high on the post-Paris science agenda. Here I will present recent findings of climate impacts at 1.5°C, including extreme weather events, water availability, agricultural yields, sea-level rise and risk of coral reef loss. In particular, I will present findings from a recent study that attempts to differentiate between such impacts at warming levels of 1.5°¸C and 2°C above pre-industrial (Schleussner et al., 2016). By analyzing changes in indicators for 26 world regions as applicable, the study found regional dependent differences between a 1.5°C and 2°C warming. Regional hot-spots of change emerge with tropical regions bearing the brunt of the impacts of an additional 0.5°C warming. These findings highlight the importance of regional differentiation to assess both future climate risks and different vulnerabilities to incremental increases in global-mean temperature. Building on that analysis, I will discuss limitations of existing approaches to differentiate between warming levels and outline opportunities for future work on refining our understanding of the difference between impacts at 1.5°C and 2°C warming. ReferencesSchleussner, C.-F. et al. Differential climate impacts for policy relevant limits to global warming: the case of 1.5°C and 2°C. Earth Syst. Dyn. 7, 327-351 (2016).
International Nuclear Information System (INIS)
Sevov, S.C.; Corbett, J.D.
1993-01-01
The remaining phases in the Na-In system have been identified and characterized. The indium-richest is Na 15 In 27.4 , with a structure containing novel closo-In 16 clusters interconnected to two kinds of nido-In 11 units and isolated, 4-bonded atoms (Cmcm, Z = 8, a = 16.108 (4) Angstrom, b = 35.279 (8) Angstrom, c = 15.931 (3) Angstrom, R/R w = 0.041/0.044 at the indium-rich limits Na 15 In 27.54 ). Fractional occupancy of two atoms in cluster chain positions were found, one as a function of a narrow nonstoichiometry. The structure is related to that recently established for Na 7 In 11.8 . Resistivity and magnetic properties are consistent with a small (0.5-3.2%) excess of electrons relative to the calculated bonding requirements. The sodium-richest phase is the stable, diamagnetic, and weakly metallic Na 2 In, isostructural with Na 2 Tl (C222 1 , Z = 16, a = 13.855 (1) Angstrom, b = 8.836 (1) Angstrom, c = 11.762 (1) Angstrom, R/R w = 0.030/0.034). A corrected phase diagram is given. 21 refs., 5 figs., 5 tabs
Many-pion production in π+d reactions at 15 GeV/c
International Nuclear Information System (INIS)
Hagopian, V.; Gluch, D.; Hagopian, S.; Horne, C.P.; Jenkins, M.; Lannutti, J.E.; Williams, P.K.; Wind, B.; Cohn, H.O.; Bugg, W.M.; Condo, G.T.; Handler, T.; Hart, E.L.
1979-01-01
The average number of charged pions produced in π + d reactions at 15-GeV/c π + momentum is 3.6 +- 0.1 and the average number of π 0 's is 1.9 +- 0.2. The average number of π 0 's produced is essentially independent of the number of charged pions. About 45% of the events have four or more charged pions in the final state. The exclusive final states with four or more charged pions with zero or one π 0 are presented and compared with modified phase-space background computations. Other than the well-known resonances, such as the rho 0 , no new peaks have been observed. Coherently produced multipion systems with up to seven pions are also discussed. Detailed cross-section information for every final state is presented
Global drought and severe drought-affected populations in 1.5 and 2 °C warmer worlds
Directory of Open Access Journals (Sweden)
W. Liu
2018-03-01
Full Text Available The 2015 Paris Agreement proposed a more ambitious climate change mitigation target on limiting global warming to 1.5 °C instead of 2 °C above preindustrial levels. Scientific investigations on environmental risks associated with these warming targets are necessary to inform climate policymaking. Based on the Coupled Model Intercomparison Project phase 5 (CMIP5 climate models, we present the first risk-based assessment of changes in global drought and the impact of severe drought on populations from additional 1.5 and 2 °C warming conditions. Our results highlight the risk of drought on a global scale and in several hotspot regions such as the Amazon, northeastern Brazil, southern Africa and Central Europe at both 1.5 and 2 °C global warming relative to the historical period, showing increases in drought durations from 2.9 to 3.2 months. Correspondingly, more total and urban populations would be exposed to severe droughts globally (+132.5 ± 216.2 million and +194.5 ± 276.5 million total population and +350.2 ± 158.8 million and +410.7 ± 213.5 million urban populations in 1.5 and 2 °C warmer worlds and regionally (e.g., East Africa, West Africa and South Asia. Less rural populations (−217.7 ± 79.2 million and −216.2 ± 82.4 million rural populations in 1.5 and 2 °C warmer worlds would be exposed to severe drought globally under climate warming, population growth and especially the urbanization-induced population migration. By keeping global warming at 1.5 °C above the preindustrial levels instead of 2 °C, there is a decrease in drought risks (i.e., less drought duration, less drought intensity and severity but relatively more frequent drought and the affected total, urban and rural populations would decrease globally and in most regions. While challenging for both East Africa and South Asia, the benefits of limiting warming to below 1.5 °C in terms of global drought risk
Glass-forming ability and stability of ternary Ni-early transition metal (Ti/Zr/Hf) alloys
Energy Technology Data Exchange (ETDEWEB)
Basu, Joysurya [Department of Metallurgy, Indian Institute of Science, Bangalore 560 012 (India); Ranganathan, S. [Department of Metallurgy, Indian Institute of Science, Bangalore 560 012 (India)]. E-mail: rangu@met.iisc.ernet.in
2006-08-15
Four Ni-bearing Ti, Zr and Hf ternary alloys of nominal composition Zr{sub 41.5}Ti{sub 41.5}Ni{sub 17}, Zr{sub 25}Ti{sub 25}Ni{sub 50}, Zr{sub 41.5}Hf{sub 41.5}Ni{sub 17} and Ti{sub 41.5}Hf{sub 41.5}Ni{sub 17} were rapidly solidified in order to produce ribbons. The Zr-Ti-Ni and Ti-Hf-Ni alloys become amorphous, whereas the Zr-Hf-Ni alloy shows precipitation of a cubic phase. The devitrification of all three alloys was followed and the relative tendency to form nanoquasicrystals and cF96 phases analysed. The relative glass-forming ability of the alloys can be explained by taking into account their atomic size difference. Addition of Ni often leads to quasicrystallisation or quasicrystal-related phases. This can be explained by the atomic radius and heat of mixing of the constituent elements. The phases precipitated at the initial stages of crystallisation indicate the possible presence of Frank-Kasper polyhedral structure in the amorphous alloys. Structural analysis reveals that the Laves and the anti-Laves phases have the same polyhedral structural unit, which is similar to the structural characteristics of glass.
Mechanisms of improving the cyclic stability of V-Ti-based hydrogen storage electrode alloys
International Nuclear Information System (INIS)
Miao He; Wang Weiguo
2010-01-01
Research highlights: → The corrosion resistance of V-based phase is much lower than that of C14 Laves phase of V-Ti-based alloys. → The addition of Cr which mostly distributes in V-based phase can effectively increase the anti-corrosion ability of V-Ti-based alloys. → The addition of Cr which mostly distributes in V-based phase can effectively increase the anti-corrosion ability of V-Ti-based alloys. - Abstract: In this work, the mechanisms of improving the cyclic stability of V-Ti-based hydrogen storage electrode alloys were investigated systemically. Several key factors for example corrosion resistance, pulverization resistance and oxidation resistance were evaluated individually. The V-based solid solution phase has much lower anti-corrosion ability than C14 Laves phase in KOH solution, and the addition of Cr in V-Ti-based alloys can suppress the dissolution of the main hydrogen absorption elements of the V-based phase in the alkaline solution. During the charge/discharge cycling, the alloy particles crack or break into several pieces, which accelerates their corrosion/oxidation and increases the contact resistance of the alloy electrodes. Proper decreasing the Vickers hardness and enhancing the fracture toughness can increase the pulverization resistance of the alloy particles. The oxidation layer thickness on the alloy particle surface obviously increases during charge/discharge cycling. This deteriorates their electro-catalyst activation to the electrochemical reaction, and leads to a quick degradation. Therefore, enhancing the oxide resistance can obviously improve the cyclic stability of V-Ti-based hydrogen storage electrode alloys.
Energy Technology Data Exchange (ETDEWEB)
Diaz, Aaron A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Larche, Michael R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Mathews, Royce [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Neill, Kevin J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Baldwin, David L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Prowant, Matthew S. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Edwards, Matthew K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Chamberlin, Clyde E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2015-09-01
This Technical Letter Report (TLR) describes work conducted at the Pacific Northwest National Laboratory (PNNL) during FY 2015 on the under-sodium viewing (USV) PNNL project 58745, Work Package AT-15PN230102. This TLR satisfies PNNL’s M3AT-15PN2301027 milestone, and is focused on summarizing the design, development, and evaluation of a two-dimensional matrix phased-array probe referred to as serial number 3 (SN3). In addition, this TLR also provides the results from a performance demonstration of in-sodium target detection trials at 260°C using a one-dimensional 22-element linear array developed in FY14 and referred to as serial number 2 (SN2).
26 CFR 1.381(c)(15)-1 - Indebtedness of certain personal holding companies.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Indebtedness of certain personal holding companies. 1.381(c)(15)-1 Section 1.381(c)(15)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(15...
Dilkush; Mohammed, Raffi; Madhusudhan Reddy, G.; Srinivasa Rao, K.
2018-03-01
In the present study, an attempt has been made to weld Inconel 718 nickel-base superalloy (IN718 alloy) using gas tungsten arc welding (GTAW) and electron beam welding (EBW) processes. Both the weldments were subjected to post-weld heat treatment condition as follows -980°C / 20 min followed by direct aging condition (DA) as 720°C/8 h/FC followed by 620°C/8 h/AC. The GTA and EB welds of IN718 alloy were compared in two conditions as-received and 980STA conditions. Welds were characterized to observe mechanical properties, pitting corrosion resistance by correlating with observed microstructures. The rate of higher cooling ranges, the fusion zone of EBW exhibited discrete and relative finer lave phases whereas the higher niobium existed laves with coarser structure were observed in GTAW. The significant dissolution of laves were observed at 980STA of EBW. Due to these effects, the EBW of IN718 alloy showed the higher mechanical properties than GTAW. The electrochemical potentiostatic etch test was carried out in 3.5wt% sodium chloride (NaCl) solution to study the pitting corrosion behaviour of the welds. Results of the present investigation established that mechanical properties and pitting corrosion behaviour are significantly better in post weld heat treated condition. The comparative studies showed that the better combination of mechanical properties and pitting corrosion resistance were obtained in 980STA condition of EBW than GTAW.
Xu, Fujia; Lv, Yaohui; Liu, Yuxin; Xu, Binshi; He, Peng
Pulsed plasma arc deposition (PPAD) was successfully used to fabricate the Ni-based superalloy Inconel 625 samples. The effects of three heat treatment technologies on microstructure and mechanical properties of the as-deposited material were investigated. It was found that the as-deposited structure exhibited homogenous cellular dendrite structure, which grew epitaxially along the deposition direction. Moreover, some intermetallic phases including Laves phase and MC carbides were precipitated in the interdendritic region as a result of Nb segregation. Compared with the as-deposited microstructure, the direct aged (DA) microstructure changed little except the precipitation of hardening phases γ' and γ" (Ni3Nb), which enhanced the hardness and tensile strength. But the plastic property was inferior due to the existence of brittle Laves phase. After solution and aging heat treatment (STA), a large amount of Laves particles in the interdendritic regions were dissolved, resulting in the reduction of Nb segregation and the precipitation of needle-like δ (Ni3Nb) in the interdendritic regions and grain boundaries. The hardness and tensile strength were improved without sacrificing the ductility. By homogenization and STA heat treatment (HSTA), Laves particles were dissolved into the matrix completely and resulted in recrystallized large grains with bands of annealing twins. The primary MC particles and remaining phase still appeared in the matrix and grain boundaries. Compared with the as-deposited sample, the mechanical properties decreased severely as a result of the grain growth coarsening. The failure modes of all the tensile specimens were analyzed with fractography.
Neutron diffraction study of phase relationship of Ti-C-H system
International Nuclear Information System (INIS)
Khidirov, I.; Mukhtarova, N.N.; Mirzaev, B.B.; Serikbaev, B.T.; Zaginaichenko, S.Yu.; Schur, D.V.; Pishuk, V.K.; Kuzmenko, L.V.; Garbuz, V.V.; Nuzhda, S.V.; Pishuk, O.V.
2006-01-01
Full text: Due to such properties as high temperature of melting, solidity, stability in aggressive environments, etc., titanium carbide is widely used in modern techniques. It is necessary to know the phase relationships in Ti-C system for scientifically proved using. According to the phase diagram of Ti-C system, there are three phases in it: the solid solutions of carbon in the hexagonal lattice of α-Ti and in the body-centered cubic (BCC) lattice of β-Ti with rather limited solubility and also the face-centered cubic (FCC) titanium carbide TiC x with wide homogeneity range (TiC 0,32 / TiC 1,00 ). A number of the ordered phases was observed on the basis of FCC-phase. It is known, that even insignificant hydrogen impurity strongly influences at the phase relations in Ti-C system. At the same time because of specificity of some technologies of titanium carbide reception, it contains an impurity of hydrogen in its composition. However influence of hydrogen on phase relations of Ti-C system is not investigated enough. The aim of the work is to study hydrogen influence on the phase relations in Ti-C system by neutron (λ =1.085 A) and X-ray ( λ =1.5418 A) diffraction methods. Samples of TiC x H y (x = C/Ti, y H/Ti) were synthesized in the wide interval of carbon and hydrogen concentrations by sintering method from the powder of titanium of PTS trade-mark containing 0,35 mass % of hydrogen, by addition both of given quantity of TiH 2 and of soot of the trade-mark 'very pure'; the samples were studied by neutron and X-ray diffraction methods. Quartz ampoules with briquettes of the samples were pumped out up to vacuum of 1.33 10'-'4 Pa at the room temperature and were sintered in the furnace using the special regime selected by us. The briquettes were annealed from the temperature of 600 deg. C. As our experiments show, at this temperature the formation of Ti 2 C 1-x H 2-x solid solution and rapid absorption of hydrogen by this solution were observed. Also at this
International Nuclear Information System (INIS)
Eriksson, A.K.; Eriksson, S.G.; Chapon, L.C.; Knee, C.S.
2010-01-01
The oxygen deficient perovskites, Bi 0.15 Sr 0.85-x Ae x CoO 3-δ , x = 0 and Ae x = Ba 0.28 , Ca 0.17 , were studied with in-situ neutron powder diffraction and combined TGA/DSC in order to investigate their behaviour at elevated temperatures in oxidising conditions. The phase stability of the I4/mmm supercell structure adopted by Bi 0.15 Sr 0.85 CoO 3-δ is shown to be dependent on temperature and the oxygen content of the phase, with three structural events, at T ∼ 250, 590 and 880 o C, detected. The first transition occurs as the perovskite supercell vanishes due to oxygen absorption; the second transition is also associated with oxidation and involves the decomposition of the perovskite phase via an exothermic process to yield a dominant hexagonal phase. Finally, at T ∼ 900 o C the perovskite phase re-forms. For the Ba and Ca containing materials the decomposition to the hexagonal phase occurs at T ∼ 600 o C and ∼ 650 o C respectively. The presence of Ca at the A-site is found to stabilise the I4/mmm supercell structure in the range RT - 650 o C. The antiferromagnetic to paramagnetic transitions occur at T N ∼ 250 o C, T N ∼ 175 o C and T N ∼ 145 o C for the samples with Ae x = Ba 0.28 , x = 0 and Ae x = Ca 0.17 , respectively.
Zou, Hua; Zhu, Xiaoqin; Hu, Yifeng; Sui, Yongxing; Sun, Yuemei; Zhang, Jianhao; Zheng, Long; Song, Zhitang
2016-12-01
In general, there is a trade off between the phase change speed and thermal stability in chalcogenide phase change materials, which leads to sacrifice the one in order to ensure the other. For improving the performance, doping is a widely applied technological process. Here, we fabricated Er doped Sn15Sb85 thin films by magnetron sputtering. Compared with the pure Sn15Sb85, we show that Er doped Sn15Sb85 thin films exhibit simultaneous improvement over the thermal stability and the phase change speed. Thus, our results suggest that Er doping provides the opportunity to solve the contradiction. The main reason for improvement of both thermal stability and crystallization speed is due to the existence of Er-Sb and Er-Sn bonds in Er doped Sn15Sb85 films. Hence, Er doped Sn15Sb85 thin films are promising candidates for the phase change memory application, and this method could be extended to other lanthanide-doped phase change materials.
International Nuclear Information System (INIS)
Narsinga Rao, G; Chen, J W; Neeleshwar, S; Chen, Y Y; Wu, M K
2009-01-01
Structural, magnetic and electrical properties of the La 0.7 Ca 0.15 Sr 0.15 Mn 1-x Mo x O 3 (0 ≤ x ≤ 0.05) compounds have been investigated. Powder x-ray analysis reveals that the sample with x = 0 crystallizes in the rhombohedral (R 3-bar c) structure, whereas in the Mo doped samples the structure can be indexed by an orthorhombic (Pbnm) structure. The important observations of the magnetic and transport properties are: (i) the Mo substitution induces a distinct suppression of the metal-insulator (T MI ) and ferromagnetic (FM)-paramagnetic transition (T C ) and the temperature of T MI was found to be higher than T C in the Mo-doped samples, (ii) the substitution of Mo enhances the magnetoresistance at room temperature, (iii) a large deviation from the Curie-Weiss law well above T C in the Mo substituted samples indicates the existence of a Griffiths phase and (iv) long-range FM order persists in all samples with a linear decrease of saturation moment as x increases. These results are discussed in terms of the Mn-site disorder and opening of strong FM coupling between Mn 2+ -O-Mn 3+ , due to the Mn 2+ ions induced by Mo 6+ at the expense of Mn 4+ ions in the La 0.7 Ca 0.15 Sr 0.15 Mn 1-x Mo x O 3 system.
Hot spots of crop production changes at 1.5°C and 2°C
Schleussner, C. F.; Deryng, D.; Mueller, C.; Elliott, J. W.; Saeed, F.; Folberth, C.; Liu, W.; Wang, X.; Pugh, T.
2017-12-01
Studying changes in global and regional crop production is central for assessing the benefits of limiting global average temperature below 1.5ºC versus 2ºC. Projections of future climatic impacts on crop production are commonly focussed on focussing on mean changes. However, substantial risks are posed by extreme weather events such as heat waves and droughts that are of great relevance for imminent policy relevant questions such as price shocks or food security. Preliminary research on the benefits of keeping global average temperature increase below 1.5ºC versus 2ºC above pre-industrial levels has indicated that changes in extreme weather event occurrences will be more pronounced than changes in the mean climate. Here we will present results of crop yield projections for a set of global gridded crop models (GGCMs) for four major staple crops at 1.5°C and 2°C warming above pre-industrial levels using climate forcing data from the Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) project. We will assess changes in crop production on the global and regional level, and identify hot spots of change. The unique multi-ensemble setup allows to identify changes in extreme yield losses with multi-year to multi-decadal return periods, and thus elucidate the consequences for global and regional food security.
Structure and properties of alloys of A15 type compounds with carbon
International Nuclear Information System (INIS)
Savitskij, E.M.; Efimov, Yu.V.; Myasnikova, E.A.
1983-01-01
Microstructure and some properties of the alloys on the base of the phases of A15 type in the V-Si-C, Nb-Si-C, Nb-Sn-C, Nb-Al-C, Nb-Ga-C, V-Ga-C ternary systems are investigated. It is established that in the niobium-rich corners of the A-B-C ternary systems the new ternary conpounds do not form, as a rule, bUt the wide ranges of threephase equilibrium A-A 3 B-C exist. New ternary phases with A15 type structure stabilized with carbon are established only in the Nb-Si-C and V-Al-C systems. Alloying with carbon results in sharp refining of structural components of stable and metastable alloys, promotes transition of the alloys into amorphous state at super fast cooling of the melts as well as increases stability of metastable state of the alloys against tempering. After super fast quenching and tempering Tsub(c) of the ternary alloys close to the A15 phases exceed Tsub(c) of equilibrium samples
Calorimetric Study of Phase Transitions Involving Twist-Grain-Boundary TGB{A} and TGB{C} Phases
Navailles, L.; Garland, C. W.; Nguyen, H. T.
1996-09-01
High-resolution calorimetry has been used to determine the heat capacity and latent heat associated with phase transitions in the homologous series of chiral liquid crystals nF_2BTFO_1M_7 [ 3-fluoro-4(1-methylheptyloxy)4'-(4''-alkoxy-2'', 3''-difluorobenzoyloxy)tolane] . These compounds exhibit smectic-C^* (SmC^*), twist-grain-boundary (TGBA for n=10, TGBC for n=11, 12) and cholesteric (N^*) phases. All the phase transitions are first order with small to moderate latent heats. There is a large rounded excess heat capacity peak in the N^* phase that is consistent with the predicted appearance of short-range TGB order (chiral line liquid character). This is analogous to the development of an Abrikosov flux vortex liquid in type-II superconductors. Both the n=11 and 12 homologs exhibit two closely spaced transitions in the region where a single TGBC - N^* transition was expected. This suggests the existence of two thermodynamically distinct TGBC phases. Des exprériences de calorimétrie haute résolution ont été réalisées pour déterminer les chaleurs spécifiques et les chaleurs latentes associées aux transitions de phase des homologues de la série crystal liquide nF_2BTFO_1M_7: 3-fluoro-4[1-methyl-heptyloxy]4'-(4''-alcoxy-2'', 3''-difluorobenzoyloxy)tolanes. Ces produits présentent la phase smectique C^* (SmC^*), les phases à torsion par joint de grain (TGBA pour n=10 et TGBC pour n=11, 12) et la phase cholestérique (N^*). Toutes les transitions de phase sont du premier ordre. La chaleur latente associée à ces transitions est faibles ou modérée. Nous observons, dans la phase N^*, un grand pic arrondi qui est en accord avec les prédictions de l'apparition d'un ordre TGB à courte distance (liquide de ligne de dislocation). Ce phénomène est l'analogue du liquide de vortex dans les supraconducteurs de type II. Les composés n=11 et 12 présentent, dans la région où nous attendions une transition TGBC - N^* unique, deux transitions sur un très faible
Karmalkar, Ambarish V; Bradley, Raymond S
2017-01-01
The differential warming of land and ocean leads to many continental regions in the Northern Hemisphere warming at rates higher than the global mean temperature. Adaptation and conservation efforts will, therefore, benefit from understanding regional consequences of limiting the global mean temperature increase to well below 2°C above pre-industrial levels, a limit agreed upon at the United Nations Climate Summit in Paris in December 2015. Here, we analyze climate model simulations from the Coupled Model Intercomparison Project Phase 5 (CMIP5) to determine the timing and magnitude of regional temperature and precipitation changes across the contiguous United States (US) for global warming of 1.5 and 2°C and highlight consensus and uncertainties in model projections and their implications for making decisions. The regional warming rates differ considerably across the contiguous US, but all regions are projected to reach 2°C about 10-20 years before the global mean temperature. Although there is uncertainty in the timing of exactly when the 1.5 and 2°C thresholds will be crossed regionally, over 80% of the models project at least 2°C warming by 2050 for all regions for the high emissions scenario. This threshold-based approach also highlights regional variations in the rate of warming across the US. The fastest warming region in the contiguous US is the Northeast, which is projected to warm by 3°C when global warming reaches 2°C. The signal-to-noise ratio calculations indicate that the regional warming estimates remain outside the envelope of uncertainty throughout the twenty-first century, making them potentially useful to planners. The regional precipitation projections for global warming of 1.5°C and 2°C are uncertain, but the eastern US is projected to experience wetter winters and the Great Plains and the Northwest US are projected to experience drier summers in the future. The impact of different scenarios on regional precipitation projections is
WxC-β-SiC Nanocomposite Catalysts Used in Aqueous Phase Hydrogenation of Furfural.
Rogowski, Jacek; Andrzejczuk, Mariusz; Berlowska, Joanna; Binczarski, Michal; Kregiel, Dorota; Kubiak, Andrzej; Modelska, Magdalena; Szubiakiewicz, Elzbieta; Stanishevsky, Andrei; Tomaszewska, Jolanta; Witonska, Izabela Alina
2017-11-22
This study investigates the effects of the addition of tungsten on the structure, phase composition, textural properties and activities of β-SiC-based catalysts in the aqueous phase hydrogenation of furfural. Carbothermal reduction of SiO₂ in the presence of WO₃ at 1550 °C in argon resulted in the formation of W x C-β-SiC nanocomposite powders with significant variations in particle morphology and content of W x C-tipped β-SiC nano-whiskers, as revealed by TEM and SEM-EDS. The specific surface area (SSA) of the nanocomposite strongly depended on the amount of tungsten and had a notable impact on its catalytic properties for the production of furfuryl alcohol (FA) and tetrahydrofurfuryl alcohol (THFA). Nanocomposite W x C-β-SiC catalysts with 10 wt % W in the starting mixture had the highest SSA and the smallest W x C crystallites. Some 10 wt % W nanocomposite catalysts demonstrated up to 90% yield of THFA, in particular in the reduction of furfural derived from biomass, although the reproducible performance of such catalysts has yet to be achieved.
A study on the Development of Zr-Ti-Mn-V-Ni hydrogen Storage Alloy for Ni-MH Rechargeable Battery
Energy Technology Data Exchange (ETDEWEB)
Kim, Dong Myung; Jung, Jae Han; Lee, Sang Min; Lee, Jae Young [Department of Meterial Science and Engineering, Korea Advanced Institute of Science and Technology, Taejon (Korea, Republic of)
1996-12-15
The Zr-based AB{sub 5} type Laves phase hydrogen storage alloys have some promising properties, long cycle life, high discharge capacity, as electrode materials in reversible metal hydride batteries. However, when these alloys are used as negative electrode for battery, there is a problem that their rate capabilities are worse than those of commercialized AB{sub 5} type hydrogen storage alloys. In this work, we tried to develop the Zr-based AB type Laves phase hydrogen storage alloys which have high capacity and, especially, high rate capability (author). 21 refs., 2 tabs., 13 figs.
New structures in the continuum of 15C populated by two-neutron transfer
International Nuclear Information System (INIS)
Cappuzzello, F.; Rea, C.; Bonaccorso, A.; Bondì, M.; Carbone, D.; Cavallaro, M.; Cunsolo, A.; Foti, A.; Orrigo, S.E.A.; Rodrigues, M.R.D.; Taranto, G.
2012-01-01
The 13 C( 18 O, 16 O) 15 C reaction has been studied at 84 MeV incident energy. The ejectiles have been detected at forward angles and 15 C excitation energy spectra have been obtained up to about 20 MeV. Several known bound and resonant states of 15 C have been identified together with two unknown structures at 10.5 MeV (FWHM=2.5 MeV) and 13.6 MeV (FWHM=2.5 MeV). Calculations based on the removal of two uncorrelated neutrons from the projectile describe a significant part of the continuum observed in the energy spectra. In particular the structure at 10.5 MeV is dominated by a resonance of 15 C near the 13 C+n+n threshold. Similar structures are found in nearby nuclei such as 14 C and 11 Be.
International Nuclear Information System (INIS)
Lelental, M.; Romanofsky, H.J.
1992-01-01
This patent describes a process which comprises forming a mixed rare earth alkaline earth copper oxide layer on a substrate and converting the mixed rare earth alkaline earth copper oxide layer to an electrically conductive layer. It comprises crystalline R 1 A 2 C 3 oxide phase by heating in the presence of oxygen, wherein rare earth and R is in each instance chosen from among yttrium, lanthanum, samarium, europium, gadolinium, dysprosium, holmium, erbium, thulium, ytterbium, and lutetium and alkaline earth and A is in each instance chosen from among calcium, strontium and barium, characterized in that a crystalline R 2 A 1 C 1 oxide phase is first formed as a layer on the substrate and the crystalline R 1 A 2 C 3 oxide phase is formed over the crystalline R 2 A 1 C 1 oxide phase by coating a mixed rare earth alkaline earth copper oxide on the crystalline R 2 A 1 C 1 oxide phase and heating the mixed rare earth alkaline earth copper oxide to a temperature of at least 1000 degrees C
Towards the IPCC Special Report on Global Warming of 1.5°C
Masson-Delmotte, Valérie
2017-04-01
signals from climate variability (e.g. changes in water cycle, extremes...), for assessing strengths and limitations of methodologies using high end climate scenarios versus true stabilisation pathways, and for exploring long term risks beyond transient response, with consideration for overshoots and the full timescale of Earth system feedbacks. Lessons learnt from past warm climatic phases may also provide insights complementary to projections, albeit without the perspective of rates of changes that is specific to the issue of 1.5°C global warming. This special report is also designed to be complementary from the other reports in preparation for the IPCC Sixth Assessment cycle (AR6), including the special reports on the ocean and the cryosphere, on land use issues, both scheduled for 2019, and the Working Group main assessment reports, scheduled for 2021-2022.
AgMIP Coordinated Global and Regional Assessments for 1.5°C and 2.0°C
Rosenzweig, C.
2017-12-01
The Agricultural Model Intercomparison and Improvement Project (AgMIP) has developed novel methods for Coordinated Global and Regional Assessments (CGRA) of agriculture and food security in a changing world. The present study performs a proof-of-concept of the CGRA to demonstrate advantages and challenges of the framework. This effort responds to the request by UNFCCC for the implications of limiting global temperature increases to 1.5°C and 2.0°C above pre-industrial conditions. The protocols for the 1.5°C/2.0°C assessment establish explicit and testable linkages across disciplines and scales, connecting outputs and inputs from the Shared Socio-economic Pathways (SSPs), Representative Agricultural Pathways (RAPs), HAPPI and CMIP5 ensemble scenarios, global gridded crop models, global agricultural economic models, site-based crop models, and within-country regional economic models. CGRA results show that at the global scale, mixed areas of positive and negative simulated yield changes, with declines in some breadbasket regions led to overall declines in productivity at both 1.5°C and 2.0°C. These projected global yield changes resulted in increases in prices of major commodities in a global economic model. Simulations for 1.5°C and 2.0°C using site-based crop models had mixed results depending on region and crop, but with more negative effects on productivity at 2.0°C than at 1.5°C for the most part. In conjunction with price changes from the global economics models, these productivity declines resulted generally in small positive effects on regional farm livelihoods, showing that farming systems should continue to be viable under high mitigation scenarios. CGRA protocols focus on how mitigation actions and effects differ across scales, with main mechanisms studied in the integrated assessment models being policies and technologies that reduce direct non-CO2 emissions from agriculture, reduce CO2 emissions from land use change and forest sink enhancement
Microstructure/Oxidation/Microhardness Correlations in Gamma-Based and Tau-Based Al-Ti-Cr Alloys
Brady, Michael P.; Smialek, J. L.; Humphrey, D. L.
1994-01-01
The relationships between alloy microstructure and air oxidation kinetics and alloy microstructure and microhardness in the Al-Ti-Cr system for exposures at 800 C and 1000 C were investigated. The relevant phases were identified as tau (Ll2), gamma (LIO), r-Al2Ti, TiCrAl (laves), and Cr2AI. Protective alumina formation was associated with tau, Al-rich TiCrAl, and gamma/TiCrAl mixtures. Brittleness was associated with the TiCrAl phase and tau decomposition to A12Ti + Cr2AI. It was concluded that two-phase gamma + TiCrAl alloys offer the greatest potential for oxidation resistance and room temperature ductility in the Al-Ti-Cr system.
C-terminal peptide extension via gas-phase ion/ion reactions
Peng, Zhou; McLuckey, Scott A.
2015-01-01
The formation of peptide bonds is of great importance from both a biological standpoint and in routine organic synthesis. Recent work from our group demonstrated the synthesis of peptides in the gas-phase via ion/ion reactions with sulfo-NHS reagents, which resulted in conjugation of individual amino acids or small peptides to the N-terminus of an existing ‘anchor’ peptide. Here, we demonstrate a complementary approach resulting in the C-terminal extension of peptides. Individual amino acids or short peptides can be prepared as reagents by incorporating gas phase-labile protecting groups to the reactive C-terminus and then converting the N-terminal amino groups to the active ketenimine reagent. Gas-phase ion/ion reactions between the anionic reagents and doubly protonated “anchor” peptide cations results in extension of the “anchor” peptide with new amide bond formation at the C-terminus. We have demonstrated that ion/ion reactions can be used as a fast, controlled, and efficient means for C-terminal peptide extension in the gas phase. PMID:26640400
Energy Technology Data Exchange (ETDEWEB)
Qiu Hongdeng [Department of Applied Chemistry and Biochemistry, Kumamoto University, 2-39-1 Kurokami, Kumamoto 860-8555 (Japan); Lanzhou Institute of Chemical Physics, Chinese Academy of Science, Lanzhou 730000 (China); Mallik, Abul K. [Department of Applied Chemistry and Biochemistry, Kumamoto University, 2-39-1 Kurokami, Kumamoto 860-8555 (Japan); Takafuji, Makoto [Department of Applied Chemistry and Biochemistry, Kumamoto University, 2-39-1 Kurokami, Kumamoto 860-8555 (Japan); Kumamoto Institute for Photo-Electro Organics (Phoenics), Kumamoto 862-0901 (Japan); Liu Xia; Jiang Shengxiang [Lanzhou Institute of Chemical Physics, Chinese Academy of Science, Lanzhou 730000 (China); Ihara, Hirotaka, E-mail: ihara@kumamoto-u.ac.jp [Department of Applied Chemistry and Biochemistry, Kumamoto University, 2-39-1 Kurokami, Kumamoto 860-8555 (Japan); Kumamoto Institute for Photo-Electro Organics (Phoenics), Kumamoto 862-0901 (Japan)
2012-08-13
Highlights: Black-Right-Pointing-Pointer Imidazolium-embedded C{sub 18} stationary phase was prepared and characterized. Black-Right-Pointing-Pointer Enhanced chromatographic selectivity was observed in SiImC{sub 18} column. Black-Right-Pointing-Pointer Seven nucleosides and bases were separated using only water as eluent within 8 min. Black-Right-Pointing-Pointer Multiple-interactions induced by embedded polar imidazolium was investigated. - Abstract: In this paper, a new imidazolium-embedded C{sub 18} stationary phase (SiImC{sub 18}) for reversed-phase high-performance liquid chromatography is described. 1-Allyl-3-octadecylimidazolium bromide ionic liquid compound having a long alkyl chain and reactive groups was newly prepared and grafted onto 3-mercaptopropyltrimethoxysilane-modified silica via a surface-initiated radical-chain transfer addition reaction. The SiImC{sub 18} obtained was characterized by elemental analysis, infrared spectroscopy, thermogravimetric analysis, diffuse reflectance infrared Fourier transform, and solid-state {sup 13}C and {sup 29}Si cross-polarization/magic angle spinning nuclear magnetic resonance spectroscopy. The selectivity toward polycyclic aromatic hydrocarbons relative to that toward alkylbenzenes exhibited by SiImC{sub 18} was higher than the corresponding selectivity exhibited by a conventional octadecyl silica (ODS) column, which could be explained by electrostatic {pi}-{pi} interaction cationic imidazolium and electron-rich aromatic rings. On the other hand, SiImC{sub 18} also showed high selectivity for polar compounds, which was based on the multiple interaction and retention mechanisms of this phase with different analytes. 1,6-Dinitropyrene and 1,8-dinitropyrene, which form a positional isomer pair of dipolar compounds, were separated successfully with the SiImC{sub 18} phase. Seven nucleosides and bases (i.e. cytidine, uracil, uridine, thymine, guanosine, xanthosine, and adenosine) were separated using only water as
Energy Technology Data Exchange (ETDEWEB)
Ma, Yong-Cheng [Clinical Pharmacology Laboratory, Henan Province People' s Hospital, No. 7, Wei Wu Road, Zhengzhou, Henan (China); Su, Nan [Department of Quality Detection and Management, Henan University of Animal Husbandry and Economy, Zhengzhou, Henan (China); Shi, Xiao-Jing; Zhao, Wen; Ke, Yu [School of Pharmaceutical Sciences, Zhengzhou University, No. 100, Science Avenue, Zhengzhou, Henan (China); Zi, Xiaolin [Department of Urology, University of California, Irvine, Orange, CA (United States); Department of Pharmacology, University of California, Irvine, Orange, CA (United States); Department of Pharmaceutical Sciences, University of California, Irvine, Orange, CA (United States); Zhao, Ning-Min; Qin, Yu-Hua; Zhao, Hong-Wei [Clinical Pharmacology Laboratory, Henan Province People' s Hospital, No. 7, Wei Wu Road, Zhengzhou, Henan (China); Liu, Hong-Min, E-mail: liuhm@zzu.edu.cn [School of Pharmaceutical Sciences, Zhengzhou University, No. 100, Science Avenue, Zhengzhou, Henan (China)
2015-01-15
Jaridonin, a novel diterpenoid from Isodon rubescens, has been shown previously to inhibit proliferation of esophageal squamous cancer cells (ESCC) through G2/M phase cell cycle arrest. However, the involved mechanism is not fully understood. In this study, we found that the cell cycle arrest by Jaridonin was associated with the increased expression of phosphorylation of ATM at Ser1981 and Cdc2 at Tyr15. Jaridonin also resulted in enhanced phosphorylation of Cdc25C via the activation of checkpoint kinases Chk1 and Chk2, as well as in increased phospho-H2A.X (Ser139), which is known to be phosphorylated by ATM in response to DNA damage. Furthermore, Jaridonin-mediated alterations in cell cycle arrest were significantly attenuated in the presence of NAC, implicating the involvement of ROS in Jaridonin's effects. On the other hand, addition of ATM inhibitors reversed Jaridonin-related activation of ATM and Chk1/2 as well as phosphorylation of Cdc25C, Cdc2 and H2A.X and G2/M phase arrest. In conclusion, these findings identified that Jaridonin-induced cell cycle arrest in human esophageal cancer cells is associated with ROS-mediated activation of ATM–Chk1/2–Cdc25C pathway. - Highlights: • Jaridonin induced G2/M phase arrest through induction of redox imbalance. • Jaridonin increased the level of ROS through depleting glutathione in cell. • ATM–Chk1/2–Cdc25C were involved in Jaridonin-induced cell cycle arrest. • Jaridonin selectively inhibited cancer cell viability and cell cycle progression.
Kinetics of formation of the A-15 phase in the Nb--Al--Ge system
International Nuclear Information System (INIS)
Kannatey-Asibu, E. Jr.
1977-05-01
A study has been made of the time and temperature dependence of the growth of the A-15 phase and its grains in the Nb-Al-Ge system. In addition, changes in the microstructure and composition of the A-15 phase have been studied using an EDAX analysis. The data obtained have been plotted and compared with theory. The results have been used to explain the variations in the superconducting properties of this system as observed in earlier work. Consequently, areas for further study towards optimizing the superconducting parameters of this system have been proposed
Impacts on terrestrial biodiversity of moving from a 2°C to a 1.5°C target
Smith, Pete; Price, Jeff; Molotoks, Amy; Warren, Rachel; Malhi, Yadvinder
2018-05-01
We applied a recently developed tool to examine the reduction in climate risk to biodiversity in moving from a 2°C to a 1.5°C target. We then reviewed the recent literature examining the impact of (a) land-based mitigation options and (b) land-based greenhouse gas removal options on biodiversity. We show that holding warming to 1.5°C versus 2°C can significantly reduce the number of species facing a potential loss of 50% of their climatic range. Further, there would be an increase of 5.5-14% of the globe that could potentially act as climatic refugia for plants and animals, an area equivalent to the current global protected area network. Efforts to meet the 1.5°C target through mitigation could largely be consistent with biodiversity protection/enhancement. For impacts of land-based greenhouse gas removal technologies on biodiversity, some (e.g. soil carbon sequestration) could be neutral or positive, others (e.g. bioenergy with carbon capture and storage) are likely to lead to conflicts, while still others (e.g. afforestation/reforestation) are context-specific, when applied at scales necessary for meaningful greenhouse gas removal. Additional effort to meet the 1.5°C target presents some risks, particularly if inappropriately managed, but it also presents opportunities. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.
DEFF Research Database (Denmark)
Lillia, Stefano; Bonalumi, Davide; Fosbøl, Philip L.
2018-01-01
, and lastly CO2 loadings from 0.2 to 0.6. The resulting overall mass transfer coefficient of absorption measured follows the trends described by the modelling of the reactor and the equations used to describe the rate of the absorption reactions. Moreover, the overall mass transfer coefficient of absorption...... loading conditions. The kinetic model intercept the values found in literature in every range of concentration. Consequently, the model is valid in every conditions and the rate of the reaction between NH3 and CO2 in liquid phase is described with an Arrhenius constant with a pre-exponential factor of 1......The absorption reaction between aqueous NH3 and CO2 was studied using the Wetted Wall Column. A total of 27 different cases are investigated in the region defined by temperatures from 15 °C to 35 °C, NH3 concentrations from 5% to 15%, which are the typical solvent conditions in absorption columns...
17 CFR 240.15c1-8 - Sales at the market.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales at the market. 240.15c1... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-8 Sales at the market... securities exchange that such security is being offered to such customer “at the market” or at a price...
Martin, Brian
Combinatorial approaches have proven useful for rapid alloy fabrication and optimization. A new method of producing controlled isothermal gradients using the Gleeble Thermomechanical simulator has been developed, and demonstrated on the metastable beta-Ti alloy beta-21S, achieving a thermal gradient of 525-700 °C. This thermal gradient method has subsequently been coupled with existing combinatorial methods of producing composition gradients using the LENS(TM) additive manufacturing system, through the use of elemental blended powders. This has been demonstrated with a binary Ti-(0-15) wt% Cr build, which has subsequently been characterized with optical and electron microscopy, with special attention to the precipitate of TiCr2 Laves phases. The TiCr2 phase has been explored for its high temperature mechanical properties in a new oxidation resistant beta-Ti alloy, which serves as a demonstration of the new bicombinatorial methods developed as applied to a multicomponent alloy system.
WxC-β-SiC Nanocomposite Catalysts Used in Aqueous Phase Hydrogenation of Furfural
Directory of Open Access Journals (Sweden)
Jacek Rogowski
2017-11-01
Full Text Available This study investigates the effects of the addition of tungsten on the structure, phase composition, textural properties and activities of β-SiC-based catalysts in the aqueous phase hydrogenation of furfural. Carbothermal reduction of SiO2 in the presence of WO3 at 1550 °C in argon resulted in the formation of WxC-β-SiC nanocomposite powders with significant variations in particle morphology and content of WxC-tipped β-SiC nano-whiskers, as revealed by TEM and SEM-EDS. The specific surface area (SSA of the nanocomposite strongly depended on the amount of tungsten and had a notable impact on its catalytic properties for the production of furfuryl alcohol (FA and tetrahydrofurfuryl alcohol (THFA. Nanocomposite WxC-β-SiC catalysts with 10 wt % W in the starting mixture had the highest SSA and the smallest WxC crystallites. Some 10 wt % W nanocomposite catalysts demonstrated up to 90% yield of THFA, in particular in the reduction of furfural derived from biomass, although the reproducible performance of such catalysts has yet to be achieved.
Su, X.; Takahashi, K.; Fujimori, S.; Hasegawa, T.; Tanaka, K.; Shiogama, H.; Emori, S.; LIU, J.; Hanasaki, N.; Hijioka, Y.; Masui, T.
2017-12-01
Large uncertainty exists in the temperature projections, including contributions from carbon cycle, climate system and aerosols. For the integrated assessment models (IAMs), like DICE, FUND and PAGE, however, the scientific uncertainties mainly rely on the distribution of (equilibrium) climate sensitivity. This study aims at evaluating the emission pathways by limiting temperature increase below 2.0 ºC or 1.5 ºC after 2100 considering scientific uncertainties, and exploring how socioeconomic indicators are affected by such scientific uncertainties. We use a stochastic version of the SCM4OPT, with an uncertainty measurement by considering alternative ranges of key parameters. Three climate cases, namely, i) base case of SSP2, ii) limiting temperature increase below 2.0 ºC after 2100 and iii) limiting temperature increase below 1.5 ºC after 2100, and three types of probabilities - i) >66% probability or likely, ii) >50% probability or more likely than not and iii) the mean of the probability distribution, are considered in the study. The results show that, i) for the 2.0ºC case, the likely CO2 reduction rate in 2100 ranges from 75.5%-102.4%, with mean value of 88.1%, and 93.0%-113.1% (mean 102.5%) for the 1.5ºC case; ii) a likely range of forcing effect is found for the 2.0 ºC case (2.7-3.9 Wm-2) due to scientific uncertainty, and 1.9-3.1 Wm-2 for the 1.5 ºC case; iii) the carbon prices within 50% confidential interval may differ a factor of 3 for both the 2.0ºC case and the 1.5 ºC case; iv) the abatement costs within 50% confidential interval may differ a factor of 4 for both the 2.0ºC case and the 1.5 ºC case. Nine C4MIP carbon cycle models and nineteen CMIP3 AOGCMs are used to account for the scientific uncertainties, following MAGICC 6.0. These uncertainties will result in a likely radiative forcing range of 6.1-7.5 Wm-2 and a likely temperature increase of 3.1-4.5 ºC in 2100 for the base case of SSP2. If we evaluate the 2 ºC target by limiting the
International Nuclear Information System (INIS)
Hernandez, O.; Cousson, A.; Kiat, J.M.; Ecole Centrale des Arts et Manufactures, 92 - Chatenay-Malabry; Paulus, W.; Technische Hochschule Aachen; Ezpeleta, J.M.; Zuniga, F.J.
1999-01-01
The structures of the commensurate 1/4 and 1/5 phases of the displacively modulated compound D-BCCD [deuterated betaine (trimethylammonioacetate) calcium chloride dihydrate, i.e. (CD 3 ) 3 NCD 2 COOCaCl 2 (D 2 O) 2 or CaCl 2 x C 5 D 11 NO 2 x 2D 2 O] have been determined by single-crystal neutron diffraction at 100 and 68 K, respectively. The structural model of the 1/4 phase is found to be quite different from that obtained previously from X-ray diffraction data of the hydrogenated compound. This discrepancy comes from the fact that X-ray irradiation induces in this compound an unusual time-dependent decrease of the intensity of high-order satellite diffraction peaks. As a consequence and due to the commensurate nature of the phases investigated, X-ray diffraction failed to detect the large anharmonicity of the structural modulation which is clearly present in the two structures determined by neutron diffraction. (orig.)
International Nuclear Information System (INIS)
Maziasz, P.J.; Klueh, R.L.
1990-01-01
Both thermal aging at 482--704 degree C for up to 25,000h and HFIR irradiation at 300--600 degree C for up to 39 dpa produce substantial changes in the as-tempered microstructure of 9Cr-1MoVNb martensitic/ferritic steel. However, the changes in the dislocation/subgrain boundary and the precipitate structures caused by thermal aging or neutron irradiation are quite different in nature. During thermal aging, the as-tempered lath/subgrain boundary and carbide precipitate structures remain stable below 650 degree C, but coarsen and recover somewhat at 650--704 degree C. The formation of abundant intergranular Laves phase, intra-lath dislocation networks, and fine dispersions of VC needles are thermal aging effects that are superimposed upon the as-tempered microstructure at 482--593 degree C. HFIR irradiation produces dense dispersions of very small ''black'' dislocations loops at 300 degree C and produces helium bubbles and voids at 400 degree C At 300--500 degree C, there is considerable recovery of the as-tempered lath/subgrain boundary structure and microstructural/microcompositional instability of the as-tempered carbide precipitates during irradiation. By contrast, the as-tempered microstructure remains essentially unchanged during irradiation at 600 degree C. Comparison of thermally aged with irradiation material suggests that the instabilities of the as-tempered lath/subgrain boundary and precipitate structures at lower irradiation temperatures are radiation-induced effects, whereas the absence of both Laves phase and fine VC needles during irradiation is a radiation-retarded thermal effect
Cormie, A. B.; Schwarcz, H. P.
1996-11-01
We have examined the relationship of bone collagen δ15N and δ13C to climatic variables, humidity, temperature, and amount of precipitation using fifty-nine specimens of North American white-tailed deer ( Odocoileus virginianus) from forty-six different locations. In previous studies of African mammals there was a significant correlation between bone collagen δ15N and local amount of precipitation. Results presented here similarly show an increase in δ15N with decreasing amount of precipitation but only for 25% of the animals, namely those consuming more than 10% C 4 plants. These animals also exhibited a significant correlation between δ13C and temperature which mirrors previous observations for grasses suggesting that these deer consume grasses during times of population and nutrient stress. In contrast, even in dry areas containing high proportions of C 4 grasses, the majority of the deer had consumed low amounts of C 4 plants and these deer did not have δ15N which correlate with amount of precipitation. Only when deer deviated from their normal feeding pattern by consuming C 4 plants or grasses did their δ15N correlate with amount of rainfall. For these animals, consumption of C 4 plants or grasses may signal conditions of water and nutrient stress. An increase in δ15N of bone collagen may result from combined effects from excretion of concentrated urine (to conserve water) and increased internal recycling of nitrogen (to conserve nitrogen).
Investigation of the metabolism of colostomized laying hens with 15N-labelled wheat. 6
International Nuclear Information System (INIS)
Gruhn, K.; Hennig, A.
1980-01-01
Three colostomized laving hens received 40 g 15 N-labelled wheat with 20.13 atom-% 15 N excess ( 15 N'), 19.18 atom-% 15 N'-lysine, 18.17 atom-% 15 N'-histidine and 20.43 atom-% 15 N'-arginine per day over a period of four days. After having received the same non-labelled feed ration on the following four days, the hens were slaughtered. The incorporation and distribution of 15 N' in the total nitrogen and the nitrogen of the basic amino acids was determined in liver, kidneys, muscles, bones and the remaining carcass (excluding blood, digestive tract and genital organs). The quota of nitrogen of natural isotope frequency ( 14 N) of the total 14 N of the hens' carcasses was 47% in the muscles, 14% in the bones and 20% in the feathers; the relative 15 N' values were 37%, 8% and 1%, resp. The atom-% 15 N' in the kidneys was twice as much as in the liver four days after the last 15 N' application. The average percentage of the nitrogen in the three basic amino acids of the total nitrogen in the tissues and organs (excluding feathers) is 25% concerning both 14 N and 15 N'. The 15N' balance revealed that in hen 1 100%, in hen 2 102% and in hen 3 101% of the consumed wheat 15 N' were found. (author)
Synthesis of Novel C-2- or C-15-Labeled BODIPY—Estrone Conjugates
Directory of Open Access Journals (Sweden)
Ildikó Bacsa
2018-04-01
Full Text Available Novel BODIPY–estrone conjugates were synthesized via Cu(I-catalyzed azide–alkyne cycloaddition (CuAAC. Estrone-alkynes or an estrone-azide as starting compounds were synthesized via Michael addition or Sonogashira reaction as key steps. Fluorescent dyes based on BODIPY-core were provided by azide or alkyne functional groups. Fluorescent labeling of estrone was efficiently achieved at the C-2 or C-15 position. The newly-elaborated coupling procedures might have a broad applicability in the synthesis of fluorescent-labeled estrone conjugates suitable for biological assays.
Impacts on terrestrial biodiversity of moving from a 2°C to a 1.5°C target
Price, Jeff; Molotoks, Amy; Warren, Rachel
2018-01-01
We applied a recently developed tool to examine the reduction in climate risk to biodiversity in moving from a 2°C to a 1.5°C target. We then reviewed the recent literature examining the impact of (a) land-based mitigation options and (b) land-based greenhouse gas removal options on biodiversity. We show that holding warming to 1.5°C versus 2°C can significantly reduce the number of species facing a potential loss of 50% of their climatic range. Further, there would be an increase of 5.5–14% of the globe that could potentially act as climatic refugia for plants and animals, an area equivalent to the current global protected area network. Efforts to meet the 1.5°C target through mitigation could largely be consistent with biodiversity protection/enhancement. For impacts of land-based greenhouse gas removal technologies on biodiversity, some (e.g. soil carbon sequestration) could be neutral or positive, others (e.g. bioenergy with carbon capture and storage) are likely to lead to conflicts, while still others (e.g. afforestation/reforestation) are context-specific, when applied at scales necessary for meaningful greenhouse gas removal. Additional effort to meet the 1.5°C target presents some risks, particularly if inappropriately managed, but it also presents opportunities. This article is part of the theme issue ‘The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. PMID:29610386
Studies of U-Pu-C-Ti compounds
International Nuclear Information System (INIS)
Milet, C.
1967-01-01
The U-Pu-C-Ti compounds (5 to 20 atoms per cent Ti) have been studied in order to improve some properties of U-Pu-C carbides and to extend the existence field of the (U, Pu) C phase. The Pu/(U+Pu) ratio has been fixed to 15 per cent. All the alloys were elaborated and cast in an arc furnace. A two-phases field (U, Pu) C + Ti C exists which permits to avoid di- and sesqui-carbides and the (U, Pu) phase. An eutectic between (U, Pu) C and Ti C was found around 15 atoms per cent Ti. Practically the whole of the titanium is in Ti C form, titanium solubility in (U, Pu) C being inferior to 1 atom per cent. The most promising alloy are those containing two phases: (U, Pu) C+ Ti C. In comparison with the (U, Pu) C phase, titanium addition does not change very much the thermal expansion coefficients nor the thermal cycling behaviour between 160 and 1000 Celsius degrees which is excellent. On the other hand atmospheric corrosion behaviour is improved; compatibility with stainless steel is better; thermal conductivity, calculated from electrical resistivity K is enhanced: for U(0.85)-Pu(0.15)-C alloy we have K 0.179 W/cm.C at 1000 C and K = 0.187 W/cm.C at 1500 C, for U-Pu-C-Ti (10 atoms % Ti) alloy we have K = 0.193 W/cm.C at 1000 C and K = 0.205 W/cm.C at 1500 C. (author) [fr
Recent Advances in Nb-silicide in-situ composites
International Nuclear Information System (INIS)
Bewlay, B.P.; Jackson, M.R.; Subramanian, P.R.; Briant, C.L.
2001-01-01
In-situ composites based on Nb silicides have great potential for future high-temperature applications. These Nb-silicide composites combine a ductile Nb-based matrix with high-strength silicides. With the appropriate combination of alloying elements, such as Ti, Hf, Cr, AI, it is possible to achieve a promising balance of fracture toughness, high-temperature creep performance, and oxidation resistance. This paper will describe the effect of volume fraction of silicide on microstructure, high-temperature creep performance, and oxidation resistance. The ratio of Nb:(W+Ti) is critical in determining both creep rate and oxidation performance. If this ratio goes below ∼1.5, the creep rate increases substantially. In more complex silicide-based systems, other intermetallics, such as laves phases and a boron-rich T-2 phase, are added for oxidation resistance. To understand the role of each phase on the creep resistance and oxidation performance of these composites, we determined the creep and oxidation behavior of the individual phases and composites at temperatures up to 1200 o C. These data allow quantification of the load-bearing capability of the individual phases in the Nb-silicide based in-situ composites. (author)
Reduced probability of ice-free summers for 1.5 °C compared to 2 °C warming
Jahn, Alexandra
2018-05-01
Arctic sea ice has declined rapidly with increasing global temperatures. However, it is largely unknown how Arctic summer sea-ice impacts would vary under the 1.5 °C Paris target compared to scenarios with greater warming. Using the Community Earth System Model, I show that constraining warming to 1.5 °C rather than 2.0 °C reduces the probability of any summer ice-free conditions by 2100 from 100% to 30%. It also reduces the late-century probability of an ice cover below the 2012 record minimum from 98% to 55%. For warming above 2 °C, frequent ice-free conditions can be expected, potentially for several months per year. Although sea-ice loss is generally reversible for decreasing temperatures, sea ice will only recover to current conditions if atmospheric CO2 is reduced below present-day concentrations. Due to model biases, these results provide a lower bound on summer sea-ice impacts, but clearly demonstrate the benefits of constraining warming to 1.5 °C.
Liquid Phase Sintering of (Ti,Zr)C with WC-Co.
Ma, Taoran; Borrajo-Pelaez, Rafael; Hedström, Peter; Blomqvist, Andreas; Borgh, Ida; Norgren, Susanne; Odqvist, Joakim
2017-01-11
(Ti,Zr)C powder was sintered with WC-Co following an industrial process, including an isotherm at 1410 °C. A series of interrupted sintering trials was performed with the aim of studying the sintering behavior and the microstructural evolution during both solid-state and liquid-state sintering. Reference samples, using the same elemental compositions but with the starting components TiC and ZrC instead of (Ti,Zr)C, were also sintered. The microstructure was investigated using scanning electron microscopy and energy dispersive X-ray spectroscopy. It is found that the (Ti,Zr)C phase decomposes into Ti-rich and Zr-rich nano-scale lamellae before the liquid-state of the sintering initiates. The final microstructure consists of the binder and WC as well as two different γ phases, rich in either Ti (γ₁) or Zr (γ₂). The γ₂ phase grains have a core-shell structure with a (Ti,Zr)C core following the full sintering cycle. The major differences observed in (Ti,Zr)C with respect to the reference samples after the full sintering cycle were the referred core-shell structure and the carbide grain sizes; additionally, the microstructural evolution during sintering differs. The grain size of carbides (WC, γ₁, and γ₂) is about 10% smaller in WC-(Ti,Zr)C-Co than WC-TiC-ZrC-Co. The shrinkage behavior and hardness of both composites are reported and discussed.
Liquid Phase Sintering of (Ti,ZrC with WC-Co
Directory of Open Access Journals (Sweden)
Taoran Ma
2017-01-01
Full Text Available (Ti,ZrC powder was sintered with WC-Co following an industrial process, including an isotherm at 1410 °C. A series of interrupted sintering trials was performed with the aim of studying the sintering behavior and the microstructural evolution during both solid-state and liquid-state sintering. Reference samples, using the same elemental compositions but with the starting components TiC and ZrC instead of (Ti,ZrC, were also sintered. The microstructure was investigated using scanning electron microscopy and energy dispersive X-ray spectroscopy. It is found that the (Ti,ZrC phase decomposes into Ti-rich and Zr-rich nano-scale lamellae before the liquid-state of the sintering initiates. The final microstructure consists of the binder and WC as well as two different γ phases, rich in either Ti (γ1 or Zr (γ2. The γ2 phase grains have a core-shell structure with a (Ti,ZrC core following the full sintering cycle. The major differences observed in (Ti,ZrC with respect to the reference samples after the full sintering cycle were the referred core-shell structure and the carbide grain sizes; additionally, the microstructural evolution during sintering differs. The grain size of carbides (WC, γ1, and γ2 is about 10% smaller in WC-(Ti,ZrC-Co than WC-TiC-ZrC-Co. The shrinkage behavior and hardness of both composites are reported and discussed.
Directory of Open Access Journals (Sweden)
Chi-Chun Ho
2017-10-01
Full Text Available Thiopurines are clinically useful in the management of diverse immunological and malignant conditions. Nevertheless, these purine analogues can cause lethal myelosuppression, which may be prevented by prospective testing for variants in the thiopurine S-methyltransferase (TPMT and, in East Asians, Nudix hydrolase 15 (NUDT15 genes. Two single-tube, tetra-primer amplification refractory mutation system polymerase chain reaction (ARMS-PCR assays were developed to genotype the common loss-of-function variants NUDT15 c.415C>T (rs116855232 and TPMT*3C c.719A>G (rs1142345. In a group of 60 unselected patients, one and seven were found to be homozygous and heterozygous, respectively, for NUDT15 c.415C>T; one was found to be heterozygous for TPMT*3C c.719A>G. There was no non-specific amplification, and the genotypes were 100% concordant with Sanger sequencing. Limit-of-detection for both assays was below 1 ng of heterozygous template per reaction. Time- and cost-effective ARMS-PCR assays, suitable for genotyping East-Asian patients for thiopurine intolerance, were successfully developed and validated.
The 480 deg. C and 405 deg. C isothermal sections of the phase diagram of Fe-Zn-Si ternary system
Energy Technology Data Exchange (ETDEWEB)
Wang Jianhua [Institute of Materials Research, School of Mechanical Engineering, Xiangtan University, Hunan 411105 (China)]. E-mail: super_wang111@hotmail.com; Su Xuping [Institute of Materials Research, School of Mechanical Engineering, Xiangtan University, Hunan 411105 (China); Yin Fucheng [Institute of Materials Research, School of Mechanical Engineering, Xiangtan University, Hunan 411105 (China); Li Zhi [Institute of Materials Research, School of Mechanical Engineering, Xiangtan University, Hunan 411105 (China); Zhao Manxiu [Institute of Materials Research, School of Mechanical Engineering, Xiangtan University, Hunan 411105 (China)
2005-08-16
The 480 deg. C and 405 deg. C isothermal sections of the Fe-Zn-Si ternary phase diagram have been determined experimentally using scanning electron microscopy (SEM) coupled with energy dispersive X-ray spectroscopy (EDS) and X-ray diffractometry. The research of the work has concentrated on the Zn-rich corner, which is relevant to general galvanizing. The present studies have confirmed the existence of equilibrium state between the liquid, the {zeta} phase and the FeSi phase at the 480 deg. C isothermal section. There exist some changes in the phase relationships compared with the isothermal section at 450 deg. C. Experimental results indicate that Si solubility in all four Zn-Fe compounds is also limited at 480 deg. C and 405 deg. C.
The Importance of Rare-Earth Additions in Zr-Based AB2 Metal Hydride Alloys
Directory of Open Access Journals (Sweden)
Kwo-Hsiung Young
2016-07-01
Full Text Available Effects of substitutions of rare earth (RE elements (Y, La, Ce, and Nd to the Zr-based AB2 multi-phase metal hydride (MH alloys on the structure, gaseous phase hydrogen storage (H-storage, and electrochemical properties were studied and compared. Solubilities of the RE atoms in the main Laves phases (C14 and C15 are very low, and therefore the main contributions of the RE additives are through the formation of the RENi phase and change in TiNi phase abundance. Both the RENi and TiNi phases are found to facilitate the bulk diffusion of hydrogen but impede the surface reaction. The former is very effective in improving the activation behaviors. −40 °C performances of the Ce-doped alloys are slightly better than the Nd-doped alloys but not as good as those of the La-doped alloys, which gained the improvement through a different mechanism. While the improvement in ultra-low-temperature performance of the Ce-containing alloys can be associated with a larger amount of metallic Ni-clusters embedded in the surface oxide, the improvement in the La-containing alloys originates from the clean alloy/oxide interface as shown in an earlier transmission electron microscopy study. Overall, the substitution of 1 at% Ce to partially replace Zr gives the best electrochemical performances (capacity, rate, and activation and is recommended for all the AB2 MH alloys for electrochemical applications.
Directory of Open Access Journals (Sweden)
Rahman Md Mizanur
2014-09-01
Full Text Available Two feeding trials were conducted to determine the optimum feeding frequency in growing Korean rockfish, (Sebastes schlegeli reared at the temperatures of 15°C and 19°C. Fish averaging 92.2±0.7 g (mean±standard deviation [SD] at 15.0±0.5°C and 100.2±0.4 g (mean±SD at 19.0±0.5°C water temperature were randomly distributed into each of 15 indoor tanks containing 250-L sea water from a semi-recirculation system. A total of five feeding frequency groups were set up in three replicates as follows: one meal in a day at 08:00 hour, two meals a day at 08:00 and 17:00 hours, three meals a day at 08:00, 14:00, and 20:00 hours, four meals a day at 08:00, 12:00, 16:00, and 20:00 hours, and one meal every 2 days at 08:00 hour. Fish were fed at the rate of 1.2% body weight (BW/d at 15°C and 1.5% BW/d at 19°C. At the end of 8 wks of feeding trial weight gain and specific growth rate were significantly higher at the fish fed groups of one meal a day and two meals a day at 15°C and fish fed groups of 1 meal every 2 days at 19°C were significantly lower than those of all other fish fed groups. Glutamic oxaloacetic transaminase and glutamic pyruvic transaminase of fish fed group at 1 meal every 2 days was significantly higher than those of all other fish fed groups in both experiments. Weight gain, specific growth rate and condition factor were gradually decreased as the feeding frequency increased. The results indicate that growing Korean rockfish 92 and 100 g perform better at 15°C than 19°C water temperature. As we expected, current results have indicated that a feeding frequency of 1 meal a day is optimal for the improvement of weight gain in growing Korean rockfish grown from 92 g to 133 g at 15°C and 100 g to 132 g at 19°C water temperature.
Directory of Open Access Journals (Sweden)
Ambarish V Karmalkar
Full Text Available The differential warming of land and ocean leads to many continental regions in the Northern Hemisphere warming at rates higher than the global mean temperature. Adaptation and conservation efforts will, therefore, benefit from understanding regional consequences of limiting the global mean temperature increase to well below 2°C above pre-industrial levels, a limit agreed upon at the United Nations Climate Summit in Paris in December 2015. Here, we analyze climate model simulations from the Coupled Model Intercomparison Project Phase 5 (CMIP5 to determine the timing and magnitude of regional temperature and precipitation changes across the contiguous United States (US for global warming of 1.5 and 2°C and highlight consensus and uncertainties in model projections and their implications for making decisions. The regional warming rates differ considerably across the contiguous US, but all regions are projected to reach 2°C about 10-20 years before the global mean temperature. Although there is uncertainty in the timing of exactly when the 1.5 and 2°C thresholds will be crossed regionally, over 80% of the models project at least 2°C warming by 2050 for all regions for the high emissions scenario. This threshold-based approach also highlights regional variations in the rate of warming across the US. The fastest warming region in the contiguous US is the Northeast, which is projected to warm by 3°C when global warming reaches 2°C. The signal-to-noise ratio calculations indicate that the regional warming estimates remain outside the envelope of uncertainty throughout the twenty-first century, making them potentially useful to planners. The regional precipitation projections for global warming of 1.5°C and 2°C are uncertain, but the eastern US is projected to experience wetter winters and the Great Plains and the Northwest US are projected to experience drier summers in the future. The impact of different scenarios on regional precipitation
Asian climate change under 1.5–4 °C warming targets
Directory of Open Access Journals (Sweden)
Ying Xu
2017-06-01
Full Text Available Based on simulations of 18 CMIP5 models under three RCP scenarios, this article investigates changes in mean temperature and precipitation and their extremes over Asia in the context of global warming targets of 1.5–4 °C, and further compares the differences between 1.5 °C and 2 °C targets. Results show that relative to the pre-industrial era, the mean temperature over Asia increases by 2.3 °C, 3.0 °C, 4.6 °C, and 6.0 °C at warming targets of 1.5 °C, 2 °C, 3 °C, and 4 °C, respectively, with stronger warming in high latitudes than in low latitudes. The corresponding enhancement in mean precipitation over the entire Asian region is 4.4%, 5.8%, 10.2%, and 13.0%, with significant regional differences. In addition, an increase in warm extremes, a decrease in cold extremes, and a strengthening in the variability of amounts of extreme precipitation are projected. Under the 1.5 °C target, compared with the climate under the 2 °C target, the mean temperature will be lower by 0.5–1 °C over Asia; the mean precipitation will be less by 5%–20% over most of Asia, but will be greater by about 10%–15% over West Asia and western South Asia; extreme high temperatures will be uniformly cooler throughout the Asian region, and the warming in extreme low temperatures will decrease significantly in high latitudes of Asia; extreme precipitation will be weaker over most of Asia but will be stronger over West Asia and western South Asia. Under the 1.5 °C and 2 °C warming targets, the probability of very hot weather (anomalies greater than 1σ, σ is standard deviation, extremely hot weather (anomalies greater than 3σ, and extremely heavy precipitation (anomalies greater than 3σ occurring will increase by at least once, 10%, and 10%, respectively, compared to the reference period (1861–1900.
Uncertain impacts on economic growth when stabilizing global temperatures at 1.5°C or 2°C warming
Pretis, Felix; Schwarz, Moritz; Tang, Kevin; Haustein, Karsten; Allen, Myles R.
2018-05-01
Empirical evidence suggests that variations in climate affect economic growth across countries over time. However, little is known about the relative impacts of climate change on economic outcomes when global mean surface temperature (GMST) is stabilized at 1.5°C or 2°C warming relative to pre-industrial levels. Here we use a new set of climate simulations under 1.5°C and 2°C warming from the `Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) project to assess changes in economic growth using empirical estimates of climate impacts in a global panel dataset. Panel estimation results that are robust to outliers and breaks suggest that within-year variability of monthly temperatures and precipitation has little effect on economic growth beyond global nonlinear temperature effects. While expected temperature changes under a GMST increase of 1.5°C lead to proportionally higher warming in the Northern Hemisphere, the projected impact on economic growth is larger in the Tropics and Southern Hemisphere. Accounting for econometric estimation and climate uncertainty, the projected impacts on economic growth of 1.5°C warming are close to indistinguishable from current climate conditions, while 2°C warming suggests statistically lower economic growth for a large set of countries (median projected annual growth up to 2% lower). Level projections of gross domestic product (GDP) per capita exhibit high uncertainties, with median projected global average GDP per capita approximately 5% lower at the end of the century under 2°C warming relative to 1.5°C. The correlation between climate-induced reductions in per capita GDP growth and national income levels is significant at the p economic inequality between countries and is relevant to discussions of loss and damage under the United Nations Framework Convention on Climate Change. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a
Uncertain impacts on economic growth when stabilizing global temperatures at 1.5°C or 2°C warming
Schwarz, Moritz; Tang, Kevin; Haustein, Karsten; Allen, Myles R.
2018-01-01
Empirical evidence suggests that variations in climate affect economic growth across countries over time. However, little is known about the relative impacts of climate change on economic outcomes when global mean surface temperature (GMST) is stabilized at 1.5°C or 2°C warming relative to pre-industrial levels. Here we use a new set of climate simulations under 1.5°C and 2°C warming from the ‘Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) project to assess changes in economic growth using empirical estimates of climate impacts in a global panel dataset. Panel estimation results that are robust to outliers and breaks suggest that within-year variability of monthly temperatures and precipitation has little effect on economic growth beyond global nonlinear temperature effects. While expected temperature changes under a GMST increase of 1.5°C lead to proportionally higher warming in the Northern Hemisphere, the projected impact on economic growth is larger in the Tropics and Southern Hemisphere. Accounting for econometric estimation and climate uncertainty, the projected impacts on economic growth of 1.5°C warming are close to indistinguishable from current climate conditions, while 2°C warming suggests statistically lower economic growth for a large set of countries (median projected annual growth up to 2% lower). Level projections of gross domestic product (GDP) per capita exhibit high uncertainties, with median projected global average GDP per capita approximately 5% lower at the end of the century under 2°C warming relative to 1.5°C. The correlation between climate-induced reductions in per capita GDP growth and national income levels is significant at the p economic inequality between countries and is relevant to discussions of loss and damage under the United Nations Framework Convention on Climate Change. This article is part of the theme issue ‘The Paris Agreement: understanding the physical and social challenges for
Liquid phase sintered SiC. Processing and transformation controlled microstructure tailoring
Directory of Open Access Journals (Sweden)
V.A. Izhevskyi
2000-10-01
Full Text Available Microstructure development and phase formation processes during sintering of silicon carbide based materials with AlN-Y2O3, AlN-Yb2O3, and AlN-La2O3 sintering additives were investigated. Densification of the materials occurred by liquid-phase sintering mechanism. Proportion of alpha- and beta-SiC powders in the initial mixtures was a variable parameter, while the molar ratio of AlN/RE2O3, and the total amount of additives (10 vol. % were kept constant. Shrinkage behavior during sintering in interrelation with the starting composition of the material and the sintering atmosphere was investigated by high temperature dilatometry. Kinetics of b-SiC to a-SiC phase transformation during post-sintering heat treatment at temperatures 1900-1950 °C was studied, the degree of phase transformation being determined by quantitative x-ray analysis using internal standard technique. Evolution of microstructure resulting from beta-SiC to alpha-SiC transformation was followed up by scanning electron microscopy on polished and chemically etched samples. Transformation-controlled grain growth mechanism similar to the one observed for silicon nitride based ceramics was established. Possibility of in-situ platelet reinforced dense SiC-based ceramics fabrication with improved mechanical properties by means of sintering was shown.
Fischer-Tropsch synthesis in slurry-phase reactors using Co/SBA-15 catalysts
Energy Technology Data Exchange (ETDEWEB)
Rodrigues, J.J.; Lima, L.A.; Lima, W.S.; Rodrigues, M.G.F. [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Unidade Academica de Engenharia Quimica], e-mail: meiry@deq.ufcg.edu.br; Fernandes, F.A.N. [Universidade Federal do Ceara (UFCE), CE (Brazil). Dept. de Engenharia Quimica
2011-07-15
The objective of this work is to describe the production of bifunctional catalysts using the incipient humidity method, producing catalysts with 15 wt.% cobalt supported in SBA-15 molecular sieve, to be applied in the Fischer-Tropsch (FT) reaction. The originality of this work is its focus on the use of a 15 wt.% Co/SBA-15 catalyst in FT synthesis in slurry reactors. The deposition of cobalt over SBA-15 support was accomplished by impregnation with a 0.1-M aqueous solution of cobalt nitrate. The Fischer-Tropsch synthesis was carried out with the catalyst at 240 deg C and 20 atm, under a COH{sub 2} atmosphere (molar ratio= 1), in a slurry reactor for 8 hours. X-ray diffraction measurements showed that the calcined cobalt catalyst did not modify the structure of SBA-15, proving that Co was present under the form of Co{sub 3}O{sub 4} in the catalyst. The addition of cobalt in the SBA-15 decreased the specific superficial area of the molecular sieve. The 15 wt.% Co/SBA-15 catalyst had a 40% CO conversion rate and a high selectivity towards the production of C{sub 5}{sup +} (53.9% after 8 hours). (author)
Charon, E.; Aléon, J.; Rouzaud, J.-N.
2014-10-01
The structure and nanostructures of carbon phases from the Acapulco and Lodran meteorites and their carbon and nitrogen isotopic composition were investigated at the nanometer and micrometer scale using a systematic combination of Raman microspectrometry, high-resolution transmission electron microscopy and secondary ion mass spectrometry to determine their origin and thermal evolution. Several morphological types were recognized belonging to roughly two isotopic and structural families: coarse carbon grains and rosettes, only found in Acapulco, and vein-like carbon occurrences present in both Acapulco and Lodran. Carbon phases in Acapulco are highly graphitized, and show a genetic relationship with metal indicative of metal-assisted graphitization. By contrast, carbon phases in Lodran are exclusively disordered mesoporous turbostratic carbons, in spite of their inclusion in metal and the higher peak temperature experienced by the Lodran parent body. δ13C values range between -59‰ and +37‰ in Acapulco and between -38‰ and -1‰ in Lodran and show in both cases a peak in their distribution at the value of chondritic insoluble organic matter (IOM, -10‰ to -15‰). N concentrations together with δ15N values indicate a mixing between a component akin to chondritic IOM in Lodran with a δ15N value around +10‰ to +20‰ and a component akin to that in the most N-poor Acapulco graphites. The latter are systematically depleted in 15N with a δ15N value constant at ∼-140‰ for N concentrations below ∼1.4 wt%. These observations can be explained if carbon phases in Acapulco and Lodran result from the late impact introduction of CI-CM like IOM, after significant cooling of the parent-body, and subsequent carbonization and graphitization of IOM by interaction with FeNi metal by the heat wave induced by the impact. Temperatures probably reached 900 °C in Acapulco, enough to achieve metal-assisted graphitization but were not significantly higher than 650 °C in
Mapping the Superconducting Anti-ferromagnetic C4 Phase in Iron-Pnictides
Stadel, Ryan; Taddei, Keith; Bugaris, Dan; Lapidus, Saul; Claus, Helmut; Phelan, Daniel; Chung, Duck Young; Kanatzidis, Mercouri; Osborn, Raymond; Rosenkranz, Stephan; Chmaissem, Omar
Following the discovery of the microscopic coexistence of antifermagnetic spin density waves and superconductivity in Ba1-xKxFe2As2 and the low temperature re-entrance to the novel magnetic C4 tetragonal phase in Ba1-xNaxFe2As2, there has been significant interest in developing an understanding of the properties and formation of these phases and analyzing their dependence on temperature and composition in hole-doped 122 alkaline earth metal/iron-pnictides. We describe the mapping of various Ba, Sr, and Ca 122 phase diagrams with systematically controlled levels of hole-doping of alkaline metal onto the alkaline earth metal site, which was investigated via x-ray and neutron diffraction. Our elaborate synthesis, diffraction work, and analysis maps and firmly establishes the C4 phase space in these ternary diagrams as well as the boundary lines that separate the individual phases, and provides natural clues as well as a framework to investigate the stability and formation of the C4 domes that shift location with doping contents in the phase diagrams. Work at Argonne was supported by US DOE, Office of Science, Materials Sciences and Engineering Division.
Investigation of microstructure in hot-pressed Nb–23Ti–15Al alloy
International Nuclear Information System (INIS)
Shi, Zhiwu; Wei, Hua; Zhang, Hongyu; Wu, Duoli; Jin, Tao; Sun, Xiaofeng; Zheng, Qi
2015-01-01
Highlights: • The Ti(O, C), a new strengthening phase, is found in Nb–Ti–Al alloys. • Ti(O, C) has a face-centered cubic structure and a lattice parameter of 4.27 Å. • Two different morphologies of Ti(O, C) are observed. • β and δ phases exhibit as large irregular blocks and equiaxed particles. • Ordering of β phase is observed in hot-pressed Nb–Ti–Al alloy. - Abstract: Microstructure of hot-pressed Nb–23Ti–15Al alloy has been systematically investigated, with emphasis on the characterization of Ti(O, C) phase. The microstructure and composition of Nb–23Ti–15Al alloy were characterized using scanning electron microscopy (SEM), X-ray diffraction (XRD), transmission electron microscopy (TEM) and electron probe microanalysis (EPMA). The results indicate the presence of β, δ and Ti(O, C) phases in the alloy. The β phase exhibits as large irregular blocks, while the δ phase presents as small equiaxed particles linked together around β blocks. Ordering of β phase is shown by related selected area electronic diffraction (SAED) patterns and dark-field micrograph. The Ti(O, C), a solid-solution of TiO or TiC, is characterized for the first time in Nb–Ti–Al alloy. The Ti(O, C) has a face-centered cubic (FCC) structure and a moderate lattice parameter between that of TiO and TiC. Two different morphologies of Ti(O, C) are observed in the alloy: large cobblestone-like aggregated particles and small dispersive particles. The formation of Ti(O, C) phase can potentially increase high-temperature strength of Nb–Ti–Al alloy
Investigation of microstructure in hot-pressed Nb–23Ti–15Al alloy
Energy Technology Data Exchange (ETDEWEB)
Shi, Zhiwu; Wei, Hua; Zhang, Hongyu; Wu, Duoli; Jin, Tao; Sun, Xiaofeng; Zheng, Qi, E-mail: qzheng@imr.ac.cn
2015-07-05
Highlights: • The Ti(O, C), a new strengthening phase, is found in Nb–Ti–Al alloys. • Ti(O, C) has a face-centered cubic structure and a lattice parameter of 4.27 Å. • Two different morphologies of Ti(O, C) are observed. • β and δ phases exhibit as large irregular blocks and equiaxed particles. • Ordering of β phase is observed in hot-pressed Nb–Ti–Al alloy. - Abstract: Microstructure of hot-pressed Nb–23Ti–15Al alloy has been systematically investigated, with emphasis on the characterization of Ti(O, C) phase. The microstructure and composition of Nb–23Ti–15Al alloy were characterized using scanning electron microscopy (SEM), X-ray diffraction (XRD), transmission electron microscopy (TEM) and electron probe microanalysis (EPMA). The results indicate the presence of β, δ and Ti(O, C) phases in the alloy. The β phase exhibits as large irregular blocks, while the δ phase presents as small equiaxed particles linked together around β blocks. Ordering of β phase is shown by related selected area electronic diffraction (SAED) patterns and dark-field micrograph. The Ti(O, C), a solid-solution of TiO or TiC, is characterized for the first time in Nb–Ti–Al alloy. The Ti(O, C) has a face-centered cubic (FCC) structure and a moderate lattice parameter between that of TiO and TiC. Two different morphologies of Ti(O, C) are observed in the alloy: large cobblestone-like aggregated particles and small dispersive particles. The formation of Ti(O, C) phase can potentially increase high-temperature strength of Nb–Ti–Al alloy.
Misfit dislocations and phase transformations in high-T sub c superconducting films
Gutkin, M Y
2002-01-01
A theoretical model is suggested that describes the effects of misfit stresses on defect structures, phase content and critical transition temperature T sub c in high-T sub c superconducting films. The focus is placed on the exemplary case of YBaCuO films deposited onto LaSrAlO sub 4 substrates. It is theoretically revealed here that misfit stresses are capable of inducing phase transformations controlled by the generation of misfit dislocations in growing cuprate films. These transformations, in the framework of the suggested model, account for experimental data on the influence of the film thickness on phase content and critical temperature T sub c of superconducting cuprate films, reported in the literature. The potential role of stress-assisted phase transformations in suppression of critical current density across grain boundaries in high-T sub c superconductors is briefly discussed.
Wang, Mingliang; Cui, Hongzhi; Wei, Na; Ding, Lei; Zhang, Xinjie; Zhao, Yong; Wang, Canming; Song, Qiang
2018-01-31
Here, a unique combination of a novel carbon-nitrogen source (g-C 3 N 4 ) with different mole ratios of Ti/g-C 3 N 4 has been utilized to fabricate iron matrix composite coatings by a synchronized powder feeding plasma transferred arc (PTA) cladding technology. The results show that submicron Ti(C,N) particles are successfully fabricated in situ on a Q235 low carbon steel substrate to reinforce the iron matrix composite coatings and exhibit dense microstructures and good metallurgical bonding between the coating and the substrate. The microstructure of the coating consists of an α-Fe matrix and Ti(C,N) particles when the mole ratio of Ti/g-C 3 N 4 is no more than 5:1. The microhardness and wear resistance of the coating gradually improve with increasing abundance of the in-situ-synthesized Ti(C,N) particles. Interestingly, for a Ti/g-C 3 N 4 mole ratio of 6:1, a fine lamellar eutectic Laves phase (Fe 2 Ti) appears, and this phase further improves the microhardness and wear resistance of the coating. The microhardness of the coating is 3.5 times greater than that of the Q235 substrate, and the wear resistance is enhanced 7.66 times over that of the substrate. The Ti(C,N)/Fe 2 Ti and Fe 2 Ti/α-Fe interfaces are very clean, and the crystallographic orientation relationships between the phases are analyzed by high-resolution transmission electron microscopy (HRTEM) and an edge-to-edge matching model. The theoretical predictions and the experimental results are in good agreement. Furthermore, based on the present study, for the solidification process near equilibrium, smaller interatomic spacing misfits and interplanar spacing d-value mismatches contribute to the formation of crystallographic orientation relationships between phases during the PTA cladding process. The existence of orientation relationships is beneficial for improving the properties of the coatings. This work not only expands the application fields of g-C 3 N 4 but also provides a new idea for the
Sordi, V. L.; Bueno, L. O.
2010-07-01
The effect of niobium additions up to 2.36 wt% on the creep behavior of a series of seven extra low carbon 18Cr-12Ni austenitic stainless steels at 700°C has been investigated. Grain size and hardness measurements, hot tensile tests and constant stress creep tests from 90 to 180 MPa were carried out for each alloy, in the solution treated condition at 1050, 1200 and 1300°C followed by quench in water. The mechanical behavior at high temperature was related to the amount of NbC precipitation occurring during the tests. Solid solution and intermetallic compound effects were also considered. Creep data analysis was done to determine the parameters of the creep power-law equation dot epsilon = A.σn and the Monkman-Grant relation dot epsilon.tmR = K. Niobium-carbide precipitation in these steels reduces the secondary stage dependence of strain rate with applied stress, resulting in n-values which indicate the possibility of operation of various creep mechanisms. The creep strength during the secondary stage is primarily controlled by the amount of NbC available for precipitation. However, the rupture times increase progressively with niobium content, as the amount of undissolved carbide particles in grain boundaries and the Laves phase precipitation increase.
Solubility data for cement hydrate phases (25oC)
International Nuclear Information System (INIS)
Atkins, M.; Glasser, F.P.; Kindness, A.; Macphee, D.E.
1991-05-01
Solubility measurements were performed on most of the more thermodynamically-stable cement hydrate phases, at 25 o C. The results for each hydrate phase are summarised in the form of datasheets. Solubility properties are discussed, and where possible a K sp value is calculated. The data are compared with the data in the literature. (author)
Specic contact resistance of phase change materials to metal electrode
Roy, Deepu; in 't Zandt, Micha A.A.; Wolters, Robertus A.M.
2010-01-01
For phase change random access memory (PCRAM) cells, it is important to know the contact resistance of phase change materials (PCMs) to metal electrodes at the contacts. In this letter, we report the systematic determination of the specic contact resistance (Ͽc ) of doped Sb2Te and Ge2Sb2Te5 to TiW
Mercury and stable isotopes (δ15N and δ13C as tracers during the ontogeny of Trichiurus lepturus
Directory of Open Access Journals (Sweden)
Ana Paula Madeira Di Beneditto
Full Text Available This study applies total mercury (THg concentration and stable isotope signature (δ15N and δ13C to evaluate the trophic status and feeding ground of Trichiurus lepturus during its ontogeny in northern Rio de Janeiro, south-eastern Brazil. The trophic position of T. lepturus is detected well by THg and δ15N as the sub-adult planktivorous specimens are distinct from the adult carnivorous specimens. The δ13C signatures suggest a feeding ground associated with marine coastal waters that are shared by fish in different ontogenetic phases. The diet tracers indicated that the fish feeding habits do not vary along seasons of the year, probably reflecting the prey availability in the study area. This fish has economic importance and the concentration of THg was compared to World Health Organization limit, showing that the adult specimens of T. lepturus are very close to the tolerable limit for safe regular ingestion.
Isothermal cross-sections of Hf-Sc-Ga(800 deg C) and Hf-Ti-Ga (750 deg C) phase diagrams
International Nuclear Information System (INIS)
Markiv, V.Ya.; Belyavina, N.N.
1981-01-01
Isothermal cross sections of Hf-Sc-Ga (800 deg C) and Hf-Ti-Ga (750 deg C) state diagrams are plotted. The existence of two ternary Hfsub(0.1-0.8)Scsub(0.9)-sub(0.2)Ga and Hfsub(0.8)Scsub(0.2)Gasub(3) phases is stated in the Hf-Sc-Ga system. The crystal structure of these compounds investigated by the powder method belongs to the structural α-MoB and ZrAl 3 types respectively. Continuous rows of (Hf, Sc 5 Ga 5 , (Hf, Ti)Ga 3 and (Hf, Ti)Ga 2 solid solutions are formed in the investigated systems. Essential quantity of the third component dissolve binary Sc 5 Ga 4 , Sc 2 Ga 3 (15 and 30 at % Hf respectively), Hf 5 Ga 4 , HfGa 2 (20, 10 at. % Sc), Hf 5 Ga 4 , HfGa, Hf 5 Ga 3 , Hf 2 Ga 3 (48, 30, 46, 20 at. % Ti) gallides [ru
17 CFR 240.15c1-7 - Discretionary accounts.
2010-04-01
... transactions or purchase or sale which are excessive in size or frequency in view of the financial resources... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-7 Discretionary...
Avoiding Extremes: Benefits of Staying below +1.5 °C Compared to +2.0 °C and +3.0 °C Global Warming
Directory of Open Access Journals (Sweden)
Claas Teichmann
2018-03-01
Full Text Available The need to restrict global mean temperature to avoid irreversible climate change is supported by scientific evidence. The need became political practice at the Conference of the Parties in 2015, where the participants decided to limit global warming to not more than +2.0 °C compared to pre-industrial times and to rather aim for a limit of +1.5 °C global warming. Nevertheless, a clear picture of what European climate would look like under +1.5 °C, +2.0 °C and +3.0 °C global warming level (GWL is still missing. In this study, we will fill this gap by assessing selected climate indices related to temperature and precipitation extremes, based on state of the art regional climate information for Europe taken from the European branch of the World Climate Research Program Coordinated Regional Downscaling Experiment (EURO-CORDEX ensemble. To assess the impact of these indices under climate change, we investigate the spatial extent of the area of the climate change signal in relation to the affected population. This allows us to demonstrate which climate extremes could be avoided when global warming is kept well below +2.0 °C or even +1.5 °C compared to higher GWLs. The European north–south gradient of tropical nights and hot days is projected to be intensified with an increasing global warming level. For precipitation-related indices, an overall increase in precipitation extremes is simulated, especially under +3.0 °C GWL, for mid- and northern Europe, whereas an increase in dry days is projected for many regions in southern Europe. The benefit of staying below +1.5 °C GWL compared to +2.0 °C GWL is the avoidance of an additional increase in tropical nights and hot days parallel to an increase in dry days in parts of southern Europe as well as an increase in heavy precipitation in parts of Scandinavia. Compared to +3.0 °C GWL, the benefit of staying at +1.5 °C GWL is to avoid a substantial increase (i.e., an increase of more than five dry
Uncertain impacts on economic growth when stabilizing global temperatures at 1.5°C or 2°C warming.
Pretis, Felix; Schwarz, Moritz; Tang, Kevin; Haustein, Karsten; Allen, Myles R
2018-05-13
Empirical evidence suggests that variations in climate affect economic growth across countries over time. However, little is known about the relative impacts of climate change on economic outcomes when global mean surface temperature (GMST) is stabilized at 1.5°C or 2°C warming relative to pre-industrial levels. Here we use a new set of climate simulations under 1.5°C and 2°C warming from the 'Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) project to assess changes in economic growth using empirical estimates of climate impacts in a global panel dataset. Panel estimation results that are robust to outliers and breaks suggest that within-year variability of monthly temperatures and precipitation has little effect on economic growth beyond global nonlinear temperature effects. While expected temperature changes under a GMST increase of 1.5°C lead to proportionally higher warming in the Northern Hemisphere, the projected impact on economic growth is larger in the Tropics and Southern Hemisphere. Accounting for econometric estimation and climate uncertainty, the projected impacts on economic growth of 1.5°C warming are close to indistinguishable from current climate conditions, while 2°C warming suggests statistically lower economic growth for a large set of countries (median projected annual growth up to 2% lower). Level projections of gross domestic product (GDP) per capita exhibit high uncertainties, with median projected global average GDP per capita approximately 5% lower at the end of the century under 2°C warming relative to 1.5°C. The correlation between climate-induced reductions in per capita GDP growth and national income levels is significant at the p < 0.001 level, with lower-income countries experiencing greater losses, which may increase economic inequality between countries and is relevant to discussions of loss and damage under the United Nations Framework Convention on Climate Change.This article is part of
Correlation between protein kinase C alpha activity and membrane phase behavior.
Micol, V; Sánchez-Piñera, P; Villalaín, J; de Godos, A; Gómez-Fernández, J C
1999-02-01
Lipid activation of protein kinase C alpha (PKC alpha) was studied by using a model mixture containing 1, 2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC), 1, 2-dimyristoyl-sn-glycero-3-phosphoserine (DMPS), and 1, 2-dimyristoyl-sn-glycerol (1,2-DMG). This lipid mixture was physically characterized by differential scanning calorimetry (DSC), Fourier transform infrared spectroscopy (FTIR), and 31P-nuclear magnetic resonance (31P-NMR). Based on these techniques, a phase diagram was constructed by keeping a constant DMPC/DMPS molar ratio of 4:1 and changing the concentration of 1,2-DMG. This phase diagram displayed three regions and two compounds: compound 1 (C1), with 45 mol% 1,2-DMG, and compound 2 (C2), with 60 mol% 1,2-DMG. When the phase diagram was elaborated in the presence of Ca2+ and Mg2+, at concentrations similar to those used in the PKC alpha activity assay, the boundaries between the regions changed slightly and C1 had 35 mol% 1,2-DMG. The activity of PKC alpha was studied at several temperatures and at different concentrations of 1,2-DMG, with a maximum of activity reached at 30 mol% 1,2-DMG and lower values at higher concentrations. In the presence of Ca2+ and Mg2+, maximum PKC alpha activity occurred at concentrations of 1,2-DMG that were close to the boundary in the phase diagram between region 1, where compound C1 and the pure phospholipid coexisted in the gel phase, and region 2, where compounds C1 and C2 coexisted. These results suggest that the membrane structure corresponding to a mixture of 1,2-DMG/phospholipid complex and free phospholipid is better able to support the activity of PKC alpha than the 1,2-DMG/phospholipid complex alone.
Habashi-Daniel, Arlette; Roberts, Janet L; Desai, Nisha; Thompson, Curtis T
2014-11-01
Lichen planopilaris (LPP) is a lymphocyte-mediated cicatricial alopecia mostly involving the bulge region of the hair follicle. The origin of LPP is unknown. Therapy for LPP often does not prevent disease progression. We describe histologic and immunohistologic features that aid in diagnosis and provide an explanation for disease progression in LPP. We sought to demonstrate a decrease in the number of catagen-/telogen-phase follicles and to confirm the loss of cytokeratin 15 (CK15) expression in the stem cells of LPP-affected follicles. In all, 144 LPP cases were retrieved; 55 cases were stained immunohistochemically, targeting the CK15 antigen with 40 cases ultimately analyzed for CK15 expression. Catagen/telogen phase was significantly decreased or absent in all cases of LPP, a novel clue useful in histologic diagnostics. The loss of CK15+ stem cells in most affected follicles in LPP was also confirmed, with unaffected follicles retaining CK15+ stem cells. Limited tissue for analysis remained in the clinical sample tissue blocks. Damaged follicles that have lost their CK15+ stem cells disappear when they enter catagen phase. CK15+ stem cell loss explains the clinical observation that LPP progresses despite immunosuppressive therapies. Finally, the absence of catagen/telogen hair follicles is a helpful diagnostic clue for LPP. Published by Elsevier Inc.
States of 15C via the (18O,16O) reaction
Cappuzzello, F; Cunsolo, A; Foti, A; Orrigo, S E A; Rodrigues, M R D; Borello-Lewin, T; Carbone, D; Schillaci, C
2010-01-01
A study of the 15C states was pursued in 2008 at the Catania INFN-LNS laboratory by the 13C(18O,16O)15C reaction at 84 MeV incident energy. The 16O ejectiles were detected at forward angles by the MAGNEX magnetic spectrometer. Thanks to an innovative technique the ejectiles were identified without the need of time of flight measurements. Exploiting the large momentum acceptance (25%) and solid angle (50 msr) of the spectrometer, the 15C energy spectra were obtained with a quite relevant yield up to about 20 MeV excitation energy. The application of the powerful technique of the trajectory reconstruction did allow to get an energy resolution of about 250 keV FWHM, limited mainly by straggling effects. The spectra show several known low lying states up to about 7 MeV excitation energy as well as two unknown resonant structures at about 11.4 and 13.5 MeV. The strong excitation of these latter together with the measured width of about 2 MeV FWHM could indicate the presence of collective modes of excitation connec...
600 °C isothermal section of the Al–Cr–Zn ternary phase diagram
Energy Technology Data Exchange (ETDEWEB)
He, Zuxin [School of Materials Science and Engineering, Changzhou University, 213164 Jiangsu (China); Jiangsu Key Laboratory of Material Surface Science and Technology, Changzhou University, 213164 Jiangsu (China); Jiangsu Collaborative Innovation Center of Photovolatic Science and Engineering, Changzhou University, 213164 Jiangsu (China); Su, Xuping, E-mail: sxping@cczu.edu.cn [School of Materials Science and Engineering, Changzhou University, 213164 Jiangsu (China); Jiangsu Key Laboratory of Material Surface Science and Technology, Changzhou University, 213164 Jiangsu (China); Jiangsu Collaborative Innovation Center of Photovolatic Science and Engineering, Changzhou University, 213164 Jiangsu (China); Peng, Haoping; Liu, Ya; Wu, Changjun; Wang, Jianhua [School of Materials Science and Engineering, Changzhou University, 213164 Jiangsu (China); Jiangsu Key Laboratory of Material Surface Science and Technology, Changzhou University, 213164 Jiangsu (China)
2015-11-15
600 °C isothermal section of the Al–Cr–Zn system has been determined by Scanning Electron Microscopy-Energy Dispersive X-ray spectrometry (SEM-EDS), and X-ray Diffraction (XRD). Eleven three-phase regions have been identified experimentally at 600 °C. The τ{sub 3} and τ{sub 4} ternary compounds were identified in this isothermal section and the crystal structures of both phases are cubic. The lattice parameters of τ{sub 3} and τ{sub 4} are a = 2.1536 nm and a = 1.8323 nm, respectively. The formerly reported τ{sub 1} phase was not found. The formerly reported τ{sub 2} phase is an extension of Al{sub 7}Cr. The highest Zn content in γ{sub 2} and ν phases is 7.1 at at.% and 6.7 at.%, respectively. The Zn solubility in Al{sub 7}Cr phase can be up to 10.4 at.%, while that in Al{sub 4}Cr phase is less than 4 at.%. The clearly phase relation of the Al–Cr–Zn system can lead us to better understand the effect of Cr on the corrosion behavior of metals in the Zn–Al bath and the Hot-dip galvanizing process. - Highlights: • Isothermal section of the Al–Cr–Zn system at 600 °C was determined. • Eleven three-phase regions were identified experimentally at 600 °C. • Existence of the γ{sub 2} and ν phases was confirmed at 600 °C. • X-ray diffraction patterns of the ternary phases τ{sub 3} and τ{sub 4} were proposed for the first time.
International Nuclear Information System (INIS)
Jeong, S.W.; Lee, Z.-H.; Lee, H.M.
2000-01-01
The effect of heat treatment and Si and Mn additions on the ferrite and austenite phase fractions of the super duplex stainless steel (SDSS), Fe-25Cr-7Ni-1.5Mo-3W-Si-Mn-0.25N (numbers are all in wt.% unless specified otherwise), was investigated. The thermodynamic calculations of phase equilibria and phase fractions were performed using the Thermo-Calc program. Based on the calculated results, specific compositions of Si and Mn were selected and alloys with these compositions were analysed by Feritscope, X-ray diffractometry and scanning electron microscopy. The calculated phase fractions and experimentally analysed ones were compared and there was a good agreement between calculations and measurements. The optimum heat treatment condition for Fe-25Cr-7Ni-1.5Mo-3W-0.5Si-0.5Mn-0.25N is to hold at 1050 to 1100 C for 2 h in considering the ferrite to austenite ratio of 50:50 and to avoid second phase precipitation such as the σ phase. It was suggested that an excessive addition of more than 0.8Si and 1.0Mn may induce the σ phase precipitation. (orig.)
Nuclear orientation of 9597Nb and 95Zr in ZrFe2
International Nuclear Information System (INIS)
Krane, K.S.; Olsen, C.E.; Rosenblum, S.S.; Steyert, W.A.
1976-01-01
The angular distribution anisotropies of γ rays were measured following the decays of 95 , 97 Nb and 95 Zr oriented at low temperatures in the ferromagnetic Laves phase compound ZrFe 2 . The magnetic hyperfine field of Nb in ZrFe 2 was deduced to be 9.4+-1.6 T; that of Zr in ZrFe 2 was estimated to be 15+-4 T. The nuclear magnetic moment of 97 Nb was deduced to be μ = (7.5+-1.4) μ/subN/
Orientational Phase Transition Around 274 K in C60 Single Crystal
Institute of Scientific and Technical Information of China (English)
徐亚伯; 何丕模; 杨宏顺; 郑萍; 余朝文; 陈兆甲; 张宣嘉; 李文铸
1994-01-01
The electrical conductivity of a C60 single crystal around 274 K and the specific heat of C60 crystals from 150 to 340 K have been measured.The delta-like specific heat peak at about 251 K related to the first-order phase transition has been reported.The activation energy change around 274 K and the lambda-like specific heat peak beginning at 270 K and ending at 310 K show that there is an orientational phase transition in fcc C60 crystals above 251 K.By taking the symmetry into consideration and further analyzing lambda-like specific heat peak and the activation energy change around 274 K,the conclusion has been reached that this new phase transition is an orientational structure transition from the merohedral twinning fcc to the orientationally disordered fcc.The temperature of free rotation of C60 molecules is about 281 K.
Entropic stabilisation of topologically close-packed phases in binary transition-metal alloys
Energy Technology Data Exchange (ETDEWEB)
Hammerschmidt, Thomas; Fries, Suzana G.; Steinbach, Ingo; Drautz, Ralf [ICAMS, Ruhr-Universitaet Bochum, Bochum (Germany); Seiser, Bernhard; Pettifor, David G. [Department of Materials, University of Oxford, Oxford (United Kingdom)
2010-07-01
The formation of topologically close-packed (tcp) phases in Ni-based superalloys leads to the degradation of the mechanical properties of the alloys. The precipitation of the tcp phases is attributed to refractory elements that are added in low concentration to improve creep resistance. It is well known that the structural stability of the tcp phases A15, {sigma} and {chi} is driven by the average d-band filling. For a direct comparison to experimental phase diagrams, we carried out extensive density-functional theory (DFT) calculations of the tcp phases A15, C14, C15, C36, {mu}, {sigma}, and {chi} in tcp-forming binary transition-metal (TM) systems. We observe several systems such as W-Re with positive values of the heat of formation for all tcp phases although some of the phases are observed experimentally. By combining our DFT total energies with the CALPHAD methodology, we can demonstrate that configurational entropy can stabilise the tcp phases in these systems.
Exploration of phase transition in Th2C under pressure: An Ab-initio investigation
Sahoo, B. D.; Joshi, K. D.; Kaushik, T. C.
2018-05-01
With the motivation of searching for new compounds in the Th-C system, we have performed ab initio evolutionary searches for all the stable compounds in this binary system in the pressure range of 0-100 GPa. We have found previously unknown, thermodynamically stable, composition Th2C along with experimentally known ThC, ThC2 and Th2C3 phases at 0 GPa. Interestingly at pressure of 13 GPa the predicted ground state orthorhombic (SG no. 59, Pmmn) phase of Th2C transforms to trigonal (SG no. 164, P-3m1) phase. We also find the mechanical and dynamical stability of both the phases. Further, the theoretically determined equation of state has been utilized to derive various physical quantities such as zero pressure equilibrium volume, bulk modulus, and pressure derivative of bulk modulus of Pmmn phase at ambient conditions.
Song, Chengjie; Fan, Mingshan; Shi, Weidong; Wang, Wei
2018-05-01
We have successfully synthesized the composites of two-phase g-C 3 N 4 heterojunction photocatalysts by one-step method. And the reduced graphene oxide/two-phase g-C 3 N 4 heterojunction photocatalyst was fabricated via a facile hydrothermal reduction method. The characterization results indicated that the two-phase g-C 3 N 4 was integrated closely, and the common phenomenon of agglomeration for g-C 3 N 4 was significantly reduced. Moreover, the oxidized graphene was reduced successfully in the composites and the graphene was overlaid on the surface or the interlayers of g-C 3 N 4 heterojunction composite uniformly. In addition, we have carried out the photocatalytic activity experiments by H 2 evolution and rhodamine B removal, tetracycline removal under the visible light irradiation. The results revealed that the composite has improved the separation efficiency a lot than the pure photocatalyst. The photocurrent test demonstrated that the recombination of electrons and holes were efficiently inhibited as well as enhanced the photocatalytic activity. The 0.4% rGO loaded samples, 0.4% rGOCN2, own the best performance. Its rate of H 2 evolution was 15 times as high as that of the pure g-C 3 N 4 .
International Nuclear Information System (INIS)
Myint Wazo; Cai Yufeng; Schiffer, Celia A.; Ishima, Rieko
2012-01-01
Nitrogen-15 Carr-Purcell-Meiboom-Gill (CPMG) transverse relaxation experiment are widely used to characterize protein backbone dynamics and chemical exchange parameters. Although an accurate value of the transverse relaxation rate, R 2 , is needed for accurate characterization of dynamics, the uncertainty in the R 2 value depends on the experimental settings and the details of the data analysis itself. Here, we present an analysis of the impact of CPMG pulse phase alternation on the accuracy of the 15 N CPMG R 2 . Our simulations show that R 2 can be obtained accurately for a relatively wide spectral width, either using the conventional phase cycle or using phase alternation when the r.f. pulse power is accurately calibrated. However, when the r.f. pulse is miscalibrated, the conventional CPMG experiment exhibits more significant uncertainties in R 2 caused by the off-resonance effect than does the phase alternation experiment. Our experiments show that this effect becomes manifest under the circumstance that the systematic error exceeds that arising from experimental noise. Furthermore, our results provide the means to estimate practical parameter settings that yield accurate values of 15 N transverse relaxation rates in the both CPMG experiments.
Effect of Drawer Master Modeling of ZPPR15 Phase A Reactor Physics Experiment on Integral Parameter
International Nuclear Information System (INIS)
Yoo, Jae Woon; Kim, Sang Ji
2011-01-01
As a part of an International-Nuclear Engineering Research Initiative (I-NERI) Project, KAERI and ANL are analyzing the ZPPR-15 reactor physics experiments. The ZPPR-15 experiments were carried out in support of the Integral Fast Reactor (IFR) project. Because of lack of the experimental data, verifying and validating the core neutronics analysis code for metal fueled sodium cooled fast reactors (SFR) has been one of the big concerns. KAERI is developing the metal fuel loaded SFR and plans to construct the demonstration SFR by around 2028. Database built through this project and its result of analysis will play an important role in validating the SFR neutronics characteristics. As the first year work of I-NERI project, KAERI analyzed ZPPR-15 Phase A experiment among four phases (Phase A to D). The effect of a drawer master modeling on the integral parameter was investigated. The approximated benchmark configurations for each loading were constructed to be used for validating a deterministic code
Ammonium nitrate with 15 wt % potassium nitrate-ethylenediamine dinitrate-nitroguanidine system
Energy Technology Data Exchange (ETDEWEB)
Spencer, W.; Cady, H.H.
1981-01-01
The phase diagram for the ternary system ammonium nitrate(AN) with 15 wt % potassium nitrate(AN:15KN)-ethylenediamine dinitrate(EDD)-nitroguanidine(NQ) has been determined from room temperature to the melting point. The ternary eutectic temperature, measured for a mixture containing 67.24, 25.30, and 7.46 mole % of AN:15KN, EDD, and NQ, respectively, was found to be 98.9/sup 0/C. The binary phase diagrams for the systems AN:15KN-EDD, AN:15KN-NQ, and EDD-NQ were also determined.
Record-breaking climate extremes in Africa under stabilized 1.5 °C and 2 °C global warming scenarios
Nangombe, Shingirai; Zhou, Tianjun; Zhang, Wenxia; Wu, Bo; Hu, Shuai; Zou, Liwei; Li, Donghuan
2018-05-01
Anthropogenic forcing is anticipated to increase the magnitude and frequency of extreme events1, the impacts of which will be particularly hard-felt in already vulnerable locations such as Africa2. However, projected changes in African climate extremes remain little explored, particularly in the context of the Paris Agreement targets3,4. Here, using Community Earth System Model low warming simulations5, we examine how heat and hydrological extremes may change in Africa under stabilized 1.5 °C and 2 °C scenarios, focusing on the projected changing likelihood of events that have comparable magnitudes to observed record-breaking seasons. In the Community Earth System Model, limiting end-of-century warming to 1.5 °C is suggested to robustly reduce the frequency of heat extremes compared to 2 °C. In particular, the probability of events similar to the December-February 1991/1992 southern African and 2009/2010 North African heat waves is estimated to be reduced by 25 ± 5% and 20 ± 4%, respectively, if warming is limited to 1.5 °C instead of 2 °C. For hydrometeorological extremes (that is, drought and heavy precipitation), by contrast, signal differences are indistinguishable from the variation between ensemble members. Thus, according to this model, continued efforts to limit warming to 1.5 °C offer considerable benefits in terms of minimizing heat extremes and their associated socio-economic impacts across Africa.
17 CFR 240.15c1-9 - Use of pro forma balance sheets.
2010-04-01
... pro forma balance sheets. The term manipulative, deceptive, or other fraudulent device or contrivance... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Use of pro forma balance sheets. 240.15c1-9 Section 240.15c1-9 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...
Okusa, Kensuke; Iwasaki, Yuki; Kuroda, Ikuma; Miwa, Shohei; Ohira, Masayoshi; Nagai, Toshiharu; Mizobe, Hoyo; Gotoh, Naohiro; Ikegami, Tohru; McCalley, David V; Tanaka, Nobuo
2014-04-25
A high-density, polymeric C18 stationary phase (Inertsil ODS-P) or a polymeric C30 phase (Inertsil C30) provided improved resolution of the isomeric fatty acids (FAs), FA methyl esters (FAMEs), triacylglycerols (TAGs), and tocopherols with an increase in pressure of 20-70MPa in reversed-phase HPLC. With respect to isomeric C18 FAMEs with one cis-double bond, ODS-P phase was effective for recognizing the position of a double bond among petroselinic (methyl 6Z-octadecenoate), oleic (methyl 9Z-octadecenoate), and cis-vaccenic (methyl 11Z-octadecenoate), especially at high pressure, but the differentiation between oleic and cis-vaccenic was not achieved by C30 phase regardless of the pressure. A monomeric C18 phase (InertSustain C18) was not effective for recognizing the position of the double bond in monounsaturated FAME, while the separation of cis- and trans-isomers was achieved by any of the stationary phases. The ODS-P and C30 phases provided increased separation for TAGs and β- and γ-tocopherols at high pressure. The transfer of FA, FAME, or TAG molecules from the mobile phase to the ODS-P stationary phase was accompanied by large volume reduction (-30∼-90mL/mol) resulting in a large increase in retention (up to 100% for an increase of 50MPa) and improved isomer separation at high pressure. For some isomer pairs, the ODS-P and C30 provided the opposite elution order, and in each case higher pressure improved the separation. The two stationary phases showed selectivity for the isomers having rigid structures, but only the ODS-P was effective for differentiating the position of a double bond in monounsaturated FAMEs. The results indicate that the improved isomer separation was provided by the increased dispersion interactions between the solute and the binding site of the stationary phase at high pressure. Copyright © 2014 Elsevier B.V. All rights reserved.
Wang, Qing; Long, Yao; Yao, Lin; Xu, Li; Shi, Zhi-Guo; Xu, Lanying
2016-01-01
A mixed-mode chromatographic stationary phase, C18-DTT (dithiothreitol) silica (SiO2) was prepared through "thiol-ene" click chemistry. The obtained material was characterized by fourier transform infrared spectroscope, nitrogen adsorption analysis and contact angle analysis. Chromatographic performance of the C18-DTT was systemically evaluated by studying the effect of acetonitrile content, pH, buffer concentration of the mobile phase and column temperature. It was demonstrated that the novel stationary phase possessed reversed phase liquid chromatography (RPLC)/hydrophilic interaction liquid chromatography (HILIC) mixed-mode property. The stop-flow test revealed that C18-DTT exhibited excellent compatibility with 100% aqueous mobile phase. Additionally, the stability and column-to-column reproducibility of the C18-DTT material were satisfactory, with relative standard deviations of retention factor of the tested analytes (verapamil, fenbufen, guanine, tetrandrine and nicotinic acid) in the range of 1.82-3.72% and 0.85-1.93%, respectively. Finally, the application of C18-DTT column was demonstrated in the separation of non-steroidal anti-inflammatory drugs, aromatic carboxylic acids, alkaloids, nucleo-analytes and polycyclic aromatic hydrocarbons. It had great resolving power in the analysis of various compounds in HILIC and RPLC chromatographic conditions and was a promising RPLC/HILIC mixed-mode stationary phase. Copyright © 2015 Elsevier B.V. All rights reserved.
Future emissions pathways consistent with limiting warming to 1.5°C
Millar, R.; Fuglestvedt, J. S.; Grubb, M.; Rogelj, J.; Skeie, R. B.; Friedlingstein, P.; Forster, P.; Frame, D. J.; Pierrehumbert, R.; Allen, M. R.
2016-12-01
The stated aim of the 2015 UNFCCC Paris Agreement is `holding the increase in global average temperature to well below 2°C above pre-industrial levels and to pursue efforts to limit temperature increases to 1.5°C'. We show that emissions reductions proportional to those achieved in an ambitious mitigation scenario, RCP2.6, but beginning in 2017, give a median estimated peak warming of 1.5°C, with a likely (66% probability) range of uncertainty of 1.2-2.0°C. Such a scenario would be approximately consistent with the most ambitious interpretation of the 2030 emissions pledges, but requires reduction rates exceeding 0.3GtC/yr/yr after 2030. A steady reduction at less than half this rate would achieve the same temperature outcome if initiated in 2020. Limiting total CO2 emissions after 2015 to 200GtC would limit future warming to likely less than 0.6°C above present, consistent with 1.5°C above pre-industrial, based on the distribution of responses of the CMIP5 Earth System, but the CMIP5 simulations do not correspond to scenarios that aim to limit warming to such low levels. If future CO2 emissions are successfully adapted to the emerging climate response so as to limit warming in 2100 to 0.6°C above present, and non-CO2 emissions follow the ambitious RCP2.6 scenario, then we estimate that resulting CO2 emissions will unlikely be restricted to less than 250GtC given current uncertainties in climate system response, although still-poorly-modelled carbon cycle feedbacks, such as release from permafrost, may encroach on this budget. Even under a perfectly successful adaptive mitigation regime, emissions consistent with limiting warming to 0.6°C above present are unlikely to be greater than 500GtC.These estimates suggest the 1.5°C goal may not yet be geophysically insurmountable but will nevertheless require, at minimum, the full implementation of the most ambitious interpretation of the Paris pledges followed by accelerated and more fundamental changes in our
High-$T_c$ superconductivity by phase cloning
Ilieva, N; Ilieva, Nevena; Thirring, Walter
2007-01-01
We consider a BCS-type model in the spin formalism and argue that the structure of the interaction provides a mechanism for control over directions of the spin $\\vect S$ other than $S_z$, which is being controlled via the conventional chemical potential. We also find the conditions for the appearance of a high-$T_c$ superconducting phase.
International Nuclear Information System (INIS)
Wasilkowska, A.; Bartsch, M.; Stein, F.; Palm, M.; Sauthoff, G.; Messerschmidt, U.
2004-01-01
Fe-10 at.% Al-2.5 at.% Zr and Fe-20 at.% Al-2.5 at.% Zr alloys were deformed between room temperature and 700 deg. C. The materials show a flow stress plateau at about 300 MPa up to 600 deg. C for the material with 10 at.% Al and above 600 MPa up to 400 deg. C for the alloy with 20% Al. The high flow stresses compared to Fe-Al reference materials are partly due to the addition of Zr. The strain rate sensitivity of the flow stress was measured by stress relaxation and strain rate cycling tests. It is low up to 400 deg. C and high between 450 and 600 deg. C, i.e. in the range of the flow stress decrease. The microstructures of the undeformed materials are described in Part I of this paper. Micrographs of the deformed specimens taken in a high-voltage electron microscope reveal that the deformation occurs mainly within the soft Fe-Al grains and in the Fe-Al component of the grain boundary eutectic. The deformation data are interpreted in terms of solution hardening from the Al solute, dynamic strain ageing due to the Cottrell effect of the same defects, the athermal stress component of elastic dislocation interactions, the Hall-Petch contribution from the grain size, and the strengthening effect of the grain boundary layers
LABORATORY GAS-PHASE DETECTION OF THE CYCLOPROPENYL CATION (c-C{sub 3}H{sub 3} {sup +})
Energy Technology Data Exchange (ETDEWEB)
Zhao, Dongfeng; Doney, Kirstin D.; Linnartz, Harold, E-mail: zhao@strw.leidenuniv.nl [Sackler Laboratory for Astrophysics, Leiden Observatory, University of Leiden, PO Box 9513, NL 2300 RA Leiden (Netherlands)
2014-08-20
The cyclopropenyl cation (c-C{sub 3}H{sub 3} {sup +}) is the smallest aromatic hydrocarbon molecule and considered to be a pivotal intermediate in ion-molecule reactions in space. An astronomical identification has been prohibited so far, because of a lack of gas-phase data. Here we report the first high resolution infrared laboratory gas-phase spectrum of the ν {sub 4} (C-H asymmetric stretching) fundamental band of c-C{sub 3}H{sub 3} {sup +}. The c-C{sub 3}H{sub 3} {sup +} cations are generated in supersonically expanding planar plasma by discharging a propyne/helium gas pulse, yielding a rotational temperature of ∼35 K. The absorption spectrum is recorded in the 3.19 μm region using sensitive continuous-wave cavity ring-down spectroscopy. The analysis of about 130 ro-vibrational transitions results in precise spectroscopic parameters. These constants allow for an accurate comparison with high-level theoretical predictions, and provide the relevant information needed to search for this astrochemically relevant carbo-cation in space.
Scenario dependence of future changes in climate extremes under 1.5 °C and 2 °C global warming.
Wang, Zhili; Lin, Lei; Zhang, Xiaoye; Zhang, Hua; Liu, Liangke; Xu, Yangyang
2017-04-20
The 2015 Paris Agreement aims to limit global warming below 2 °C and pursue efforts to even limit it to 1.5 °C relative to pre-industrial levels. Decision makers need reliable information on the impacts caused by these warming levels for climate mitigation and adaptation measures. We explore the changes in climate extremes, which are closely tied to economic losses and casualties, under 1.5 °C and 2 °C global warming and their scenario dependence using three sets of ensemble global climate model simulations. A warming of 0.5 °C (from 1.5 °C to 2 °C) leads to significant increases in temperature and precipitation extremes in most regions. However, the projected changes in climate extremes under both warming levels highly depend on the pathways of emissions scenarios, with different greenhouse gas (GHG)/aerosol forcing ratio and GHG levels. Moreover, there are multifold differences in several heavily polluted regions, among the scenarios, in the changes in precipitation extremes due to an additional 0.5 °C warming from 1.5 °C to 2 °C. Our results demonstrate that the chemical compositions of emissions scenarios, not just the total radiative forcing and resultant warming level, must be considered when assessing the impacts of global 1.5/2 °C warming.
International Nuclear Information System (INIS)
Siefken, U.
1979-01-01
The search for new superconducting materials with high transition temperatures is concentrated on alloys with a cubic A15 structure (Cr 3 Si structure). In this paper we present the preparation of metastable A15-Nb 3 Si which is expected to have a very high transition temperature Tsub(c). The properties of the A15 structure which are relevant for superconductivity are described, in particular the orthogonal chains as the most important structural characteristic, metastability, and the relation between lattice defects and transition temperature. For target compositions of 75% Nb / 25% Si and 80% Nb / 20% Si A15-Nb 3 Si transition temperatures of Tsub(c) = 5.3 K and Tsub(c) = 7.5 K have been measured respectively, with lattice constants asub(o) = 5.19 A and asub(o) = 5.18 A. (orig.) [de
Resonances in the nuclear reactions 15N + 12C and 15N + 16O
International Nuclear Information System (INIS)
Monnehan, G.A.
1987-06-01
The reaction 12 C + 15 N have been studied at 15 N beam energies between 30 and 70 MeV. For each reaction, about twelve residual nuclei have been identified through the γ-ray detection method. Excitation functions were obtained for the fusion and peripheral channels. Resonances are seen in the channels containing at least one α particle at energies below 50 MeV. At higher energies, strong structures are observed in the direct reaction channels. The evolution of the fusion cross section is well reproduced by a model based on the statistical desexcitation of the compound nucleus if the discrete states of the residual nuclei are taken into account. The favourable observation of resonant phenomena in 15 N induced reactions can be understood in terms of a small number of channels open to the grazing wave. In the range 50 to 60 MeV, there is a strong coupling between the fusion and the direct reaction channels. The occurrence of resonances above E lab = 50 MeV in the peripheral channels is explained with the band crossing and effective barrier models. In the 15 N induced reactions, the absorption of the surface waves is weak [fr
Non-Toxic, Non-Flammable, -80 C Phase Change Materials
Cutbirth, J. Michael
2013-01-01
The objective of this effort was to develop a non-toxic, non-flammable, -80 C phase change material (PCM) to be used in NASA's ICEPAC capsules for biological sample preservation in flight to and from Earth orbit. A temperature of about -68 C or lower is a critical temperature for maintaining stable cell, tissue, and cell fragment storage.
Biogeochemical potential of biomass pyrolysis systems for limiting global warming to 1.5 °C
Werner, C.; Schmidt, H.-P.; Gerten, D.; Lucht, W.; Kammann, C.
2018-04-01
Negative emission (NE) technologies are recognized to play an increasingly relevant role in strategies limiting mean global warming to 1.5 °C as specified in the Paris Agreement. The potentially significant contribution of pyrogenic carbon capture and storage (PyCCS) is, however, highly underrepresented in the discussion. In this study, we conduct the first quantitative assessment of the global potential of PyCCS as a NE technology based on biomass plantations. Using a process-based biosphere model, we calculate the land use change required to reach specific climate mitigation goals while observing biodiversity protection guardrails. We consider NE targets of 100–300 GtC following socioeconomic pathways consistent with a mean global warming of 1.5 °C as well as the option of additional carbon balancing required in case of failure or delay of decarbonization measures. The technological opportunities of PyCCS are represented by three tracks accounting for the sequestration of different pyrolysis products: biochar (as soil amendment), bio-oil (pumped into geological storages) and permanent-pyrogas (capture and storage of CO2 from gas combustion). In addition, we analyse how the gain in land induced by biochar-mediated yield increases on tropical cropland may reduce the pressure on land. Our results show that meeting the 1.5 °C goal through mitigation strategies including large-scale NE with plantation-based PyCCS may require conversion of natural vegetation to biomass plantations in the order of 133–3280 Mha globally, depending on the applied technology and the NE demand. Advancing towards additional bio-oil sequestration reduces land demand considerably by potentially up to 60%, while the benefits from yield increases account for another 3%–38% reduction (equalling 82–362 Mha). However, when mitigation commitments are increased by high balancing claims, even the most advanced PyCCS technologies and biochar-mediated co-benefits cannot compensate for
Vulnerabilities and resilience of European power generation to 1.5 °C, 2 °C and 3 °C warming
Tobin, I.; Greuell, W.; Jerez, S.; Ludwig, F.; Vautard, R.; van Vliet, M. T. H.; Bréon, F.-M.
2018-04-01
The electricity sector is currently considered mainly on the emission side of the climate change equation. In order to limit climate warming to below 2 °C, or even 1.5 °C, it must undergo a rapid transition towards carbon neutral production by the mid-century. Simultaneously, electricity generating technologies will be vulnerable to climate change. Here, we assess the impacts of climate change on wind, solar photovoltaic, hydro and thermoelectric power generation in Europe using a consistent modelling approach across the different technologies. We compare the impacts for different global warming scenarios: +1.5 °C, +2 °C and +3 °C. Results show that climate change has negative impacts on electricity production in most countries and for most technologies. Such impacts remain limited for a 1.5 °C warming, and roughly double for a 3 °C warming. Impacts are relatively limited for solar photovoltaic and wind power potential which may reduce up to 10%, while hydropower and thermoelectric generation may decrease by up to 20%. Generally, impacts are more severe in southern Europe than in northern Europe, inducing inequity between EU countries. We show that a higher share of renewables could reduce the vulnerability of power generation to climate change, although the variability of wind and solar PV production remains a significant challenge.
C-O volatiles in Apollo 15 and Apollo 17 picritic glasses
Rutherford, Malcolm J.; Fogel, Robert A.
1993-01-01
A15 and A17 primitive picritic glasses have been examined by FTIR for the presence of dissolved C-O species to determine the role of C-O gasses on driving lunar fire-fountains. A15 green and yellow glasses were extensively studied and found to be free of dissolved C species down to FTIR detection limits (10-100 ppm; species and sample specific). Preliminary data on A17 orange glasses are similarly devoid of FTIR detectable C-O species. Re-analyses of the C-O driving mechanism theory for mare volcanism demonstrates the need to determine the fO2 of the lunar interior; the factor that most critically determined the role of C gasses in the fire-fountaining events. Oxygen fugacities equivalent to IW-0.5 and above imply dissolved CO3(=) in the primitive glasses at levels above FTIR detection. The f02's below IW-0.5 imply concentrations of CO3(=) below FTIR detection. Recent data suggesting lunar mantle fO2's of IW-2 or less, strongly mitigate against finding FTIR measurable dissolved CO3(=) consistent with the findings of this study.
SiC/SiC composites through transient eutectic-phase route for fusion applications
International Nuclear Information System (INIS)
Katoh, Y.; Kohyama, A.; Nozawa, T.; Sato, M.
2004-01-01
Factors that may limit attractiveness of silicon-carbide-based ceramic composites to fusion applications include thermal conductivity, applicable design stress, chemical compatibility, hermeticity, radiation stability and fabrication cost. A novel SiC/SiC composite, which has recently been developed through nano-infiltration and transient eutectic-phase (NITE) processing route, surpasses conventional materials in many of these properties. In this paper, the latest development, property evaluation and prospect of the NITE SiC/SiC composites are briefly reviewed. The topics range from fundamental aspects of process development to industrial process development. Elevated temperature strength, fracture behavior, and thermo-physical properties in various environments are summarized. Future directions of materials and application technology development are also discussed
Phase relationship in AL-Cu-Sc alloys at 450-500 deg C
International Nuclear Information System (INIS)
Kharakterova, M.L.
1991-01-01
Al-Cu-Sc alloys containing up to 40% Cu and up to 6% Sc at 450 deg C and 500 deg C are studied using light microscopy, X-ray-spectral microanalysis, X-ray diffraction analysis, scanning electron microscopy, measurement of microhardness and electric resistance. It is determined, that in equilibrium with aluminium solid solution under the given temperature ther are Al 3 Sc, CuAl 2 phases of the respective binary systems and W (ScCu 6.6-4 Al 5.4-8 ) ternary phase. Isothermal cross sections of Al-Cu-Sc system at 450 and 500 deg C are plotted. Microhardness of equilibrium phases is measured. Combined solubility of copper and scandium in aluminium is determined
Directory of Open Access Journals (Sweden)
Gérald Franz
2013-11-01
Full Text Available An advanced elastic-plastic self-consistent polycrystalline model, accounting for intragranular microstructure development and evolution, is coupled with a bifurcation-based localization criterion and applied to the numerical investigation of the impact of microstructural patterns on ductility of single-phase steels. The proposed multiscale model, taking into account essential microstructural aspects, such as initial and induced textures, dislocation densities, and softening mechanisms, allows us to emphasize the relationship between intragranular microstructure of B.C.C. steels and their ductility. A qualitative study in terms of forming limit diagrams for various dislocation networks, during monotonic loading tests, is conducted in order to analyze the impact of intragranular substructure parameters on the formability of single-phase B.C.C. steels.
Scenario dependence of future changes in climate extremes under 1.5 °C and 2 °C global warming
Wang, Zhili; Lin, Lei; Zhang, Xiaoye; Zhang, Hua; Liu, Liangke; Xu, Yangyang
2017-01-01
The 2015 Paris Agreement aims to limit global warming below 2 °C and pursue efforts to even limit it to 1.5 °C relative to pre-industrial levels. Decision makers need reliable information on the impacts caused by these warming levels for climate mitigation and adaptation measures. We explore the changes in climate extremes, which are closely tied to economic losses and casualties, under 1.5 °C and 2 °C global warming and their scenario dependence using three sets of ensemble global climate model simulations. A warming of 0.5 °C (from 1.5 °C to 2 °C) leads to significant increases in temperature and precipitation extremes in most regions. However, the projected changes in climate extremes under both warming levels highly depend on the pathways of emissions scenarios, with different greenhouse gas (GHG)/aerosol forcing ratio and GHG levels. Moreover, there are multifold differences in several heavily polluted regions, among the scenarios, in the changes in precipitation extremes due to an additional 0.5 °C warming from 1.5 °C to 2 °C. Our results demonstrate that the chemical compositions of emissions scenarios, not just the total radiative forcing and resultant warming level, must be considered when assessing the impacts of global 1.5/2 °C warming. PMID:28425445
High temperature resistive phase transition in A15 high temperature superconductors
International Nuclear Information System (INIS)
Chu, C.W.; Huang, C.Y.; Schmidt, P.H.; Sugawara, K.
1976-01-01
Resistive measurements were made on A15 high temperature superconductors. Anomalies indicative of a phase transition were observed at 433 0 K in a single crystal Nb 3 Sn and at 485 0 K in an unbacked Nb 3 Ge sputtered thin film. Results are compared with the high temperature transmission electron diffraction studies of Nb 3 Ge films by Schmidt et al. A possible instability in the electron energy spectrum is discussed
Cyclopentanone: A raw material for production of C15 and C17 fuel precursors
International Nuclear Information System (INIS)
Hronec, Milan; Fulajtárova, Katarína; Liptaj, Tibor; Štolcová, Magdaléna; Prónayová, Naďa; Soták, Tomáš
2014-01-01
The synthesis of diesel or jet fuels intermediates from furfural or 5-hydroxymethylfurfural (HMF) via aqueous aldol-condensation with cyclopentanone was studied. Cyclopentanone is the product of furfural rearrangement in an aqueous system. Since the aldol-condensation reaction is conducted in an aqueous solution all these biomass-derived reactants can be applied as water solutions formed in the processes of their preparation. The aldol condensation of furfural with cyclopentanone is at low concentration of base and molar ratio of reactants 2:1 highly selective and after 40–80 min of reaction at a temperature of 40–100 °C more than 95 mol% yield of 2,5-bis (2-furylmethylidene) cyclopentan-1-one (F 2 C) was obtained. When instead of furfural as a reactant HMF was used higher than 98 mol% yield of 2,5-bis (5-hydroxymethyl-2-furylmethylidene) cyclopentan-1-one was achieved. The final products of aldol condensation of furfural and HMF are exclusively corresponding dimers, what enables to obtain after subsequent hydrogenation/hydrodeoxygenation step dialkylcyclopentane type of diesel or jet fuels having C 15 or C 17 molecules. - Highlights: • The aldol condensation of biomass derived cyclopentanone with furfural and HMF. • More than 95 mol % yields of products are achieved. • The products are compounds having exclusively 15 or 17 carbon atoms in molecule. • Reactants can be used as diluted aqueous solutions. • The products are separated as solids insoluble in water
SPIRITS 15c and SPIRITS 14buu: Two Obscured Supernovae in the Nearby Star-forming Galaxy IC 2163
Energy Technology Data Exchange (ETDEWEB)
Jencson, Jacob E.; Kasliwal, Mansi M.; Cao, Yi [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Johansson, Joel [Benoziyo Center for Astrophysics, Weizmann Institute of Science, 76100 Rehovot (Israel); Contreras, Carlos; Castellón, Sergio; Morrell, Nidia; Phillips, Mark [Las Campanas Observatory, Carnegie Observatories, Casilla 601, La Serena (Chile); Bond, Howard E.; Monson, Andrew J. [Dept. of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Masci, Frank J.; Helou, George [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Cody, Ann Marie [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Andrews, Jennifer E. [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Bally, John; Green, Wayne [Center for Astrophysics and Space Astronomy, University of Colorado, 389 UCB, Boulder, CO 80309 (United States); Fox, Ori D. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Gburek, Timothy; Gehrz, Robert D. [Minnesota Institute for Astrophysics, School of Physics and Astronomy, 116 Church Street, S. E., University of Minnesota, Minneapolis, MN 55455 (United States); Hsiao, Eric, E-mail: jj@astro.caltech.edu [Department of Physics, Florida State University, 77 Chieftain Way, Tallahassee, FL, 32306 (United States); and others
2017-03-10
SPitzer InfraRed Intensive Transients Survey—SPIRITS—is an ongoing survey of nearby galaxies searching for infrared (IR) transients with Spitzer /IRAC. We present the discovery and follow-up observations of one of our most luminous ( M {sub [4.5]} = −17.1 ± 0.4 mag, Vega) and reddest ([3.6] − [4.5] = 3.0 ± 0.2 mag) transients, SPIRITS 15c. The transient was detected in a dusty spiral arm of IC 2163 ( D ≈ 35.5 Mpc). Pre-discovery ground-based imaging revealed an associated, shorter-duration transient in the optical and near-IR (NIR). NIR spectroscopy showed a broad (≈8400 km s{sup −1}), double-peaked emission line of He i at 1.083 μ m, indicating an explosive origin. The NIR spectrum of SPIRITS 15c is similar to that of the Type IIb SN 2011dh at a phase of ≈200 days. Assuming an A {sub V} = 2.2 mag of extinction in SPIRITS 15c provides a good match between their optical light curves. The NIR light curves, however, show some minor discrepancies when compared with SN 2011dh, and the extreme [3.6]–[4.5] color has not been previously observed for any SN IIb. Another luminous ( M {sub 4.5} = −16.1 ± 0.4 mag) event, SPIRITS 14buu, was serendipitously discovered in the same galaxy. The source displays an optical plateau lasting ≳80 days, and we suggest a scenario similar to the low-luminosity Type IIP SN 2005cs obscured by A{sub V} ≈ 1.5 mag. Other classes of IR-luminous transients can likely be ruled out in both cases. If both events are indeed SNe, this may suggest that ≳18% of nearby core-collapse SNe are missed by currently operating optical surveys.
SPIRITS 15c and SPIRITS 14buu: Two Obscured Supernovae in the Nearby Star-forming Galaxy IC 2163
International Nuclear Information System (INIS)
Jencson, Jacob E.; Kasliwal, Mansi M.; Cao, Yi; Johansson, Joel; Contreras, Carlos; Castellón, Sergio; Morrell, Nidia; Phillips, Mark; Bond, Howard E.; Monson, Andrew J.; Masci, Frank J.; Helou, George; Cody, Ann Marie; Andrews, Jennifer E.; Bally, John; Green, Wayne; Fox, Ori D.; Gburek, Timothy; Gehrz, Robert D.; Hsiao, Eric
2017-01-01
SPitzer InfraRed Intensive Transients Survey—SPIRITS—is an ongoing survey of nearby galaxies searching for infrared (IR) transients with Spitzer /IRAC. We present the discovery and follow-up observations of one of our most luminous ( M [4.5] = −17.1 ± 0.4 mag, Vega) and reddest ([3.6] − [4.5] = 3.0 ± 0.2 mag) transients, SPIRITS 15c. The transient was detected in a dusty spiral arm of IC 2163 ( D ≈ 35.5 Mpc). Pre-discovery ground-based imaging revealed an associated, shorter-duration transient in the optical and near-IR (NIR). NIR spectroscopy showed a broad (≈8400 km s −1 ), double-peaked emission line of He i at 1.083 μ m, indicating an explosive origin. The NIR spectrum of SPIRITS 15c is similar to that of the Type IIb SN 2011dh at a phase of ≈200 days. Assuming an A V = 2.2 mag of extinction in SPIRITS 15c provides a good match between their optical light curves. The NIR light curves, however, show some minor discrepancies when compared with SN 2011dh, and the extreme [3.6]–[4.5] color has not been previously observed for any SN IIb. Another luminous ( M 4.5 = −16.1 ± 0.4 mag) event, SPIRITS 14buu, was serendipitously discovered in the same galaxy. The source displays an optical plateau lasting ≳80 days, and we suggest a scenario similar to the low-luminosity Type IIP SN 2005cs obscured by A V ≈ 1.5 mag. Other classes of IR-luminous transients can likely be ruled out in both cases. If both events are indeed SNe, this may suggest that ≳18% of nearby core-collapse SNe are missed by currently operating optical surveys.
International Nuclear Information System (INIS)
Sjoewall, Christopher; Wetteroe, Jonas; Bengtsson, Torbjoern; Askendal, Agneta; Almroth, Gunnel; Skogh, Thomas; Tengvall, Pentti
2007-01-01
C-reactive protein (CRP) interacts with phosphorylcholine (PC), Fcγ receptors, complement factor C1q and cell nuclear constituents, yet its biological roles are insufficiently understood. The aim was to characterize CRP-induced complement activation by ellipsometry. PC conjugated with keyhole limpet hemocyanin (PC-KLH) was immobilized to cross-linked fibrinogen. A low-CRP serum with different amounts of added CRP was exposed to the PC-surfaces. The total serum protein deposition was quantified and deposition of IgG, C1q, C3c, C4, factor H, and CRP detected with polyclonal antibodies. The binding of serum CRP to PC-KLH dose-dependently triggered activation of the classical pathway. Unexpectedly, the activation was efficiently down-regulated at CRP levels >150 mg/L. Using radial immunodiffusion, CRP-C1q interaction was observed in serum samples with high CRP concentrations. We propose that the underlying mechanism depends on fluid-phase interaction between C1q and CRP. This might constitute another level of complement regulation, which has implications for systemic lupus erythematosus where CRP is often low despite flare-ups
48 CFR 15.403-4 - Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).
2010-10-01
... or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b). 15.403-4 Section 15.403-4 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 15.403-4 Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C...
The Cu-Bi-Se phase system at temperatures between 300° and 750° C
DEFF Research Database (Denmark)
Karup-Møller, Sven
2003-01-01
Phase relations were determined in the Cu-Bi-Se phase system at 300, 350, 400, 450, 550, 650 and 750degreesC. Four ternary phases, phase A-D, have been synthesized. Phase A (Cu4Bi4Se9) is isotype with Cu4Bi4S9, and phase B (Cu1.7Bi4.7 Se-8) and phase C (Cu3Bi5Se9) have the same structure type as P...
The SafeBoosC phase II clinical trial
DEFF Research Database (Denmark)
Riera, Joan; Hyttel-Sorensen, Simon; Bravo, María Carmen
2016-01-01
BACKGROUND: The SafeBoosC phase II randomised clinical trial recently demonstrated the benefits of a combination of cerebral regional tissue oxygen saturation (rStO2) by near-infrared spectroscopy (NIRS) and a treatment guideline to reduce the oxygen imbalance in extremely preterm infants. AIMS: ...
Superconductivity in the lanthanum-yttrium-manganese alloy system
International Nuclear Information System (INIS)
Stierman, R.J.
1980-03-01
An empirical approach involving lattice instabilities was investigated in the search for new superconducting materials. Pseudo-lanthanide compounds using La and Y were prepared for the system La/sub 1-x/Y/sub x/Mn 2 by arc melting and subsequent heat treatment. Low temperature magnetic susceptibility and low temperature heat capacity measurements were made. The unit cell lattice parameters were determined from x-ray powder patterns taken on most samples and metallographic examination was carried out on selected samples. Alloys with low La concentrations (x greater than or equal to 0.6) showed RMn 2 in the cubic C15 Laves phase as the major component with second phase material present. The magnetic susceptibility and x-ray data indicated a superconducting phase which seemed to be the RMn 2 phase, but heat capacity measurements showed the second phase material was the superconductor, while the RMn 2 was not. Failure to form compounds with higher La content was experienced and may be due to the lattice instability expected at x = 0.56. This indicates that perhaps more stingent conditions are required to form pseudo-lanthanide compounds than were previously considered. More systems should be investigated to see if this is true, and to determine the possibilities of this approach
Fate of 15N and 14C from labelled plant material
DEFF Research Database (Denmark)
Rasmussen, Jim; Gjettermann, Birgitte; Eriksen, Jørgen
2008-01-01
strength of labelled plant residues in dissolved inorganic N (DIN) and dissolved organic N (DON) in pore water from the plough layer, and (ii) the plant uptake of organically bound N. Litterbags containing 14C- and 15N-labelled ryegrass or clover roots or leaves were inserted into the sward of a ryegrass......–clover mixture in early spring. The fate of the released 14C and 15N was monitored in harvested biomass, roots, soil, and pore water percolating from the plough layer. No evidence of plant uptake of dual-labelled organic compounds from the dual-labelled residues could be observed. N in pore water from the plough...
Climate Impacts in Europe Under +1.5°C Global Warming
Jacob, Daniela; Kotova, Lola; Teichmann, Claas; Sobolowski, Stefan P.; Vautard, Robert; Donnelly, Chantal; Koutroulis, Aristeidis G.; Grillakis, Manolis G.; Tsanis, Ioannis K.; Damm, Andrea; Sakalli, Abdulla; Vliet, van Michelle T.H.
2018-01-01
The Paris Agreement of the United Nations Framework Convention on Climate Change aims not only at avoiding +2°C warming (and even limit the temperature increase further to +1.5°C), but also sets long-term goals to guide mitigation. Therefore, the best available science is required to inform
α-NiPt(Al) and phase equilibria in the Ni-Al-Pt system at 1150 deg C
International Nuclear Information System (INIS)
Hayashi, S.; Ford, S.I.; Young, D.J.; Sordelet, D.J.; Besser, M.F.; Gleeson, B.
2005-01-01
The α-NiPt(Al) phase and its associated equilibria in the Ni-Al-Pt system at 1150 deg C were investigated by analyzing equilibrated bulk alloys and the interdiffusion zones of diffusion couples. Phase constitutions, tie-lines and microstructures were determined using a combination of techniques, including high-energy synchrotron X-ray diffraction, scanning electron microscopy and electron probe microanalysis. A large Pt solubility limit was found to exist in the β-NiAl, ∼42 at.%, and in γ'-Ni 3 Al, ∼32 at.%. The α-NiPt(Al) phase was found to have wide Pt solubility range of about 33-60 at.% and to skew along an almost constant Pt/Al ratio of 1.5. The α-NiPt(Al) has an ordered face-centered tetragonal L1 0 crystal structure, with the Al and Pt atoms found to be preferentially located in the corners and prismatic faces, respectively. The temperature dependence of the lattice parameters and unit cell volume of the α phase were also determined
Directory of Open Access Journals (Sweden)
Glowacz A.
2017-12-01
Full Text Available A degradation of metallurgical equipment is normal process depended on time. Some factors such as: operation process, friction, high temperature can accelerate the degradation process of metallurgical equipment. In this paper the authors analyzed three phase induction motors. These motors are common used in the metallurgy industry, for example in conveyor belt. The diagnostics of such motors is essential. An early detection of faults prevents financial loss and downtimes. The authors proposed a technique of fault diagnosis based on recognition of currents. The authors analyzed 4 states of three phase induction motor: healthy three phase induction motor, three phase induction motor with 1 faulty rotor bar, three phase induction motor with 2 faulty rotor bars, three phase induction motor with faulty ring of squirrel-cage. An analysis was carried out for original method of feature extraction called MSAF-RATIO15 (Method of Selection of Amplitudes of Frequencies – Ratio 15% of maximum of amplitude. A classification of feature vectors was performed by Bayes classifier, Linear Discriminant Analysis (LDA and Nearest Neighbour classifier. The proposed technique of fault diagnosis can be used for protection of three phase induction motors and other rotating electrical machines. In the near future the authors will analyze other motors and faults. There is also idea to use thermal, acoustic, electrical, vibration signal together.
Isothermal section of the ternary phase diagram U–Fe–Ge at 900 °C and its new intermetallic phases
Energy Technology Data Exchange (ETDEWEB)
Henriques, M.S., E-mail: mish@itn.pt [Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 182 21 Prague (Czech Republic); CCTN, IST/CFMCUL, University of Lisbon, Nuclear and Technological Campus, P-2695-066 Bobadela (Portugal); Berthebaud, D.; Lignie, A.; El Sayah, Z.; Moussa, C.; Tougait, O. [Institut des Sciences Chimiques de Rennes, Chimie du Solide et Matériaux, Université Rennes 1, UMR CNRS 6226, 263 Avenue du Général Leclerc, 35042 Rennes (France); Havela, L. [Department of Condensed Matter Physics, Faculty of Mathematics and Physics, Charles University, Ke Karlovu 5, 121 16 Prague (Czech Republic); Gonçalves, A.P. [CCTN, IST/CFMCUL, University of Lisbon, Nuclear and Technological Campus, P-2695-066 Bobadela (Portugal)
2015-08-05
Highlights: • Isothermal section of the U–Fe–Ge at 900 °C was investigated. • Ten ternary compounds and four significant solubility ranges were found. • Three new compounds and a solid solution were discovered. - Abstract: The isothermal section at 900 °C of the U–Fe–Ge ternary system was assessed using experimental results from X-ray diffraction and observations by scanning electron microscopy coupled with energy dispersive X-ray spectroscopy chemical analysis. The phase diagram at this temperature is characterized by the formation of fourteen stable phases: four homogeneity ranges and ten intermetallic compounds. Among these, there is an extension of the binary compound UFe{sub 2} into the ternary system (UFe{sub 2−x}Ge{sub x,}x < 0.15), three ternary line compounds, U{sub 2}Fe{sub 17−x}Ge{sub x} (2 < x < 3.7), UFe{sub 1−x}Ge{sub 2} (0.58 < x < 0.78), UFe{sub 6+x}Ge{sub 6−x} (x < 0.7), and ten ternary stoichiometric compounds, U{sub 2}Fe{sub 3}Ge, U{sub 6}Fe{sub 16}Ge{sub 7}, UFe{sub 4}Ge{sub 2}, U{sub 6}Fe{sub 22}Ge{sub 13}, UFeGe, U{sub 3}Fe{sub 4}Ge{sub 4}, UFe{sub 2}Ge{sub 2}, U{sub 34}Fe{sub 3.32}Ge{sub 33}, U{sub 3}Fe{sub 2}Ge{sub 7}, and U{sub 9}Fe{sub 7}Ge{sub 24}.
(13)C-(15)N correlation via unsymmetrical indirect covariance NMR: application to vinblastine.
Martin, Gary E; Hilton, Bruce D; Blinov, Kirill A; Williams, Antony J
2007-12-01
Unsymmetrical indirect covariance processing methods allow the derivation of hyphenated 2D NMR data from the component 2D spectra, potentially circumventing the acquisition of the much lower sensitivity hyphenated 2D NMR experimental data. Calculation of HSQC-COSY and HSQC-NOESY spectra from GHSQC, COSY, and NOESY spectra, respectively, has been reported. The use of unsymmetrical indirect covariance processing has also been applied to the combination of (1)H- (13)C GHSQC and (1)H- (15)N long-range correlation data (GHMBC, IMPEACH, or CIGAR-HMBC). The application of unsymmetrical indirect covariance processing to spectra of vinblastine is now reported, specifically the algorithmic extraction of (13)C- (15)N correlations via the unsymmetrical indirect covariance processing of the combination of (1)H- (13)C GHSQC and long-range (1)H- (15)N GHMBC to produce the equivalent of a (13)C- (15)N HSQC-HMBC correlation spectrum. The elimination of artifact responses with aromatic solvent-induced shifts (ASIS) is shown in addition to a method of forecasting potential artifact responses through the indirect covariance processing of the GHSQC spectrum used in the unsymmetrical indirect covariance processing.
Emission pathways to achieve 2.0°C and 1.5°C climate targets
Su, Xuanming; Takahashi, Kiyoshi; Fujimori, Shinichiro; Hasegawa, Tomoko; Tanaka, Katsumasa; Kato, Etsushi; Shiogama, Hideo; Masui, Toshihiko; Emori, Seita
2017-06-01
We investigated the feasibilities of 2.0°C and 1.5°C climate targets by considering the abatement potentials of a full suite of greenhouse gases, pollutants, and aerosols. We revised the inter-temporal dynamic optimization model DICE-2013R by introducing three features as follows. First, we applied a new marginal abatement cost curve derived under moderate assumptions regarding future socioeconomic development—the Shared Socioeconomic Pathways 2 (SSP2) scenario. Second, we addressed emission abatement for not only industrial CO2 but also land-use CO2, CH4, N2O, halogenated gases, CO, volatile organic compounds, SOx, NOx, black carbon and organic carbon. Third, we improved the treatment of the non-CO2 components in the climate module based on MAGICC 6.0. We obtained the following findings: (1) It is important to address the individual emissions in an analysis of low stabilization scenarios because abating land-use CO2, non-CO2 and aerosol emissions also contributes to maintaining a low level of radiative forcing and substantially affects the climate costs. (2) The 2.0°C target can be efficiently reached under the assumptions of the SSP2 scenario. (3) The 1.5°C target can be met with early deep cuts under the assumption of a temperature overshoot, and it will triple the carbon price and double the mitigation cost compared with the 2.0°C case.
Phase stability limit of c-BN under hydrostatic and non-hydrostatic pressure conditions
International Nuclear Information System (INIS)
Xiao, Jianwei; Du, Jinglian; Wen, Bin; Zhang, Xiangyi; Melnik, Roderick; Kawazoe, Yoshiyuki
2014-01-01
Phase stability limit of cubic boron nitride (c-BN) has been investigated by the crystal structure search technique. It indicated that this limit is ∼1000 GPa at hydrostatic pressure condition. Above this pressure, c-BN turns into a metastable phase with respect to rocksalt type boron nitride (rs-BN). However, rs-BN cannot be retained at 0 GPa owing to its instability at pressure below 250 GPa. For non-hydrostatic pressure conditions, the phase stability limit of c-BN is substantially lower than that under hydrostatic pressure conditions and it is also dramatically different for other pressure mode
International Nuclear Information System (INIS)
Hua Jinsong; Lin Ping; Liu Chun; Wang Qi
2011-01-01
Highlights: → We study phase-field models for multi-phase flow computation. → We develop an energy-law preserving C0 FEM. → We show that the energy-law preserving method work better. → We overcome unphysical oscillation associated with the Cahn-Hilliard model. - Abstract: We use the idea in to develop the energy law preserving method and compute the diffusive interface (phase-field) models of Allen-Cahn and Cahn-Hilliard type, respectively, governing the motion of two-phase incompressible flows. We discretize these two models using a C 0 finite element in space and a modified midpoint scheme in time. To increase the stability in the pressure variable we treat the divergence free condition by a penalty formulation, under which the discrete energy law can still be derived for these diffusive interface models. Through an example we demonstrate that the energy law preserving method is beneficial for computing these multi-phase flow models. We also demonstrate that when applying the energy law preserving method to the model of Cahn-Hilliard type, un-physical interfacial oscillations may occur. We examine the source of such oscillations and a remedy is presented to eliminate the oscillations. A few two-phase incompressible flow examples are computed to show the good performance of our method.
Schleussner, Carl-Friedrich; Lissner, Tabea K.; Fischer, Erich M.; Wohland, Jan; Perrette, Mahé; Golly, Antonius; Rogelj, Joeri; Childers, Katelin; Schewe, Jacob; Frieler, Katja; Mengel, Matthias; Hare, William; Schaeffer, Michiel
2016-04-01
Robust appraisals of climate impacts at different levels of global-mean temperature increase are vital to guide assessments of dangerous anthropogenic interference with the climate system. The 2015 Paris Agreement includes a two-headed temperature goal: "holding the increase in the global average temperature to well below 2 °C above pre-industrial levels and pursuing efforts to limit the temperature increase to 1.5 °C". Despite the prominence of these two temperature limits, a comprehensive overview of the differences in climate impacts at these levels is still missing. Here we provide an assessment of key impacts of climate change at warming levels of 1.5 °C and 2 °C, including extreme weather events, water availability, agricultural yields, sea-level rise and risk of coral reef loss. Our results reveal substantial differences in impacts between a 1.5 °C and 2 °C warming that are highly relevant for the assessment of dangerous anthropogenic interference with the climate system. For heat-related extremes, the additional 0.5 °C increase in global-mean temperature marks the difference between events at the upper limit of present-day natural variability and a new climate regime, particularly in tropical regions. Similarly, this warming difference is likely to be decisive for the future of tropical coral reefs. In a scenario with an end-of-century warming of 2 °C, virtually all tropical coral reefs are projected to be at risk of severe degradation due to temperature-induced bleaching from 2050 onwards. This fraction is reduced to about 90 % in 2050 and projected to decline to 70 % by 2100 for a 1.5 °C scenario. Analyses of precipitation-related impacts reveal distinct regional differences and hot-spots of change emerge. Regional reduction in median water availability for the Mediterranean is found to nearly double from 9 % to 17 % between 1.5 °C and 2 °C, and the projected lengthening of regional dry spells increases from 7 to 11 %. Projections for
The level structure of 13C around Esub(x)=20 MeV studied by polarised neutron scattering from 12C
International Nuclear Information System (INIS)
Tornow, W.; Woye, E.
1987-01-01
Analysing-power data for elastic scattering of neutrons from 12 C have been obtained at selected angles in small energy steps between incident energies of 15.55 and 17.35 MeV. The excitation energy, spin and parity of levels in 13 C have been determined for excitation energies around 20 MeV via a phase-shift analysis of these data and of previously measured n- 12 C total cross section data. In addition, an auxiliary phase-shift analysis has been performed in the neutron energy range from 12 to 15 MeV. All experimental data are well reproduced by the phase shifts obtained. The need for further experimental data is pointed out. (author)
Solid Phase Characterization of Tank 241-C-105 Grab Samples
International Nuclear Information System (INIS)
Ely, T. M.; LaMothe, M. E.; Lachut, J. S.
2016-01-01
The solid phase characterization (SPC) of three grab samples from single-shell Tank 241-C-105 (C-105) that were received at the laboratory the week of October 26, 2015, has been completed. The three samples were received and broken down in the 11A hot cells.
DEFF Research Database (Denmark)
Makovicky, E.; Karup-Møller, Sven
2000-01-01
Phase relations in the S-poor portions of the dry condensed Pt-Ir-Fe-S system were determined at 1000 degrees and 1100 degreesC with a particular emphasis on delineation of the solid solubility fields of the Pt-Ir-Fe alloys. At both temperatures, a broad field of gamma (Ir,Fe,Pt) alloy coexists...... with gamma-(Pt,Fe), Pt3Fe and PtFe which dissolve respectively at least 5.1, 29.3 and 24.0 at.% Ir at 1100 degreesC (2.2, 23.6 and less than or equal to 17.2 at.% Ir at 1000 degreesC). Gaps between the nearly Ir-free Pt-Fe alloys gamma (Pt,Fe), Pt3Fe s.s., PtFe s.s. and gamma (Fe,Pt) were estimated as 20......-23 at.%, 40-42 at.% and 54.2-similar to 57 at.% Fe at 1100 degreesC (18-23, 39.5-42.5 and 59-62 at.% Fe at 1000 degreesC). The first gap agrees with data from natural phases by Cabri et ni. (1996). The Fe-rich sulphide melt dissolves only traces of Pt and Ir; Fe1-xS dissolves up to 5.8 at.% Ir at 1100...
The potential contribution of disruptive low-carbon innovations to 1.5 °C climate mitigation
Wilson, C.; Pettifor, H.; Cassar, E.; Kerr, L.; Wilson, M.
2018-01-01
This paper investigates the potential for consumer-facing innovations to contribute emission reductions for limiting warming to 1.5 °C. First, we show that global integrated assessment models which characterise transformation pathways consistent with 1.5 °C mitigation are limited in their ability to analyse the emergence of novelty in energy end-use. Second, we introduce concepts of disruptive innovation which can be usefully applied to the challenge of 1.5 °C mitigation. Disruptive low-carbo...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV
Spencer, Brady L; Shenoy, Anukul T; Orihuela, Carlos J; Nahm, Moon H
2017-08-01
As a species, Streptococcus pneumoniae (the pneumococcus) utilizes a diverse array of capsular polysaccharides to evade the host. In contrast to large variations in sugar composition and linkage formation, O-acetylation is a subtle capsular modification that nonetheless has a large impact on capsular shielding and recognition of the capsule by vaccine-elicited antibodies. Serotype 15B, which is included in the 23-valent pneumococcal polysaccharide vaccine (PPV23), carries the putative O-acetyltransferase gene wciZ The coding sequence of wciZ contains eight consecutive TA repeats [(TA) 8 ]. Replication slippage is thought to result in the addition or loss of TA repeats, subsequently causing frameshift and truncation of WciZ to yield a nonacetylated serotype, 15C. Using sensitive serological tools, we show that serotype 15C isolates whose wciZ contains seven or nine TA repeats retain partial O-acetylation, while serotype 15C isolates whose wciZ contains six TA repeats have barely detectable O-acetylation. We confirmed by inhibition enzyme-linked immunosorbent assay that (TA) 7 serotype 15C is ∼0.1% as acetylated as serotype 15B, while serotype 15X is nonacetylated. To eliminate the impact of genetic background, we created isogenic serotype 15B, (TA) 7 serotype 15C, and 15BΔ wciZ (15X) strains and found that reduction or absence of WciZ-mediated O-acetylation did not affect capsular shielding from phagocytes, biofilm formation, adhesion to nasopharyngeal cells, desiccation tolerance, or murine colonization. Sera from PPV23-immunized persons opsonized serotype 15B significantly but only slightly better than serotypes 15C and 15X; thus, PPV23 may not result in expansion of serotype 15C. Copyright © 2017 American Society for Microbiology.
The CN/C15N isotopic ratio towards dark clouds
Hily-Blant, P.; Pineau des Forêts, G.; Faure, A.; Le Gal, R.; Padovani, M.
2013-09-01
Understanding the origin of the composition of solar system cosmomaterials is a central question, not only in the cosmochemistry and astrochemistry fields, and requires various approaches to be combined. Measurements of isotopic ratios in cometary materials provide strong constraints on the content of the protosolar nebula. Their relation with the composition of the parental dark clouds is, however, still very elusive. In this paper, we bring new constraints based on the isotopic composition of nitrogen in dark clouds, with the aim of understanding the chemical processes that are responsible for the observed isotopic ratios. We have observed and detected the fundamental rotational transition of C15N towards two starless dark clouds, L1544 and L1498. We were able to derive the column density ratio of C15N over 13CN towards the same clouds and obtain the CN/C15N isotopic ratios, which were found to be 500 ± 75 for both L1544 and L1498. These values are therefore marginally consistent with the protosolar value of 441. Moreover, this ratio is larger than the isotopic ratio of nitrogen measured in HCN. In addition, we present model calculations of the chemical fractionation of nitrogen in dark clouds, which make it possible to understand how CN can be deprived of 15N and HCN can simultaneously be enriched in heavy nitrogen. The non-fractionation of N2H+, however, remains an open issue, and we propose some chemical way of alleviating the discrepancy between model predictions and the observed ratios. Appendices are available in electronic form at http://www.aanda.orgThe reduced spectra (in FITS format) are available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (ftp://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/557/A65
Projected Changes in the Asian-Australian Monsoon Region in 1.5°C and 2.0°C Global-Warming Scenarios
Chevuturi, Amulya; Klingaman, Nicholas P.; Turner, Andrew G.; Hannah, Shaun
2018-03-01
In light of the Paris Agreement, it is essential to identify regional impacts of half a degree additional global warming to inform climate adaptation and mitigation strategies. We investigate the effects of 1.5°C and 2.0°C global warming above preindustrial conditions, relative to present day (2006-2015), over the Asian-Australian monsoon region (AAMR) using five models from the Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) project. There is considerable intermodel variability in projected changes to mean climate and extreme events in 2.0°C and 1.5°C scenarios. There is high confidence in projected increases to mean and extreme surface temperatures over AAMR, as well as more-frequent persistent daily temperature extremes over East Asia, Australia, and northern India with an additional 0.5°C warming, which are likely to occur. Mean and extreme monsoon precipitation amplify over AAMR, except over Australia at 1.5°C where there is uncertainty in the sign of the change. Persistent daily extreme precipitation events are likely to become more frequent over parts of East Asia and India with an additional 0.5°C warming. There is lower confidence in projections of precipitation change than in projections of surface temperature change. These results highlight the benefits of limiting the global-mean temperature change to 1.5°C above preindustrial, as the severity of the above effects increases with an extra 0.5°C warming.
Climate extremes, land-climate feedbacks and land-use forcing at 1.5°C.
Seneviratne, Sonia I; Wartenburger, Richard; Guillod, Benoit P; Hirsch, Annette L; Vogel, Martha M; Brovkin, Victor; van Vuuren, Detlef P; Schaller, Nathalie; Boysen, Lena; Calvin, Katherine V; Doelman, Jonathan; Greve, Peter; Havlik, Petr; Humpenöder, Florian; Krisztin, Tamas; Mitchell, Daniel; Popp, Alexander; Riahi, Keywan; Rogelj, Joeri; Schleussner, Carl-Friedrich; Sillmann, Jana; Stehfest, Elke
2018-05-13
This article investigates projected changes in temperature and water cycle extremes at 1.5°C of global warming, and highlights the role of land processes and land-use changes (LUCs) for these projections. We provide new comparisons of changes in climate at 1.5°C versus 2°C based on empirical sampling analyses of transient simulations versus simulations from the 'Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) multi-model experiment. The two approaches yield similar overall results regarding changes in climate extremes on land, and reveal a substantial difference in the occurrence of regional extremes at 1.5°C versus 2°C. Land processes mediated through soil moisture feedbacks and land-use forcing play a major role for projected changes in extremes at 1.5°C in most mid-latitude regions, including densely populated areas in North America, Europe and Asia. This has important implications for low-emissions scenarios derived from integrated assessment models (IAMs), which include major LUCs in ambitious mitigation pathways (e.g. associated with increased bioenergy use), but are also shown to differ in the simulated LUC patterns. Biogeophysical effects from LUCs are not considered in the development of IAM scenarios, but play an important role for projected regional changes in climate extremes, and are thus of high relevance for sustainable development pathways.This article is part of the theme issue 'The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. © 2018 The Authors.
Climate extremes, land–climate feedbacks and land-use forcing at 1.5°C
Wartenburger, Richard; Guillod, Benoit P.; Hirsch, Annette L.; Vogel, Martha M.; Brovkin, Victor; van Vuuren, Detlef P.; Schaller, Nathalie; Boysen, Lena; Calvin, Katherine V.; Doelman, Jonathan; Greve, Peter; Havlik, Petr; Humpenöder, Florian; Krisztin, Tamas; Mitchell, Daniel; Popp, Alexander; Riahi, Keywan; Rogelj, Joeri; Schleussner, Carl-Friedrich; Sillmann, Jana; Stehfest, Elke
2018-01-01
This article investigates projected changes in temperature and water cycle extremes at 1.5°C of global warming, and highlights the role of land processes and land-use changes (LUCs) for these projections. We provide new comparisons of changes in climate at 1.5°C versus 2°C based on empirical sampling analyses of transient simulations versus simulations from the ‘Half a degree Additional warming, Prognosis and Projected Impacts’ (HAPPI) multi-model experiment. The two approaches yield similar overall results regarding changes in climate extremes on land, and reveal a substantial difference in the occurrence of regional extremes at 1.5°C versus 2°C. Land processes mediated through soil moisture feedbacks and land-use forcing play a major role for projected changes in extremes at 1.5°C in most mid-latitude regions, including densely populated areas in North America, Europe and Asia. This has important implications for low-emissions scenarios derived from integrated assessment models (IAMs), which include major LUCs in ambitious mitigation pathways (e.g. associated with increased bioenergy use), but are also shown to differ in the simulated LUC patterns. Biogeophysical effects from LUCs are not considered in the development of IAM scenarios, but play an important role for projected regional changes in climate extremes, and are thus of high relevance for sustainable development pathways. This article is part of the theme issue ‘The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. PMID:29610382
Climate extremes, land-climate feedbacks and land-use forcing at 1.5°C
Seneviratne, Sonia I.; Wartenburger, Richard; Guillod, Benoit P.; Hirsch, Annette L.; Vogel, Martha M.; Brovkin, Victor; van Vuuren, Detlef P.; Schaller, Nathalie; Boysen, Lena; Calvin, Katherine V.; Doelman, Jonathan; Greve, Peter; Havlik, Petr; Humpenöder, Florian; Krisztin, Tamas; Mitchell, Daniel; Popp, Alexander; Riahi, Keywan; Rogelj, Joeri; Schleussner, Carl-Friedrich; Sillmann, Jana; Stehfest, Elke
2018-05-01
This article investigates projected changes in temperature and water cycle extremes at 1.5°C of global warming, and highlights the role of land processes and land-use changes (LUCs) for these projections. We provide new comparisons of changes in climate at 1.5°C versus 2°C based on empirical sampling analyses of transient simulations versus simulations from the `Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) multi-model experiment. The two approaches yield similar overall results regarding changes in climate extremes on land, and reveal a substantial difference in the occurrence of regional extremes at 1.5°C versus 2°C. Land processes mediated through soil moisture feedbacks and land-use forcing play a major role for projected changes in extremes at 1.5°C in most mid-latitude regions, including densely populated areas in North America, Europe and Asia. This has important implications for low-emissions scenarios derived from integrated assessment models (IAMs), which include major LUCs in ambitious mitigation pathways (e.g. associated with increased bioenergy use), but are also shown to differ in the simulated LUC patterns. Biogeophysical effects from LUCs are not considered in the development of IAM scenarios, but play an important role for projected regional changes in climate extremes, and are thus of high relevance for sustainable development pathways. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.
Mourya, Satyendra; Jaiswal, Jyoti; Malik, Gaurav; Kumar, Brijesh; Chandra, Ramesh
2018-01-01
In this work, we have reported the in-situ fabrication of nanocrystalline rhombohedral silicon carbide (15R-SiC) thin films by RF-magnetron sputtering at 800 °C substrate temperature. The structural and optical properties were investigated for the films grown on four different substrates (ZrO2, MgO, SiC, and Si). The contact angle measurement was performed on all the substrates to investigate the role of interfacial surface energy in nucleation and growth of the films. The XRD measurement revealed the growth of (1 0 10) orientation for all the samples and demonstrated better crystallinity on Si substrate, which was further corroborated by the TEM results. The Raman spectroscopy confirmed the growth of rhombohedral phase with 15R polytype. Surface characteristics of the films have been investigated by energy dispersive x-ray spectroscopy, FTIR, and atomic force microscope (AFM) to account for chemical composition, bonding, and root mean square surface roughness (δrms). The optical dispersion behavior of 15R-SiC thin films was examined by variable angle spectroscopic ellipsometry in the wide spectral range (246-1688 nm), including the surface characteristics in the optical model. The non-linear optical parameters (χ3 and n2) of the samples have been calculated by the Tichy and Ticha relation using a single effective oscillator model of Wemple and Didomenico. Additionally, our optical results provided an alternative way to measure the ratio of carrier concentration to the effective mass (N/m*). These investigated optical parameters allow one to design and fabricate optoelectronic, photonic, and telecommunication devices for deployment in extreme environment.
Phase diagram of the Fe-Sn-Zr system at 800 °C
International Nuclear Information System (INIS)
Nieva, N.; Corvalán, C.; Jiménez, M.J.; Gómez, A.; Arreguez, C.; Joubert, J.-M.; Arias, D.
2017-01-01
New experimental results on the Fe-Sn-Zr phase diagram at 800 °C are presented, particularly in the central, Fe rich and Sn rich regions of the Gibbs triangle. Seven ternary alloys were designed, produced and examined by different techniques: optical and scanning electron microscopy, semi-quantitative microanalysis, quantitative microanalysis and X-ray diffraction. The results of this work and previous experimental data were used to determine the phase diagram section at 800 °C which contains at least five ternary compounds: Fe 6 Sn 6 Zr, Y, X′, θ and C36. - Highlights: •A phase diagram of Fe-Sn-Zr system at 800 °C is proposed. •The isothermal section of Fe-Sn-Zr system at 800 °C and that at 900 °C determined previously allow reliable extrapolations at low temperatures. •The study at different temperatures (900 °C and 800 °C in this case) is highly desirable because it allows the separation between enthalpic and entropic effects in a future Calphad modelling.
Phase diagram of the Fe-Sn-Zr system at 800 °C
Energy Technology Data Exchange (ETDEWEB)
Nieva, N. [Laboratorio de Física del Sólido, Departamento de Física, Facultad de Ciencias Exactas y Tecnología, Universidad Nacional de Tucumán (Argentina); Corvalán, C., E-mail: corvalan@cnea.gov.ar [Gerencia de Materiales, Comisión Nacional de Energía Atómica Argentina (CNEA), Universidad Nacional de Tres de Febrero, Argentina, CONICET, Consejo Nacional de Ciencia y Técnica (Argentina); Jiménez, M.J. [IFISUR, CONICET, Departamento de Física, Universidad Nacional del Sur, Bahía Blanca (Argentina); Gómez, A. [Grupo LMFAE – PPFAE, Centro Atómico Ezeiza, Comisión Nacional de Energía Atómica (Argentina); Arreguez, C. [Laboratorio de Física del Sólido, Departamento de Física, Facultad de Ciencias Exactas y Tecnología, Universidad Nacional de Tucumán (Argentina); Joubert, J.-M. [Chimie Métallurgique des Terres Rares (CMTR), Institut de Chimie et des Matériaux Paris-Est (ICMPE), CNRS, Université Paris-Est Créteil, 2-8 rue Henri Dunant, 94320 Thiais Cedex (France); Arias, D. [Instituto de Tecnología J. Sabato, Universidad Nacional de San Martín-CNEA (Argentina)
2017-04-15
New experimental results on the Fe-Sn-Zr phase diagram at 800 °C are presented, particularly in the central, Fe rich and Sn rich regions of the Gibbs triangle. Seven ternary alloys were designed, produced and examined by different techniques: optical and scanning electron microscopy, semi-quantitative microanalysis, quantitative microanalysis and X-ray diffraction. The results of this work and previous experimental data were used to determine the phase diagram section at 800 °C which contains at least five ternary compounds: Fe{sub 6}Sn{sub 6}Zr, Y, X′, θ and C36. - Highlights: •A phase diagram of Fe-Sn-Zr system at 800 °C is proposed. •The isothermal section of Fe-Sn-Zr system at 800 °C and that at 900 °C determined previously allow reliable extrapolations at low temperatures. •The study at different temperatures (900 °C and 800 °C in this case) is highly desirable because it allows the separation between enthalpic and entropic effects in a future Calphad modelling.
International Nuclear Information System (INIS)
Nyman D, May; Bonhomme R, Francois; Teter M, David; Maxwell, R.S.; Gu, B.X.; Wang, L.M.; Ewing, R.C.; Nenoff M, Tina
2000-01-01
Exploratory hydrothermal synthesis in the system Cs 2 O-SiO 2 -TiO 2 -H 2 O has produced a new polymorph of Cs 2 TiSi 6 O 15 (SNL-A) whose structure was determined using a combination of experimental and theoretical techniques ( 29 Si and 133 Cs NMR, X-ray Rietveld refinement, and Density Functional Theory). SNL-A crystallizes in the monoclinic space-group Cc with unit cell parameters: a = 12.998(2) angstrom, b = 7.5014(3) angstrom, c = 15.156(3) angstrom, η = 105.80(3) degree. The SNL-A framework consists of silicon tetrahedra and titanium octahedra which are linked in 3-, 5-, 6-, 7- and 8-membered rings in three dimensions. SNL-A is distinctive from a previously reported C2/c polymorph of Cs 2 TiSi 6 O 15 by different ring geometries. Similarities and differences between the two structures are discussed. Other characterizations of SNL-A include TGA-DTA, Cs/Si/Ti elemental analyses, and SEM/EDS. Furthermore, the chemical and radiation durability of SNL-A was studied in interest of ceramic waste form applications. These studies show that SNL-A is durable in both radioactive and rigorous chemical environments. Finally, calculated cohesive energies of the two Cs 2 TiSi 6 O 15 polymorphs suggest that the SNL-A phase (synthesized at 200 C) is energetically more favorable than the C2/c polymorph (synthesized at 1,050 C)
The hadron production in π−-C interaction at 40 GeV/c and QCD phase transition
Directory of Open Access Journals (Sweden)
Otgongerel B.
2017-01-01
Full Text Available In this paper, we proposed to study the phase transition process to use the new pair of variables, the temperature T and the cumulative number nc (T,nc. We considered the transverse energy spectra of protons and π−-mesons produced in π−-C interactions at 40 GeV/c as a function of cumulative number nc (or four-dimensional momentum transfer t and the baryonic chemical potential μb(√t. Obtained results indicate the possible appearance of QCD phase transition of nuclear matter.
Keeping global warming within 1.5 °C constrains emergence of aridification
Park, Chang-Eui; Jeong, Su-Jong; Joshi, Manoj; Osborn, Timothy J.; Ho, Chang-Hoi; Piao, Shilong; Chen, Deliang; Liu, Junguo; Yang, Hong; Park, Hoonyoung; Kim, Baek-Min; Feng, Song
2018-01-01
Aridity—the ratio of atmospheric water supply (precipitation; P) to demand (potential evapotranspiration; PET)—is projected to decrease (that is, areas will become drier) as a consequence of anthropogenic climate change, exacerbating land degradation and desertification1-6. However, the timing of significant aridification relative to natural variability—defined here as the time of emergence for aridification (ToEA)—is unknown, despite its importance in designing and implementing mitigation policies7-10. Here we estimate ToEA from projections of 27 global climate models (GCMs) under representative concentration pathways (RCPs) RCP4.5 and RCP8.5, and in doing so, identify where emergence occurs before global mean warming reaches 1.5 °C and 2 °C above the pre-industrial level. On the basis of the ensemble median ToEA for each grid cell, aridification emerges over 32% (RCP4.5) and 24% (RCP8.5) of the total land surface before the ensemble median of global mean temperature change reaches 2 °C in each scenario. Moreover, ToEA is avoided in about two-thirds of the above regions if the maximum global warming level is limited to 1.5 °C. Early action for accomplishing the 1.5 °C temperature goal can therefore markedly reduce the likelihood that large regions will face substantial aridification and related impacts.
Solid phase radioimmunoassays for human C-reactive protein
International Nuclear Information System (INIS)
Shine, B.; Beer, F.C. de; Pepys, M.B.
1981-01-01
Two new, rapid and sensitive radioimmunoassays for human C-reactive protein (CRP) have been established using antiserum coupled to magnetizable cellulose particles, which facilitate phase separation. A single antibody method, using solid phase anti-CRP, provides a sensitivity of 50 μg/l with a 1-h incubation time and intra- and inter-assay coefficients of variation of 10%. A double antibody method, using fluid phase rabbit anti-CRP serum and solid phase sheep anti-rabbit IgG serum, provides a sensitivity of 3 μg/l with an overnight incubation and intra- and inter-assay coefficients of variation of 10%. Among 468 sera from normal adult volunteer blood donors the median CRP concentration was 800 μg/l, interquartile range 340-1700 μg/l and range 70-29,000 μg/l. Ninety percent of samples contained less than 3 mg/l and 99% less than 10 mg/l. Low levels (14-650 μg/l) of CRP were detected both in amniotic fluids and in cerebrospinal fluids. (Auth.)
Density of states and T/sub c/ of disordered A15 compounds
International Nuclear Information System (INIS)
Ghosh, A.K.; Strongin, M.
1979-01-01
In this paper various data for the depression of T/sub c/ and N(O) are presented for a wide class of A15 materials. The question of disorder and the limits on T/sub c/ in these materials are discussed
Energy Technology Data Exchange (ETDEWEB)
Tornow, W.; Woye, E.; Walter, R.L.
1987-02-01
Analysing-power data for elastic scattering of neutrons from /sup 12/C have been obtained at selected angles in small energy steps between incident energies of 15.55 and 17.35 MeV. The excitation energy, spin and parity of levels in /sup 13/C have been determined for excitation energies around 20 MeV via a phase-shift analysis of these data and of previously measured n-/sup 12/C total cross section data. In addition, an auxiliary phase-shift analysis has been performed in the neutron energy range from 12 to 15 MeV. All experimental data are well reproduced by the phase shifts obtained. The need for further experimental data is pointed out.
Transformation of India's transport sector under Global Warming of 2oC and 1.5oC Scenario
DEFF Research Database (Denmark)
Dhar, Subash; Pathak, Minal; Shukla, P.R.
2018-01-01
The Paris agreement stresses on concerted efforts to limit global temperature increase to 2°C and make efforts towards achieving 1.5°C temperature stabilization. Countries announced actions under the Nationally Determined Contributions outlining domestic mitigation actions to achieve the global...
Solid-state amorphization of SmFe3 by hydrogenation
International Nuclear Information System (INIS)
Mueller, K.H.; Kubis, M.; Handstein, A.; Gutfleisch, O.
2000-01-01
Hydrogen-induced amorphization (HIA) has received much attention as a method for the preparation of amorphous compounds since its discovery by Yeh et al. Meanwhile it has been observed for a large number of intermetallic compounds with C15, C23, B8 2 , DO 19 and L1 2 structures. E.G. the C15 Laves-type compounds (MgCu 2 -type structure) of rare earth (R) - transition metal (T) compounds RT 2 show HIA for R = Y, Ce, Pr, Nd, Sm, Gd, Tb, Dy, Ho and Er. Aoki et al. postulated that new amorphizing compounds can be expected at high hydrogen pressures. In this work, the structural changes of SmFe 3 (PuNi 3 -type structure) during heating in high hydrogen pressures are reported
17 CFR 240.15c3-3 - Customer protection-reserves and custody of securities.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Customer protection-reserves... Markets § 240.15c3-3 Customer protection—reserves and custody of securities. (a) Definitions. For the... the dealer as to that collateral; (iii) The Securities Investor Protection Act of 1970 (15 U.S.C...
International Nuclear Information System (INIS)
Madyanov, S.A.; Voronenko, B.I.; Makhnev, E.S.
1978-01-01
It is shown that preliminary heat treatment has a significant effect on the α→γ transformation kinetics, the quantity of residual austenite, the grain size and mechanical properties of the Kh15N5D2T steel after final heat treatment. The preliminary heat treatment regimes leading to the increase of the quantity of residual austenite and to grain refining increase the work of crack propagation in the finally strengthened state. The optimum properties were obtained after threefold preliminary tempering for 1h at 650 deg C. An approximately constant relation of α- and γ-phases (approximately 50%) is observed at 625 deg C irrespective of the investigated regimes of preliminary heat treatment
Energy Technology Data Exchange (ETDEWEB)
Sordi, V L; Bueno, L O, E-mail: sordi@ufscar.b [Federal University of Sao Carlos, Materials Engineering Department, Sao Carlos (SP), 13565-905 (Brazil)
2010-07-01
The effect of niobium additions up to 2.36 wt% on the creep behavior of a series of seven extra low carbon 18Cr-12Ni austenitic stainless steels at 700{sup 0}C has been investigated. Grain size and hardness measurements, hot tensile tests and constant stress creep tests from 90 to 180 MPa were carried out for each alloy, in the solution treated condition at 1050, 1200 and 1300{sup 0}C followed by quench in water. The mechanical behavior at high temperature was related to the amount of NbC precipitation occurring during the tests. Solid solution and intermetallic compound effects were also considered. Creep data analysis was done to determine the parameters of the creep power-law equation {epsilon}-dot = A.{sigma}{sup n} and the Monkman-Grant relation {epsilon}-dot .t{sup m}{sub R} = K. Niobium-carbide precipitation in these steels reduces the secondary stage dependence of strain rate with applied stress, resulting in n-values which indicate the possibility of operation of various creep mechanisms. The creep strength during the secondary stage is primarily controlled by the amount of NbC available for precipitation. However, the rupture times increase progressively with niobium content, as the amount of undissolved carbide particles in grain boundaries and the Laves phase precipitation increase.
Warren, R; Price, J; Graham, E; Forstenhaeusler, N; VanDerWal, J
2018-05-18
In the Paris Agreement on Climate Change, the United Nations is pursuing efforts to limit global warming to 1.5°C, whereas earlier aspirations focused on a 2°C limit. With current pledges, corresponding to ~3.2°C warming, climatically determined geographic range losses of >50% are projected in ~49% of insects, 44% of plants, and 26% of vertebrates. At 2°C, this falls to 18% of insects, 16% of plants, and 8% of vertebrates and at 1.5°C, to 6% of insects, 8% of plants, and 4% of vertebrates. When warming is limited to 1.5°C as compared with 2°C, numbers of species projected to lose >50% of their range are reduced by ~66% in insects and by ~50% in plants and vertebrates. Copyright © 2018 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.
Study on the origin of pressure-induced superconductivity of Cs3C60
International Nuclear Information System (INIS)
Fujiki, S.; Kubozono, Y.; Takabayashi, Y.; Kashino, S.; Kobayashi, M.; Ishii, K.; Suematsu, H.
2001-01-01
Physical properties of bco phase of Cs 3+α C 60 (α=0.0-1.0) and A15 phase of Cs 3 C 60 are studied by X-ray diffraction, ESR, AC susceptibility, resistivity and Raman. The ESR of Cs 300(6) C 60 showed a broad peak of ∼380 G due to conduction electron, while no broad peak was observed in the ESR of bco Cs 3+α C 60 (α≠0.0) and A15 phase. This shows that only bco phase of Cs 3 C 60 is metallic. The AC susceptibility of bco phase of Cs 3.2(3) C 60 and Cs 3.5(1) C 60 showed no superconducting transition above 1.3 K even under high pressure, and the resistivity was 0.52 Ω cm for both samples
International Nuclear Information System (INIS)
Geng, Jiwei; Teng, Xinying; Zhou, Guorong; Leng, Jinfeng; Zhao, Degang
2014-01-01
In situ synthesized TiC particles were prepared by a thermal explosion method. Adding “in situ synthesized” TiC into Zr 60 Cu 10 Al 15 Ni 15 glass matrix to obtain amorphous matrix composites was achieved. The corrosion behavior of Zr 60 Cu 10 Al 15 Ni 15 amorphous composites was evaluated using potentiodynamic polarization measurements in 3.5 wt% NaCl solution at room temperature. The results show that the microhardness and thermal stability are improved apparently, while the TiC (≤0.6 wt%) does not significantly affect the supercooled liquid behavior. Moreover, the corrosion resistance is improved apparently because the nanocrystals accelerate the diffusion of passive elements for faster formation of the protective passive film at nanocrystals/amorphous interfaces. However, when the TiC content is more than 0.6 wt%, both glass forming ability and corrosion resistance are reduced significantly
International Nuclear Information System (INIS)
Takaesu, Y; Nakama, T; Kinjyo, A; Yonamine, S; Hedo, M; Yagasaki, K; Uchima, K; Uwatoko, Y; Burkov, A T
2010-01-01
Electrical resistivity ρ and thermopower S of Y 1-x R x Co 2 (R=Gd, Tb, Dy, Ho and Er) Laves phase alloy systems were measured at temperatures from 1.5 K to 300 K in magnetic fields up to 15 T and under hydrostatic pressure up to 2 GPa. We show that there is a universal linear relation between the pressure and magnetic field derivatives of the resistivity, dρ/dP and dρ/dB, with gradient, determined by pressure derivative of the critical metamagnetic field of the cobalt 3d electron system. A similar scaling behavior was found for the thermopower dependencies on pressure and alloy composition.
Polymorphism of Bi1-xLnxO1.5 phases (04Ln2O9 (x=0.33; Ln=La, Pr, Nd)
International Nuclear Information System (INIS)
Drache, Michel; Huve, Marielle; Roussel, Pascal; Conflant, Pierre
2003-01-01
The Bi 1-x Ln x O 1.5 solid solutions (Ln=La, Pr, Nd), of the β 2 /β 1 /ε (Bi-Sr-O) structural type, have been investigated in their Ln-rich domains. For Ln=La, Pr, and Nd, the upper limits are 0.35, 0.35 and 0.33, respectively. The Bi 4 Ln 2 O 9 ε phase (x=0.33) appears to be the single definite compound. For Bi 4 La 2 O 9 , Bi 4 Pr 2 O 9 and Bi 4 Nd 2 O 9 , the ε-type cells are respectively: a=9.484(4) A, b=3.982(2) A, c=7.030(3) A, β=104.75(3) deg.; a=9.470(5) A, b=3.945(2) A, c=6.968(4) A, β=104.73(3) deg. and a=9.439(3) A, b=3.944(2) A, c=6.923(2) A, β=105.03(3) deg. . Upon heating, each monoclinic (ε) compound transforms successively into rhombohedral phases (β 2 /β 1 ) and finally into a cubic fluorite-type phase. For La- and Pr-based compounds, all transitions are reversible; for Nd, depending on the thermal treatment, the reversibility of ε→β 2 can be incomplete. These transformations are characterized using X-ray thermodiffractometry, differential thermal analysis, dilatometry and impedance spectroscopy versus temperature. Examination of Bi 4 (Ln, Ln') 2 O 9 samples allows to correlate the evolution of the thermal behavior and of the unit cell parameters, to the lanthanide size. A partial plot of the (Bi 2 O 3 ) 1-x -(La 2 O 3 ) x phase diagram (0≤x≤0.40) is proposed
Pathways limiting warming to 1.5°C: a tale of turning around in no time?
Kriegler, Elmar; Luderer, Gunnar; Bauer, Nico; Baumstark, Lavinia; Fujimori, Shinichiro; Popp, Alexander; Rogelj, Joeri; Strefler, Jessica; van Vuuren, Detlef P
2018-05-13
We explore the feasibility of limiting global warming to 1.5°C without overshoot and without the deployment of carbon dioxide removal (CDR) technologies. For this purpose, we perform a sensitivity analysis of four generic emissions reduction measures to identify a lower bound on future CO 2 emissions from fossil fuel combustion and industrial processes. Final energy demand reductions and electrification of energy end uses as well as decarbonization of electricity and non-electric energy supply are all considered. We find the lower bound of cumulative fossil fuel and industry CO 2 emissions to be 570 GtCO 2 for the period 2016-2100, around 250 GtCO 2 lower than the lower end of available 1.5°C mitigation pathways generated with integrated assessment models. Estimates of 1.5°C-consistent CO 2 budgets are highly uncertain and range between 100 and 900 GtCO 2 from 2016 onwards. Based on our sensitivity analysis, limiting warming to 1.5°C will require CDR or terrestrial net carbon uptake if 1.5°C-consistent budgets are smaller than 650 GtCO 2 The earlier CDR is deployed, the more it neutralizes post-2020 emissions rather than producing net negative emissions. Nevertheless, if the 1.5°C budget is smaller than 550 GtCO 2 , temporary overshoot of the 1.5°C limit becomes unavoidable if CDR cannot be ramped up faster than to 4 GtCO 2 in 2040 and 10 GtCO 2 in 2050.This article is part of the theme issue 'The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. © 2018 The Author(s).
Pathways limiting warming to 1.5°C: a tale of turning around in no time?
Kriegler, Elmar; Luderer, Gunnar; Bauer, Nico; Baumstark, Lavinia; Fujimori, Shinichiro; Popp, Alexander; Rogelj, Joeri; Strefler, Jessica; van Vuuren, Detlef P.
2018-05-01
We explore the feasibility of limiting global warming to 1.5°C without overshoot and without the deployment of carbon dioxide removal (CDR) technologies. For this purpose, we perform a sensitivity analysis of four generic emissions reduction measures to identify a lower bound on future CO2 emissions from fossil fuel combustion and industrial processes. Final energy demand reductions and electrification of energy end uses as well as decarbonization of electricity and non-electric energy supply are all considered. We find the lower bound of cumulative fossil fuel and industry CO2 emissions to be 570 GtCO2 for the period 2016-2100, around 250 GtCO2 lower than the lower end of available 1.5°C mitigation pathways generated with integrated assessment models. Estimates of 1.5°C-consistent CO2 budgets are highly uncertain and range between 100 and 900 GtCO2 from 2016 onwards. Based on our sensitivity analysis, limiting warming to 1.5°C will require CDR or terrestrial net carbon uptake if 1.5°C-consistent budgets are smaller than 650 GtCO2. The earlier CDR is deployed, the more it neutralizes post-2020 emissions rather than producing net negative emissions. Nevertheless, if the 1.5°C budget is smaller than 550 GtCO2, temporary overshoot of the 1.5°C limit becomes unavoidable if CDR cannot be ramped up faster than to 4 GtCO2 in 2040 and 10 GtCO2 in 2050. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.
The Cu-Te-Sb phase system at temperatures between 300 and 1000 degree C
DEFF Research Database (Denmark)
Karup-Møller, Sven
1997-01-01
Phase relations were determined in the Cu-Te-Sb phase system at 300, 350, 400, 500, 600, 700, 800, 900 and 1000 degree C. At temperatures between 400 and 900 degree C a cubic primitive ternary phase A exists. It has the empirical formula Cu(10.32-0.97x)Te(x)Sb(4-x) (Z=2, a=7.682 Å). A small liquid...
DEFF Research Database (Denmark)
Sørensen, Inge Juul; Nielsen, EH; Andersen, Ove
1996-01-01
Serum amyloid P component (SAP), a member of the conserved pentraxin family of plasma proteins, binds calcium dependently to its ligands. The authors investigated SAPs interaction with the complement proteins C4b binding protein (C4bp) and C1q by ELISA, immunoelectrophoresis and electron microscopy....... Binding of these proteins to SAP was demonstrated when SAP was immobilized using F(ab')2 anti-SAP, but not when SAP reacted with these proteins in liquid phase; thus the binding to human SAP was markedly phase state dependent. Presaturation of solid phase SAP with heparin, which binds SAP with high...... affinity, did not interfere with the subsequent binding of C4bp or C1q to SAP. In contrast, collagen I and IV showed partial competition with the binding of C1q to SAP. Using fresh serum, immobilized native SAP bound C4bp whereas binding of C1q/C1 could not be demonstrated. Altogether the results indicate...
International Nuclear Information System (INIS)
Morton, David W.; Lui, Matthew P.W.; Young, Colin L.
2003-01-01
Previously, the investigation of the (gas + liquid) critical properties of (alkanol + alkane) mixtures has focussed on (primary alkanol + straight chain alkane) mixtures. The experimental data available for (alkanol + alkane) mixtures, which include secondary or tertiary alcohols and/or branched chain alkanes, are extremely limited. This work extends the existing body of data on (alkanol + alkane) mixtures to include mixtures containing these components. Here the (gas + liquid) critical temperatures of 29 {alkanol (C 2 -C 5 ) + alkane (C 5 -C 12 )} mixtures are reported. All the (gas + liquid) critical lines for the binary mixtures studied are continuous, indicating they obey either Type I or Type II phase behaviour
1H, 15N and 13C NMR Assignments of Mouse Methionine Sulfoxide Reductase B2
Breivik, Åshild S.; Aachmann, Finn L.; Sal, Lena S.; Kim, Hwa-Young; Del Conte, Rebecca; Gladyshev, Vadim N.; Dikiy, Alexander
2011-01-01
A recombinant mouse methionine-r-sulfoxide reductase 2 (MsrB2ΔS) isotopically labeled with 15N and 15N/13C was generated. We report here the 1H, 15N and 13C NMR assignments of the reduced form of this protein. PMID:19636904
Climate Impacts in Europe Under +1.5°C Global Warming
Jacob, Daniela; Kotova, Lola; Teichmann, Claas; Sobolowski, Stefan P.; Vautard, Robert; Donnelly, Chantal; Koutroulis, Aristeidis G.; Grillakis, Manolis G.; Tsanis, Ioannis K.; Damm, Andrea; Sakalli, Abdulla; van Vliet, Michelle T. H.
2018-02-01
The Paris Agreement of the United Nations Framework Convention on Climate Change aims not only at avoiding +2°C warming (and even limit the temperature increase further to +1.5°C), but also sets long-term goals to guide mitigation. Therefore, the best available science is required to inform policymakers on the importance of and the adaptation needs in a +1.5°C warmer world. Seven research institutes from Europe and Turkey integrated their competencies to provide a cross-sectoral assessment of the potential impacts at a pan-European scale. The initial findings of this initiative are presented and key messages communicated. The approach is to select periods based on global warming thresholds rather than the more typical approach of selecting time periods (e.g., end of century). The results indicate that the world is likely to pass the +1.5°C threshold in the coming decades. Cross-sectoral dimensions are taken into account to show the impacts of global warming that occur in parallel in more than one sector. Also, impacts differ across sectors and regions. Alongside the negative impacts for certain sectors and regions, some positive impacts are projected. Summer tourism in parts of Western Europe may be favored by climate change; electricity demand decreases outweigh increases over most of Europe and catchment yields in hydropower regions will increase. However, such positive findings should be interpreted carefully as we do not take into account exogenous factors that can and will influence Europe such as migration patterns, food production, and economic and political instability.
Thermodynamic and kinetic modelling: creep resistant materials
DEFF Research Database (Denmark)
Hald, John; Korcakova, L.; Danielsen, Hilmar Kjartansson
2008-01-01
The use of thermodynamic and kinetic modelling of microstructure evolution in materials exposed to high temperatures in power plants is demonstrated with two examples. Precipitate stability in martensitic 9–12%Cr steels is modelled including equilibrium phase stability, growth of Laves phase part...
Redox-controlled backbone dynamics of human cytochrome c revealed by 15N NMR relaxation measurements
International Nuclear Information System (INIS)
Sakamoto, Koichi; Kamiya, Masakatsu; Uchida, Takeshi; Kawano, Keiichi; Ishimori, Koichiro
2010-01-01
Research highlights: → The dynamic parameters for the backbone dynamics in Cyt c were determined. → The backbone mobility of Cyt c is highly restricted due to the covalently bound heme. → The backbone mobility of Cyt c is more restricted upon the oxidation of the heme. → The redox-dependent dynamics are shown in the backbone of Cyt c. → The backbone dynamics of Cyt c would regulate the electron transfer from Cyt c. -- Abstract: Redox-controlled backbone dynamics in cytochrome c (Cyt c) were revealed by 2D 15 N NMR relaxation experiments. 15 N T 1 and T 2 values and 1 H- 15 N NOEs of uniformly 15 N-labeled reduced and oxidized Cyt c were measured, and the generalized order parameters (S 2 ), the effective correlation time for internal motion (τ e ), the 15 N exchange broadening contributions (R ex ) for each residue, and the overall correlation time (τ m ) were estimated by model-free dynamics formalism. These dynamic parameters clearly showed that the backbone dynamics of Cyt c are highly restricted due to the covalently bound heme that functions as the stable hydrophobic core. Upon oxidation of the heme iron in Cyt c, the average S 2 value was increased from 0.88 ± 0.01 to 0.92 ± 0.01, demonstrating that the mobility of the backbone is further restricted in the oxidized form. Such increases in the S 2 values were more prominent in the loop regions, including amino acid residues near the thioether bonds to the heme moiety and positively charged region around Lys87. Both of the regions are supposed to form the interaction site for cytochrome c oxidase (CcO) and the electron pathway from Cyt c to CcO. The redox-dependent mobility of the backbone in the interaction site for the electron transfer to CcO suggests an electron transfer mechanism regulated by the backbone dynamics in the Cyt c-CcO system.
Magnetostriction of rare earth-Fe2 Laves phase compounds
International Nuclear Information System (INIS)
Clark, A.E.; Abbundi, R.; Savage, H.T.
1977-01-01
Single crystal magnetostriction measurements were made as a function of temperature on TbFe 2 and DyFe 2 . From these, the intrinsic magnetoelastic coupling coefficients were determined for the rare earth-Fe 2 compounds. Employing X-ray techniques, certain multicomponent rare earth-Fe 2 compounds were identified to maximize the magnetostriction to anisotropy ratio. (Auth.)
International Nuclear Information System (INIS)
Cornehl, H.H.; Hornung, G.; Schwarz, H.
1996-01-01
The gas-phase reactivity of the fluorinated hydrocarbons CF 4 , CHF 3 , CH 3 F, C 2 F 6 , 1,1-C 2 H 4 F 2 , and C 6 F 6 with the lanthanide cations Ce + , Pr + , Sm + , Ho + , Tm + , and Yb + and the reactivity of C 6 H 5 F with all lanthanide cations Ln + (Ln = La-Lu, with the exception of Pm + ) have been examined by Fourier-transform ion cyclotron resonance mass spectrometry. The perfluorinated compounds tetrafluoromethane and hexafluoroethane as well as trifluoromethane do not react with any lanthanide cation. Selective activation of the strong C-F bonds in fluoromethane, 1,1-difluoroethane, hexafluorobenzene, and fluorobenzene appears as a general reaction scheme along the 4f row. Experimental evidence is given for a 'harpoon'-like mechanism for the F atom abstraction process which operates via an initial electron transfer from the lanthanide cation to the fluorinated substrate in the encounter complex Ln + RF. The most reactive lanthanides La + , Ce + , Gd + , and Tb + and also the formal closed-shell species Lu + exhibit additional C-H and C-C bond activation pathways in the reaction with fluorobenzene, namely dehydrohalogenation as well as loss of a neutral acetylene molecule. In the case of Tm + and Yb + the formation of neutral LnF 3 is observed in a multistep process via C-C coupling and charge transfer. 17 refs., 2 figs., 2 tabs
The mechanism of hard metal TiC-TiNi composite liquid-phase sintering
International Nuclear Information System (INIS)
Akimov, V.V.
2006-01-01
The sintering conditions are investigated for hard alloys on their production from powders of titanium nickelide with particle size of 10-25 μ and titanium carbide with particles of 5-10 μ at temperatures of 1280-1350 deg C under pressure of 0.1 MPa with holding at heat for 180-900 s. The analysis of experimental data shows that optimum sintering conditions are determined by the quantity of a binding phase TiNi. In the systems with a binding phase content no more than 40 % a heterogeneous structure with nonuniform aggregates of TiC and TiNi phases is observed. With increasing a binding phase amount up to 50-70 % and a temperature up to 1350 deg C, titanium nickelide melts and spreads uniformly among carbide grains. This results in a low porosity of the composite material and in an increase of thermodynamic stability of the system [ru
Thermodynamic properties of hydrated cement phases: C-S-H, C-A-S-H and M-S-H
International Nuclear Information System (INIS)
Roosz, Cedric
2016-01-01
Concrete is one of the most widely used building materials in the world. Durability, mechanical and chemical properties have made it a material of choice in storage concepts proposed by the French National Agency for Radioactive Waste Management (Andra), including the achievement of retaining structures, cell plugs, massive supports or conditioning waste. The study of the stability of the constituent phases of cementitious materials is needed in view of the planned quantities and the durability of the structures, and must consider (i) temperature ranges suitable for cement matrices containment in contact with exothermic waste (25-80 deg. C), and (ii) a representative time scale of the lifetime of the storage. The Andra ThermoChimie project therefore aims to develop a consistent thermodynamic database, to model the chemical evolution of cement materials in the environment of radioactive waste. However, in the present state, the database offers only thermodynamic data of cementitious crystalline phases, as well as a limited data set of three different chemical compositions for nano-crystalline C-S-H. This does not allow to reproduce the degradation of cementitious materials, or model the degradation of the new formulations, such as 'Low pH' concretes. The objective is therefore to acquire a thermodynamic complementary data set on phases such as C-S-H (Calcium Silicate Hydrates) C-A-S-H (Calcium Aluminate Silicate Hydrates) and M-S-H (Magnesium Silicate Hydrates), to complete the ThermoChimie database. This study is based on experimental, analytical and digital work, in order to obtain a set of thermodynamic data (Δ f G 0 , Δ f H 0 , Cp(T), S 0 ) sufficiently representative of the chemical variability of these phases. Finally, this set of data allows the development of a thermodynamic predictive model in extended spaces of compositions and temperatures. Development of this predictive model requires (i) The acquisition of thermodynamic properties on
Crop productivity changes in 1.5 °C and 2 °C worlds under climate sensitivity uncertainty
Schleussner, Carl-Friedrich; Deryng, Delphine; Müller, Christoph; Elliott, Joshua; Saeed, Fahad; Folberth, Christian; Liu, Wenfeng; Wang, Xuhui; Pugh, Thomas A. M.; Thiery, Wim; Seneviratne, Sonia I.; Rogelj, Joeri
2018-06-01
Following the adoption of the Paris Agreement, there has been an increasing interest in quantifying impacts at discrete levels of global mean temperature (GMT) increase such as 1.5 °C and 2 °C above pre-industrial levels. Consequences of anthropogenic greenhouse gas emissions on agricultural productivity have direct and immediate relevance for human societies. Future crop yields will be affected by anthropogenic climate change as well as direct effects of emissions such as CO2 fertilization. At the same time, the climate sensitivity to future emissions is uncertain. Here we investigate the sensitivity of future crop yield projections with a set of global gridded crop models for four major staple crops at 1.5 °C and 2 °C warming above pre-industrial levels, as well as at different CO2 levels determined by similar probabilities to lead to 1.5 °C and 2 °C, using climate forcing data from the Half a degree Additional warming, Prognosis and Projected Impacts project. For the same CO2 forcing, we find consistent negative effects of half a degree warming on productivity in most world regions. Increasing CO2 concentrations consistent with these warming levels have potentially stronger but highly uncertain effects than 0.5 °C warming increments. Half a degree warming will also lead to more extreme low yields, in particular over tropical regions. Our results indicate that GMT change alone is insufficient to determine future impacts on crop productivity.
GLAG theory for superconducting property variations with A15 composition in Nb3Sn wires.
Li, Yingxu; Gao, Yuanwen
2017-04-25
We present a model for the variation of the upper critical field H c2 with Sn content in A15-type Nb-Sn wires, within the Ginzburg-Landau-Abrikosov-Gor'kov (GLAG) theory frame. H c2 at the vicinity of the critical temperature T c is related quantitatively to the electrical resistivity ρ, specific heat capacity coefficient γ and T c . H c2 versus tin content is theoretically formulated within the GLAG theory, and generally reproduces the experiment results. As Sn content gradually approaches the stoichiometry, A15-type Nb-Sn undergoes a transition from the dirty limit to clean limit, split by the phase transformation boundary. The H-T phase boundary and pinning force show different behaviors in the cubic and tetragonal phase. We dipict the dependence of the composition gradient on the superconducting properties variation in the A15 layer, as well as the curved tail at vicinity of H c2 in the Kramer plot of the Nb 3 Sn wire. This helps understanding of the inhomogeneous-composition inducing discrepancy between the results by the state-of-art scaling laws and experiments.
The Effects of L2C Signal Tracking on High-Precision Carrier Phase GPS Positioning
Berglund, H.; Blume, F.; Estey, L. H.; Borsa, A. A.
2010-12-01
In 2005, the L2C signal was introduced to improve the accuracy, tracking and redundancy of the GPS system for civilian users. The L2C signal also provides improved SNR data when compared with the L2P(Y) legacy signal, comparable to that of the L1 C/A-code, which allows for better tracking at lower elevations. With the recent launch of the first block II-F satellite (SVN62/PRN25), there are 8 healthy satellites broadcasting L2C signals, or 25% of the constellation. However, GNSS network operators such as the UNAVCO Plate Boundary Observatory (PBO) have been hesitant to use the new signal as it is not well determined how tracking and logging L2C could affect the positions derived from L2 carrier phase measurements for a given receiver. The L2C carrier phase is in quadrature (90° out of phase) with the L2P(Y) phase that has been used by high-precision positioning software since the beginning of GPS. To complicate matters further, some receiver manufacturers (e.g. Trimble) correct for this when logging L2C phase while others (e.g. Topcon) do not. The L2C capability of receivers currently in widespread use in permanent networks can depend on firmware as well as hardware; in some cases receivers can simultaneously track L2C and L2P(Y) phases and some can track only one or the other, and the resulting observation files can depend on how individual operators configure the devices. In cases where both L2C and L2P(Y) are logged simultaneously, translation software (such as UNAVCO’s teqc) must be used carefully in order to select which L2 observation is written to RINEX (2.11) and used in positioning. Modifications were recently made to teqc to eliminate potential confusion in that part of the process; if L2C code observations appear in a RINEX (2.11) file produced by teqc, the L2 phase and S2 SNR observations were from the L2C carrier for those satellites. To date L2C analyses have been restricted to special applications such as snow depth and soil moisture using SNR data
Barrat , Jean-Alix ,
1991-01-01
Mémoires et Documents du CAESS, n°48; L'existence d'un point chaud localisé en Afar est confirmée. Principalement deux composants mantelliques interviennent dans la genèse des laves du Sud de la Mer Rouge et d'Afar: un manteau appauvri en LREE et une source présentant des caractéristiques du pôle HIMU. Certains basaltes des plateaux éthiopiens et d'Afar (en particulier ceux émis avant l'ouverture du Golfe de Tadjoura) sont contaminés par la croûte continentale. Les résultats analytiques prése...
Enhancement in the high-T{sub c} phase of BSCCO superconductors by Nb addition
Energy Technology Data Exchange (ETDEWEB)
Soezeri, Hueseyin [TUBITAK-UME, National Metrology Institute, PO Box 54 TR-41470, Gebze Kocaeli (Turkey); Ghazanfari, Nader [Middle East Technical University, Physics Department, 06531 Ankara (Turkey); Oezkan, Huesnue [Middle East Technical University, Physics Department, 06531 Ankara (Turkey); Kilic, Ahmet [Middle East Technical University, Physics Department, 06531 Ankara (Turkey)
2007-06-15
Pure and Nb{sub 2}O{sub 5} added Bi{sub 1.6}Pb{sub 0.4}Nb{sub x}Sr{sub 2}Ca{sub 2}Cu{sub 3}O{sub {delta}} superconductors (x varies up to 0.30) were synthesized by the solid state reaction method. Structural and superconducting properties of the samples were investigated. The fraction of the high-T{sub c} phase (2223) increases with Nb addition up to x = 0.10, for which a nearly single 2223 phase was obtained. The critical temperature of the samples increases from 96 to 104 K with doping up to x = 0.20 and a further increase in Nb decreases the T{sub c} sharply. Similarly, there is a considerable enhancement in the critical current density (j{sub c}) of the samples in the same doping range. Both AC susceptibility and transport measurements showed that the optimum Nb concentration is x = 0.20. The out-of-phase component of the AC susceptibility measurements showed that inter-grain coupling was enhanced up to the same doping level. Nb additions above x = 0.30 decrease the fraction of the high-T{sub c} phase and degrade the superconducting properties. Present measurements indicate that x = 0.20 is the optimum Nb concentration in the BSCCO superconductor to enhance phase purity, inter-grain coupling and superconducting parameters (T{sub c} and j{sub c})
Experimental study and thermodynamic assessment of the ZrO2-DyO1.5 system
International Nuclear Information System (INIS)
Wang, Chong; Zinkevich, M.; Aldinger, F.; Stuttgart Univ.
2007-01-01
The phase equilibria and thermodynamic properties in the ZrO 2 -DyO 1.5 system have been studied using the experimental methods of X-ray diffraction, scanning electron microscopy, energy dispersive X-ray spectroscopy, differential thermal analysis and high temperature drop calorimetry. The tetragonal + fluorite and fluorite + C-Dy 2 O 3 phase equilibria between 1400 C and 1700 C have been determined, together with the enthalpy increments of the materials with 30 mol.% and 50 mol.% DyO 1.5 in the temperature range 200-1400 C. Furthermore, the martensitic transformation temperatures (A s ,M s ) have been measured for the samples with 1 and 2 mol.% DyO 1.5 . Finally, thermodynamic assessment has been carried out using the experimental results obtained and literature data. (orig.)
Directory of Open Access Journals (Sweden)
Mauro Carlos Lopes Souza
2009-01-01
Full Text Available Changes to the microestructure during thermal aging treatment at 610 ºC in Fe-xMo-5Ni-0.05C alloys were studied for different aging times with different Mo concentrations. The heat treatment at 610 ºC induces carbide precipitation into the metallic matrix near Fe2Mo phase. The X-ray diffraction studies revealed a more intense precipitation of α-FeMo, Fe3Mo, R(Fe63Mo37 phases and MoC, Fe2MoC carbides for the alloys containing 15 and 11% Mo, respectively. This work shows that hardness and coercive force changes are function of the molybdenum content and aging time variation. Vickers hardness and coercive force both increase with the increase of molybdenum content and reach maximum values at 4 and 1h of aging, respectively.
Estimates of genetic parameters for traits measured in Phase A, C ...
African Journals Online (AJOL)
Unknown
South African Journal of Animal Science 2000, 30(Supplement 1). © South African ... recorded in Phase D (growth tests on-farm) were also included into the analyses. Traits evaluated in ... Results from this study will allow Phase C data to be included into the ... single sire contemporary groups, embryo calves and twins.
Phase transformations in Higher Manganese Silicides
Energy Technology Data Exchange (ETDEWEB)
Allam, A. [MADIREL, UMR 7246 CNRS - Universite Aix-Marseille, av Normandie-Niemen, 13397 Marseille Cedex 20 (France); IM2NP, UMR 7334 CNRS - Universite Aix-Marseille, av Normandie-Niemen, Case 142, 13397 Marseille Cedex 20 (France); Boulet, P. [MADIREL, UMR 7246 CNRS - Universite Aix-Marseille, av Normandie-Niemen, 13397 Marseille Cedex 20 (France); Nunes, C.A. [Departamento de Engenharia de Materiais (DEMAR), Escola de Engenharia de Lorena (EEL), Universidade de Sao Paulo - USP, Caixa Postal 116, 12600-970 Lorena, Sao Paulo (Brazil); Sopousek, J.; Broz, P. [Masaryk University, Faculty of Science, Department of Chemistry, Kolarska 2, 611 37 Brno (Czech Republic); Masaryk University, Central European Institute of Technology, CEITEC, Kamenice 753/5, 625 00 Brno (Czech Republic); Record, M.-C., E-mail: m-c.record@univ-cezanne.fr [IM2NP, UMR 7334 CNRS - Universite Aix-Marseille, av Normandie-Niemen, Case 142, 13397 Marseille Cedex 20 (France)
2013-02-25
Highlights: Black-Right-Pointing-Pointer The phase transitions of the Higher Manganese Silicides were investigated. Black-Right-Pointing-Pointer The samples were characterised by XRD, DTA and DSC. Black-Right-Pointing-Pointer Mn{sub 27}Si{sub 47} is the stable phase at room temperature and under atmospheric pressure. Black-Right-Pointing-Pointer At around 800 Degree-Sign C, Mn{sub 27}Si{sub 47} is transformed into Mn{sub 15}Si{sub 26}. Black-Right-Pointing-Pointer The phase transition is of a second order. - Abstract: This work is an investigation of the phase transformations of the Higher Manganese Silicides in the temperature range [100-1200 Degree-Sign C]. Several complementary experimental techniques were used, namely in situ X-ray Diffraction (XRD), Differential Thermal Analysis (DTA) and Differential Scanning Calorimetry (DSC). The evolution of both the lattice parameters and the thermal expansion coefficients was determined from in situ XRD measurements. The stability of the samples was investigated by thermal analysis (DTA) and Cp measurements (DSC). This study shows that Mn{sub 27}Si{sub 47} which is the stable phase at room temperature and under atmospheric pressure undergoes a phase transformation at around 800 Degree-Sign C. Mn{sub 27}Si{sub 47} is transformed into Mn{sub 15}Si{sub 26}. This phase transformation seems to be of a second order one. Indeed it was not evidenced by DTA and by contrast it appears on the Cp curve.
Phase relationships in the quasi-ternary LaO1.5–SiO2–MgO system at 1773 K
Directory of Open Access Journals (Sweden)
Kiyoshi Kobayashi and Yoshio Sakka
2012-01-01
Full Text Available Phase relationships in the LaO1.5–SiO2–MgO quasi-ternary system at 1773 K were investigated by powder x-ray diffraction (XRD analysis applying single- and multiple-phase Rietveld methods. Most of the formed phases satisfied the Gibbs' phase rule, except for the samples containing LaO1.5 and a liquid phase at 1773 K. The detection of segregated MgO phases was difficult in the XRD profiles of the compositional samples around the oxyapatite single phase because the MgO peaks were weak and heavily overlapped by peaks from the oxyapatite and La(OH3 phases. The solid solubility limit of MgO in oxyapatite was determined not only from the chemical composition of the oxyapatite phase, which was confirmed by XRD, but also from several phase boundary compositions among the two-phase and three-phase regions based on the Gibbs' phase rule. Formation of a liquid phase at 1773 K was observed in a wide range of compositions and considered when constructing the phase diagram.
Phase relations in the SiC-Al2O3-Pr2O3 system
International Nuclear Information System (INIS)
Pan, W.; Wu, L.; Jiang, Y.; Huang, Z.
2016-01-01
Phase relations in the Si-Al-Pr-O-C system, including the SiC-Al 2 O 3 -Pr 2 O 3 , the Al 2 O 3 -Pr 2 O 3 -SiO 2 and the SiC-Al 2 O 3 -Pr 2 O 3 -SiO 2 subsystems, were determined by means of XRD phase analysis of solid-state-reacted samples fabricated by using SiC, Al 2 O 3 , Pr 2 O 3 and SiO 2 powders as the starting materials. Subsolidus phase diagrams of the systems were presented. Two Pr-aluminates, namely PrAlO 3 (PrAP) and PrAl 11 O 18 (β(Pr) β-Al 2 O 3 type) were formed in the SiC-Al 2 O 3 -Pr 2 O 3 system. SiC was compatible with both of them. Pr-silicates of Pr 2 SiO 5 , Pr 2 Si 2 O 7 and Pr 9.33 Si 6 O 26 (H(Pr) apatite type) were formed owing to presence of SiO 2 impurity in the SiC powder. The presence of the SiO 2 extended the ternary system of SiC-Al 2 O 3 -Pr 2 O 3 into a quaternary system of SiC-Al 2 O 3 -SiO 2 -Pr 2 O 3 (Si-Al-Pr-O-C). SiC was compatible with Al 2 O 3 , Pr 2 O 3 and the Pr-silicates. The effect of SiO 2 on the phase relations and liquid phase sintering of SiC ceramics was discussed.
International Nuclear Information System (INIS)
Moler, E.J.; Kellar, S.A.; Huff, W.R.A.
1997-01-01
The authors report a study of the spatial structure of (√3 x √3)R30 degrees (low coverage) and (1.5 x 1.5)R18 degrees (intermediate coverage) CO adsorbed on Cu(111), using the Angle-Resolved Photoemission Extended Fine Structure (ARPEFS) technique at beamline 9.3.2 at the Advanced Light Source. The CO molecule adsorbs on an atop site for both adsorption phases. Full multiple-scattering spherical-wave (MSSW) calculations were used to extract the C-Cu. bond length and the first Cu-Cu layer spacing for each adsorption phase. The authors find that the C-Cu bond length remains unchanged with increasing coverage, but the 1st Cu-Cu layer spacing contracts at the intermediate coverage. They calculate the bending mode force constant in the (1.5 x 1.5)R18 degrees phase to be K δ = 2.2 (1) x 10 -12 dyne-cm/rad from their experimentally determined bond lengths combined with previously published infra-red absorption frequencies
Risks for the global freshwater system at 1.5 °C and 2 °C global warming
Döll, Petra; Trautmann, Tim; Gerten, Dieter; Müller Schmied, Hannes; Ostberg, Sebastian; Saaed, Fahad; Schleussner, Carl-Friedrich
2018-04-01
To support implementation of the Paris Agreement, the new HAPPI ensemble of 20 bias-corrected simulations of four climate models was used to drive two global hydrological models, WaterGAP and LPJmL, for assessing freshwater-related hazards and risks in worlds approximately 1.5 °C and 2 °C warmer than pre-industrial. Quasi-stationary HAPPI simulations are better suited than transient CMIP-like simulations for assessing hazards at the two targeted long-term global warming (GW) levels. We analyzed seven hydrological hazard indicators that characterize freshwater-related hazards for humans, freshwater biota and vegetation. Using a strict definition for significant differences, we identified for all but one indicator that areas with either significantly wetter or drier conditions (calculated as percent changes from 2006–2015) are smaller in the 1.5 °C world. For example, 7 day high flow is projected to increase significantly on 11% and 21% of the global land area at 1.5 °C and 2 °C, respectively. However, differences between hydrological hazards at the two GW levels are significant on less than 12% of the area. GW affects a larger area and more people by increases—rather than by decreases—of mean annual and 1-in-10 dry year streamflow, 7 day high flow, and groundwater recharge. The opposite is true for 7 day low flow, maximum snow storage, and soil moisture in the driest month of the growing period. Mean annual streamflow shows the lowest projected percent changes of all indicators. Among country groups, low income countries and lower middle income countries are most affected by decreased low flows and increased high flows, respectively, while high income countries are least affected by such changes. The incremental impact between 1.5 °C and 2 °C on high flows would be felt most by low income and lower middle income countries, the effect on soil moisture and low flows most by high income countries.
Optimum tungsten content in high strength 9 to 12% chromium containing creep resistant steels
International Nuclear Information System (INIS)
Hasegawa, Y.; Muraki, T.; Mimura, H.
2000-01-01
Tungsten containing ferritic creep resistant steels are the candidate materials for ultra-super-critical fossil power plant because of their high creep rupture strength. But the strengthening mechanisms by tungsten addition have not yet been completely studied. In this report, creep rupture time and creep strain rate measurement decided the optimum tungsten content in 9 to 12% chromium ferritic steels. The precipitation behavior of Laves phase and the precise discussion of creep strain rate analyses explain the contribution of Laves phase at the lath boundary and the contribution of tungsten in solid solution. P92 contains the optimum amount of tungsten and chromium, 1.8 mass% and 9 mass% respectively judging from the creep rupture strength point of view. (orig.)
Projected changes of thermal growing season over Northern Eurasia in a 1.5 °C and 2 °C warming world
Zhou, Baiquan; Zhai, Panmao; Chen, Yang; Yu, Rong
2018-03-01
Projected changes of the thermal growing season (TGS) over Northern Eurasia at 1.5 °C and 2 °C global warming levels are investigated using 22 CMIP5 models under both RCP4.5 and RCP8.5 scenarios. The multi-model mean projections indicate Northern Eurasia will experience extended and intensified TGSs in a warmer world. The prolongation of TGSs under 1.5 °C and 2 °C warming is attributed to both earlier onset and later termination, with the latter factor playing a dominating role. Interestingly, earlier onset is of greater importance under RCP4.5 than under RCP8.5 in prolonging TGS as the world warms by an additional 0.5 °C. Under both RCPs, growing degree day sum (GDD) above 5 °C is anticipated to increase by 0 °C-450 °C days and 0 °C-650 °C days over Northern Eurasia at 1.5 °C and 2 °C warming, respectively. However, effective GDD (EGDD) which accumulates optimum temperature for the growth of wheat, exhibits a decline in the south of Central Asia under warmer climates. Therefore, for wheat production over Northern Eurasia, adverse effects incurred by scorching temperatures and resultant inadequacy in water availability may counteract benefits from lengthening and warming TGS. In response to a future 1.5 °C and 2 °C warmer world, proper management and scientifically-tailored adaptation are imperative to optimize local-regional agricultural production.
Emanuele, Michael J; Ciccia, Alberto; Elia, Andrew E H; Elledge, Stephen J
2011-06-14
The anaphase-promoting complex/cyclosome (APC/C) is a cell cycle-regulated E3 ubiquitin ligase that controls the degradation of substrate proteins at mitotic exit and throughout the G1 phase. We have identified an APC/C substrate and cell cycle-regulated protein, KIAA0101/PAF15. PAF15 protein levels peak in the G2/M phase of the cell cycle and drop rapidly at mitotic exit in an APC/C- and KEN-box-dependent fashion. PAF15 associates with proliferating cell nuclear antigen (PCNA), and depletion of PAF15 decreases the number of cells in S phase, suggesting a role for it in cell cycle regulation. Following irradiation, PAF15 colocalized with γH2AX foci at sites of DNA damage through its interaction with PCNA. Finally, PAF15 depletion led to an increase in homologous recombination-mediated DNA repair, and overexpression caused sensitivity to UV-induced DNA damage. We conclude that PAF15 is an APC/C-regulated protein involved in both cell cycle progression and the DNA damage response.
N-Mesityl-C-acylketenimines: 1,5-Sigmatropic Shifts and Electrocyclization to Quinolines.
Rao, V. V. Ramana; Fulloon, Belinda E.; Bernhardt, Paul V.; Koch, Rainer; Wentrup, Curt
1998-08-21
Flash vacuum thermolysis (FVT) of triazoles 6a-c generates alpha-oxoketenimines 10, the ester 10a being isolable. FVT of pyrroledione 8 generates the isomeric imidoylketene 9a. Ketenes 9 and ketenimines 10 undergo thermal interconversion by 1,3-shifts of methoxy and dimethylamino groups under mild FVT conditions (ca. 350-400 degrees C). Both 9 and 10 are directly observable by IR spectroscopy at either 77 K or on Ar matrix isolation at 12 K. On FVT at temperatures above ca. 400 degrees C, the ketenimines 10 undergo a 1,5-H shift to o-quinoid imines 12/13, followed by electrocyclization to dihydroquinolines 14 (unobserved) and 15 (observed by NMR). The latter are easily oxidized to alkylquinoline-3-carboxylates or quinoline-3-carboxamides 16 by atmospheric oxygen. Ab initio calculations on model compounds 18-23 predict an energy barrier of ca. 38 kcal mol(-)(1) (161 kJ mol(-)(1)) for the 1,5-H shift in N-(o-methylphenyl)ketenimines via the transition state TS19 followed by an electrocyclization barrier to dihydroquinoline 23a via TS22a of ca. 16 kcal mol(-)(1).
Scenarios towards limiting global mean temperature increase below 1.5 °C
Rogelj, Joeri; Popp, Alexander; Calvin, Katherine V.; Luderer, Gunnar; Emmerling, Johannes; Gernaat, David; Fujimori, Shinichiro; Strefler, Jessica; Hasegawa, Tomoko; Marangoni, Giacomo; Krey, Volker; Kriegler, Elmar; Riahi, Keywan; van Vuuren, Detlef P.; Doelman, Jonathan; Drouet, Laurent; Edmonds, Jae; Fricko, Oliver; Harmsen, Mathijs; Havlík, Petr; Humpenöder, Florian; Stehfest, Elke; Tavoni, Massimo
2018-04-01
The 2015 Paris Agreement calls for countries to pursue efforts to limit global-mean temperature rise to 1.5 °C. The transition pathways that can meet such a target have not, however, been extensively explored. Here we describe scenarios that limit end-of-century radiative forcing to 1.9 W m-2, and consequently restrict median warming in the year 2100 to below 1.5 °C. We use six integrated assessment models and a simple climate model, under different socio-economic, technological and resource assumptions from five Shared Socio-economic Pathways (SSPs). Some, but not all, SSPs are amenable to pathways to 1.5 °C. Successful 1.9 W m-2 scenarios are characterized by a rapid shift away from traditional fossil-fuel use towards large-scale low-carbon energy supplies, reduced energy use, and carbon-dioxide removal. However, 1.9 W m-2 scenarios could not be achieved in several models under SSPs with strong inequalities, high baseline fossil-fuel use, or scattered short-term climate policy. Further research can help policy-makers to understand the real-world implications of these scenarios.
Permafrost thaw strongly reduces allowable CO2 emissions for 1.5°C and 2°C
Kechiar, M.; Gasser, T.; Kleinen, T.; Ciais, P.; Huang, Y.; Burke, E.; Obersteiner, M.
2017-12-01
We quantify how the inclusion of carbon emission from permafrost thaw impacts the budgets of allowable anthropogenic CO2 emissions. We use the compact Earth system model OSCAR v2.2 which we expand with a permafrost module calibrated to emulate the behavior of the complex models JSBACH, ORCHIDEE and JULES. When using the "exceedance" method and with permafrost thaw turned off, we find budgets very close to the CMIP5 models' estimates reported by IPCC. With permafrost thaw turned on, the total budgets are reduced by 3-4%. This corresponds to a 33-45% reduction of the remaining budget for 1.5°C, and a 9-13% reduction for 2°C. When using the "avoidance" method, however, permafrost thaw reduces the total budget by 3-7%, which corresponds to reductions by 33-56% and 56-79% of the remaining budget for 1.5°C and 2°C, respectively. The avoidance method relies on many scenarios that actually peak below the target whereas the exceedance method overlooks the carbon emitted by thawed permafrost after the temperature target is reached, which explains the difference. If we use only the subset of scenarios in which there is no net negative emissions, the permafrost-induced reduction in total budgets rises to 6-15%. Permafrost thaw therefore makes the emission budgets strongly path-dependent. We also estimate budgets of needed carbon capture in scenarios overshooting the temperature targets. Permafrost thaw strongly increases these capture budgets: in the case of a 1.5°C target overshot by 0.5°C, which is in line with the Paris agreement, about 30% more carbon must be captured. Our conclusions are threefold. First, inclusion of permafrost thaw systematically reduces the emission budgets, and very strongly so if the temperature target is overshot. Second, the exceedance method, that is the only one that complex models can follow, only partially accounts for the effect of slow non-linear processes such as permafrost thaw, leading to overestimated budgets. Third, the newfound
Fate of [15N]glycine in peat as determined by 13C and 15N CP-MAS NMR spectroscopy
International Nuclear Information System (INIS)
Benzing-Purdie, L.M.; Cheshire, M.V.; Williams, B.L.; Sparling, G.P.; Ratcliffe, C.I.; Ripmeester, J.A.
1986-01-01
Peat samples, nonsterile, sterilized by γ irradiation or autoclaving, were incubated with [ 15 N]glycine for a period of 6 months. The 13 C NMR data showed the established trend of increased humification with decreasing particle size and that autoclaving had significantly disturbed the humification-particle size distribution. The 15 N CP-MAS NMR spectra showed the presence of [ 15 N]glycine in all fractions after incubation. 15 NH 4 + , a result of either biological or chemical deamination, was one of the main products in the nonsterile peat series. The 15 N spectra also showed resonances corresponding to amine, secondary amide, and pyrrole-type nitrogen and the presence of glycine derivatives and melanoidins. The results presented give the first spectroscopic evidence of the possible involvement of the Maillard reaction in the humification process
Extreme Temperatures over India in the 1.5°C and 2°C warmer worlds
Thanigachalam, A.; Achutarao, K. M.
2017-12-01
n the summer of 2015 a heat wave claimed more than 2500 lives of southeastern India. Wehner et al., (2016) showed that the risk of this heat wave has increased due to anthropogenic forcings. Under the RCP 8.5 scenario, surface temperature over India shows a rate of increase of about 0.2°C/decade during the 21st Century (Basha et al., 2017). The extreme temperatures that have occurred in the recent past and further increases projected for the future have implications for human health and productivity. In light of the Paris accords, future stabilization of global mean temperature at the 1.5°C above pre-industrial aspirational target and the "not to be exceeded" 2°C target (still higher than current temperatures), the possibility of increases in extreme temperatures under these scenarios is very real. In this study we seek to understand the nature of extreme temperatures over India in the 1.5°C and 2°C worlds in comparison to the current climate. We make use of model output contributed under the Half a degree Additional warming, Prognosis and Projected Impacts project (HAPPI; Mitchell et al., 2017). The HAPPI database contains output from many atmospheric GCMs with multiple simulations ( 100 each) of historical (2005-2015), 1.5°C warmer decade, and 2°C warmer decade. The large number of ensembles provides an opportunity to study the extremes in temperature that occur over India and how they may change. In order to provide insights into the future comparable against current operational practices, we make use of definitions of "hot days", "heat waves", and "severe heat waves" used by the India Meteorological Department (IMD). We compare modelled data (and bias corrected model output where available) against observed daily temperatures from the IMD gridded (1°x1°) dataset available for 1951-2015 as also circulation features that lead to such events by comparing against reanalysis products. We also investigate the timing of such events in the future scenarios
Energy Technology Data Exchange (ETDEWEB)
Wong, D.F. [BASF/Battery Materials-Ovonic, 2983 Waterview Drive, Rochester Hills, MI 48309 (United States); Department of Chemical Engineering, Wayne State University, Detroit, MI 48202 (United States); Young, K., E-mail: kwo.young@basf.com [BASF/Battery Materials-Ovonic, 2983 Waterview Drive, Rochester Hills, MI 48309 (United States); Department of Chemical Engineering, Wayne State University, Detroit, MI 48202 (United States); Nei, J.; Wang, L. [BASF/Battery Materials-Ovonic, 2983 Waterview Drive, Rochester Hills, MI 48309 (United States); Ng, K.Y.S. [Department of Chemical Engineering, Wayne State University, Detroit, MI 48202 (United States)
2015-10-25
Nd-addition to the AB{sub 2}-based alloy Ti{sub 12}Zr{sub 22.8−x}V{sub 10}Cr{sub 7.5}Mn{sub 8.1}Co{sub 7.0}Ni{sub 32.2}Al{sub 0.4}Nd{sub x} is studied for its effects on the structure, gaseous-phase hydrogen storage, and electrochemical properties. This study follows a series of Cu, Mo, Fe, Y, Si, and La doping studies in similar AB{sub 2}-based alloys. Limited solubility of Nd in the main Laves phase promotes the formation of secondary phases (AB and Zr{sub 7}Ni{sub 10}) to provide catalytic effects and synergies for improved capacity and high-rate dischargeability (HRD) performance. The main C14 storage phase has smaller lattice constants and cell volumes, and these effects reduce the storage capacity at higher Nd levels. Different hydrogen absorption mechanisms can occur in these multi-component, multi-phase alloys depending on the interfaces of the phases, and they have effects on the alloy properties. Higher Nd-levels improve the HRD performance despite having lower bulk diffusion and surface exchange current. Magnetic susceptibility measurements indicate large percentage of larger metallic nickel clusters are present in the surface oxide of alloys with higher Nd-content, and AC impedance studies show very low charge-transfer resistance with high catalytic capability in the alloys. The −40 °C charge-transfer resistance of 8.9 Ω g in this Nd-series of alloys is the lowest measured out of the studies investigating doped AB{sub 2}-based MH alloys for improved low-temperature characteristics. The improvement in HRD and low-temperature performance appears to be related to the proportion of the highly catalytic NdNi-phase at the surface, which must offset the increased bulk diffusion resistance in the alloy. - Graphical abstract: Schematics of hydrogen flow and corresponding PCT isotherms in funneling mode. - Highlights: • Structural and hydrogen storage properties of Nd-substituted AB{sub 2} metal hydride are reported. • Nd contributes to the lowest
Evolution of 3C-SiC islands nucleated from a liquid phase on Si face α-SiC substrates
International Nuclear Information System (INIS)
Kim-Hak, Olivier; Ferro, Gabriel; Lorenzzi, Jean; Carole, Davy; Dazord, Jacques; Chaudouet, Patrick; Chaussende, Didier; Miele, Philippe
2010-01-01
The contact between α-SiC crystals and Si-Ge based melts provokes the nucleation of 3C-SiC islands on the crystal surface. Evolution of these islands as a function of various parameters was studied. On both 4H and 6H substrates, it was found that, after nucleation, 3C-SiC islands first enlarge and may form a complete 3C layer under certain conditions. The 3C deposit can then be dissolved by the liquid phase at high temperature or for prolonged contact at relatively moderate temperature. The graphite crucible is proposed to play a central role in these enlargement and dissolution mechanisms by providing extra carbon atoms on the seed surface (enlargement) or provoking thermal induced carbon transport toward the sidewall (dissolution). Several differences between the use of 4H and 6H substrates were also observed.
International Nuclear Information System (INIS)
Levin, E.M.; Gschneidner, K.A.; Pecharsky, V.K.
2001-01-01
The temperature (from 5 to 300 K) and DC magnetic field (from 0 to 90 kOe) dependencies of the DC magnetization and magnetic susceptibility, and the temperature (from 5 to 350 K) dependency of the AC magnetic susceptibility of Gd 5 (Si 1.5 Ge 2.5 ) have been studied. The temperature and/or magnetic field induced magnetic phase transition in Gd 5 (Si 1.5 Ge 2.5 ) is a first order ferromagnet-paramagnet transition. The temperature of the magnetic transition in low AC magnetic field is 206 and 217 K for cooling and heating, respectively. The DC magnetic field increases the transition temperature by ∼0.36 K/kOe indicating that the paramagnetic phase can be reversibly transformed into the ferromagnetic phase. When the magnetic field is removed, the ferromagnetic phase transforms into the paramagnetic phase showing a large remanence-free hysteresis. The magnetic phase diagram based on the isothermal magnetic field dependence of the DC magnetization at various temperatures for Gd 5 (Si 1.5 Ge 2.5 ) is proposed. The magnetic field dependence of the magnetization in the vicinity of the first order phase transition shows evidence for the formation of a magnetically heterogeneous system in the volume of Gd 5 (Si 1.5 Ge 2.5 ) specimen where the magnetically ordered (ferromagnetic) and disordered (paramagnetic) phases co-exist
Fabrication, magnetostriction properties and applications of Tb-Dy-Fe alloys: a review
Directory of Open Access Journals (Sweden)
Nai-juan Wang
2016-03-01
Full Text Available As an excellent giant-magnetostrictive material, Tb-Dy-Fe alloys (based on Tb0.27-0.30Dy0.73-0.70Fe1.9-2 Laves compound can be applied in many engineering fields, such as sonar transducer systems, sensors, and micro-actuators. However, the cost of the rare earth elements Tb and Dy is too high to be widely applied for the materials. Nowadays, there are two different ways to substitute for these alloying elements. One is to partially replace Tb or Dy by cheaper rare earth elements, such as Pr, Nd, Sm and Ho; and the other is to use non-rare earth elements, such as Co, Al, Mn, Si, Ce, B, Be and C, to substitute Fe to form single MgCu2-type Laves phase and a certain amount of Re-rich phase, which can reduce the brittleness and improve the corrosion resistance of the alloy. This paper systemically introduces the development, the fabrication methods and the corresponding preferred growth directions of Tb-Dy-Fe alloys. In addition, the effects of alloying elements and heat treatment on magnetostrictive and mechanical properties of Tb-Dy-Fe alloys are also reviewed, respectively. Finally, some possible applications of Tb-Dy-Fe alloys are presented.
International Nuclear Information System (INIS)
Straus, Suzana K.; Bremi, Tobias; Ernst, Richard R.
1998-01-01
High-resolution heteronuclear NMR correlation experiments and strategies are proposed for the assignment of fully 13 C/ 15 N-labelled polypeptides in the solid state. By the combination of intra-residue and inter-residue 13 C- 15 N correlation experiments with 13 C- 13 C spin-diffusion studies, it becomes feasible to partially assign backbone and side-chain resonances in solid proteins. The performance of sequences using 15 N instead of 13 C detection is evaluated regarding sensitivity and resolution for a labelled dipeptide (L-Val-L-Phe). The techniques are used for a partial assignment of the 15 N and 13 C resonances in human ubiquitin
Modelling of phase equilibria in CH4–C2H6–C3H8–nC4H10–NaCl–H2O systems
International Nuclear Information System (INIS)
Li, Jun; Zhang, Zhigang; Luo, Xiaorong; Li, Xiaochun
2015-01-01
Highlights: • A new model was established for the phase equilibria of C1–C2–C3–nC4–brine systems. • The model can reproduce of hydrocarbon–brine equilibria to high T&P and salinity. • The model can well predict H 2 O solubility in light hydrocarbon rich phases. - Abstract: A thermodynamic model is presented for the mutual solubility of CH 4 –C 2 H 6 –C 3 H 8 –nC 4 H 10 –brine systems up to high temperature, pressure and salinity. The Peng–Robinson model is used for non-aqueous phase fugacity calculations, and the Pitzer model is used for aqueous phase activity calculations. The model can accurately reproduce the experimental solubilities of CH 4 , C 2 H 6 , C 3 H 8 and nC 4 H 10 in water or NaCl solutions and H 2 O solubility in the non-aqueous phase. The experimental data of mutual solubility for the CH 4 –brine subsystem are sufficient for temperatures exceeding 250 °C, pressures exceeding 1000 bar and NaCl molalities greater than 6 molal. Compared to the CH 4 –brine system, the mutual solubility data of C 2 H 6 –brine, C 3 H 8 –brine and nC 4 H 10 –brine are not sufficient. Based on the comparison with the experimental data of H 2 O solubility in C 2 H 6 -, C 3 H 8 - or nC 4 H 10 -rich phases, the model has an excellent capability for the prediction of H 2 O solubility in hydrocarbon-rich phases, as these experimental data were not used in the modelling. Predictions of hydrocarbon solubility (at temperatures up to 200 °C, pressures up to 1000 bar and NaCl molalities greater than 6 molal) were made for the C 2 H 6 –brine, C 3 H 8 –brine and nC 4 H 10 –brine systems. The predictions suggest that increasing pressure generally increases the hydrocarbon solubility in water or brine, especially in the lower-pressure region. Increasing temperature usually decreases the hydrocarbon solubility at lower temperatures but increases the hydrocarbon solubility at higher temperatures. Increasing water salinity dramatically decreases
Implications of geoengineering under the 1.5 °C target: Analysis and policy suggestions
Directory of Open Access Journals (Sweden)
Ying Chen
2017-06-01
Full Text Available The Paris Agreement introduced a 1.5 °C target to control the rise in global temperature, but clear arrangements for feasible implementation pathways were not made. Achieving the 1.5 °C target imposes high requirements on global emission reduction. Nationally Determined Contributions of all Parties are far from the 1.5 °C target, and conventional emission reduction technologies and policies will also have difficulty in fulfilling this task. In this context, geoengineering is gaining interest in the international arena. The Paris Agreement includes afforestation, carbon capture, utilization and storage, and negative emission technologies such as bio-energy with carbon capture and store. All of these techniques are CO2 removal technologies that belong to geoengineering. Solar radiation management, which is highly controversial, has also attracted increased attention in recent years. Although the outline of the IPCC Special Report on 1.5 °C does not include a specific section on geoengineering issues yet, geoengineering is an unconventional technical option that cannot be avoided in research and discussions on impact assessment, technical options, ethics, and international governance under the 1.5 °C target. On the basis of analyzing and discussing abovementioned issues, this paper proposes several policy suggestions for China to strengthen research on and response to geoengineering.
Creep properties and microstructure evaluation of weld joint of the pipe made of P92 steel
Energy Technology Data Exchange (ETDEWEB)
Kasl, Josef; Jandova, Dagmar; Chvostova, Eva [SKODA VYZKUM s.r.o., Plzen (Czech Republic); Folkova, Eva [SKODA POWER a.s., Plzen (Czech Republic)
2010-07-01
One-side weld joint of W type was prepared from P92 type steel using GTAW and SMAW method. Creep test to the rupture of smooth cross-weld samples has been carried out at temperatures ranging from 575 to 650 C and at stresses from 70 to 240 MPa. Fractographic analysis, hardness measurement and detailed study of submicrostructure have been performed using light, scanning and transmission electron microscopy. Changes of microstructure were correlated with the creep strength. Increase in size of secondary phases and cavities formation were evident after creep tests at temperatures above 575 C. Voids were concentrated in the fine prior austenite grain heat affected zones, where fracture occurred. In addition, a sporadic occurrence of individual cavities was found out in the base material and the weld metal after tests at 625 and 650 C. During creep exposures at temperatures above 600 C Laves phase precipitated. (orig.)
Synthesis and characterisation of pure C(-A)-S-H phases
International Nuclear Information System (INIS)
L'Hopital, E.; Lothenbach, B.; Le Saout, G.; Kulik, D.A.; Scrivener, K.
2015-01-01
The construction of nuclear power plants requires huge quantity of cement and the cement production generates about 8% of global man-made CO 2 emissions. One way of reducing the concrete's CO 2 contribution is to lower its CO 2 generation and energy consumption by a partial replacement of clinker with supplementary cementitious materials (SCMs). Common SCMs such as blast furnace slag or fly ash contain more silicon and aluminium than Portland cement, so that the hydrates formed are different than in Portland cements, which might affect the concrete mechanical properties. The most important phase formed during the reaction of Portland cement with water is calcium silicate hydrate, C-S-H. In the presence of SCMs, C-S-H can have different composition compared to C-S-H in Portland cements. The present work focuses on synthesis of pure C(-A)- S-H at a Ca/Si ratio equal to 1 in presence of different quantities of aluminium (Al/Si atomic ratio from 0 to 0.05) to determine the aluminium incorporation in C-S-H. The absence of any other solids and the low aluminium concentrations measured in the solution clearly showed an uptake of aluminium within the C-(A)-S-H phase. The presence of aluminium increased the interlayer distance, indicating an uptake of aluminium in the C-(A)-S-H structure. The uptake of aluminium was more pronounced at higher dissolved aluminium concentrations, consistent with the formation of a solid solution between C-S-H and C-A-S-H. The presence of aluminium led to a decrease of the calcium concentrations, while the silica and aluminium concentrations increased
Heat wave exposure in India in current, 1.5 °C, and 2.0 °C worlds
Mishra, Vimal; Mukherjee, Sourav; Kumar, Rohini; Stone, Dáithí A.
2017-12-01
Heatwaves with large impacts have increased in the recent past and will continue to increase under future warming. However, the implication for population exposure to severe heatwaves remains unexplored. Here, we characterize maximum potential human exposure (without passive/active reduction measures) to severe heatwaves in India. We show that if the global mean temperature is limited to 2.0 °C above pre-industrial conditions, the frequency of severe heatwaves will rise by 30 times the current climate by the end-21st century. In contrast, the frequency is projected to be about 2.5 times more (than the low-warming scenario of 2 °C) under conditions expected if the RCP8.5 ‘business-as-usual’ emissions scenario is followed. Under the 2.0 °C low-warming target, population exposure to severe heatwaves is projected to increase by about 15 and 92 times the current level by the mid and end-21st century respectively. Strategies to reduce population growth in India during the 21st century may provide only limited mitigation of heatwave exposure mostly late in the century. Limiting global temperatures to 1.5 °C above preindustrial would reduce the exposure by half relative to RCP8.5 by the mid-21st century. If global temperatures are to exceed 1.5 °C then substantial measures will be required to offset the large increase in exposure to severe heatwaves in India.
Phase transformations in titanium oxycarbide TiC0.545O0.08
International Nuclear Information System (INIS)
Tashmetov, M.Yu.; Em, V.T.; Savenko, B.N.; Batdemberel, G.
2003-01-01
Phase transformations in titanium oxycarbide TiC 0.545 O 0.08 have been studied by the methods of neutron diffraction and X-ray structure analysis. It was established that the ordered cubic structure δ ' (sp. gr. Fd3m) of the oxycarbide sample is the low-temperature ordered phase existing up to 990 K. The order-disorder phase transition (990 K) results in the formation of an ordered trigonal structure (sp. gr. R3-barm or P3 1 21). The α-Ti-phase is separated at the temperature 1020 K. The order-disorder phase transition was found at T = 1040 K
Feng, Caihui; Shan, Jingfeng; Xu, Aoshu; Xu, Yang; Zhang, Meiguang; Lin, Tingting
2017-10-01
Trigonal yttrium hypocarbide (Y2C), crystallizing in a layered hR3 structure, is an intriguing quasi-two-dimensional electride metal with potential application for the next generation of electronics. By using an efficient structure search method in combination with first-principles calculations, we have extensively explored the phase transitions and electronic properties of Y2C in a wide pressure range of 0-200 GPa. Three structural transformations were predicted, as hR3 → oP12 → tI12 → mC12. Calculated pressures of phase transition are 20, 118, and 126 GPa, respectively. The high-pressure oP12 phase exhibits a three-dimensional extended C-Y network built up from face- and edge-sharing CY8 hendecahedrons, whereas both the tI12 and mC12 phases are featured by the presence of C2 units. No anionic electrons confined to interstitial spaces have been found in the three predicted high-pressure phases, indicating that they are not electrides. Moreover, Y2C is dynamically stable and also energetically stable relative to the decomposition into its elemental solids.
Solid-state amorphization of SmFe{sub 3} by hydrogenation
Energy Technology Data Exchange (ETDEWEB)
Mueller, K.H.; Kubis, M.; Handstein, A.; Gutfleisch, O.
2000-05-10
Hydrogen-induced amorphization (HIA) has received much attention as a method for the preparation of amorphous compounds since its discovery by Yeh et al. Meanwhile it has been observed for a large number of intermetallic compounds with C15, C23, B8{sub 2}, DO{sub 19} and L1{sub 2} structures. E.G. the C15 Laves-type compounds (MgCu{sub 2}-type structure) of rare earth (R) - transition metal (T) compounds RT{sub 2} show HIA for R = Y, Ce, Pr, Nd, Sm, Gd, Tb, Dy, Ho and Er. Aoki et al. postulated that new amorphizing compounds can be expected at high hydrogen pressures. In this work, the structural changes of SmFe{sub 3} (PuNi{sub 3}-type structure) during heating in high hydrogen pressures are reported.
International Nuclear Information System (INIS)
Inoue, A.; Masumoto, T.
1984-01-01
The effect of cold rolling on the superconducting properties was examined for amorphous Nb 50 Zr 35 Si 15 and Nb 70 Zr 15 Si 15 superconductors. Cold rolling to 10 to 20% reduction in thickness results in a rise of superconducting transition temperature (Tsub(c)) and a decrease in transition width (ΔTsub(c)), upper critical field gradient near Tsub(c) [dHsub(c2)/dT)sub(Tsub(c)], critical current density [Jsub(c)(H)] and normal electrical resistivity (rhosub(n)). Changes of about 7% for Tsub(c), 33% for ΔTsub(c), 12% for -(dHsub(c2)/dT)sub(Tsub(c) and 70% for Jsub(c)(H) are found. The rise of Tsub(c) upon cold rolling was considered to originate from the increase in the electron-phonon coupling constant (lambda) due to an increase in the electronic density of states at the Fermi level [N(Esub(f))] and a decrease in the phonon frequency (ω), while the decreases in ΔTsub(c), Jsub(c)(H) and rhosub(n) were attributed to the decrease in fluxoid pinning force due to an increase in homogeneity in the amorphous structure. From the results described above, the following two conclusions were derived: (a) cold rolling causes changes in electronic and phonon-states in the quenched amorphous phase, and (b) deformation upon cold rolling occurs not only in the coarse deformation bands observable by optical microscopy, but also on a much finer scale comparable to the coherence length (approx. = 7.7 nm). (author)
DEFF Research Database (Denmark)
Molin, S.; Sabato, A. G.; Javed, H.
2018-01-01
of a mixed (Cu,Mn,Co)3O4 spinel. By the incorporation of Cu, the density of the coatings improved. Scanning and transmission electron microscopy observations, supplemented with energy dispersive spectroscopy, confirmed dissolution of Cu in the spinel phase. For the un-doped Mn1.5Co1.5O4 both the tetragonal...... and cubic phases are detected at room temperature by X-ray diffractometry, whereas the addition of Cu seems to stabilize the cubic phase. Initial (∼1000 h) high temperature corrosion evaluation at 800 °C in air showed promising properties of the mixed spinel coating....
Phase Transitions in Mechanically Milled Mn-Al-C Permanent Magnets
Directory of Open Access Journals (Sweden)
Michael J. Lucis
2014-04-01
Full Text Available Mn-Al powders were prepared by rapid solidification followed by high-energy mechanical milling. The rapid solidification resulted in single-phase ε. The milling was performed in both the ε phase and the τ phase, with the τ-phase formation accomplished through a heat treatment at 500 °C for 10 min. For the ε-milled samples, the conversion of the ε to the τ phase was accomplished after milling via the same heat treatment. Mechanical milling induced a significant increase in coercivity in both cases, reaching 4.5 kOe and 4.1 kOe, respectively, followed by a decrease upon further milling. The increase in coercivity was the result of grain refinement induced by the high-energy mechanical milling. Additionally, in both cases a loss in magnetization was observed. Milling in the ε phase showed a smaller decrease in the magnetization due to a higher content of the τ phase. The loss in magnetization was attributed to a stress-induced transition to the equilibrium phases, as no site disorder or oxidation was observed. Surfactant-assisted milling in oleic acid also improved coercivity, but in this case values reached >4 kOe and remained stable at least through 32 h of milling.
The SafeBoosC Phase II Randomised Clinical Trial
DEFF Research Database (Denmark)
Pellicer, Adelina; Greisen, Gorm; Benders, Manon
2013-01-01
Near-infrared spectroscopy-derived regional tissue oxygen saturation of haemoglobin (rStO2) reflects venous oxygen saturation. If cerebral metabolism is stable, rStO2 can be used as an estimate of cerebral oxygen delivery. The SafeBoosC phase II randomised clinical trial hypothesises that the bur...
1.5 °C carbon budget dependent on carbon cycle uncertainty and future non-CO2 forcing.
Mengis, Nadine; Partanen, Antti-Ilari; Jalbert, Jonathan; Matthews, H Damon
2018-04-11
Estimates of the 1.5 °C carbon budget vary widely among recent studies, emphasizing the need to better understand and quantify key sources of uncertainty. Here we quantify the impact of carbon cycle uncertainty and non-CO 2 forcing on the 1.5 °C carbon budget in the context of a prescribed 1.5 °C temperature stabilization scenario. We use Bayes theorem to weight members of a perturbed parameter ensemble with varying land and ocean carbon uptake, to derive an estimate for the fossil fuel (FF) carbon budget of 469 PgC since 1850, with a 95% likelihood range of (411,528) PgC. CO 2 emissions from land-use change (LUC) add about 230 PgC. Our best estimate of the total (FF + LUC) carbon budget for 1.5 °C is therefore 699 PgC, which corresponds to about 11 years of current emissions. Non-CO 2 greenhouse gas and aerosol emissions represent equivalent cumulative CO 2 emissions of about 510 PgC and -180 PgC for 1.5 °C, respectively. The increased LUC, high non-CO 2 emissions and decreased aerosols in our scenario, cause the long-term FF carbon budget to decrease following temperature stabilization. In this scenario, negative emissions would be required to compensate not only for the increasing non-CO 2 climate forcing, but also for the declining natural carbon sinks.
17 CFR 240.15c2-7 - Identification of quotations.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Identification of quotations... quotations. (a) It shall constitute an attempt to induce the purchase or sale of a security by making a “fictitious quotation” within the meaning of section 15(c)(2) of the Act, for any broker or dealer to furnish...
Sumitomo's R and D activities for advanced USC boilers
Energy Technology Data Exchange (ETDEWEB)
Ogawa, Hidenori [Sumitomo Metal Industries, Ltd., London (United Kingdom); Okada, Hirokazu; Hirata, Hiroyuki; Semba, Hiroyuki; Igarashi, Masaaki [Sumitomo Metal Industries, Ltd., Hyogo (Japan). Corporate R and D Labs.; Matsuo, Hiroshi [Sumitomo Metal Industries, Ltd., Hyogo (Japan). Steel Tube Work
2011-07-01
Advanced Ni-base super alloys are strongly required for the advanced ultra-super critical (A-USC) power plants operated at steam temperatures above 700 C. The developed Ni base alloy HR6W with 23Cr-45Ni-7W, which is strengthened by Fe2W-type Laves phase and M23C6, is one of the candidate materials for thick wall pipe application. The stability of long-term creep strength and superior creep rupture ductility have been proved by creep rupture tests. A newly developed Ni-base alloy HR35 with 30r-50Ni-W alloy has been also proposed for thick wall piping application. (orig.)
Magnetic exitations in the itinerant ferromagnet UFe2
DEFF Research Database (Denmark)
Paolasini, L.; Lander, G.H.; Shapiro, S.M.
1996-01-01
UFe2 (Laves phase, fee crystal structure) is a ferromagnet with T-C=165 K, Previous neutron elastic measurements have established that the Fe moment is 0.6 mu(B) and that the moment on the U atom is almost zero because of the cancellation of the spin and orbital moments, which are both about 0.23...... electrons. We find also that D is strongly temperature dependent, presumably due to two-magnon interactions. Thus, this effect, together with the low moment on the Fe atoms, results in the comparatively low, as compared to the RFe(2) compounds, T-C of 165 K in UFe2....
International Nuclear Information System (INIS)
Tumba, Kaniki; Letcher, Trevor M.; Naidoo, Paramespri; Ramjugernath, Deresh
2013-01-01
Highlights: • Activity coefficients at infinite dilution measured in the ionic liquid [3C 6 C 14 P][BTI]. • 22 solutes investigated at T = (313.15, 333.15, 353.15, 373.15) K using glc. • Selectivities and capacities for selected separations compared to other IL’s and solvents. -- Abstract: Activity coefficients at infinite dilution for organic solutes, which include n-alkanes, alk-1-enes, alk-1-ynes, cycloalkanes, alkylbenzenes, alcohols and ketones, in the ionic liquid trihexyltetradecylphosphonium bis (trifluoromethylsulfonyl) imide were measured by gas–liquid chromatography using the latter as the stationary phase. This ionic liquid had previously been studied and reported in literature; however due to significant discrepancies in the reported infinite activity coefficient values, there was justification for further study and reporting. The temperature range investigated in this study is significantly wider and at higher temperatures than presented previously in the literature. From the experimental infinite dilution activity coefficient data at the four different temperatures T = (313.15, 333.15, 353.15 and 373.15) K, partial molar excess enthalpies at infinite dilution were calculated. Values of the selectivity for hexane/benzene and methanol/benzene separations were determined from experimental values of the activity coefficients at infinite dilution and these results were compared to literature values for other ionic liquids, as well as for industrial solvents. The capacities were also determined as it gives an indication of the solvent extraction behavior of the ionic liquid
DEFF Research Database (Denmark)
Rasmussen, Jim; Kusliene, Gedrime; Jacobsen, Ole Stig
2013-01-01
that 15N also had a heterogeneous distribution (up to two orders of magnitude). Conclusion Bicarbonate can efficiently be used to introduce 14C or 13C into plant via the leaf-labeling method. Both 14C and 15N showed heterogeneous distribution in the plant, although the distribution of 15N was more even......Aims: Application of carbon (C) and nitrogen (N) isotopes is an essential tool to study C and N flows in plant-soil-microorganisms systems. When targeting single plants in a community the tracers need to be added via e.g., leaf-labeling or stem-feeding approaches. In this study we: (i) investigated...... if bicarbonate can be used to introduce 14C (or 13C) into white clover and ryegrass, and (ii) compared the patterns of 14C and 15N allocation in white clover and ryegrass to evaluate the homogeneity of tracer distribution after two alternative labeling approaches. Methods Perennial ryegrass and white clover were...
Design of three-phased SPWM based on AT89C52
Wu, Xiaorui
2018-05-01
According to the AT89C52 and the area equivalent principle, a three phase SPWM algorithm based on the 8 bit single chip is obtained. Through computer programming, three-phase SPWM wave generated by a single chip microcomputer is applied to the circuit of the static reactive power generator. The result shows that this method is feasible and can reduce the cost of SVG.
Energy Technology Data Exchange (ETDEWEB)
Moler, E.J.; Kellar, S.A.; Huff, W.R.A. [Lawrence Berkeley National Lab., CA (United States)] [and others
1997-04-01
The authors report a study of the spatial structure of ({radical}3 x {radical}3)R30{degrees} (low coverage) and (1.5 x 1.5)R18{degrees} (intermediate coverage) CO adsorbed on Cu(111), using the Angle-Resolved Photoemission Extended Fine Structure (ARPEFS) technique at beamline 9.3.2 at the Advanced Light Source. The CO molecule adsorbs on an atop site for both adsorption phases. Full multiple-scattering spherical-wave (MSSW) calculations were used to extract the C-Cu. bond length and the first Cu-Cu layer spacing for each adsorption phase. The authors find that the C-Cu bond length remains unchanged with increasing coverage, but the 1st Cu-Cu layer spacing contracts at the intermediate coverage. They calculate the bending mode force constant in the (1.5 x 1.5)R18{degrees} phase to be K{sub {delta}} = 2.2 (1) x 10{sup {minus}12} dyne-cm/rad from their experimentally determined bond lengths combined with previously published infra-red absorption frequencies.
DEFF Research Database (Denmark)
Thams, P; Capito, K; Hedeskov, C J
1990-01-01
and potentiated phase 1 of glucose-induced secretion. Furthermore, perifusion of islets in the presence of staurosporine (1 microM), an inhibitor of protein kinase C, potentiated phase 1 and inhibited phase 2 of glucose-induced secretion. In addition, down-regulation of protein kinase C potentiated phase 1...
Phased mission methodology. A state of the art report: Parts A, B and C
International Nuclear Information System (INIS)
Terpstra, K.; Van Driel, G.; Kafka, P.; Polke, H.
1986-01-01
A complex system has to perform a number of different tasks. Sometimes these tasks must be performed at the same time, but in a lot of cases the system has to perform its tasks subsequently. The execution of the different tasks is effected by parts of the system, so-called subsystems more or less dependent by means of processes and/or shared equipment. Examples of such complex systems can be found, for instance, in modern space travel, in nuclear power plants, in military weapon systems, etc. A phased mission is a task for a complex system to be performed in parts (subtasks), one part after the other. The present report covers the work carried out under the tripartite concert between the European Communities (CEC), the Gesellschaft fuer Reaktorsicherheit mbH (GRS) and the Netherlands Energy Research Foundation (ECN). The scope of the studies is to assess the practical usefulness of phased mission analyses. The present volume consists of three parts: Part A: Phased mission analysis. A review of mathematical modelling and of a number of existing computer programs; Part B: Example for the application of phased mission methods in reliability and risk studies; and, Part C: Calculation results for a phased mission - Part C1 - Phased mission calculation for a reference heat removal system - Part C2 - Application of phased mission methods in reliability and risk studies
International Nuclear Information System (INIS)
Shiro, Yoshitsugu; Iizuka, Tetsutaro; Makino, Ryu; Ishimura, Yuzuru; Morishima, Isao
1989-01-01
The cyanide (C 15 N - ) complex of Pseudomonas putida cytochrome P-450 (P-450 cam ) exhibited well-resolved and hyperfine-shifted 15 N NMR resonances arising from the iron-bound C 15 N - at 423 and 500 ppm in the absence and presence of the substrate, d-camphor, respectively. The values were smaller than those for cyanide complexes of myoglobin and hemoglobin (∼ 1000 ppm) but fell into the same range as those for the cyanide complexes of peroxidases (∼ 500 ppm). The 15 N shift values of P-450 cam were not incompatible with the existence of anionic ligand, such as cysteinyl thiolate anion, at the fifth coordination site of heme iron. The difference in the 15 N chemical shift values between camphor-free and bound enzymes was inferred by the increase in the steric constraint to the Fe-C-N bond upon substrate binding
MAX Phase Modified SiC Composites for Ceramic-Metal Hybrid Cladding Tubes
International Nuclear Information System (INIS)
Jung, Yang-Il; Kim, Sun-Han; Park, Dong-Jun; Park, Jeong-Hwan; Park, Jeong-Yong; Kim, Hyun-Gil; Koo, Yang-Hyun
2015-01-01
A metal-ceramic hybrid cladding consists of an inner zirconium tube, and an outer SiC fiber-matrix SiC ceramic composite with surface coating as shown in Fig. 1 (left-hand side). The inner zirconium allows the matrix to remain fully sealed even if the ceramic matrix cracks through. The outer SiC composite can increase the safety margin by taking the merits of the SiC itself. In addition, the outermost layer prevents the dissolution of SiC during normal operation. On the other hand, a ceramic-metal hybrid cladding consists of an outer zirconium tube, and an inner SiC ceramic composite as shown in Fig. 1 (right-hand side). The outer zirconium protects the fuel rod from a corrosion during reactor operation, as in the present fuel claddings. The inner SiC composite, additionally, is designed to resist the severe oxidation under a postulated accident condition of a high-temperature steam environment. Reaction-bonded SiC was fabricated by modifying the matrix as the MAX phase. The formation of Ti 3 SiC 2 was investigated depending on the compositions of the preform and melt. In most cases, TiSi 2 was the preferential phase because of its lowest melting point in the Ti-Si-C system. The evidence of Ti 3 SiC 2 was the connection with the pressurizing
As-received microstructure of a SiC/Ti-15-3 composite
Lerch, Bradley A.; Hull, David R.; Leonhardt, Todd A.
1988-01-01
A silicon carbide fiber reinforced titanium (Ti-15V-3Cr-3Sn-3Al) composite is metallographically examined. Several methods for examining composite materials are investigated and documented. Polishing techniques for this material are described. An interference layering method is developed to reveal the structure of the fiber, the reaction zone, and various phases within the matrix. Microprobe and transmission electron microscope (TEM) analyses are performed on the fiber/matrix interface. A detailed description of the fiber distribution as well as the microstructure of the fiber and matrix are presented.
Directory of Open Access Journals (Sweden)
Čička R.
2012-01-01
Full Text Available The precipitation of secondary phases was investigated in the 0.17C-16Cr-11Mn-0.43N austenitic stainless steel during annealing at 800 and 850°C for times between 5 min and 100 h. Light microscopy, transmission electron microscopy, energy dispersive X-ray spectroscopy, scanning electron microscopy, and differential thermal analysis were used in experiments. Thermodynamic calculations were done by the ThermoCalc database software package. Cr2N and M23C6 were considered to be stable phases at the annealing temperatures. Cells consisting of alternating Cr2N and austenite lamellae were observed in the steel microstructure after sufficiently long annealing. The metastable chi phase was also found in all the annealed samples. After 100 h of annealing the equilibrium sigma started to precipitate. The thermodynamically predicted M6C was not confirmed experimentally in any of the annealed samples. DTA analysis showed the initial precipitation stage was followed by the phase dissolution. For the investigated steel the computational thermodynamics can be used only for qualitative interpretation of the experimental results as the measured endothermal peaks were found to be shifted of about 50 ÷ 70°C related to the computed results.
Synthesis of (+-)-(1,1'- sup 15 N sub 2 , 2'- sup 13 C)-trans-3'-methylnicotine
Energy Technology Data Exchange (ETDEWEB)
Sirimanne, S.R.; Maggio, V.L.; Patterson, D.G. Jr. (Department of Health and Human Services, Atlanta, GA (United States))
1992-03-01
The synthesis of ({+-})- (1,1'-{sup 15}N{sub 2}, 2'-{sup 13}C)-trans-3'-methylnicotine is reported. {sup 15}N-3-Bromopyridine obtained from bromination of pyridine was formylated with nBuLi/(carbonyl-{sup 13}C)-methyl formate. The resulting {sup 15}n-Pyridine-3-({sup 13}C-carbonyl)-carboxaldehyde was reacted with {sup 15}N-methylamine and then the resulting Schiff's base was condensed with succinic anhydride to give ({+-})- (1,1'-{sup 15}N{sub 2}, 5'-{sup 13}C)-trans-4'-carboxycotinine. Reduction with lithium aluminum hydride and mesylation followed by reduction with Zn/NaI gave ({+-})-(1,1'-{sup 15}N{sub 2}, 2'-{sup 13}C)-trans-3'-methylnicotine. (Author).
Phase diagram of Ti-B-C system in the temperature range of 300-3500 K
International Nuclear Information System (INIS)
Gusev, A.I.
1996-01-01
Calculation of phase equilibrium in the ternary system Ti-B-C in the areas of the TiC y -TiB 2 and B 4 C y -TiB 2 cross sections as well as partial construction of three-dimensional (spatial)diagram of the Ti-B-C system within the temperature range of 300-3500 K is carried out. The form of the isothermal cross section of the ternary system remains almost unchanged up to 1900 K. The most essential change is related to disordering of the low-temperature ordered phases Ti 2 C, Ti 3 C and Ti 6 C 5 of the titanium carbide at T > 950 K [ru
Liquid phase interaction in TiC0,5N0,5-TiNi-Mo and TiC0,5N0,5-TiNi-Ti-Mo
International Nuclear Information System (INIS)
Askarova, L.Kh; Grigorov, I.G.; Zajnulin, Yu.G.
1998-01-01
Using the methods of X ray diffraction analysis, electron microscopy and X ray spectrum microanalysis a study was made into specific features of phase and structure formation in alloys TiC 0,5 N 0,5 -TiNi-Mo and TiC 0,5 N 0,5 -TiNi-Mo in the presence of a liquid phase at temperatures of 1380-1600 deg C. It is revealed that the physical and chemical processes taking place during the liquid-phase sintering result in the formation of a three-phase alloy consisting of nonstoichiometric titanium carbonitride TiC 0.5-x N 0.5-x , a molybdenum base solid solution of titanium, nickel and carbon Mo(Ti, Ni, C) and one of two intermetallic compounds, either TiNi or Ni 3 Ti. Metallic element concentration in individual phase constituents of the alloy is determined by means of X ray spectrum microanalysis
The Effect of SiC Polytypes on the Heat Distribution Efficiency of a Phase Change Memory.
Aziz, M. S.; Mohammed, Z.; Alip, R. I.
2018-03-01
The amorphous to crystalline transition of germanium-antimony-tellurium (GST) using three types of silicon carbide’s structure as a heating element was investigated. Simulation was done using COMSOL Multiphysic 5.0 software with separate heater structure. Silicon carbide (SiC) has three types of structure; 3C-SiC, 4H-SiC and 6H-SiC. These structures have a different thermal conductivity. The temperature of GST and phase transition of GST can be obtained from the simulation. The temperature of GST when using 3C-SiC, 4H-SiC and 6H-SiC are 467K, 466K and 460K, respectively. The phase transition of GST from amorphous to crystalline state for three type of SiC’s structure can be determined in this simulation. Based on the result, the thermal conductivity of SiC can affecting the temperature of GST and changed of phase change memory (PCM).
Reaction π-p→ωn in the (15/40) GeV/c momentum range
International Nuclear Information System (INIS)
Apel, W.D.; Augenstein, K.H.; Krueger, M.; Mueller, H.; Schneider, H.; Sigurdsson, G.; Donskov, S.V.; Inyakin, A.V.; Kachanov, V.A.; Krasnokutsky, R.N.; Lednev, A.A.; Mikhailov, Yu.V.; Prokoshkin, Yu.D.; Shuvalov, R.S.; Leder, G.
1979-01-01
A high statistics measurement of the reaction π - p→ωn with ω→π 0 γ has been performed at the 70 GeV Serpukhov accelerator for 15, 20.2, 25, 30 and 40 GeV/c incident pion momentum, using the NICE set-up with its associated 648-channel γ-ray spectrometer. Values of the density matrix elements, differential and integral cross sections are reported. Already at 15 GeV/c, the unnatural parity exchange contribution to ω production in helicity 1 state is negligible. After a maximum around /t/ approximately equal to 0.12 (GeV/c) 2 , the differential cross section decreases exponentially up to /t/ approximately equal to 0.7 (GeV/c) 2 , where a break is seen in its slope. (author)
International Nuclear Information System (INIS)
Huang Huan; Zhang Lei; Wang Yang; Han Xiaodong; Wu Yiqun; Zhang Ze; Gan Fuxi
2011-01-01
Research highlights: → We study the optical, dielectric, and structural characteristics of Si 15 Sb 85 phase change memory thin films under a moving continuous-wave laser initialization. → The optical and dielectric constants, absorption coefficient of Si 15 Sb 85 change regularly with the increasing laser power. → The optical band gaps of Si 15 Sb 85 irradiated upon different power lasers were calculated. → HRTEM images of the samples were observed and the changes of optical and dielectric constants are determined by crystalline structures changes of the films. - Abstract: The optical, dielectric, and structural characteristics of Si 15 Sb 85 phase change memory thin films under a moving continuous-wave laser initialization are studied by using spectroscopic ellipsometry and high-resolution transmission electron microscopy. The dependence of complex refractive index, dielectric functions, absorption coefficient, and optical band gap of the films on its crystallization extents formed by the different initialization laser power are analyzed in detail. The structural change from as-deposited amorphous phase to distorted rhombohedra-Sb-like crystalline structure with the increase of initialization laser power is clearly observed with sub-nanometer resolution. The optical and dielectric constants, the relationship between them, and the local atomic arrangements of this new phase change material can help explain the phase change mechanism and design the practical phase change memory devices.
International Nuclear Information System (INIS)
Rana, J.; Robins, D.J.
1985-01-01
The labelling patterns in (+)-lupanine, (+)-13-hydroxylupanine, and (+)-angustifoline derived biosynthetically from [1-amino- 15 N,1- 13 C]-1,5-diaminopentane (cadaverine) have been established by 13 C n.m.r. spectroscopy. Three cadaverine units are incorporated to about the same extent into each of these three alkaloids. The presence of two doublets due to 13 C- 15 N coupling in the 13 C brace 1 H brace n.m.r. spectra associated with C-2 and C-15 of lupanine and 13-hydroxylupanine, and one 13 C- 15 N doublet at C-2 of angustifoline, indicate that two of the cadaverine units are converted into the outer rings of the tetracyclic quinolizidine alkaloids in a specific fashion. (author)
Alcohol consumption reduces HbA1c and glycated albumin concentrations but not 1,5-anhydroglucitol.
Inada, Shinya; Koga, Masafumi
2017-11-01
Background The effect of alcohol consumption on glycaemic control indicators is not well known. In this study, we studied the effect of alcohol consumption on the plasma glucose and glycaemic control indicators in non-diabetic men. Methods The study enrolled 300 non-diabetic men who received a complete medical checkup (age: 52.8 ± 6.5 years, body mass index: 24.4 ± 2.8 kg/m 2 ). The subjects were divided into four groups by the amount of alcohol consumed, and the plasma glucose, HbA1c, glycated albumin (GA) and 1,5-anhydroglucitol (1,5-AG) concentrations of the groups were compared. Results As the level of alcohol consumption increased, significantly high concentrations of fasting plasma glucose (FPG) were observed, and the oral glucose tolerance test 2-h plasma glucose concentrations tended to rise. While no significant effect of alcohol consumption on HbA1c, 1,5-AG, and the 1,5-AG/FPG ratio was observed, the HbA1c/FPG ratio, GA and the GA/FPG ratio exhibited significantly low values as the level of alcohol consumption increased. In stepwise multivariate regression analysis, alcohol consumption was a significant negative independent variable for HbA1c and GA, but not for 1,5-AG. Conclusions As the level of alcohol consumption increased, the plasma glucose concentrations rose, but the HbA1c and GA concentrations were lower compared with the plasma glucose concentrations. These findings suggest that alcohol consumption may reduce HbA1c and GA concentrations, but not 1,5-AG.
Large old trees influence patterns of delta13C and delta15N in forests.
Weber, Pascale; Bol, Roland; Dixon, Liz; Bardgett, Richard D
2008-06-01
Large old trees are the dominant primary producers of native pine forest, but their influence on spatial patterns of soil properties and potential feedback to tree regeneration in their neighbourhood is poorly understood. We measured stable isotopes of carbon (delta(13)C) and nitrogen (delta(15)N) in soil and litter taken from three zones of influence (inner, middle and outer zone) around the trunk of freestanding old Scots pine (Pinus sylvestris L.) trees, to determine the trees' influence on below-ground properties. We also measured delta(15)N and delta(13)C in wood cores extracted from the old trees and from regenerating trees growing within their three zones of influence. We found a significant and positive gradient in soil delta(15)N from the inner zone, nearest to the tree centre, to the outer zone beyond the tree crown. This was probably caused by the higher input of (15)N-depleted litter below the tree crown. In contrast, the soil delta(13)C did not change along the gradient of tree influence. Distance-related trends, although weak, were visible in the wood delta(15)N and delta(13)C of regenerating trees. Moreover, the wood delta(15)N of small trees showed a weak negative relationship with soil N content in the relevant zone of influence. Our results indicate that large old trees control below-ground conditions in their immediate surroundings, and that stable isotopes might act as markers for the spatial and temporal extent of these below-ground effects. John Wiley & Sons, Ltd
High-pressure phase relations and thermodynamic properties of CaAl 4Si 2O 11 CAS phase
Akaogi, M.; Haraguchi, M.; Yaguchi, M.; Kojitani, H.
2009-03-01
Phase relations in CaAl4Si2O11 were examined at 12-23 GPa and 1000-1800 °C by multianvil experiments. A three-phase mixture of grossular, kyanite and corundum is stable below about 13 GPa at 1000-1800 °C. At higher pressure and at temperature below about 1200 °C, a mixture of grossular, stishovite and corundum is stable, indicating the decomposition of kyanite. Above about 1200 °C, CaAl4Si2O11 CAS phase is stable at pressure higher than about 13 GPa. The triple point is placed at 14.7 GPa and 1280 °C. The equilibrium boundary of formation of CAS phase from the mixture of grossular, kyanite and corundum has a small negative slope, and that from the mixture of grossular, stishovite and corundum has a strongly negative slope, while the decomposition boundary of kyanite has a small positive slope. Enthalpies of the transitions were measured by high-temperature drop-solution calorimetry. The enthalpy of formation of CaAl4Si2O11 CAS phase from the mixture of grossular, kyanite and corundum was 139.5 ± 15.6 kJ/mol, and that from the mixture of grossular, stishovite and corundum was 94.2 ± 15.4 kJ/mol. The transition boundaries calculated using the measured enthalpy data were consistent with those determined by the high-pressure experiments. The boundaries in this study are placed about 3 GPa higher in pressure and about 200 °C lower in temperature than those by Zhai and Ito [Zhai, S., Ito, E., 2008. Phase relations of CaAl4Si2O11 at high-pressure and high-temperature with implications for subducted continental crust into the deep mantle. Phys. Earth Planet. Inter. 167, 161-167]. Combining the thermodynamic data measured in this study with those in the literature, dissociation boundary of CAS phase into a mixture of Ca-perovskite, corundum and stishovite and that of grossular into Ca-perovskite plus corundum were calculated to further constrain the stability field of CAS phase. The result suggests that the stability of CAS phase would be limited at the bottom of
Phase Behavior of Binary Blends of AB+AC Block Copolymers with compatible B and C blocks
Pryamitsyn, Victor; Ganesan, Venkat
2012-02-01
Recently the experimental studies of phase behavior of binary blends of PS-b-P2VP and PS-b-PHS demonstrated an interesting effect: blends of symmetric PS-b-P2VP and shorter symmetric (PS-b-PHS) formed cylindrical HEX and spherical BCC phases, while each pure component formed lamellas. The miscibility of P2VP and PHS is caused by the hydrogen bonding between P2VP and PHS,which can be described as a negative Flory ?-parameter between P2VP and PHS. We developed a theory of the microphase segregation of AB+AC blends of diblock copolymers based on strong stretching theory. The main result of our theory is that in the copolymer brush-like layer formed by longer B chain and shorter C chains, the attraction between B and shorter C chains causes relative stretching of short C chains and compression of longer B chains. The latter manifests in an excessive bending force towards the grafting surface (BC|AA interface). Such bending force causes a transition from a symmetric lamella phase to a HEX cylinder or BCC spherical phases with the BC phase being a ``matrix'' component. In a blend of asymmetric BCC sphere forming copolymers (where B and C segments are the minor components), such bending force may unfold BCC spherical phase to a HEX cylinder phase, or even highly uneven lamella phases.
International Nuclear Information System (INIS)
Phan, Anh Thu; Paek, Min-Kyu; Kang, Youn-Bae
2014-01-01
In order to provide an efficient tool to design alloy chemistry and processing conditions for high-strength, lightweight steel, an investigation of the Fe–Al–C ternary system was carried out by experimental phase diagram measurement and a CALPHAD thermodynamic analysis. Discrepancies between previously available experimental results and thermodynamic calculations were identified. The Fe–Al sub-binary system was re-optimized in order to obtain an accurate description of the liquid phase, while Gibbs energies of solid phases were mainly taken from a previous thermodynamic modeling. Phase equilibria among face-centered cubic (fcc)/body-centered cubic (bcc)/graphite/κ-carbide/liquid phases in the Fe–Al–C system in the temperature range from 1000 to 1400 °C were obtained by chemical equilibration followed by quenching, and subsequent composition analysis using electron probe microanalysis/inductively coupled plasma spectroscopy. By merging the revised Fe–Al binary description with existing Fe–C and Al–C binary descriptions, a complete thermodynamic description of the Fe–Al–C system was obtained in the present study. The modified quasi-chemical model in the pair approximation was used to model the liquid phase, while solid solutions were modeled using compound energy formalism. A2/B2 order/disorder transition in the bcc phase was taken into account. Compared with previously known experiments/thermodynamic modeling, a better agreement was obtained in the present study, regarding the stable region of fcc and the solidification thermal peak of a ternary alloy near the liquidus temperature. The obtained thermodynamic description also reproduced various types of experimental data in the Fe–Al–C system such as isothermal sections, vertical sections, liquidus projection, etc. The solidification of various steel grades was predicted and discussed
Sigma phase transformation in super duplex steel in the range of 900-1050 oC
International Nuclear Information System (INIS)
Garin, J.L; Manheim, R.L; Rios, D
2012-01-01
The embrittlement phenomenon observed in duplex stainless steels obeys to the presence of intermediate phases in the microstructure, principally the so-called sigma-phase, which preferently arises by heating over the range of 540 to 850 o C. The present article describes the dissolution of sigma-phase in welded joints of cast super duplex stainless steels (ASTM A890), at temperatures from 900 to 1050 o C. The experimental procedure utilized usual techniques of quantitative metallography and X-ray diffraction. Annealing of the samples at 850 o C yielded starting contents of sigma of 40,4 % (vol) in the fusion zone and 45,4 % (vol) in the heat-affected zone. The dissolution of the compound was observed after annealing of the specimens at 900, 950, 1.000 and 1.050 o C, with a moderate kinetics at lesser temperatures, while the transformation became fully achieved at 1.050 o C
International Nuclear Information System (INIS)
Kobayashi, Satoru; Schneider, Andre; Zaefferer, Stefan; Frommeyer, Georg; Raabe, Dierk
2005-01-01
In the context of the development of high-strength Fe 3 Al-based alloys, phase equilibria among α-Fe(Al, Cr, Ti), liquid and TiC phases in the Fe-Al-Cr-Ti-C quinary system and the formation of TiC were determined. A pseudo-eutectic trough (L α + L + TiC) exists at 1470 deg C at around Fe-26Al-5Cr-2Ti-1.7C on the vertical section between Fe-26Al-5Cr (α) and Ti-46C (TiC) in at.%. Large faceted TiC precipitates form from the melt after the formation of primary α phase even in hypoeutectic alloys. The TiC formation is thought to be due to the composition change of the liquid towards the hypereutectic compositions by solidification of the primary α. In order to remove the faceted TiC, which are unfavourable for strengthening the material, two different processing routes have been successfully tested: (i) solidification with an increased rate to reduce the composition variation of the liquid during solidification, and (ii) unidirectional solidification to separate the light TiC precipitates from the melt
Acree, William; Chickos, James S.
2017-03-01
The second part of this compendium concludes with a collection of phase change enthalpies of organic molecules inclusive of C11-C192 reported over the period 1880-2015. Also included are phase change enthalpies including fusion, vaporization, and sublimation enthalpies for organometallic, ionic liquids, and a few inorganic compounds. Paper I of this compendium, published separately, includes organic compounds from C1 to C10 and describes a group additivity method for evaluating solid, liquid, and gas phase heat capacities as well as temperature adjustments of phase changes. Paper II of this compendium also includes an updated version of a group additivity method for evaluating total phase change entropies which together with the fusion temperature can be useful in estimating total phase change enthalpies. Other uses include application in identifying potential substances that either form liquid or plastic crystals or exhibit additional phase changes such as undetected solid-solid transitions or behave anisotropically in the liquid state.
Liu, Nan; Nittler, Larry R.; Pignatari, Marco; O'D. Alexander, Conel M.; Wang, Jianhua
2017-06-01
We report C, N, and Si isotopic data for 59 highly 13C-enriched presolar submicron- to micron-sized SiC grains from the Murchison meteorite, including eight putative nova grains (PNGs) and 29 15N-rich (14N/15N ≤ solar) AB grains, and their Mg-Al, S, and Ca-Ti isotope data when available. These 37 grains are enriched in 13C, 15N, and 26Al with the PNGs showing more extreme enhancements. The 15N-rich AB grains show systematically higher 26Al and 30Si excesses than the 14N-rich AB grains. Thus, we propose to divide the AB grains into groups 1 (14N/15N PNG and found 32S and/or 50Ti enhancements. Interestingly, one AB1 grain had the largest 32S and 50Ti excesses, strongly suggesting a neutron-capture nucleosynthetic origin of the 32S excess and thus the initial presence of radiogenic 32Si (t 1/2 = 153 years). More importantly, we found that the 15N and 26Al excesses of AB1 grains form a trend that extends to the region in the N-Al isotope plot occupied by C2 grains, strongly indicating a common stellar origin for both AB1 and C2 grains. Comparison of supernova models with the AB1 and C2 grain data indicates that these grains came from supernovae that experienced H ingestion into the He/C zones of their progenitors.
International Nuclear Information System (INIS)
Hawke, D.J.; Clark, J.M.
2010-01-01
Seabird burrows provide a soil environment for processing discards such as feathers and guano, hence constituting a primary interface between the sea and the land. This study involved collection and culturing of soil invertebrates from three blue penguin (Eudyptula minor) burrows, and examined their 13 C/ 12 C and 15 N/ 14 N isotopic composition in relation to potential burrow resources (terrestrial plant litter, burrow soil, guano, blue penguin feathers). Two taxa (cerylonid beetles and small tineid moth larvae) had a depleted 13 C/ 12 C indicative of a level of dependence on C from terrestrial soil. Tineid moth larvae (Monopis crocicapitella and (or) M. ethelella) substantially increased their 13 C/ 12 C enrichment during development, implying increasing dependence on marine C. Remaining taxa, both decomposers and predators, had 13 C/ 12 C intermediate between guano and feathers. Larval and emergent fleas had the most enriched 13 C/ 12 C , indicative of a greater dependence on feather C and the likelihood of co-processing with guano. Pseudoscorpions and histerid beetles had overlapping isotopic enrichments implying competition for prey, but were spatially separated in burrow soil. With their highly enriched 15 N/ 14 N and marine 13 C/ 12 C, larvae and protonymphs of the histiostomatid mite Myianoetus antipodus stood alone. Blue penguin burrows therefore support a diverse invertebrate fauna that incorporates terrestrial soil as well as varying proportions of the various blue penguin discards. (author). 45 refs., 1 fig., 1 tab.
Halogenated Terpenes and a C15-Acetogenin from the Marine Red Alga Laurencia saitoi
Directory of Open Access Journals (Sweden)
Xiao-Ming Li
2008-11-01
Full Text Available Seven parguerane diterpenes: 15-bromo-2,7,19-triacetoxyparguer-9(11-en-16-ol (1, 15-bromo-2,7,16,19-tetraacetoxyparguer-9(11-ene (2, 15-bromo-2,19-diacetoxyparguer-9(11-en-7,16-diol (3, 15-bromo-2,16,19-triacetoxyparguer-9(11-en-7-ol (4, 15-bromo-2,16-diacetoxyparguer-9(11-en-7-ol (5, 15-bromoparguer-9(11-en-16-ol (6, 15-bromoparguer-7-en-16-ol (7, two polyether triterpenes: thyrsiferol (8 and thyrsiferyl 23-acetate (9, and one C15-acetogenin, neolaurallene (10, were isolated from a sample of marine red alga Laurencia saitoi collected off the coast of Yantai. Their structures were established by detailed NMR spectroscopic analysis and comparison with literature data.