Is plant mitochondrial RNA editing a source of phylogenetic incongruence? An answer from in silico and in vivo data sets

Directory of Open Access Journals (Sweden)

Quagliariello Carla

2008-03-01

Full Text Available Abstract Background In plant mitochondria, the post-transcriptional RNA editing process converts C to U at a number of specific sites of the mRNA sequence and usually restores phylogenetically conserved codons and the encoded amino acid residues. Sites undergoing RNA editing evolve at a higher rate than sites not modified by the process. As a result, editing sites strongly affect the evolution of plant mitochondrial genomes, representing an important source of sequence variability and potentially informative characters. To date no clear and convincing evidence has established whether or not editing sites really affect the topology of reconstructed phylogenetic trees. For this reason, we investigated here the effect of RNA editing on the tree building process of twenty different plant mitochondrial gene sequences and by means of computer simulations. Results Based on our simulation study we suggest that the editing ‘noise’ in tree topology inference is mainly manifested at the cDNA level. In particular, editing sites tend to confuse tree topologies when artificial genomic and cDNA sequences are generated shorter than 500 bp and with an editing percentage higher than 5.0%. Similar results have been also obtained with genuine plant mitochondrial genes. In this latter instance, indeed, the topology incongruence increases when the editing percentage goes up from about 3.0 to 14.0%. However, when the average gene length is higher than 1,000 bp (rps3, matR and atp1 no differences in the comparison between inferred genomic and cDNA topologies could be detected. Conclusions Our findings by the here reported in silico and in vivo computer simulation system seem to strongly suggest that editing sites contribute in the generation of misleading phylogenetic trees if the analyzed mitochondrial gene sequence is highly edited (higher than 3.0% and reduced in length (shorter than 500 bp. In the current lack of direct experimental evidence the results

Site-specific genome editing for correction of induced pluripotent stem cells derived from dominant dystrophic epidermolysis bullosa.

Science.gov (United States)

Shinkuma, Satoru; Guo, Zongyou; Christiano, Angela M

2016-05-17

Genome editing with engineered site-specific endonucleases involves nonhomologous end-joining, leading to reading frame disruption. The approach is applicable to dominant negative disorders, which can be treated simply by knocking out the mutant allele, while leaving the normal allele intact. We applied this strategy to dominant dystrophic epidermolysis bullosa (DDEB), which is caused by a dominant negative mutation in the COL7A1 gene encoding type VII collagen (COL7). We performed genome editing with TALENs and CRISPR/Cas9 targeting the mutation, c.8068_8084delinsGA. We then cotransfected Cas9 and guide RNA expression vectors expressed with GFP and DsRed, respectively, into induced pluripotent stem cells (iPSCs) generated from DDEB fibroblasts. After sorting, 90% of the iPSCs were edited, and we selected four gene-edited iPSC lines for further study. These iPSCs were differentiated into keratinocytes and fibroblasts secreting COL7. RT-PCR and Western blot analyses revealed gene-edited COL7 with frameshift mutations degraded at the protein level. In addition, we confirmed that the gene-edited truncated COL7 could neither associate with normal COL7 nor undergo triple helix formation. Our data establish the feasibility of mutation site-specific genome editing in dominant negative disorders.

GRI baseline projection of U.S. Energy supply and demand to 2010. 1991 edition

International Nuclear Information System (INIS)

Holtberg, P.D.; Woods, T.J.; Lihn, M.L.; McCabe, N.C.

1991-04-01

The report summarizes the 1991 Edition of the GRI Baseline Projection of U.S. Energy Supply and Demand and presents a series of summary tables, sectoral breakdowns of energy demand, and the natural gas supply and price trends. Appendixes include a discussion of the methodology and assumptions used to prepare the 1991 projection, a brief discussion of the potential for higher levels of gas demand, a description of industrial and commercial cogeneration, a description of the independent power producer (IPP) methodology and projection, a comparison of the 1991 edition with previous projections, and a discussion of additional data used in developing the projection

ExpEdit: a webserver to explore human RNA editing in RNA-Seq experiments.

Science.gov (United States)

Picardi, Ernesto; D'Antonio, Mattia; Carrabino, Danilo; Castrignanò, Tiziana; Pesole, Graziano

2011-05-01

ExpEdit is a web application for assessing RNA editing in human at known or user-specified sites supported by transcript data obtained by RNA-Seq experiments. Mapping data (in SAM/BAM format) or directly sequence reads [in FASTQ/short read archive (SRA) format] can be provided as input to carry out a comparative analysis against a large collection of known editing sites collected in DARNED database as well as other user-provided potentially edited positions. Results are shown as dynamic tables containing University of California, Santa Cruz (UCSC) links for a quick examination of the genomic context. ExpEdit is freely available on the web at http://www.caspur.it/ExpEdit/.

Small kernel 1 encodes a pentatricopeptide repeat protein required for mitochondrial nad7 transcript editing and seed development in maize (Zea mays) and rice (Oryza sativa).

Science.gov (United States)

Li, Xiao-Jie; Zhang, Ya-Feng; Hou, Mingming; Sun, Feng; Shen, Yun; Xiu, Zhi-Hui; Wang, Xiaomin; Chen, Zong-Liang; Sun, Samuel S M; Small, Ian; Tan, Bao-Cai

2014-09-01

RNA editing modifies cytidines (C) to uridines (U) at specific sites in the transcripts of mitochondria and plastids, altering the amino acid specified by the DNA sequence. Here we report the identification of a critical editing factor of mitochondrial nad7 transcript via molecular characterization of a small kernel 1 (smk1) mutant in Zea mays (maize). Mutations in Smk1 arrest both the embryo and endosperm development. Cloning of Smk1 indicates that it encodes an E-subclass pentatricopeptide repeat (PPR) protein that is targeted to mitochondria. Loss of SMK1 function abolishes the C → U editing at the nad7-836 site, leading to the retention of a proline codon that is edited to encode leucine in the wild type. The smk1 mutant showed dramatically reduced complex-I assembly and NADH dehydrogenase activity, and abnormal biogenesis of the mitochondria. Analysis of the ortholog in Oryza sativa (rice) reveals that rice SMK1 has a conserved function in C → U editing of the mitochondrial nad7-836 site. T-DNA knock-out mutants showed abnormal embryo and endosperm development, resulting in embryo or seedling lethality. The leucine at NAD7-279 is highly conserved from bacteria to flowering plants, and analysis of genome sequences from many plants revealed a molecular coevolution between the requirement for C → U editing at this site and the existence of an SMK1 homolog. These results demonstrate that Smk1 encodes a PPR-E protein that is required for nad7-836 editing, and this editing is critical to NAD7 function in complex-I assembly in mitochondria, and hence to embryo and endosperm development in maize and rice. © 2014 The Authors The Plant Journal © 2014 John Wiley & Sons Ltd.

U.S., Russia join efforts to clean up nuclear sites

International Nuclear Information System (INIS)

Richard Seltzer.

1993-01-01

U.S. and Russian scientists are stepping up their cooperative efforts to deal with a vexing and controversial problem in both nations--cleanup of radioactive wastes at former nuclear weapons production sites. Last month, a top-level delegation of Russian officials and scientists came to the U.S. for two weeks. They visited Washington, D.C., and the Department of Energy's (DOE) Hanford site in Washington State, studying U.S. cleanup activities and providing information on Russian problems and efforts. The visit was part of a program of exchanges in the areas of environmental restoration and waste management called for by a 1990 memorandum of cooperation between DOE and the Russian Ministry of Atomic Energy. The memo helps implement a U.S.-Russian collaborative agreement on peaceful uses of atomic energy. Currently, cooperation under the memo exists in four areas: vitrification, waste separation, contaminant transport modeling, and student-scientist exchanges. The paper summarizes the visit to the Hanford Reservation and describes the cleanup efforts there

Site status monitoring report for underground storage tanks 1219-U, 1222-U, 2082-U, and 2068-U at the Rust Garage Facility, Buildings 9720-15 and 9754-1, Oak Ridge Y-12 Plant, Oak Ridge, Tennessee, Facility ID No. 0-010117

International Nuclear Information System (INIS)

1994-10-01

The purpose of this document is to provide hydrogeologic, geochemical, and vapor monitoring data required for site status monitoring of underground storage tanks (UST) 1219-U, 1222-U, 2082-U, and 2068-U at the Rust Garage Facility. Comprehensive monitoring was conducted at the site in May 1994 as part of a Monitoring Only program approved by Tennessee Department of Environment and Conservation (TDEC) based on review and approval of Site Ranking. This document presents the results of the first semiannual site status monitoring, which was conducted in September 1994. Site status monitoring and preparation of this report have been conducted in accordance with the requirements of the TDEC Rule 1200-1-15, the TDEC UST Reference Handbook, Second Edition, and direction from TDEC. This document is organized into three sections. Section 1 presents introductory information relative to the site including regulatory initiative and a site description. Section 2 includes the results of sampling of monitoring wells GW-508, GW-631, GW-632, and GW-634. Section 3 presents data from vapor monitoring conducted in subsurface utilities present at the site

CRISPR-Cas9-Edited Site Sequencing (CRES-Seq): An Efficient and High-Throughput Method for the Selection of CRISPR-Cas9-Edited Clones.

Science.gov (United States)

Veeranagouda, Yaligara; Debono-Lagneaux, Delphine; Fournet, Hamida; Thill, Gilbert; Didier, Michel

2018-01-16

The emergence of clustered regularly interspaced short palindromic repeats-Cas9 (CRISPR-Cas9) gene editing systems has enabled the creation of specific mutants at low cost, in a short time and with high efficiency, in eukaryotic cells. Since a CRISPR-Cas9 system typically creates an array of mutations in targeted sites, a successful gene editing project requires careful selection of edited clones. This process can be very challenging, especially when working with multiallelic genes and/or polyploid cells (such as cancer and plants cells). Here we described a next-generation sequencing method called CRISPR-Cas9 Edited Site Sequencing (CRES-Seq) for the efficient and high-throughput screening of CRISPR-Cas9-edited clones. CRES-Seq facilitates the precise genotyping up to 96 CRISPR-Cas9-edited sites (CRES) in a single MiniSeq (Illumina) run with an approximate sequencing cost of $6/clone. CRES-Seq is particularly useful when multiple genes are simultaneously targeted by CRISPR-Cas9, and also for screening of clones generated from multiallelic genes/polyploid cells. © 2018 by John Wiley & Sons, Inc. Copyright © 2018 John Wiley & Sons, Inc.

Application for Permit to Operate a Class III Solid Waste Disposal Site at the Nevada Test Site - U10c Disposal Site

Energy Technology Data Exchange (ETDEWEB)

NSTec Environmental Programs

2010-08-05

The NTS is located approximately 105 km (65 mi) northwest of Las Vegas, Nevada. NNSA/NSO is the federal lands management authority for the NTS and NSTec is the Management & Operations contractor. Access on and off the NTS is tightly controlled, restricted, and guarded on a 24-hour basis. The NTS is posted with signs along its entire perimeter. NSTec is the operator of all solid waste disposal sites on the NTS. The U10C Disposal Site is located in the northwest corner of Area 9 at the NTS (Figure 1) and is located in a subsidence crater created by two underground nuclear events, one in October 1962 and another in April 1964. The disposal site opened in 1971 for the disposal of rubbish, refuse, pathological waste, asbestos-containing material, and industrial solid waste. A Notice of Intent form to operate the disposal site as a Class II site was submitted to the state of Nevada on January 26, 1994, and was acknowledged in a letter to the DOE on February 8, 1994. It operated as a state of Nevada Class II Solid Waste Disposal Site (SWDS) until it closed on October 5, 1995, for retrofit as a Class III SWDS. The retrofit consisted of the installation of a minimum four-foot compacted soil layer to segregate the different waste types and function as a liner to inhibit leachate and water flow into the lower waste zone. Five neutron monitoring tubes were installed in this layer to monitor possible leachate production and water activity. Upon acceptance of the installed barrier and approval of an Operating Plan by NDEP/BFF, the site reopened in January 1996 as a Class III SWDS for the disposal of industrial solid waste and other inert waste.

Molecular evolution of pentatricopeptide repeat genes reveals truncation in species lacking an editing target and structural domains under distinct selective pressures

Directory of Open Access Journals (Sweden)

Hayes Michael L

2012-05-01

Full Text Available Abstract Background Pentatricopeptide repeat (PPR proteins are required for numerous RNA processing events in plant organelles including C-to-U editing, splicing, stabilization, and cleavage. Fifteen PPR proteins are known to be required for RNA editing at 21 sites in Arabidopsis chloroplasts, and belong to the PLS class of PPR proteins. In this study, we investigate the co-evolution of four PPR genes (CRR4, CRR21, CLB19, and OTP82 and their six editing targets in Brassicaceae species. PPR genes are composed of approximately 10 to 20 tandem repeats and each repeat has two α-helical regions, helix A and helix B, that are separated by short coil regions. Each repeat and structural feature was examined to determine the selective pressures on these regions. Results All of the PPR genes examined are under strong negative selection. Multiple independent losses of editing site targets are observed for both CRR21 and OTP82. In several species lacking the known editing target for CRR21, PPR genes are truncated near the 17th PPR repeat. The coding sequences of the truncated CRR21 genes are maintained under strong negative selection; however, the 3’ UTR sequences beyond the truncation site have substantially diverged. Phylogenetic analyses of four PPR genes show that sequences corresponding to helix A are high compared to helix B sequences. Differential evolutionary selection of helix A versus helix B is observed in both plant and mammalian PPR genes. Conclusion PPR genes and their cognate editing sites are mutually constrained in evolution. Editing sites are frequently lost by replacement of an edited C with a genomic T. After the loss of an editing site, the PPR genes are observed with three outcomes: first, few changes are detected in some cases; second, the PPR gene is present as a pseudogene; and third, the PPR gene is present but truncated in the C-terminal region. The retention of truncated forms of CRR21 that are maintained under strong negative

Molecular evolution of pentatricopeptide repeat genes reveals truncation in species lacking an editing target and structural domains under distinct selective pressures.

Science.gov (United States)

Hayes, Michael L; Giang, Karolyn; Mulligan, R Michael

2012-05-14

Pentatricopeptide repeat (PPR) proteins are required for numerous RNA processing events in plant organelles including C-to-U editing, splicing, stabilization, and cleavage. Fifteen PPR proteins are known to be required for RNA editing at 21 sites in Arabidopsis chloroplasts, and belong to the PLS class of PPR proteins. In this study, we investigate the co-evolution of four PPR genes (CRR4, CRR21, CLB19, and OTP82) and their six editing targets in Brassicaceae species. PPR genes are composed of approximately 10 to 20 tandem repeats and each repeat has two α-helical regions, helix A and helix B, that are separated by short coil regions. Each repeat and structural feature was examined to determine the selective pressures on these regions. All of the PPR genes examined are under strong negative selection. Multiple independent losses of editing site targets are observed for both CRR21 and OTP82. In several species lacking the known editing target for CRR21, PPR genes are truncated near the 17th PPR repeat. The coding sequences of the truncated CRR21 genes are maintained under strong negative selection; however, the 3' UTR sequences beyond the truncation site have substantially diverged. Phylogenetic analyses of four PPR genes show that sequences corresponding to helix A are high compared to helix B sequences. Differential evolutionary selection of helix A versus helix B is observed in both plant and mammalian PPR genes. PPR genes and their cognate editing sites are mutually constrained in evolution. Editing sites are frequently lost by replacement of an edited C with a genomic T. After the loss of an editing site, the PPR genes are observed with three outcomes: first, few changes are detected in some cases; second, the PPR gene is present as a pseudogene; and third, the PPR gene is present but truncated in the C-terminal region. The retention of truncated forms of CRR21 that are maintained under strong negative selection even in the absence of an editing site target

A-to-I RNA editing in the rat brain is age-dependent, region-specific and sensitive to environmental stress across generations.

Science.gov (United States)

Zaidan, Hiba; Ramaswami, Gokul; Golumbic, Yaela N; Sher, Noa; Malik, Assaf; Barak, Michal; Galiani, Dalia; Dekel, Nava; Li, Jin B; Gaisler-Salomon, Inna

2018-01-08

Adenosine-to-inosine (A-to-I) RNA editing is an epigenetic modification catalyzed by adenosine deaminases acting on RNA (ADARs), and is especially prevalent in the brain. We used the highly accurate microfluidics-based multiplex PCR sequencing (mmPCR-seq) technique to assess the effects of development and environmental stress on A-to-I editing at 146 pre-selected, conserved sites in the rat prefrontal cortex and amygdala. Furthermore, we asked whether changes in editing can be observed in offspring of stress-exposed rats. In parallel, we assessed changes in ADARs expression levels. In agreement with previous studies, we found editing to be generally higher in adult compared to neonatal rat brain. At birth, editing was generally lower in prefrontal cortex than in amygdala. Stress affected editing at the serotonin receptor 2c (Htr2c), and editing at this site was significantly altered in offspring of rats exposed to prereproductive stress across two generations. Stress-induced changes in Htr2c editing measured with mmPCR-seq were comparable to changes measured with Sanger and Illumina sequencing. Developmental and stress-induced changes in Adar and Adarb1 mRNA expression were observed but did not correlate with editing changes. Our findings indicate that mmPCR-seq can accurately detect A-to-I RNA editing in rat brain samples, and confirm previous accounts of a developmental increase in RNA editing rates. Our findings also point to stress in adolescence as an environmental factor that alters RNA editing patterns several generations forward, joining a growing body of literature describing the transgenerational effects of stress.

Application for Permit to Operate a Class II Solid Waste Disposal Site at the Nevada Test Site - U10c Disposal Site

Energy Technology Data Exchange (ETDEWEB)

NSTec Environmental Programs

2010-03-31

The Nevada Test Site (NTS) is located approximately 105 km (65 mi) northwest of Las Vegas, Nevada. National Nuclear Security Administration Nevada Site Office (NNSA/NSO) is the federal lands management authority for the NTS and National Security Technologies LLC (NSTec) is the Management and Operations contractor. Access on and off the NTS is tightly controlled, restricted, and guarded on a 24-hour basis. The NTS is posted with signs along its entire perimeter. NSTec is the operator of all solid waste disposal sites on the NTS. The site will be used for the disposal of refuse, rubbish, garbage, sewage sludge, pathological waste, Asbestos-Containing Material (ACM), industrial solid waste, hydrocarbon-burdened soil, hydrocarbon-burdened demolition and construction waste, and other inert waste (hereafter called permissible waste). Waste containing free liquids or regulated under Subtitle C of the Resource Conservation and Recovery Act (RCRA) will not be accepted for disposal at the site. Waste regulated under the Toxic Substance Control Act (TSCA), excluding Polychlorinated Biphenyl [PCB], Bulk Product Waste (see Section 6.2.5) and ACM (see Section 6.2.2.2) will not be accepted for disposal at the site. The disposal site will be used as the sole depository of permissible waste which is: (1) Generated by entities covered under the U.S. Environmental Protection Agency (EPA) Hazardous Waste Generator Identification Number for the NTS; (2) Generated at sites identified in the Federal Facilities Agreement and Consent Order (FFACO); (3) Sensitive records and media, including documents, vugraphs, computer disks, typewriter ribbons, magnetic tapes, etc., generated by NNSA/NSO or its contractors; (4) ACM generated by NNSA/NSO or its contractors according to Section 6.2.2.2, as necessary; (5) Hydrocarbon-burdened soil and solid waste from areas covered under the EPA Hazardous Waste Generator Identification Number for the NTS; (6) Other waste on a case-by-case concurrence by

REDIdb: the RNA editing database.

Science.gov (United States)

Picardi, Ernesto; Regina, Teresa Maria Rosaria; Brennicke, Axel; Quagliariello, Carla

2007-01-01

The RNA Editing Database (REDIdb) is an interactive, web-based database created and designed with the aim to allocate RNA editing events such as substitutions, insertions and deletions occurring in a wide range of organisms. The database contains both fully and partially sequenced DNA molecules for which editing information is available either by experimental inspection (in vitro) or by computational detection (in silico). Each record of REDIdb is organized in a specific flat-file containing a description of the main characteristics of the entry, a feature table with the editing events and related details and a sequence zone with both the genomic sequence and the corresponding edited transcript. REDIdb is a relational database in which the browsing and identification of editing sites has been simplified by means of two facilities to either graphically display genomic or cDNA sequences or to show the corresponding alignment. In both cases, all editing sites are highlighted in colour and their relative positions are detailed by mousing over. New editing positions can be directly submitted to REDIdb after a user-specific registration to obtain authorized secure access. This first version of REDIdb database stores 9964 editing events and can be freely queried at http://biologia.unical.it/py_script/search.html.

Single-stranded γPNAs for in vivo site-specific genome editing via Watson-Crick recognition.

Science.gov (United States)

Bahal, Raman; Quijano, Elias; McNeer, Nicole A; Liu, Yanfeng; Bhunia, Dinesh C; Lopez-Giraldez, Francesco; Fields, Rachel J; Saltzman, William M; Ly, Danith H; Glazer, Peter M

2014-01-01

Triplex-forming peptide nucleic acids (PNAs) facilitate gene editing by stimulating recombination of donor DNAs within genomic DNA via site-specific formation of altered helical structures that further stimulate DNA repair. However, PNAs designed for triplex formation are sequence restricted to homopurine sites. Herein we describe a novel strategy where next generation single-stranded gamma PNAs (γPNAs) containing miniPEG substitutions at the gamma position can target genomic DNA in mouse bone marrow at mixed-sequence sites to induce targeted gene editing. In addition to enhanced binding, γPNAs confer increased solubility and improved formulation into poly(lactic-co-glycolic acid) (PLGA) nanoparticles for efficient intracellular delivery. Single-stranded γPNAs induce targeted gene editing at frequencies of 0.8% in mouse bone marrow cells treated ex vivo and 0.1% in vivo via IV injection, without detectable toxicity. These results suggest that γPNAs may provide a new tool for induced gene editing based on Watson-Crick recognition without sequence restriction.

Cleanup Summary Report for the Defense Threat Reduction Agency Fiscal Year 2007, Task 6.7, U12u-Tunnel (Legacy Site), Nevada Test Site, Nevada

International Nuclear Information System (INIS)

2008-01-01

This letter serves as notice of completion for cleanup of the U12u-Tunnel (Legacy Site) as specified in the Defense Threat Reduction Agency (DTRA) Fiscal Year 2007 Statement of Work, Task 6.7. The U12u-Tunnel Legacy Site is located near the intersection of the U12u-Tunnel access road and the U12n-Tunnel access road in Area 12 of the Nevada Test Site (see Figure 1). The site encompasses 1.2 acres and was used to store miscellaneous mining equipment and materials that were used to support DTRA testing in Area 12. Field activities commenced February 11, 2008, and were completed February 20, 2008. Radiological surveys were performed on a drill jumbo and all material stored at the site. The drill jumbo was relocated to U12p-Tunnel portal and consolidated with other critical mining equipment for future use or storage. Ten truck loads of solid waste (53 tons) were shipped to the Nevada Test Site, Area 9 U10c Sanitary Landfill for disposal. No hazardous or radiological waste was generated at this site

Substrate specificity and catalysis by the editing active site of alanyl-tRNA synthetase from Escherichia coli†

Science.gov (United States)

Pasman, Zvi; Robey-Bond, Susan; Mirando, Adam C.; Smith, Gregory J.; Lague, Astrid; Francklyn, Christopher S.

2011-01-01

Aminoacyl-tRNA synthetases (ARSs) enhance the fidelity of protein synthesis through multiple mechanisms, including hydrolysis of the adenylate and cleavage of misacylated tRNA. Alanyl-tRNA synthetase (AlaRS) limits misacylation with glycine and serine by use of a dedicated editing domain, and a mutation in this activity has been genetically linked to a mouse model of a progressive neurodegenerative disease. Using the free standing P. horikoshii AlaX editing domain complexed with serine as a model and both Ser-tRNAAla and Ala-tRNAAla as substrates, the deacylation activities of the wild type and five different E. coli AlaRS editing site substitution mutants were characterized. The wild type AlaRS editing domain deacylated Ser-tRNAAla with a kcat/KM of 6.6 × 105 M−1 s−1, equivalent to a rate enhancement of 6000 over the rate of enzyme-independent deacylation, but only 12.2-fold greater than the rate with Ala-tRNAAla. While the E664A and T567G substitutions only minimally decreased kcat/KM, Q584H, I667E, and C666A AlaRS were more compromised in activity, with decreases in kcat/KM in the range of 6-, 7.3-, and 15-fold. C666A AlaRS was 1.4-fold more active on Ala-tRNAAla relative to Ser-tRNAAla, providing the only example of a true reversal of substrate specificity and highlighting a potential role of the coordinated zinc in editing substrate specificity. Along with the potentially serious physiological consequences of serine mis-incorporation, the relatively modest specificity of the AlaRS editing domain may provide a rationale for the widespread phylogenetic distribution of AlaX free standing editing domains, thereby contributing a further mechanism to lower concentrations of misacylated tRNAAla. PMID:21241052

Oligocene-Miocene magnetic stratigraphy carried by biogenic magnetite at sites U1334 and U1335 (equatorial Pacific Ocean)

Science.gov (United States)

Channell, J. E. T.; Ohneiser, C.; Yamamoto, Y.; Kesler, M. S.

2013-02-01

AbstractSediments from the equatorial Pacific Ocean, at the Integrated Ocean Drilling Program sites U1334 and U1335, record reliable magnetic polarity stratigraphies back to ~26.5 Ma (late Oligocene) at sedimentation rates usually in the 5-20 m/Myr range. Putative polarity subchrons that do not appear in current polarity timescales occur within Chrons C5ACr, C5ADn, and C5Bn.1r at Site U1335; and within Chrons C6AAr.2r, C6Br, C7Ar, and C8n.1n at Site U1334. Subchron C5Dr.1n (~17.5 Ma) is recorded at both sites, supporting its apparent recording in the South Atlantic Ocean, and has an estimated duration of ~40 kyr. The Oligocene-Miocene calcareous oozes have magnetizations carried by submicron magnetite, as indicated by thermal demagnetization of magnetic remanences, the anhysteretic remanence to susceptibility ratio, and magnetic hysteresis parameters. Transmission electron microscopy of magnetic separates indicates the presence of low-titanium iron oxide (magnetite) grains with size (50-100 nm) and shape similar to modern and fossil bacterial magnetite, supporting other evidence that biogenic submicron magnetite is the principal remanence carrier in these sediments. In the equatorial Pacific Ocean, low organic-carbon burial arrests microbial pore-water sulfate reduction, thereby aiding preservation of bacterial magnetite.

Identification of genomic sites for CRISPR/Cas9-based genome editing in the Vitis vinifera genome

Science.gov (United States)

CRISPR/Cas9 has been recently demonstrated as an effective and popular genome editing tool for modifying genomes of human, animals, microorganisms, and plants. Success of such genome editing is highly dependent on the availability of suitable target sites in the genomes to be edited. Many specific t...

RNA editing in kinetoplastid parasites: what to do with U

NARCIS (Netherlands)

Sloof, P.; Benne, R.

1997-01-01

The editing of the mitochondrial RNAs of kinetoplastid protozoa is a bizarre form of transcript maturation that involves insertion and deletion of uridylate residues. Editing leads to the formation of translational initiation and termination codons, the correction of gene-encoded reading frame

Long-term trends in U.S. gas supply and prices: 1992 edition of the GRI baseline projection of U.S. energy supply and demand to 2010

International Nuclear Information System (INIS)

Woods, T.J.

1991-12-01

The paper summarizes the gas supply outlook in the 1992 Edition of the GRI Baseline Projection of U.S. Energy Supply and Demand, which has been adopted as a major input to the planning cycle leading to the development of the Gas Research Institute (GRI) 1993 research and development program. The 1992 projection presents the GRI planning outlook for the economic and the energy supply and demand situation to the year 2010. It was prepared independently by GRI using publicly available data and a framework of commercially available models that GRI has developed over several years. It is not derived from the views of GRI member companies. The 1992 Edition of the GRI Baseline Projection presents an optimistic outlook for the U.S. gas industry in which increased gas supply can be obtained at competitive prices. The gas prices in the 1992 projection support growth in all major U.S. gas supply sources: lower-48, Alaska, Canada, Mexico, and LNG. By about 2005, U.S. gas supply is at its highest level ever. By 2010, U.S. gas supply has grown to almost 25 quads. U.S. gas production increases 2.6 quads between 1990 and 2010; imports increase 2.2 quads. Although imports do not increase as much as U.S. gas production, they account for an increased share of U.S. gas supply. The import share grows from 7 percent to 12 percent over the projection period. Supplemental gas sources provide about 1 percent of U.S. gas supply

Statistical Physics Approaches to RNA Editing

Science.gov (United States)

Bundschuh, Ralf

2012-02-01

The central dogma of molecular Biology states that DNA is transcribed base by base into RNA which is in turn translated into proteins. However, some organisms edit their RNA before translation by inserting, deleting, or substituting individual or short stretches of bases. In many instances the mechanisms by which an organism recognizes the positions at which to edit or by which it performs the actual editing are unknown. One model system that stands out by its very high rate of on average one out of 25 bases being edited are the Myxomycetes, a class of slime molds. In this talk we will show how the computational methods and concepts from statistical Physics can be used to analyze DNA and protein sequence data to predict editing sites in these slime molds and to guide experiments that identified previously unknown types of editing as well as the complete set of editing events in the slime mold Physarum polycephalum.

Contribution to the study of U-Ti and U-Pu-Ti carbides; Contribution a l'etude des carbures U-C-Ti et (U, Pu) - C-Ti

Energy Technology Data Exchange (ETDEWEB)

Milet, C A [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

1968-07-01

After having discussed the reasons to use (U,Pu) carbides as fast reactor fuel, we examine the influence of the addition of titanium to these carbides. A preliminary study has been done on the system of U-C-Ti and some properties have been measured such as: density, thermal expansion, electrical resistivity, atmospheric corrosion and compatibility with stainless steel. The systems U-Pu-C-Ti (Pu/U + Pu equal to 15 per cent) and U-C-Ti have been found to be very similar. There exists a two phases region (U,Pu)C + TiC, an eutectic between (U,Pu)C and TiC for approximately 15 at %. The solubilities of U + Pu in TiC and of Ti in (U,Pu)C is less than 1 % at. The addition of titanium does not markedly change thermal expansion coefficients of (U,Pu)C. However the resistance to atmospheric corrosion and compatibility with stainless steel is improved. Thermal conductivity, calculated from electrical resistivity, has increased. On the other side, the density of fissile material is lowered. The combination of (U,Pu)C + TiC seems to be the most promising alloy for application as nuclear fuel. (author) [French] Apres avoir rappele les problemes poses par un combustible pour les reacteurs a neutrons rapides et l'interet des carbures U-Pu-C comme combustible, on examine l'influence de l'addition de titane dans ces carbures. Une etude preliminaire sur le systeme U-C-Ti a ete effectuee et quelques proprietes sont indiquees: densite, coefficients de dilatation, resistivite electrique, tenue a la corrosion atmospherique, compatibilite avec l'acier inoxydable. Le systeme U-Pu-C-Ti (Pu/U + Pu egal a 15 pour cent) presente de grandes analogies avec le systeme U-C-Ti. Il existe un domaine biphase (U,Pu)C + TiC, un eutectique entre (U,Pu)C et TiC pour environ 15 at % Ti; les solubilites de U + Pu clans TiC et de Ti dans (U,Pu)C sont inferieures a 1 at %. Par rapport a la phase (U,Pu)C, l'addition de titane est sans effets importants sur les coefficients de dilatation. Par contre la tenue a

Revised Late Oligocene to Early Miocene magnetic stratigraphy recorded by drift sediments at Sites U1405 and U1406, IODP Expedition 342 (Newfoundland, NW Atlantic)

Science.gov (United States)

van Peer, Tim; Xuan, Chuang; Wilson, Paul; Liebrand, Diederik; Lippert, Peter

2015-04-01

The nannofossil oozes drilled at IODP Expedition 342 (Paleogene Newfoundland Sediment Drifts) Sites U1405 and U1406 provide an exceptional sedimentary archive of the Late Oligocene to Early Miocene due to high sedimentation rates (2-6 cm/kyr at U1406 and up to 20 cm/kyr at U1405) and their ideal location below the Deep Western Boundary Current. These drift sediment sequences provide a unique opportunity to study the Oligocene-Miocene Transition (OMT) and Mi1-event (a transient 1‰ positive oxygen isotope excursion) at an unprecedented resolution from a Northern Hemisphere perspective. The exact timing of the OMT and its rate of change require a reliable and high-resolution magnetic stratigraphic age control, as Chron C6Cn with its three subchrons roughly spans the Mi1 event and the reversal C6Cn.2n/C6Cn.2r defines the Oligocene-Miocene boundary. Natural Remanent Magnetisation (NRM) was measured on 140 m of u-channel samples at U1405 and 190 m at U1406. The u-channel sample based magnetostratigraphy is in good agreement with that based on the shipboard data and reveal distinctive well-defined patterns of normal and reversed polarities, which can be correlated to the Geomagnetic Polarity Time Scale between C6Bn.2n and C9n (ca. 22.2 to 27 Ma) at U1406 and between C6Bn.2n and C6Cr (ca. 22.2 to 23.5 Ma) at U1405. Furthermore, putative cryptochrons in Chron C6Br and C7Ar, previously reported at Site U1334 (IODP Expedition 320), are observed in the u-channel magnetic stratigraphy for Sites U1405 and U1406. Anhysteretic Remanent Magnetisation (ARM) intensity variations are combined with X-Ray Fluorescence (XRF) generated elemental measurements to refine the shipboard splice of both U1405 and U1406. Latest Oligocene to earliest Miocene splice refinements are complicated by the presence of large-scale stratigraphic gaps (up to 25 m at U1405) unrelated to drilling disturbances. The depth and estimated age of these stratigraphic gaps vary from hole to hole, and do not appear

Crystallization and X-ray diffraction analysis of the Trp/amber editing site of hepatitis delta virus (+)RNA: a case of rational design

International Nuclear Information System (INIS)

MacElrevey, Celeste; Wedekind, Joseph E.

2005-01-01

Well diffracting decamer crystals of the hepatitis delta virus RNA-editing site were prepared, but exhibited merohedral twinning and base averaging owing to duplex symmetry. A longer asymmetric construct that includes additional flanking RNA sequences has been crystallized that does not appear to exhibit these defects. RNA editing by mammalian ADAR1 (Adenosine Deaminase Acting on RNA) is required for the life cycle of the hepatitis delta virus (HDV). Editing extends the single viral open reading frame to yield two protein products of alternate length. ADARs are believed to recognize double-stranded RNA substrates via a ‘structure-based’ readout mechanism. Crystals of 10-mer duplexes representing the HDV RNA-editing site diffracted to 1.35 Å resolution, but suffered from merohedral twinning and averaging of the base registry. Expansion of the construct to include two flanking 3 × 1 internal loops yielded crystals in the primitive tetragonal space group P4 1 2 1 2 or P4 3 2 1 2. X-ray diffraction data were collected to 2.8 Å resolution, revealing a unit cell with parameters a = 62.5, c = 63.5 Å. The crystallization and X-ray analysis of multiple forms of the HDV RNA-editing substrate, encounters with common RNA crystal-growth defects and a strategy to overcome these problems are reported

Site-Specific Integration of Exogenous Genes Using Genome Editing Technologies in Zebrafish

Directory of Open Access Journals (Sweden)

Atsuo Kawahara

2016-05-01

Full Text Available The zebrafish (Danio rerio is an ideal vertebrate model to investigate the developmental molecular mechanism of organogenesis and regeneration. Recent innovation in genome editing technologies, such as zinc finger nucleases (ZFNs, transcription activator-like effector nucleases (TALENs and the clustered regularly interspaced short palindromic repeats (CRISPR/CRISPR associated protein 9 (Cas9 system, have allowed researchers to generate diverse genomic modifications in whole animals and in cultured cells. The CRISPR/Cas9 and TALEN techniques frequently induce DNA double-strand breaks (DSBs at the targeted gene, resulting in frameshift-mediated gene disruption. As a useful application of genome editing technology, several groups have recently reported efficient site-specific integration of exogenous genes into targeted genomic loci. In this review, we provide an overview of TALEN- and CRISPR/Cas9-mediated site-specific integration of exogenous genes in zebrafish.

TbRGG2 facilitates kinetoplastid RNA editing initiation and progression past intrinsic pause sites.

Science.gov (United States)

Ammerman, Michelle L; Presnyak, Vladimir; Fisk, John C; Foda, Bardees M; Read, Laurie K

2010-11-01

TbRGG2 is an essential kinetoplastid RNA editing accessory factor that acts specifically on pan-edited RNAs. To understand the mechanism of TbRGG2 action, we undertook an in-depth analysis of edited RNA populations in TbRGG2 knockdown cells and an in vitro examination of the biochemical activities of the protein. We demonstrate that TbRGG2 down-regulation more severely impacts editing at the 5' ends of pan-edited RNAs than at their 3' ends. The initiation of editing is reduced to some extent in TbRGG2 knockdown cells. In addition, TbRGG2 plays a post-initiation role as editing becomes stalled in TbRGG2-depleted cells, resulting in an overall decrease in the 3' to 5' progression of editing. Detailed analyses of edited RNAs from wild-type and TbRGG2-depleted cells reveal that TbRGG2 facilitates progression of editing past intrinsic pause sites that often correspond to the 3' ends of cognate guide RNAs (gRNAs). In addition, noncanonically edited junction regions are either absent or significantly shortened in TbRGG2-depleted cells, consistent with impaired gRNA transitions. Sequence analysis further suggests that TbRGG2 facilitates complete utilization of certain gRNAs. In vitro RNA annealing and in vivo RNA unwinding assays demonstrate that TbRGG2 can modulate RNA-RNA interactions. Collectively, these data are consistent with a model in which TbRGG2 facilitates initiation and 3' to 5' progression of editing through its ability to affect gRNA utilization, both during the transition between specific gRNAs and during usage of certain gRNAs.

The Extent of mRNA Editing Is Limited in Chicken Liver and Adipose, but Impacted by Tissular Context, Genotype, Age, and Feeding as Exemplified with a Conserved Edited Site in COG3

Directory of Open Access Journals (Sweden)

Pierre-François Roux

2016-02-01

Full Text Available RNA editing is a posttranscriptional process leading to differences between genomic DNA and transcript sequences, potentially enhancing transcriptome diversity. With recent advances in high-throughput sequencing, many efforts have been made to describe mRNA editing at the transcriptome scale, especially in mammals, yielding contradictory conclusions regarding the extent of this phenomenon. We show, by detailed description of the 25 studies focusing so far on mRNA editing at the whole-transcriptome scale, that systematic sequencing artifacts are considered in most studies whereas biological replication is often neglected and multi-alignment not properly evaluated, which ultimately impairs the legitimacy of results. We recently developed a rigorous strategy to identify mRNA editing using mRNA and genomic DNA sequencing, taking into account sequencing and mapping artifacts, and biological replicates. We applied this method to screen for mRNA editing in liver and white adipose tissue from eight chickens and confirm the small extent of mRNA recoding in this species. Among the 25 unique edited sites identified, three events were previously described in mammals, attesting that this phenomenon is conserved throughout evolution. Deeper investigations on five sites revealed the impact of tissular context, genotype, age, feeding conditions, and sex on mRNA editing levels. More specifically, this analysis highlighted that the editing level at the site located on COG3 was strongly regulated by four of these factors. By comprehensively characterizing the mRNA editing landscape in chickens, our results highlight how this phenomenon is limited and suggest regulation of editing levels by various genetic and environmental factors.

An integrated CRISPR Bombyx mori genome editing system with improved efficiency and expanded target sites.

Science.gov (United States)

Ma, Sanyuan; Liu, Yue; Liu, Yuanyuan; Chang, Jiasong; Zhang, Tong; Wang, Xiaogang; Shi, Run; Lu, Wei; Xia, Xiaojuan; Zhao, Ping; Xia, Qingyou

2017-04-01

Genome editing enabled unprecedented new opportunities for targeted genomic engineering of a wide variety of organisms ranging from microbes, plants, animals and even human embryos. The serial establishing and rapid applications of genome editing tools significantly accelerated Bombyx mori (B. mori) research during the past years. However, the only CRISPR system in B. mori was the commonly used SpCas9, which only recognize target sites containing NGG PAM sequence. In the present study, we first improve the efficiency of our previous established SpCas9 system by 3.5 folds. The improved high efficiency was also observed at several loci in both BmNs cells and B. mori embryos. Then to expand the target sites, we showed that two newly discovered CRISPR system, SaCas9 and AsCpf1, could also induce highly efficient site-specific genome editing in BmNs cells, and constructed an integrated CRISPR system. Genome-wide analysis of targetable sites was further conducted and showed that the integrated system cover 69,144,399 sites in B. mori genome, and one site could be found in every 6.5 bp. The efficiency and resolution of this CRISPR platform will probably accelerate both fundamental researches and applicable studies in B. mori, and perhaps other insects. Copyright © 2017 Elsevier Ltd. All rights reserved.

Chronostratigraphic framework for the late Miocene interval of IODP Exp. 355 Site U1457: timing of the C3-C4 transition

Science.gov (United States)

Tauxe, L.; Feakins, S. J.; Liddy, H.; Kulhanek, D. K.; Scardia, G.; Routledge, C.

2017-12-01

Combining magnetostratigraphic, biostratigraphic, and isotopic data for the Late Miocene interval of U1457 provides a tight temporal framework for the C3-C4 isotopic transition first documented by Quade et al. (1989) in northern Pakistan. We have re-evaluated the chronological constraints for the shifts recorded in Pakistan, Nepal and India. Records include those from Rhotas (Behrensmeyer et al., 2007), Jalalpur (Johnson et al., 1982, Quade and Cerling, 1995) from Pakistan, Jawalamukhti and Haripur Kola (NW India) in Voegeli et al. (2017) with magnetostratigraphic control from Meigs et al. (1995), and Sangode et al. (1996) and records from Nepal summarized by Quade et al. (1995) with magnetostratigraphic control documented by Ojha et al. (2009). An age for the C3-C4 transition at ca. 7.0 Ma is consistent with all records in hand suggesting that it is possible that the transition occurred simultaneously in the Indian subcontinent Ma (although differences are allowed but not demanded by the data). We also updated the magnetic and nannofossil stratigraphies for IODP Expedition 355, Site U1457, revising the calibration of certain nannofossil datums. These data, combined with geochemical proxy data sensitive to the C3-C4 transition (d13C values of C35 n-alkanes (per mil relative to PD Belemnite) which shows a transition at 648 mcd, lead to the tentative conclusion that the C3-C4 transition recorded at Site U1457 occurred within C3Ar, or also at ca. 7; it is apparently synchronous with the records on the Indian subcontinent. A.K. Behrensmeyer, J. Quade, T. E. Cerling , J. Kappelman, I. A. Khan, P. Copeland, L. Roe, J. Hicks, P. Stubblefield, B. J. Willis, C. Latorre, Geol. Soc. Am. Bull 119 1486-1505 (2007). F. M. Gradstein, J. G. Ogg, M. D. Schmitz, G. M. Ogg, (2012). N. M. Johnson, N. D. Opdyke, G. D. Johnson, E. H. Lindsay, R. A. K. Tahirkheli, Paleogeo. Paleoclim. and Paleoecol. 37 17-42 (1982). A.J. Meigs, D. W. Burbank, R. A. Beck, Geology 23 423-426 (1995). Ojha

Review of the thermodynamics of the U--C, Pu--C, and U--Pu--C systems

International Nuclear Information System (INIS)

Tetenbaum, M.; Sheth, A.; Olson, W.

1975-06-01

Thermodynamic properties such as enthalpy, heat capacity, entropy, heat and free energy of formation, and vaporization behavior are presented for the U--C, Pu--C, and U--Pu--C systems. These properties are of interest to scientists and engineers involved in the expanding field of advanced fuel LMFBR systems. The information on these systems has been derived largely from the discussions of the IAEA Panel on the assessment of thermodynamic properties of the U--C, Pu--C, and U--Pu--C systems. (U.S.)

Long-term trends in U.S. gas transportation: 1992 edition of the GRI baseline projection of U.S. energy supply and demand to 2010, June 1992. Gas Research Insights

International Nuclear Information System (INIS)

Lihn, M.L.; Woods, T.J.

1992-06-01

The paper summarizes the trends in lower-48 gas transportation in the 1992 Edition of the GRI Baseline Projection of U.S. Energy Supply and Demand to 2010, which has been adopted as a major input to the planning cycle leading to the development of the Gas Research Institute (GRI) 1993 research and development program. The 1992 projection presents an optimistic outlook for the U.S. gas industry in which increased gas supply can be obtained at competitive prices

New U.S. LHC Web site launched

CERN Multimedia

Katie Yurkewicz

2007-01-01

On September 12, the U.S. Department of Energy's Office of Science launched a new Web site, www.uslhc.us, to tell the story of the U.S. role in the LHC. The site provides general information for the public about the LHC and its six experiments, as well as detailed information about the participation of physicists, engineers and students from the United States. The U.S. site joins the UK's LHC site in providing information for a national audience, with sites from several more countries expected to launch within the next year. The US LHC site features news and information about the LHC, along with high-resolution images and resources for students and educators. The site also features blogs by four particle physicists, including ATLAS collaborators Monica Dunford from the University of Chicago and Peter Steinberg from Brookhaven National Laboratory. More than 1,300 scientists from over 90 U.S. institutions participate in the LHC and its experiments, representing universities and national laboratories from...

CRISPR/Cas9-loxP-Mediated Gene Editing as a Novel Site-Specific Genetic Manipulation Tool.

Science.gov (United States)

Yang, Fayu; Liu, Changbao; Chen, Ding; Tu, Mengjun; Xie, Haihua; Sun, Huihui; Ge, Xianglian; Tang, Lianchao; Li, Jin; Zheng, Jiayong; Song, Zongming; Qu, Jia; Gu, Feng

2017-06-16

Cre-loxP, as one of the site-specific genetic manipulation tools, offers a method to study the spatial and temporal regulation of gene expression/inactivation in order to decipher gene function. CRISPR/Cas9-mediated targeted genome engineering technologies are sparking a new revolution in biological research. Whether the traditional site-specific genetic manipulation tool and CRISPR/Cas9 could be combined to create a novel genetic tool for highly specific gene editing is not clear. Here, we successfully generated a CRISPR/Cas9-loxP system to perform gene editing in human cells, providing the proof of principle that these two technologies can be used together for the first time. We also showed that distinct non-homologous end-joining (NHEJ) patterns from CRISPR/Cas9-mediated gene editing of the targeting sequence locates at the level of plasmids (episomal) and chromosomes. Specially, the CRISPR/Cas9-mediated NHEJ pattern in the nuclear genome favors deletions (64%-68% at the human AAVS1 locus versus 4%-28% plasmid DNA). CRISPR/Cas9-loxP, a novel site-specific genetic manipulation tool, offers a platform for the dissection of gene function and molecular insights into DNA-repair pathways. Copyright © 2017 The Author(s). Published by Elsevier Inc. All rights reserved.

Transcriptional Slippage and RNA Editing Increase the Diversity of Transcripts in Chloroplasts: Insight from Deep Sequencing of Vigna radiata Genome and Transcriptome.

Directory of Open Access Journals (Sweden)

Ching-Ping Lin

Full Text Available We performed deep sequencing of the nuclear and organellar genomes of three mungbean genotypes: Vigna radiata ssp. sublobata TC1966, V. radiata var. radiata NM92 and the recombinant inbred line RIL59 derived from a cross between TC1966 and NM92. Moreover, we performed deep sequencing of the RIL59 transcriptome to investigate transcript variability. The mungbean chloroplast genome has a quadripartite structure including a pair of inverted repeats separated by two single copy regions. A total of 213 simple sequence repeats were identified in the chloroplast genomes of NM92 and RIL59; 78 single nucleotide variants and nine indels were discovered in comparing the chloroplast genomes of TC1966 and NM92. Analysis of the mungbean chloroplast transcriptome revealed mRNAs that were affected by transcriptional slippage and RNA editing. Transcriptional slippage frequency was positively correlated with the length of simple sequence repeats of the mungbean chloroplast genome (R2=0.9911. In total, 41 C-to-U editing sites were found in 23 chloroplast genes and in one intergenic spacer. No editing site that swapped U to C was found. A combination of bioinformatics and experimental methods revealed that the plastid-encoded RNA polymerase-transcribed genes psbF and ndhA are affected by transcriptional slippage in mungbean and in main lineages of land plants, including three dicots (Glycine max, Brassica rapa, and Nicotiana tabacum, two monocots (Oryza sativa and Zea mays, two gymnosperms (Pinus taeda and Ginkgo biloba and one moss (Physcomitrella patens. Transcript analysis of the rps2 gene showed that transcriptional slippage could affect transcripts at single sequence repeat regions with poly-A runs. It showed that transcriptional slippage together with incomplete RNA editing may cause sequence diversity of transcripts in chloroplasts of land plants.

Charge disproportionation of mixed-valent Cr triggered by Bi lone-pair effect in the A -site-ordered perovskite BiC u3C r4O12

Science.gov (United States)

Etter, Martin; Isobe, Masahiko; Sakurai, Hiroya; Yaresko, Alexander; Dinnebier, Robert E.; Takagi, Hidenori

2018-05-01

A new A -site-ordered perovskite BiC u3C r4O12 is synthesized under a high pressure of 7.7 GPa. A phase transition from a paramagnetic metal to a ferrimagnetic metal is observed at Tc=190 K accompanied with a structural change from cubic to monoclinic. Structural analysis of the low-temperature monoclinic phase reveals that this transition represents a charge disproportionation of C r3.75 + into C r4 + and C r3.5 + . We argue that the asymmetric displacement of Bi caused by a lone-pair effect triggers the formation of a dimeric Cr4+2O5 unit and leads to an ordering of C r4 + and C r3.5 + below the transition.

Two Distinct Approaches for CRISPR-Cas9-Mediated Gene Editing in Cryptococcus neoformans and Related Species.

Science.gov (United States)

Wang, Ping

2018-06-27

Cryptococcus neoformans and related species are encapsulated basidiomycetous fungi that cause meningoencephalitis in individuals with immune deficiency. This pathogen has a tractable genetic system; however, gene disruption via electroporation remains difficult, while biolistic transformation is often limited by lack of multiple genetic markers and the high initial cost of equipment. The approach using clustered regularly interspaced short palindromic repeats (CRISPR) and CRISPR-associated protein 9 (Cas9) has become the technology of choice for gene editing in many organisms due to its simplicity, efficiency, and versatility. The technique has been successfully demonstrated in C. neoformans and Cryptococcus deneoformans in which two DNA plasmids expressing either the Streptococcus pyogenes CAS9 gene or the guide RNA (gRNA) were employed. However, potential adverse effects due to constitutive expression and the time-consuming process of constructing vectors to express each gRNA remain as a primary barrier for wide adaptation. This report describes the delivery of preassembled CRISPR-Cas9-gRNA ribonucleoproteins (RNPs) via electroporation that is able to generate edited mutant alleles. RNP-mediated CRISPR-Cas9 was used to replace the wild-type GIB2 gene encoding a Gβ-like/RACK1 Gib2 protein with a gib2 :: NAT allele via homologous recombination in both C. neoformans and C. deneoformans In addition, a DNA plasmid (pCnCas9:U6-gRNA) that expresses both Cas9 and gRNA, allowing for convenient yet low-cost DNA-mediated gene editing, is described. pCnCas9:U6-gRNA contains an endogenous U6 promoter for gRNA expression and restriction sites for one-step insertion of a gRNA. These approaches and resources provide new opportunities to accelerate genetic studies of Cryptococcus species. IMPORTANCE For genetic studies of the Cryptococcus genus, generation of mutant strains is often hampered by a limited number of selectable genetic markers, the tedious process of vector

Characterization of U.S. Wave Energy Converter (WEC) Test Sites: A Catalogue of Met-Ocean Data, 2nd Edition

Energy Technology Data Exchange (ETDEWEB)

Dallman, Ann R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Water Power Technologies; Neary, Vincent S. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Water Power Technologies

2015-09-01

This report presents met-ocean data and wave energy characteristics at eight U.S. wave energy converter (WEC) test and potential deployment sites. Its purpose is to enable the comparison of wave resource characteristics among sites as well as the selection of test sites that are most suitable for a developer's device and that best meet their testing needs and objectives. It also provides essential inputs for the design of WEC test devices and planning WEC tests, including the planning of deployment, and operations and maintenance. For each site, this report catalogues wave statistics recommended in the International Electrotechnical Commission Technical Speci cation (IEC 62600-101 TS) on Wave Energy Characterization, as well as the frequency of occurrence of weather windows and extreme sea states, and statistics on wind and ocean currents. It also provides useful information on test site infrastructure and services.

Contribution to the study of the (U,Pu)C,N system; Contribution a l'etude du systeme (U,Pu)C,N

Energy Technology Data Exchange (ETDEWEB)

Lorenzelli, R [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

1968-07-01

The reactions of UC, PuC, (U,Pu)C, UC{sub 2} and U(C{sub 1-x}O{sub x}) with nitrogen at moderate temperatures (room temperature to 400 C) are described. The influence of the uptake of nitrogen by the powders necessary to sinter the carbides upon the nature of the final product has been investigated; it has been shown that the sintered carbides are hyper-stoichiometric. The reactions of carbon with UN, PuN and (U,Pu)N has also been studied. Under vacuum, carbon reacts on the nitrides at temperatures as low as 1100 C; nitrogen is replaced by carbon and the final product is a carbonitride. The reaction is: MN + x C {yields} MN{sub 1-x}C{sub x} + x/2N{sub 2}. The reaction is limited and the carbonitrides have a fixed composition in presence of M{sub 2}C{sub 3} or MC{sub 2}; hence it is impossible to produce pure MC using the reaction. The ternary diagram U-C-N, Pu-C-N and (U,Pu)C-N have been drawn. They show clearly that it is possible to obtain single phase carbonitrides in a wide domain of compositions. (author) [French] On decrit les reactions avec l'azote de UC, PuC,(U,Pu)C,UC{sub 2} et U(C{sub 1-x}O{sub x}), par action directe de l'azote a temperature moderee (de l'ambiante a 450 C). On a etudie l'influence de la contamination par l'azote des poudres de carbures necessaires au frittage sur la nature des produits frittes; on a montre que les carbures frittes obtenus sont hyperstoechiometriques. On a etudie parallelement les reactions du carbone avec UN, PuN et (U,Pu)N. Sous vide le carbone reagit sur les nitrures des 1100 C: le carbone se substitue a l'azote; l'azote libere est elimine et le produit final est un carbonitrure. La reaction s'ecrit: MN + x C {yields} MN{sub 1-x}C{sub x} + x/2N{sub 2}. La reaction est limitee et les carbonitrures obtenus ont une composition limite fixe en presence des carbures superieurs M{sub 2}C{sub 3} et MC{sub 2}; il est donc impossible d'obtenir MC pur par cette reaction. Les diagrammes d'equilibre U-C-N, Pu-C-N et (U,Pu) C-N, ont

Heterologous and endogenous U6 snRNA promoters enable CRISPR/Cas9 mediated genome editing in Aspergillus niger.

Science.gov (United States)

Zheng, Xiaomei; Zheng, Ping; Sun, Jibin; Kun, Zhang; Ma, Yanhe

2018-01-01

U6 promoters have been used for single guide RNA (sgRNA) transcription in the clustered regularly interspaced short palindromic repeats/CRISPR-associated protein (CRISPR/Cas9) genome editing system. However, no available U6 promoters have been identified in Aspergillus niger, which is an important industrial platform for organic acid and protein production. Two CRISPR/Cas9 systems established in A. niger have recourse to the RNA polymerase II promoter or in vitro transcription for sgRNA synthesis, but these approaches generally increase cloning efforts and genetic manipulation. The validation of functional RNA polymerase II promoters is therefore an urgent need for A. niger . Here, we developed a novel CRISPR/Cas9 system in A. niger for sgRNA expression, based on one endogenous U6 promoter and two heterologous U6 promoters. The three tested U6 promoters enabled sgRNA transcription and the disruption of the polyketide synthase albA gene in A. niger . Furthermore, this system enabled highly efficient gene insertion at the targeted genome loci in A. niger using donor DNAs with homologous arms as short as 40-bp. This study demonstrated that both heterologous and endogenous U6 promoters were functional for sgRNA expression in A. niger . Based on this result, a novel and simple CRISPR/Cas9 toolbox was established in A. niger, that will benefit future gene functional analysis and genome editing.

Genome Editing: A New Approach to Human Therapeutics.

Science.gov (United States)

Porteus, Matthew

2016-01-01

The ability to manipulate the genome with precise spatial and nucleotide resolution (genome editing) has been a powerful research tool. In the past decade, the tools and expertise for using genome editing in human somatic cells and pluripotent cells have increased to such an extent that the approach is now being developed widely as a strategy to treat human disease. The fundamental process depends on creating a site-specific DNA double-strand break (DSB) in the genome and then allowing the cell's endogenous DSB repair machinery to fix the break such that precise nucleotide changes are made to the DNA sequence. With the development and discovery of several different nuclease platforms and increasing knowledge of the parameters affecting different genome editing outcomes, genome editing frequencies now reach therapeutic relevance for a wide variety of diseases. Moreover, there is a series of complementary approaches to assessing the safety and toxicity of any genome editing process, irrespective of the underlying nuclease used. Finally, the development of genome editing has raised the issue of whether it should be used to engineer the human germline. Although such an approach could clearly prevent the birth of people with devastating and destructive genetic diseases, questions remain about whether human society is morally responsible enough to use this tool.

Transcripts of the NADH-dehydrogenase subunit 3 gene are differentially edited in Oenothera mitochondria.

Science.gov (United States)

Schuster, W; Wissinger, B; Unseld, M; Brennicke, A

1990-01-01

A number of cytosines are altered to be recognized as uridines in transcripts of the nad3 locus in mitochondria of the higher plant Oenothera. Such nucleotide modifications can be found at 16 different sites within the nad3 coding region. Most of these alterations in the mRNA sequence change codon identities to specify amino acids better conserved in evolution. Individual cDNA clones differ in their degree of editing at five nucleotide positions, three of which are silent, while two lead to codon alterations specifying different amino acids. None of the cDNA clones analysed is maximally edited at all possible sites, suggesting slow processing or lowered stringency of editing at these nucleotides. Differentially edited transcripts could be editing intermediates or could code for differing polypeptides. Two edited nucleotides in an open reading frame located upstream of nad3 change two amino acids in the deduced polypeptide. Part of the well-conserved ribosomal protein gene rps12 also encoded downstream of nad3 in other plants, is lost in Oenothera mitochondria by recombination events. The functional rps12 protein must be imported from the cytoplasm since the deleted sequences of this gene are not found in the Oenothera mitochondrial genome. The pseudogene sequence is not edited at any nucleotide position. Images Fig. 3. Fig. 4. Fig. 7. PMID:1688531

REDIdb: an upgraded bioinformatics resource for organellar RNA editing sites.

Science.gov (United States)

Picardi, Ernesto; Regina, Teresa M R; Verbitskiy, Daniil; Brennicke, Axel; Quagliariello, Carla

2011-03-01

RNA editing is a post-transcriptional molecular process whereby the information in a genetic message is modified from that in the corresponding DNA template by means of nucleotide substitutions, insertions and/or deletions. It occurs mostly in organelles by clade-specific diverse and unrelated biochemical mechanisms. RNA editing events have been annotated in primary databases as GenBank and at more sophisticated level in the specialized databases REDIdb, dbRES and EdRNA. At present, REDIdb is the only freely available database that focuses on the organellar RNA editing process and annotates each editing modification in its biological context. Here we present an updated and upgraded release of REDIdb with a web-interface refurbished with graphical and computational facilities that improve RNA editing investigations. Details of the REDIdb features and novelties are illustrated and compared to other RNA editing databases. REDIdb is freely queried at http://biologia.unical.it/py_script/REDIdb/. Copyright © 2010 Elsevier B.V. and Mitochondria Research Society. All rights reserved.

Contribution to the study of the (U,Pu)C,N system; Contribution a l'etude du systeme (U,Pu)C,N

Energy Technology Data Exchange (ETDEWEB)

Lorenzelli, R. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

1968-07-01

The reactions of UC, PuC, (U,Pu)C, UC{sub 2} and U(C{sub 1-x}O{sub x}) with nitrogen at moderate temperatures (room temperature to 400 C) are described. The influence of the uptake of nitrogen by the powders necessary to sinter the carbides upon the nature of the final product has been investigated; it has been shown that the sintered carbides are hyper-stoichiometric. The reactions of carbon with UN, PuN and (U,Pu)N has also been studied. Under vacuum, carbon reacts on the nitrides at temperatures as low as 1100 C; nitrogen is replaced by carbon and the final product is a carbonitride. The reaction is: MN + x C {yields} MN{sub 1-x}C{sub x} + x/2N{sub 2}. The reaction is limited and the carbonitrides have a fixed composition in presence of M{sub 2}C{sub 3} or MC{sub 2}; hence it is impossible to produce pure MC using the reaction. The ternary diagram U-C-N, Pu-C-N and (U,Pu)C-N have been drawn. They show clearly that it is possible to obtain single phase carbonitrides in a wide domain of compositions. (author) [French] On decrit les reactions avec l'azote de UC, PuC,(U,Pu)C,UC{sub 2} et U(C{sub 1-x}O{sub x}), par action directe de l'azote a temperature moderee (de l'ambiante a 450 C). On a etudie l'influence de la contamination par l'azote des poudres de carbures necessaires au frittage sur la nature des produits frittes; on a montre que les carbures frittes obtenus sont hyperstoechiometriques. On a etudie parallelement les reactions du carbone avec UN, PuN et (U,Pu)N. Sous vide le carbone reagit sur les nitrures des 1100 C: le carbone se substitue a l'azote; l'azote libere est elimine et le produit final est un carbonitrure. La reaction s'ecrit: MN + x C {yields} MN{sub 1-x}C{sub x} + x/2N{sub 2}. La reaction est limitee et les carbonitrures obtenus ont une composition limite fixe en presence des carbures superieurs M{sub 2}C{sub 3} et MC{sub 2}; il est donc impossible d'obtenir MC pur par cette reaction. Les diagrammes

RNA Editing During Sexual Development Occurs in Distantly Related Filamentous Ascomycetes.

Science.gov (United States)

Teichert, Ines; Dahlmann, Tim A; Kück, Ulrich; Nowrousian, Minou

2017-04-01

RNA editing is a post-transcriptional process that modifies RNA molecules leading to transcript sequences that differ from their template DNA. A-to-I editing was found to be widely distributed in nuclear transcripts of metazoa, but was detected in fungi only recently in a study of the filamentous ascomycete Fusarium graminearum that revealed extensive A-to-I editing of mRNAs in sexual structures (fruiting bodies). Here, we searched for putative RNA editing events in RNA-seq data from Sordaria macrospora and Pyronema confluens, two distantly related filamentous ascomycetes, and in data from the Taphrinomycete Schizosaccharomyces pombe. Like F. graminearum, S. macrospora is a member of the Sordariomycetes, whereas P. confluens belongs to the early-diverging group of Pezizomycetes. We found extensive A-to-I editing in RNA-seq data from sexual mycelium from both filamentous ascomycetes, but not in vegetative structures. A-to-I editing was not detected in different stages of meiosis of S. pombe. A comparison of A-to-I editing in S. macrospora with F. graminearum and P. confluens, respectively, revealed little conservation of individual editing sites. An analysis of RNA-seq data from two sterile developmental mutants of S. macrospora showed that A-to-I editing is strongly reduced in these strains. Sequencing of cDNA fragments containing more than one editing site from P. confluens showed that at the beginning of sexual development, transcripts were incompletely edited or unedited, whereas in later stages transcripts were more extensively edited. Taken together, these data suggest that A-to-I RNA editing is an evolutionary conserved feature during fruiting body development in filamentous ascomycetes. © The Author(s) 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

Long-term trends in U.S. gas supply and prices: 1991 edition of the GRI baseline projection of U.S. energy supply and demand to 2010, April 1991. Gas research insights

International Nuclear Information System (INIS)

Woods, T.J.

1991-04-01

The report summarizes the gas supply and price outlook in the 1991 Edition of the GRI Baseline Projection of U.S. Energy Supply and Demand. Projected U.S. gas production, gas imports, and other sources of gas supply are discussed along with the sensitivity of the outlook to changes in price expectations. The critical uncertainties and issues affecting the gas supply and price outlook are discussed. Appendixes include a comparison of the 1991 and the 1989 projections of gas supply and price trends; and a description of the GRI Hydrocarbon Model

Plate impact experiments on DC745U cooled to ~ -60 °C

Energy Technology Data Exchange (ETDEWEB)

Gustavsen, Richard L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Dattelbaum, Dana M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Bartram, Brian Douglas [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Gibson, Lloyd Lee [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Jones, Justin Daniel [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Goodbody, Austin Bernard [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics

2016-08-11

Using gas-gun driven plate impact experiments, we have measured the U_S - u_p Hugoniot of the silicone elastomer DC745U cooled to -60 °C. In summary, the initial density changes from p₀ (23°C) = 1.312 ± 0.010 g/cm³ to p₀ (-60°C) = 1.447 ± 0.011 g/cm³. The linear U_S - u_p Hugoniot changes from U_S = 1.62 + 1.74u_p km/s at +23°C, to U_S = 2.03 ± 0.06 + (2.03 ± 0.06) u_p km/s at -60°C. DC745U, therefore is much stiffer at -60°C than at +23°C, probably due to the crystallization that occurs at ~ -50°C. Caveats/deficiencies: 1) This report does not provide an adequate pedigree of the DC745U used. 2) References to unpublished room temperature shock compression data on the elastomer are inadequate. 3) The report has not been fact checked by a DC745 subject matter expert.

Selective Self-Presentation and Social Comparison Through Photographs on Social Networking Sites.

Science.gov (United States)

Fox, Jesse; Vendemia, Megan A

2016-10-01

Through social media and camera phones, users enact selective self-presentation as they choose, edit, and post photographs of themselves (such as selfies) to social networking sites for an imagined audience. Photos typically focus on users' physical appearance, which may compound existing sociocultural pressures about body image. We identified users of social networking sites among a nationally representative U.S. sample (N = 1,686) and examined women's and men's photo-related behavior, including posting photos, editing photos, and feelings after engaging in upward and downward social comparison with others' photos on social networking sites. We identified some sex differences: women edited photos more frequently and felt worse after upward social comparison than men. Body image and body comparison tendency mediated these effects.

From Genomics to Gene Therapy: Induced Pluripotent Stem Cells Meet Genome Editing.

Science.gov (United States)

Hotta, Akitsu; Yamanaka, Shinya

2015-01-01

The advent of induced pluripotent stem (iPS) cells has opened up numerous avenues of opportunity for cell therapy, including the initiation in September 2014 of the first human clinical trial to treat dry age-related macular degeneration. In parallel, advances in genome-editing technologies by site-specific nucleases have dramatically improved our ability to edit endogenous genomic sequences at targeted sites of interest. In fact, clinical trials have already begun to implement this technology to control HIV infection. Genome editing in iPS cells is a powerful tool and enables researchers to investigate the intricacies of the human genome in a dish. In the near future, the groundwork laid by such an approach may expand the possibilities of gene therapy for treating congenital disorders. In this review, we summarize the exciting progress being made in the utilization of genomic editing technologies in pluripotent stem cells and discuss remaining challenges toward gene therapy applications.

Contribution to the study of the (U,Pu)C,N system

International Nuclear Information System (INIS)

Lorenzelli, R.

1968-01-01

The reactions of UC, PuC, (U,Pu)C, UC 2 and U(C 1-x O x ) with nitrogen at moderate temperatures (room temperature to 400 C) are described. The influence of the uptake of nitrogen by the powders necessary to sinter the carbides upon the nature of the final product has been investigated; it has been shown that the sintered carbides are hyper-stoichiometric. The reactions of carbon with UN, PuN and (U,Pu)N has also been studied. Under vacuum, carbon reacts on the nitrides at temperatures as low as 1100 C; nitrogen is replaced by carbon and the final product is a carbonitride. The reaction is: MN + x C → MN 1-x C x + x/2N 2 . The reaction is limited and the carbonitrides have a fixed composition in presence of M 2 C 3 or MC 2 ; hence it is impossible to produce pure MC using the reaction. The ternary diagram U-C-N, Pu-C-N and (U,Pu)C-N have been drawn. They show clearly that it is possible to obtain single phase carbonitrides in a wide domain of compositions. (author) [fr

Genetic Determinants of RNA Editing Levels of ADAR Targets in Drosophila melanogaster.

Science.gov (United States)

Kurmangaliyev, Yerbol Z; Ali, Sammi; Nuzhdin, Sergey V

2015-12-12

RNA editing usually affects only a fraction of expressed transcripts and there is a vast amount of variation in editing levels of ADAR (adenosine deaminase, RNA-specific) targets. Here we explore natural genetic variation affecting editing levels of particular sites in 81 natural strains of Drosophila melanogaster. The analysis of associations between editing levels and single-nucleotide polymorphisms allows us to map putative cis-regulatory regions affecting editing of 16 A-to-I editing sites (cis-RNA editing quantitative trait loci or cis-edQTLs, P < 10(-8)). The observed changes in editing levels are validated by independent molecular technique. All identified regulatory variants are located in close proximity of modulated editing sites. Moreover, colocalized editing sites are often regulated by same loci. Similar to expression and splicing QTL studies, the characterization of edQTLs will greatly expand our understanding of cis-regulatory evolution of gene expression. Copyright © 2016 Kurmangaliyev et al.

Genetic Determinants of RNA Editing Levels of ADAR Targets in Drosophila melanogaster

Directory of Open Access Journals (Sweden)

Yerbol Z. Kurmangaliyev

2016-02-01

Full Text Available RNA editing usually affects only a fraction of expressed transcripts and there is a vast amount of variation in editing levels of ADAR (adenosine deaminase, RNA-specific targets. Here we explore natural genetic variation affecting editing levels of particular sites in 81 natural strains of Drosophila melanogaster. The analysis of associations between editing levels and single-nucleotide polymorphisms allows us to map putative cis-regulatory regions affecting editing of 16 A-to-I editing sites (cis-RNA editing quantitative trait loci or cis-edQTLs, P < 10−8. The observed changes in editing levels are validated by independent molecular technique. All identified regulatory variants are located in close proximity of modulated editing sites. Moreover, colocalized editing sites are often regulated by same loci. Similar to expression and splicing QTL studies, the characterization of edQTLs will greatly expand our understanding of cis-regulatory evolution of gene expression.

Preparation of D-[U-14C]galactose and α-D-[U-14C]galactose-1-phosphate

International Nuclear Information System (INIS)

Kolina, J.; Hromadkova, B.

1989-01-01

Optically pure D-[U- 14 C]galactose was prepared on a preparatory scale using the galactokinase enzyme. The suggested procedure allows to also prepare a α-D-[U- 14 C]galactose-1-phosphate and L-[U- 14 ]galactose giving good yield. The experiments proved that the raw fraction isolated from yeast of the Kluyveromyces fragilis strain or the Kluyveromyces lactis strain shows sufficient activity. Phosphorylation of D-[U- 14 C]galactose practically terminates after 30 mins of incubation. DL-[U- 14 C]galactose isolated using preparatory paper chromatography from the acid hydrolyzate of [U- 14 C] polysaccharide is a satisfactory radioactive precursor. The developed preparation procedure theoretically contributed towards the further elucidation of the problem of the proportional representation of galactose stereo-isomers in extracellular polysaccharide isolated from red algae. In this respect data in the literature differ and some sources state a significantly higher propertion of L-galactose. The experiments showed that [U- 14 C] polysaccharide isolated from the red algae Porphyridium cruentum prevalently contains D-[U- 14 C]galactose, which confirms the process of enzyme reaction. (author). 1 tab., 4 refs

Studies of U-Pu-C-Ti compounds

International Nuclear Information System (INIS)

Milet, C.

1967-01-01

The U-Pu-C-Ti compounds (5 to 20 atoms per cent Ti) have been studied in order to improve some properties of U-Pu-C carbides and to extend the existence field of the (U, Pu) C phase. The Pu/(U+Pu) ratio has been fixed to 15 per cent. All the alloys were elaborated and cast in an arc furnace. A two-phases field (U, Pu) C + Ti C exists which permits to avoid di- and sesqui-carbides and the (U, Pu) phase. An eutectic between (U, Pu) C and Ti C was found around 15 atoms per cent Ti. Practically the whole of the titanium is in Ti C form, titanium solubility in (U, Pu) C being inferior to 1 atom per cent. The most promising alloy are those containing two phases: (U, Pu) C+ Ti C. In comparison with the (U, Pu) C phase, titanium addition does not change very much the thermal expansion coefficients nor the thermal cycling behaviour between 160 and 1000 Celsius degrees which is excellent. On the other hand atmospheric corrosion behaviour is improved; compatibility with stainless steel is better; thermal conductivity, calculated from electrical resistivity K is enhanced: for U(0.85)-Pu(0.15)-C alloy we have K 0.179 W/cm.C at 1000 C and K = 0.187 W/cm.C at 1500 C, for U-Pu-C-Ti (10 atoms % Ti) alloy we have K = 0.193 W/cm.C at 1000 C and K = 0.205 W/cm.C at 1500 C. (author) [fr

Genes (including RNA editing information) - RMG | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available t tested T: transcribed N: not transcribed Editing site Editing site N: not transcribed Previous reports on ...editing sites Previous reports on editing sites Strand Strand S: sense A: antisense exon1 start Start positi

Genetic mapping uncovers cis-regulatory landscape of RNA editing.

Science.gov (United States)

Ramaswami, Gokul; Deng, Patricia; Zhang, Rui; Anna Carbone, Mary; Mackay, Trudy F C; Li, Jin Billy

2015-09-16

Adenosine-to-inosine (A-to-I) RNA editing, catalysed by ADAR enzymes conserved in metazoans, plays an important role in neurological functions. Although the fine-tuning mechanism provided by A-to-I RNA editing is important, the underlying rules governing ADAR substrate recognition are not well understood. We apply a quantitative trait loci (QTL) mapping approach to identify genetic variants associated with variability in RNA editing. With very accurate measurement of RNA editing levels at 789 sites in 131 Drosophila melanogaster strains, here we identify 545 editing QTLs (edQTLs) associated with differences in RNA editing. We demonstrate that many edQTLs can act through changes in the local secondary structure for edited dsRNAs. Furthermore, we find that edQTLs located outside of the edited dsRNA duplex are enriched in secondary structure, suggesting that distal dsRNA structure beyond the editing site duplex affects RNA editing efficiency. Our work will facilitate the understanding of the cis-regulatory code of RNA editing.

Systematic identification of edited microRNAs in the human brain

Science.gov (United States)

Alon, Shahar; Mor, Eyal; Vigneault, Francois; Church, George M.; Locatelli, Franco; Galeano, Federica; Gallo, Angela; Shomron, Noam; Eisenberg, Eli

2012-01-01

Adenosine-to-inosine (A-to-I) editing modifies RNA transcripts from their genomic blueprint. A prerequisite for this process is a double-stranded RNA (dsRNA) structure. Such dsRNAs are formed as part of the microRNA (miRNA) maturation process, and it is therefore expected that miRNAs are affected by A-to-I editing. Editing of miRNAs has the potential to add another layer of complexity to gene regulation pathways, especially if editing occurs within the miRNA–mRNA recognition site. Thus, it is of interest to study the extent of this phenomenon. Current reports in the literature disagree on its extent; while some reports claim that it may be widespread, others deem the reported events as rare. Utilizing a next-generation sequencing (NGS) approach supplemented by an extensive bioinformatic analysis, we were able to systematically identify A-to-I editing events in mature miRNAs derived from human brain tissues. Our algorithm successfully identified many of the known editing sites in mature miRNAs and revealed 17 novel human sites, 12 of which are in the recognition sites of the miRNAs. We confirmed most of the editing events using in vitro ADAR overexpression assays. The editing efficiency of most sites identified is very low. Similar results are obtained for publicly available data sets of mouse brain-regions tissues. Thus, we find that A-to-I editing does alter several miRNAs, but it is not widespread. PMID:22499667

Effective gene editing by high-fidelity base editor 2 in mouse zygotes

Directory of Open Access Journals (Sweden)

Puping Liang

2017-06-01

Full Text Available ABSTRACT Targeted point mutagenesis through homologous recombination has been widely used in genetic studies and holds considerable promise for repairing disease-causing mutations in patients. However, problems such as mosaicism and low mutagenesis efficiency continue to pose challenges to clinical application of such approaches. Recently, a base editor (BE system built on cytidine (C deaminase and CRISPR/Cas9 technology was developed as an alternative method for targeted point mutagenesis in plant, yeast, and human cells. Base editors convert C in the deamination window to thymidine (T efficiently, however, it remains unclear whether targeted base editing in mouse embryos is feasible. In this report, we generated a modified high-fidelity version of base editor 2 (HF2-BE2, and investigated its base editing efficacy in mouse embryos. We found that HF2-BE2 could convert C to T efficiently, with up to 100% biallelic mutation efficiency in mouse embryos. Unlike BE3, HF2-BE2 could convert C to T on both the target and non-target strand, expanding the editing scope of base editors. Surprisingly, we found HF2-BE2 could also deaminate C that was proximal to the gRNA-binding region. Taken together, our work demonstrates the feasibility of generating point mutations in mouse by base editing, and underscores the need to carefully optimize base editing systems in order to eliminate proximal-site deamination.

Synthesis of disodium [benzene-U-{sup 14}C]-(4-chlorophenylthio)methylenediphosphonate, [benzene-U-{sup 14}C]-tiludronate

Energy Technology Data Exchange (ETDEWEB)

Burgos, Alain; Ellames, G.J. [Alnwick Research Centre (United Kingdom). Dept. of Metabolism and Pharmacokinetics

1995-12-31

Disodium [benzene-U-{sup 14}C]-(4-chlorophenylithio)methylenediphosphonate, [benzene-{sup 14}C]-Tiludronate, 2, has been prepared in six steps from [benzene-U-{sup 14}C]-acetanilide in an overall radiochemical yield of 41%. A key step in this transformation was the efficient conversion of [U-{sup 14}C]-4-chloroaniline to [benzene-U-{sup 14}C]-4-chlorophenylthiocyanate, 5, in 83% yield by treatment of the corresponding diazonium salt, 9 with iron(111) thiocyanate. It should be noted that formation of the isomeric [benzene-U-{sup 14}C]-4-chlorophenylisothiocyanate, 11, as a byproduct, was observed in only {approx} 1% yield. (author).

Comparison of Various Nuclear Localization Signal-Fused Cas9 Proteins and Cas9 mRNA for Genome Editing in Zebrafish.

Science.gov (United States)

Hu, Peinan; Zhao, Xueying; Zhang, Qinghua; Li, Weiming; Zu, Yao

2018-03-02

The clustered regularly interspaced short palindromic repeats (CRISPR)/Cas9 system has been proven to be an efficient and precise genome editing technology in various organisms. However, the gene editing efficiencies of Cas9 proteins with a nuclear localization signal (NLS) fused to different termini and Cas9 mRNA have not been systematically compared. Here, we compared the ability of Cas9 proteins with NLS fused to the N-, C-, or both the N- and C-termini and N-NLS-Cas9-NLS-C mRNA to target two sites in the tyr gene and two sites in the gol gene related to pigmentation in zebrafish. Phenotypic analysis revealed that all types of Cas9 led to hypopigmentation in similar proportions of injected embryos. Genome analysis by T7 Endonuclease I (T7E1) assays demonstrated that all types of Cas9 similarly induced mutagenesis in four target sites. Sequencing results further confirmed that a high frequency of indels occurred in the target sites ( tyr1 > 66%, tyr2 > 73%, gol1 > 50%, and gol2 > 35%), as well as various types (more than six) of indel mutations observed in all four types of Cas9-injected embryos. Furthermore, all types of Cas9 showed efficient targeted mutagenesis on multiplex genome editing, resulting in multiple phenotypes simultaneously. Collectively, we conclude that various NLS-fused Cas9 proteins and Cas9 mRNAs have similar genome editing efficiencies on targeting single or multiple genes, suggesting that the efficiency of CRISPR/Cas9 genome editing is highly dependent on guide RNAs (gRNAs) and gene loci. These findings may help to simplify the selection of Cas9 for gene editing using the CRISPR/Cas9 system. Copyright © 2018 Hu et al.

INVESTIGATION OF HOLOCENE FAULTING PROPOSED C-746-U LANDFILL EXPANSION

Energy Technology Data Exchange (ETDEWEB)

Lettis, William [William Lettis & Associates, Inc.

2006-07-01

This report presents the findings of a fault hazard investigation for the C-746-U landfill's proposed expansion located at the Department of Energy's (DOE) Paducah Gaseous Diffusion Plant (PGDP), in Paducah, Kentucky. The planned expansion is located directly north of the present-day C-746-U landfill. Previous geophysical studies within the PGDP site vicinity interpret possible northeast-striking faults beneath the proposed landfill expansion, although prior to this investigation the existence, locations, and ages of these inferred faults have not been confirmed through independent subsurface exploration. The purpose of this investigation is to assess whether or not Holocene-active fault displacement is present beneath the footprint of the proposed landfill expansion.

Method of preparing D-mannose(U-14C) from glucons(U-14C) separated from natural material

International Nuclear Information System (INIS)

Kucar, S.; Zemek, J.; Bilik, V.; Kolina, J.

1981-01-01

Glucans(U- 14 C) separated from green or blue-green algae are hydrolysed using diluted mineral acids in the presence of small amounts of molybdate ions to D-glucose(U- 14 C) which, at a temperature of 60 to 100 degC epimerizes to D-mannose(U- 14 C). The epimeric aldoses are separated from the reaction mixture by paper chromatography. (H.S.)

Cinema as a site of memory: thoughts from amateur Super-8 films re-edited in the short film 'Supermemórias'

Directory of Open Access Journals (Sweden)

Maíra Magalhães Bosi

2016-07-01

Full Text Available This paper aims to study amateur films, made in a private context, as a powerful way of creating memory. To do so, we first present a theoretical analisys on the idea of “sites os memory” (Nora 1984 and also on the desire to protect memory, that calls to action the amateur filmmaker. At least, we analyze two Super-8 amateur films produced in Fortaleza (Brazil, in 1978, which were re-edited in the short movie Supermemorias (Danilo Carvalho, 2010. This analysis evidences to us the editing process as a way of constructing new sites of memory and also allow us to reafirm that the amateur film production can instigate interesting and relevant contemporary investigations.

New Synthesis of nZVI/C Composites as an Efficient Adsorbent for the Uptake of U(VI) from Aqueous Solutions.

Science.gov (United States)

Liu, Haibo; Li, Mengxue; Chen, Tianhu; Chen, Changlun; Alharbi, Njud S; Hayat, Tasawar; Chen, Dong; Zhang, Qiang; Sun, Yubing

2017-08-15

New nanoscale zerovalent iron/carbon (nZVI/C) composites were successfully prepared via heating natural hematite and pine sawdust at 800 °C under nitrogen conditions. Characterization by SEM, XRD, FTIR, and XPS analyses indicated that the as-prepared nZVI/C composites contained a large number of reactive sites. The lack of influence of the ionic strength revealed inner-sphere complexation dominated U(VI) uptake by the nZVI/C composites. Simultaneous adsorption and reduction were involved in the uptake process of U(VI) according to the results of XPS and XANES analyses. The presence of U-C/U-U shells demonstrated that innersphere complexation and surface coprecipitation dominated the U(VI) uptake at low and high pH conditions, respectively. The uptake behaviors of U(VI) by the nZVI/C composites were fitted well by surface complexation modeling with two weak and two strong sites. The maximum uptake capacity of U(VI) by the nZVI/C composites was 186.92 mg/g at pH 4.0 and 328 K. Additionally, the nZVI/C composites presented good recyclability and recoverability for U(VI) uptake in regeneration experiments. These observations indicated that the nZVI/C composites can be considered as potential adsorbents to remove radionuclides for environmental remediation.

Nuclease Target Site Selection for Maximizing On-target Activity and Minimizing Off-target Effects in Genome Editing

Science.gov (United States)

Lee, Ciaran M; Cradick, Thomas J; Fine, Eli J; Bao, Gang

2016-01-01

The rapid advancement in targeted genome editing using engineered nucleases such as ZFNs, TALENs, and CRISPR/Cas9 systems has resulted in a suite of powerful methods that allows researchers to target any genomic locus of interest. A complementary set of design tools has been developed to aid researchers with nuclease design, target site selection, and experimental validation. Here, we review the various tools available for target selection in designing engineered nucleases, and for quantifying nuclease activity and specificity, including web-based search tools and experimental methods. We also elucidate challenges in target selection, especially in predicting off-target effects, and discuss future directions in precision genome editing and its applications. PMID:26750397

Evolutionary analysis reveals regulatory and functional landscape of coding and non-coding RNA editing.

Science.gov (United States)

Zhang, Rui; Deng, Patricia; Jacobson, Dionna; Li, Jin Billy

2017-02-01

Adenosine-to-inosine RNA editing diversifies the transcriptome and promotes functional diversity, particularly in the brain. A plethora of editing sites has been recently identified; however, how they are selected and regulated and which are functionally important are largely unknown. Here we show the cis-regulation and stepwise selection of RNA editing during Drosophila evolution and pinpoint a large number of functional editing sites. We found that the establishment of editing and variation in editing levels across Drosophila species are largely explained and predicted by cis-regulatory elements. Furthermore, editing events that arose early in the species tree tend to be more highly edited in clusters and enriched in slowly-evolved neuronal genes, thus suggesting that the main role of RNA editing is for fine-tuning neurological functions. While nonsynonymous editing events have been long recognized as playing a functional role, in addition to nonsynonymous editing sites, a large fraction of 3'UTR editing sites is evolutionarily constrained, highly edited, and thus likely functional. We find that these 3'UTR editing events can alter mRNA stability and affect miRNA binding and thus highlight the functional roles of noncoding RNA editing. Our work, through evolutionary analyses of RNA editing in Drosophila, uncovers novel insights of RNA editing regulation as well as its functions in both coding and non-coding regions.

Towards an Accurate Orbital Calibration of Late Miocene Climate Events: Insights From a High-Resolution Chemo- and Magnetostratigraphy (8-6 Ma) from Equatorial Pacific IODP Sites U1337 and U1338

Science.gov (United States)

Drury, A. J.; Westerhold, T.; Frederichs, T.; Wilkens, R.; Channell, J. E. T.; Evans, H. F.; Hodell, D. A.; John, C. M.; Lyle, M. W.; Roehl, U.; Tian, J.

2015-12-01

In the 8-6 Ma interval, the late Miocene is characterised by a long-term -0.3 ‰ reduction in benthic foraminiferal δ18O and distinctive short-term δ18O cycles, possibly related to dynamic Antarctic ice sheet variability. In addition, the late Miocene carbon isotope shift (LMCIS) marks a permanent long-term -1 ‰ shift in oceanic δ13CDIC, which is the largest, long-term perturbation in the global marine carbon cycle since the mid Miocene Monterey excursion. Accurate age control is crucial to investigate the origin of the δ18O cyclicity and determine the precise onset of the LMCIS. The current Geological Time Scale in the 8-6 Ma interval is constructed using astronomical tuning of sedimentary cycles in Mediterranean outcrops. However, outside of the Mediterranean, a comparable high-resolution chemo-, magneto-, and cyclostratigraphy at a single DSDP/ODP/IODP site does not exist. Generating an accurate astronomically-calibrated chemo- and magneto-stratigraphy in the 8-6 Ma interval became possible with retrieval of equatorial Pacific IODP Sites U1337 and U1338, as both sites have sedimentation rates ~2 cm/kyr, high biogenic carbonate content, and magnetic polarity stratigraphies. Here we present high-resolution correlation of Sites U1337 and U1338 using Milankovitch-related cycles in core images and X-ray fluorescence core scanning data. By combining inclination and declination data from ~400 new discrete samples with shipboard measurements, we are able to identify 14 polarity reversals at Site U1337 from the young end of Chron C3An.1n (~6.03 Ma) to the onset of Chron C4n.2n (~8.11 Ma). New high-resolution (<1.5 kyr) stable isotope records from Site U1337 correlate highly with Site U1338 records, enabling construction of a high-resolution stack. Initial orbital tuning of the U1337-U1338 records show that the δ18O cyclicity is obliquity driven, indicating high-latitude climate forcing. The LMCIS starts ~7.55 Ma and is anchored in Chron C4n.1n, which is

REDIdb 3.0: A Comprehensive Collection of RNA Editing Events in Plant Organellar Genomes.

Science.gov (United States)

Lo Giudice, Claudio; Pesole, Graziano; Picardi, Ernesto

2018-01-01

RNA editing is an important epigenetic mechanism by which genome-encoded transcripts are modified by substitutions, insertions and/or deletions. It was first discovered in kinetoplastid protozoa followed by its reporting in a wide range of organisms. In plants, RNA editing occurs mostly by cytidine (C) to uridine (U) conversion in translated regions of organelle mRNAs and tends to modify affected codons restoring evolutionary conserved aminoacid residues. RNA editing has also been described in non-protein coding regions such as group II introns and structural RNAs. Despite its impact on organellar transcriptome and proteome complexity, current primary databases still do not provide a specific field for RNA editing events. To overcome these limitations, we developed REDIdb a specialized database for RNA editing modifications in plant organelles. Hereafter we describe its third release containing more than 26,000 events in a completely novel web interface to accommodate RNA editing in its genomics, biological and evolutionary context through whole genome maps and multiple sequence alignments. REDIdb is freely available at http://srv00.recas.ba.infn.it/redidb/index.html.

REDIdb 3.0: A Comprehensive Collection of RNA Editing Events in Plant Organellar Genomes

Directory of Open Access Journals (Sweden)

Claudio Lo Giudice

2018-04-01

Full Text Available RNA editing is an important epigenetic mechanism by which genome-encoded transcripts are modified by substitutions, insertions and/or deletions. It was first discovered in kinetoplastid protozoa followed by its reporting in a wide range of organisms. In plants, RNA editing occurs mostly by cytidine (C to uridine (U conversion in translated regions of organelle mRNAs and tends to modify affected codons restoring evolutionary conserved aminoacid residues. RNA editing has also been described in non-protein coding regions such as group II introns and structural RNAs. Despite its impact on organellar transcriptome and proteome complexity, current primary databases still do not provide a specific field for RNA editing events. To overcome these limitations, we developed REDIdb a specialized database for RNA editing modifications in plant organelles. Hereafter we describe its third release containing more than 26,000 events in a completely novel web interface to accommodate RNA editing in its genomics, biological and evolutionary context through whole genome maps and multiple sequence alignments. REDIdb is freely available at http://srv00.recas.ba.infn.it/redidb/index.html

USH2A Gene Editing Using the CRISPR System

Directory of Open Access Journals (Sweden)

Carla Fuster-García

2017-09-01

Full Text Available Usher syndrome (USH is a rare autosomal recessive disease and the most common inherited form of combined visual and hearing impairment. Up to 13 genes are associated with this disorder, with USH2A being the most prevalent, due partially to the recurrence rate of the c.2299delG mutation. Excluding hearing aids or cochlear implants for hearing impairment, there are no medical solutions available to treat USH patients. The repair of specific mutations by gene editing is, therefore, an interesting strategy that can be explored using the CRISPR/Cas9 system. In this study, this method of gene editing is used to target the c.2299delG mutation on fibroblasts from an USH patient carrying the mutation in homozygosis. Successful in vitro mutation repair was demonstrated using locus-specific RNA-Cas9 ribonucleoproteins with subsequent homologous recombination repair induced by an engineered template supply. Effects on predicted off-target sites in the CRISPR-treated cells were discarded after a targeted deep-sequencing screen. The proven effectiveness and specificity of these correction tools, applied to the c.2299delG pathogenic variant of USH2A, indicates that the CRISPR system should be considered to further explore a potential treatment of USH. Keywords: Usher syndrome, USH2A, c.2299delG, CRISPR, gene editing, RNPs

Identification of Site Selection Factors in the U.S. Franchise Restaurant Industry: An Exploratory Study

OpenAIRE

Park, Kunsoon

2002-01-01

The purpose of this study was to identify and rank the importance of the site selection factors that influence the U.S. franchise restaurant industry as well as rank the confidence level of the experts. To identify the site selection factors, this study sought assistance and support from restaurant professionals. The Delphi technique was used to elicit the opinions of a panel of experts regarding the site selection factors. The panel was composed of restaurant professionals of restaurant c...

Nevada National Security Site. Site-Directed Research and Development FY 2011 Annual Report

International Nuclear Information System (INIS)

Bender, Howard

2012-01-01

This fiscal year 2011 annual report of the Site-Directed Research and Development program, the 10th anniversary edition, recognizes a full decade of innovative R and D accomplishments in support of the Nevada National Security Site (NNSS). Last year the NNSS itself was renamed to reflect a diversifying mission, and our R and D program has contributed significantly to shape emerging missions that will continue to evolve. New initiatives in stockpile stewardship science, nonproliferation, and treaty verification and monitoring have had substantial successes in FY 2011, and many more accomplishments are expected. SDRD is the cornerstone on which many of these initiatives rest. Historically supporting our main focus areas, SDRD is also building a solid foundation for new, and non-traditional, emerging national security missions. The program continues its charter to advance science and technology for a broad base of agencies including the U.S. Department of Energy (DOE), U.S. Department of Defense (DoD), U.S. Department of Homeland Security (DHS), and many others.

ADAR RNA editing in human disease; more to it than meets the I.

Science.gov (United States)

Gallo, Angela; Vukic, Dragana; Michalík, David; O'Connell, Mary A; Keegan, Liam P

2017-09-01

We review the structures and functions of ADARs and their involvements in human diseases. ADAR1 is widely expressed, particularly in the myeloid component of the blood system, and plays a prominent role in promiscuous editing of long dsRNA. Missense mutations that change ADAR1 residues and reduce RNA editing activity cause Aicardi-Goutières Syndrome, a childhood encephalitis and interferonopathy that mimics viral infection and resembles an extreme form of Systemic Lupus Erythmatosus (SLE). In Adar1 mouse mutant models aberrant interferon expression is prevented by eliminating interferon activation signaling from cytoplasmic dsRNA sensors, indicating that unedited cytoplasmic dsRNA drives the immune induction. On the other hand, upregulation of ADAR1 with widespread promiscuous RNA editing is a prominent feature of many cancers and particular site-specific RNA editing events are also affected. ADAR2 is most highly expressed in brain and is primarily required for site-specific editing of CNS transcripts; recent findings indicate that ADAR2 editing is regulated by neuronal excitation for synaptic scaling of glutamate receptors. ADAR2 is also linked to the circadian clock and to sleep. Mutations in ADAR2 could contribute to excitability syndromes such as epilepsy, to seizures, to diseases involving neuronal plasticity defects, such as autism and Fragile-X Syndrome, to neurodegenerations such as ALS, or to astrocytomas or glioblastomas in which reduced ADAR2 activity is required for oncogenic cell behavior. The range of human disease associated with ADAR1 mutations may extend further to include other inflammatory conditions while ADAR2 mutations may affect psychiatric conditions.

Synthesis of [3-14C]- and [phenyl-U-14C] olaquindox

International Nuclear Information System (INIS)

Maul, W.; Scherling, D.; Seng, F.

1981-01-01

Olaquindox is a new feed additive. [ 14 C]Olaquindox, labelled in different positions, was needed for tracer-studies of pharmacokinetics, biotransformation and residues in several species of animals. 2-[N-(2-hydroxethyl)-carbamoyl]-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide([3- 14 C]Olaquindox) was synthesized from barium[ 14 C]carbonate (22 mmoles; 1.15 Ci) via [1- 14 C]acetic acid, sodium[1- 14 C]acetate, [1- 14 C]acetylchloride, ethyl[3- 14 C]acetoacetate and 2-carbethoxy-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide with an overall yield of 10%, based on barium[ 14 C]carbonate. The radiochemical purity was better than 98% (tlc). The specific activities of three preparations were 10.5, 8.4 and 5.45 μCi/mg respectively. [phenyl-U- 14 C]Olaquindox was synthesized starting from [U- 14 C]aniline (19.8 mmoles; 284.4 mCi). Intermediate products were N-acetyl[U- 14 C]aniline, 2-nitro-N-acetyl[U- 14 C]aniline, 2-nitro[U- 14 C]aniline and [U- 14 C]benzofurazanoxide. The total yield was 50% as calculated for [U- 14 C]aniline. At calibration samples of two preparations showed specific activities of 49.5 and 11.1 μCi/mg respectively. The radiochemical purity was checked by tlc and exceeded 98%. (author)

Damage estimates for European and U.S.sites using the U.S. high-cycle fatigue data base

Energy Technology Data Exchange (ETDEWEB)

Sutherland, H J [Wind Energy Technology, Sandia National Lab., Albuquerque, NM (United States)

1996-09-01

This paper uses two high-cycle fatigue data bases, one for typical U.S. blade materials and one for European materials, to analyze the service lifetime of a wind turbine blade subjected to the WISPER load spectrum for northern European sites and the WISPER protocol load spectrum for U.S. wind farm sites. The U.S. data base contains over 2200 data points that were obtained using coupon testing procedures. These data are used to construct a Goodman diagram that is suitable for analyzing wind turbine blades. This result is compared to the Goodman diagram derived from the European fatigue data base FACT. The LIFE2 fatigue analysis code for wind turbines is then used to predict the service lifetime of a turbine blade subjected to the two loading histories. The results of this study indicate that the WISPER load spectrum from northern European sites significantly underestimates the WISPER protocol load spectrum from a U.S. wind farm site, i.e., the WISPER load spectrum significantly underestimates the number and magnitude of the loads observed at a U.S. wind farm site. Further, the analysis demonstrate that the European and the U.S. fatigue material data bases are in general agreement for the prediction of tensile failures. However, for compressive failures, the two data bases are significantly different, with the U.S. data base predicting significantly shorter service lifetimes than the European data base. (au) 14 refs.

The genome editing revolution

DEFF Research Database (Denmark)

Stella, Stefano; Montoya, Guillermo

2016-01-01

-Cas system has become the main tool for genome editing in many laboratories. Currently the targeted genome editing technology has been used in many fields and may be a possible approach for human gene therapy. Furthermore, it can also be used to modifying the genomes of model organisms for studying human......In the last 10 years, we have witnessed a blooming of targeted genome editing systems and applications. The area was revolutionized by the discovery and characterization of the transcription activator-like effector proteins, which are easier to engineer to target new DNA sequences than...... sequence). This ribonucleoprotein complex protects bacteria from invading DNAs, and it was adapted to be used in genome editing. The CRISPR ribonucleic acid (RNA) molecule guides to the specific DNA site the Cas9 nuclease to cleave the DNA target. Two years and more than 1000 publications later, the CRISPR...

Dicty_cDB: Contig-U07021-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U07021-1 no gap 601 2 3862699 3862098 MINUS 1 2 U07021 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U07021-1 Contig ID Contig-U07021-1 Contig update 2001. 8.30 Contig sequence >Contig-U07021-1 (Contig...-U07021-1Q) /CSM_Contig/Contig-U07021-1Q.Seq.d AAAAAAACAAAATGAATAAATTTAATATTACATCATTATTTATTATTTTA...TTTAATATATTCAGAAGGAAATTC TTATTTACAACAAAATTTCCCATTACTTTCTTANTTAAANTCCGTTAAAA T Gap no gap Contig length 601 C...QACCRTTQLFINYADNSFLDSAGFSPFGKVISGFNNTLNFYGGYGEEPDQSLIYSE GNSYLQQNFPLLSXLXSVK own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U15057-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( U58944 |pid:none) Dissostichus mawsoni AFGP antifreeze g... 44 0.012 C81265( C81265 )probable lipoprotein ...U43149_1( U43149 |pid:none) Dissostichus mawsoni antifreeze glycop... 36 3.2 ( P24856 ) RecName: Full=Ice-st

Dicty_cDB: Contig-U08861-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U08861-1 gap included 1295 5 2877914 2879217 PLUS 1 2 U08861 0 0 0 0 1 0 0 0 0 0 0 0 0 0 Show Contig...-U08861-1 Contig ID Contig-U08861-1 Contig update 2002. 9.13 Contig sequence >Contig-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861...CACATTATAAAGTACCAAATAAGTTATTAATTTTAGAAAATA AATTCCAAAGAATGCAATGTCTAAAGTTAATAAAAAAGAATACTAAAATA TTTTC Gap gap included Contig...k**iwsryccnhcl*kkqkttnef*r i*nql*tkistl*stk*vinfrk*ipknamskvnkkey*nif own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861-1Q.Seq.d (1305 letters) Database: C

Dicty_cDB: Contig-U09615-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09615-1 gap included 1134 3 4459395 4458259 MINUS 1 2 U09615 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09615-1 Contig ID Contig-U09615-1 Contig update 2002. 9.13 Contig sequence >Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U0961...TGCAAGATTAGAAAGATTAGAAAAAGATGCTATGCTAAAAATA Gap gap included Contig length 1134 Chromosome number (1..6, M) ...*wcnlyfrcre*emgkcn iefhiintrfkiwphrcidtighnvgicw**fnfecsfisleiqyrv**mgirfkyw*ww s*c*irpyfnnhafqyydyiwwskfwh*...4. 6.10 Homology vs CSM-cDNA Query= Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U09615-1Q.Seq.d (1

Fusion Canada issue 32. Final edition

International Nuclear Information System (INIS)

1997-07-01

Fusion Canada is a bulletin of the National Fusion Program, this is the last edition. Included in this July edition are articles on Funding for Canada's fusion program, Research and Development on TdeV-96 , Divertor Maintenance Robotics and reference listing for Canada's Fusion research and development sites

Site Release Report for C-Well Pipeline, UE-25 Large Rocks Test Site, and 29 GSF Test Pits

International Nuclear Information System (INIS)

K.E. Rasmuson

2002-01-01

The U.S. Department of Energy has implemented a program to reclaim lands disturbed by site characterization at Yucca Mountain. Long term goals of the program are to re-establish processes on disturbed sites that will lead to self-sustaining plant communities. The Biological Opinion for Yucca Mountain Site Characterization Studies required that the U.S. Department of Energy develop a Reclamation Standards and Monitoring Plan to evaluate the success of reclamation efforts. According to the Reclamation Standards and Monitoring Plan, reclaimed sites will be monitored periodically, remediated if necessary, and eventually compared to an appropriate reference area to determine whether reclamation goals have been achieved and the site can be released from further monitoring. Plant cover, density, and species richness (success parameters) on reclaimed sites are compared to 60 percent of the values (success criteria) for the same parameters on the reference area. Small sites (less than 0.1 ha) are evaluated for release using qualitative methods while large sites (greater than 0.1 ha) are evaluated using quantitative methods. In the summer of 2000, 31 small sites reclaimed in 1993 and 1994 were evaluated for reclamation success and potential release from further monitoring. Plant density, cover, and species richness were estimated on the C-Well Pipeline, UE-25 Large Rocks test site, and 29 ground surface facility test pits. Evidence of erosion, reproduction and natural recruitment, exotic species abundance, and animal use (key attributes) also were recorded for each site and used in success evaluations. The C-Well Pipeline and ground surface facility test pits were located in a ''Larrea tridentata - Ephedra nevadensis'' vegetation association while the UE-25 Large Rocks test site was located in an area dominated by ''Coleogyne ramosissima and Ephedra nevadensis''. Reference areas in the same vegetation associations with similar slope and aspect were chosen for comparison to

Site Release Reports for C-Well Pipeline, UE-25 Large Rocks Test Site, and 29 GSF Test Pits

Energy Technology Data Exchange (ETDEWEB)

K.E. Rasmuson

2002-04-02

The U.S. Department of Energy has implemented a program to reclaim lands disturbed by site characterization at Yucca Mountain. Long term goals of the program are to re-establish processes on disturbed sites that will lead to self-sustaining plant communities. The Biological Opinion for Yucca Mountain Site Characterization Studies required that the U.S. Department of Energy develop a Reclamation Standards and Monitoring Plan to evaluate the success of reclamation efforts. According to the Reclamation Standards and Monitoring Plan, reclaimed sites will be monitored periodically, remediated if necessary, and eventually compared to an appropriate reference area to determine whether reclamation goals have been achieved and the site can be released from further monitoring. Plant cover, density, and species richness (success parameters) on reclaimed sites are compared to 60 percent of the values (success criteria) for the same parameters on the reference area. Small sites (less than 0.1 ha) are evaluated for release using qualitative methods while large sites (greater than 0.1 ha) are evaluated using quantitative methods. In the summer of 2000, 31 small sites reclaimed in 1993 and 1994 were evaluated for reclamation success and potential release from further monitoring. Plant density, cover, and species richness were estimated on the C-Well Pipeline, UE-25 Large Rocks test site, and 29 ground surface facility test pits. Evidence of erosion, reproduction and natural recruitment, exotic species abundance, and animal use (key attributes) also were recorded for each site and used in success evaluations. The C-Well Pipeline and ground surface facility test pits were located in a ''Larrea tridentata - Ephedra nevadensis'' vegetation association while the UE-25 Large Rocks test site was located in an area dominated by ''Coleogyne ramosissima and Ephedra nevadensis''. Reference areas in the same vegetation associations with similar slope

Small RNA and A-to-I Editing in Autism Spectrum Disorders

Science.gov (United States)

Eran, Alal

One in every 88 children is diagnosed with Autism Spectrum Disorders (ASDs), a set of neurodevelopmental conditions characterized by social impairments, communication deficits, and repetitive behavior. ASDs have a substantial genetic component, but the specific cause of most cases remains unknown. Understanding gene-environment interactions underlying ASD is essential for improving early diagnosis and identifying critical targets for intervention and prevention. Towards this goal, we surveyed adenosine-to-inosine (A-to-I) RNA editing in autistic brains. A-to-I editing is an epigenetic mechanism that fine-tunes synaptic function in response to environmental stimuli, shown to modulate complex behavior in animals. We used ultradeep sequencing to quantify A-to-I receding of candidate synaptic genes in postmortem cerebella from individuals with ASD and neurotypical controls. We found unexpectedly wide distributions of human A-to-I editing levels, whose extremes were consistently populated by individuals with ASD. We correlated A-to-I editing with isoform usage, identified clusters of correlated sites, and examined differential editing patterns. Importantly, we found that individuals with ASD commonly use a dysfunctional form of the editing enzyme ADARB1. We next profiled small RNAs thought to regulate A-to-I editing, which originate from one of the most commonly altered loci in ASD, 15q11. Deep targeted sequencing of SNORD115 and SNORD116 transcripts enabled their high-resolution detection in human brains, and revealed a strong gender bias underlying their expression. The consistent 2-fold upregulation of 15q11 small RNAs in male vs. female cerebella could be important in delineating the role of this locus in ASD, a male dominant disorder. Overall, these studies provide an accurate population-level view of small RNA and A-to-I editing in human cerebella, and suggest that A-to-I editing of synaptic genes may be informative for assessing the epigenetic risk for autism

Convergence of exterior solutions to radial Cauchy solutions for $\\partial_t^2U-c^2\\Delta U=0$

Directory of Open Access Journals (Sweden)

Helge Kristian Jenssen

2016-09-01

Full Text Available Consider the Cauchy problem for the 3-D linear wave equation $\\partial_t^2U-c^2\\Delta U=0$ with radial initial data $U(0,x=\\Phi(x=\\varphi(|x|$, $U_t(0,x=\\Psi(x=\\psi(|x|$. A standard result states that $U$ belongs to $C([0,T];H^s(\\mathbb{R}^3$ whenever $(\\Phi,\\Psi\\in H^s\\times H^{s-1}(\\mathbb{R}^3$. In this article we are interested in the question of how U can be realized as a limit of solutions to initial-boundary value problems on the exterior of vanishing balls $B_\\varepsilon$ about the origin. We note that, as the solutions we compare are defined on different domains, the answer is not an immediate consequence of $H^s$ well-posedness for the wave equation.

Plutonium diffusion in advanced fuels (U,Pu)(C,O) and (U,Pu)(C,N)

International Nuclear Information System (INIS)

Bradbury, M.H.; Matzke, H.

1983-01-01

The self-diffusion of 238 Pu was measured in an oxicarbide (U,Pu)(C,O) and a carbonitride (U,Pu) (C,N). The activation enthalpies were 447 and 347 kJ mol -1 , respectively. The carbonitrides were confirmed to fall into three classes: carbide-like compositions with less than 30% nitrogen in the metalloid lattice, nitride-like composition with more than 70% nitrogen and with reduced atomic mobilities, and carbonitrides with about 50% nitrogen showing an intermediate behavior. The oxicarbide showed diffusion coefficients slightly larger than those of pure carbides

Editing modifies the GABA(A) receptor subunit alpha3

DEFF Research Database (Denmark)

Ohlson, Johan; Pedersen, Jakob Skou; Haussler, David

2007-01-01

Adenosine to inosine (A-to-I) pre-mRNA editing by the ADAR enzyme family has the potential to increase the variety of the proteome. This editing by adenosine deamination is essential in mammals for a functional brain. To detect novel substrates for A-to-I editing we have used an experimental method...... to find selectively edited sites and combined it with bioinformatic techniques that find stem-loop structures suitable for editing. We present here the first verified editing candidate detected by this screening procedure. We show that Gabra-3, which codes for the alpha3 subunit of the GABA(A) receptor......, is a substrate for editing by both ADAR1 and ADAR2. Editing of the Gabra-3 mRNA recodes an isoleucine to a methionine. The extent of editing is low at birth but increases with age, reaching close to 100% in the adult brain. We therefore propose that editing of the Gabra-3 mRNA is important for normal brain...

NCCI Medically Unlikely Edits (MUEs)

Data.gov (United States)

U.S. Department of Health & Human Services — Medically Unlikely Edits (MUEs) define for each HCPCS / CPT code the maximum units of service (UOS) that a provider would report under most circumstances for a...

EdiPy: a resource to simulate the evolution of plant mitochondrial genes under the RNA editing.

Science.gov (United States)

Picardi, Ernesto; Quagliariello, Carla

2006-02-01

EdiPy is an online resource appropriately designed to simulate the evolution of plant mitochondrial genes in a biologically realistic fashion. EdiPy takes into account the presence of sites subjected to RNA editing and provides multiple artificial alignments corresponding to both genomic and cDNA sequences. Each artificial data set can successively be submitted to main and widespread evolutionary and phylogenetic software packages such as PAUP, Phyml, PAML and Phylip. As an online bioinformatic resource, EdiPy is available at the following web page: http://biologia.unical.it/py_script/index.html.

Tracer experiment administering L-phenylalanine-U-14C and L-tyrosine-U-14C to the tissue slices of bamboo shoots

International Nuclear Information System (INIS)

Kozukue, E.; Mizuno, S.

1987-01-01

Uniformly 14 C-labeled L-phenylalanine and L-tyrosine were administered to tissue slices of both top and base sections of bamboo shoots. Alcohol soluble substances were extracted and then separated into organic acid, sugar and amino acid fractions by ion exchange chromatography. The homogentisic acid fraction among the organic acids was collected by high-performance liquid chromatography (HPLC) and its radioactivity was measured, while the alcohol insoluble residue was used for the analysis of lignin aldehyde by the method of alkaline nitrobenzene oxidation. 1. The two labeled amino acids were steadily incorporated into the tissues during incubation and rapidly converted to organic acid, sugar and alcohol insoluble residue, especially the latter. 2. On determining the amount of phenylalanine converted to tyrosine, it was found that this was extremely small. 3. The incorporation of phenylalanine-U- 14 C into alcohol insoluble residue was higher than that of tyrosine in both sections. 4. Although the conversion into lignin aldehyde from phenylalanine-U- 14 C was higher than that from tyrosine-U- 14 C, it was found that tyrosine incorporated into the shoots was converted to a remarkable extent for formation of lignin aldehyde. 5. The incorporation of phenylalanine and tyrosine into homogentisic acid was very low. From these results, we assume that the conversion of phenylalanine to tyrosine or of tyrosine to homogentisic acid is very small, and that a part of the high amount of tyrosine in the shoots may be used for formation of lignin

[Genome editing of industrial microorganism].

Science.gov (United States)

Zhu, Linjiang; Li, Qi

2015-03-01

Genome editing is defined as highly-effective and precise modification of cellular genome in a large scale. In recent years, such genome-editing methods have been rapidly developed in the field of industrial strain improvement. The quickly-updating methods thoroughly change the old mode of inefficient genetic modification, which is "one modification, one selection marker, and one target site". Highly-effective modification mode in genome editing have been developed including simultaneous modification of multiplex genes, highly-effective insertion, replacement, and deletion of target genes in the genome scale, cut-paste of a large DNA fragment. These new tools for microbial genome editing will certainly be applied widely, and increase the efficiency of industrial strain improvement, and promote the revolution of traditional fermentation industry and rapid development of novel industrial biotechnology like production of biofuel and biomaterial. The technological principle of these genome-editing methods and their applications were summarized in this review, which can benefit engineering and construction of industrial microorganism.

Electronic structure of C28, Pa at sign C28, and U at sign C28

International Nuclear Information System (INIS)

Zhao, K.; Pitzer, R.M.

1996-01-01

Electronic structure calculations, including relativistic core potentials and the spin-orbit interaction, have been carried out on the C 28 , Pa at sign C 28 , and U at sign C 28 species. Excitation energies, spin-orbit splittings, the electron affinity, and the ionization potential are computed for C 28 . The ground state of C 28 is described well by the Hartree-Fock wave functions, but other states are not. The computed electron affinity and ionization potential are similar to those of C 60 . Strong metal-cage binding is found for Pa at sign C 28 and U at sign C 28 , similar to that in U(C 8 H 8 ) 2 . The ground electronic states depend on the order of the lowest-energy cage π * and metal 5f orbitals, with (π * ) 1 and (π * ) 1 (5f) 1 found to be the ground electronic configurations for the two complexes. U at sign C 28 is found to be diamagnetic. 30 refs., 1 fig., 13 tabs

Spectrally edited 2D 13Csbnd 13C NMR spectra without diagonal ridge for characterizing 13C-enriched low-temperature carbon materials

Science.gov (United States)

Johnson, Robert L.; Anderson, Jason M.; Shanks, Brent H.; Fang, Xiaowen; Hong, Mei; Schmidt-Rohr, Klaus

2013-09-01

Two robust combinations of spectral editing techniques with 2D 13Csbnd 13C NMR have been developed for characterizing the aromatic components of 13C-enriched low-temperature carbon materials. One method (exchange with protonated and nonprotonated spectral editing, EXPANSE) selects cross peaks of protonated and nearby nonprotonated carbons, while the other technique, dipolar-dephased double-quantum/single-quantum (DQ/SQ) NMR, selects signals of bonded nonprotonated carbons. Both spectra are free of a diagonal ridge, which has many advantages: Cross peaks on the diagonal or of small intensity can be detected, and residual spinning sidebands or truncation artifacts associated with the diagonal ridge are avoided. In the DQ/SQ experiment, dipolar dephasing of the double-quantum coherence removes protonated-carbon signals; this approach also eliminates the need for high-power proton decoupling. The initial magnetization is generated with minimal fluctuation by combining direct polarization, cross polarization, and equilibration by 13C spin diffusion. The dipolar dephased DQ/SQ spectrum shows signals from all linkages between aromatic rings, including a distinctive peak from polycondensed aromatics. In EXPANSE NMR, signals of protonated carbons are selected in the first spectral dimension by short cross polarization combined with dipolar dephasing difference. This removes ambiguities of peak assignment to overlapping signals of nonprotonated and protonated aromatic carbons, e.g. near 125 ppm. Spin diffusion is enhanced by dipolar-assisted rotational resonance. Before detection, Csbnd H dipolar dephasing by gated decoupling is applied, which selects signals of nonprotonated carbons. Thus, only cross peaks due to magnetization originating from protonated C and ending on nearby nonprotonated C are retained. Combined with the chemical shifts deduced from the cross-peak position, this double spectral editing defines the bonding environment of aromatic, COO, and Cdbnd O carbons

Genome editing: a robust technology for human stem cells.

Science.gov (United States)

Chandrasekaran, Arun Pandian; Song, Minjung; Ramakrishna, Suresh

2017-09-01

Human pluripotent stem cells comprise induced pluripotent and embryonic stem cells, which have tremendous potential for biological and therapeutic applications. The development of efficient technologies for the targeted genome alteration of stem cells in disease models is a prerequisite for utilizing stem cells to their full potential. Genome editing of stem cells is possible with the help of synthetic nucleases that facilitate site-specific modification of a gene of interest. Recent advances in genome editing techniques have improved the efficiency and speed of the development of stem cells for human disease models. Zinc finger nucleases, transcription activator-like effector nucleases, and clustered regularly interspaced short palindromic repeats (CRISPR)/CRISPR-associated system are powerful tools for editing DNA at specific loci. Here, we discuss recent technological advances in genome editing with site-specific nucleases in human stem cells.

Comparison of Wechsler Memory Scale-Fourth Edition (WMS-IV) and Third Edition (WMS-III) dimensional structures: improved ability to evaluate auditory and visual constructs.

Science.gov (United States)

Hoelzle, James B; Nelson, Nathaniel W; Smith, Clifford A

2011-03-01

Dimensional structures underlying the Wechsler Memory Scale-Fourth Edition (WMS-IV) and Wechsler Memory Scale-Third Edition (WMS-III) were compared to determine whether the revised measure has a more coherent and clinically relevant factor structure. Principal component analyses were conducted in normative samples reported in the respective technical manuals. Empirically supported procedures guided retention of dimensions. An invariant two-dimensional WMS-IV structure reflecting constructs of auditory learning/memory and visual attention/memory (C1 = .97; C2 = .96) is more theoretically coherent than the replicable, heterogeneous WMS-III dimension (C1 = .97). This research suggests that the WMS-IV may have greater utility in identifying lateralized memory dysfunction.

Compact toroid injection into C-2U

Science.gov (United States)

Roche, Thomas; Gota, H.; Garate, E.; Asai, T.; Matsumoto, T.; Sekiguchi, J.; Putvinski, S.; Allfrey, I.; Beall, M.; Cordero, M.; Granstedt, E.; Kinley, J.; Morehouse, M.; Sheftman, D.; Valentine, T.; Waggoner, W.; the TAE Team

2015-11-01

Sustainment of an advanced neutral beam-driven FRC for a period in excess of 5 ms is the primary goal of the C-2U machine at Tri Alpha Energy. In addition, a criteria for long-term global sustainment of any magnetically confined fusion reactor is particle refueling. To this end, a magnetized coaxial plasma-gun has been developed. Compact toroids (CT) are to be injected perpendicular to the axial magnetic field of C-2U. To simulate this environment, an experimental test-stand has been constructed. A transverse magnetic field of B ~ 1 kG is established (comparable to the C-2U axial field) and CTs are fired across it. As a minimal requirement, the CT must have energy density greater than that of the magnetic field it is to penetrate, i.e., 1/2 ρv2 >=B2 / 2μ0 . This criteria is easily met and indeed the CTs traverse the test-stand field. A preliminary experiment on C-2U shows the CT also capable of penetrating into FRC plasmas and refueling is observed resulting in a 20 - 30% increase in total particle number per single-pulsed CT injection. Results from test-stand and C-2U experiments will be presented.

GRI baseline projection of U.S. energy supply and demand to 2010. 1992 edition

International Nuclear Information System (INIS)

Holtberg, P.D.; Woods, T.J.; Lihn, M.L.; Koklauner, A.B.

1992-04-01

The annual GRI baseline projection is the result of a complex modeling effort that seeks to achieve an internally consistent energy supply and demand outlook across all energy sources and end-use demand sectors. The year's projection includes the adoption of a new petroleum refinery methodology, the incorporation of a new approach to determining electric utility generating capacity heat rates, the extensive update of both the residential and commercial databases and methodologies, and the continued update of the GRI Hydrocarbon Model. The report presents a series of summary tables, sectoral breakdowns of energy demand, and the natural gas supply and price trends. The appendices include a discussion of the methodology and assumptions used to prepare the 1992 edition of the projection, an analysis of the potential for higher levels of gas demand, a description of industrial and commercial cogeneration, a description of the independent power producer projection, a comparison of the 1992 edition of the projection with previous GRI projections, and a discussion of additional data used in developing the projection

Genome editing for crop improvement: Challenges and opportunities.

Science.gov (United States)

Abdallah, Naglaa A; Prakash, Channapatna S; McHughen, Alan G

2015-01-01

Genome or gene editing includes several new techniques to help scientists precisely modify genome sequences. The techniques also enables us to alter the regulation of gene expression patterns in a pre-determined region and facilitates novel insights into the functional genomics of an organism. Emergence of genome editing has brought considerable excitement especially among agricultural scientists because of its simplicity, precision and power as it offers new opportunities to develop improved crop varieties with clear-cut addition of valuable traits or removal of undesirable traits. Research is underway to improve crop varieties with higher yields, strengthen stress tolerance, disease and pest resistance, decrease input costs, and increase nutritional value. Genome editing encompasses a wide variety of tools using either a site-specific recombinase (SSR) or a site-specific nuclease (SSN) system. Both systems require recognition of a known sequence. The SSN system generates single or double strand DNA breaks and activates endogenous DNA repair pathways. SSR technology, such as Cre/loxP and Flp/FRT mediated systems, are able to knockdown or knock-in genes in the genome of eukaryotes, depending on the orientation of the specific sites (loxP, FLP, etc.) flanking the target site. There are 4 main classes of SSN developed to cleave genomic sequences, mega-nucleases (homing endonuclease), zinc finger nucleases (ZFNs), transcriptional activator-like effector nucleases (TALENs), and the CRISPR/Cas nuclease system (clustered regularly interspaced short palindromic repeat/CRISPR-associated protein). The recombinase mediated genome engineering depends on recombinase (sub-) family and target-site and induces high frequencies of homologous recombination. Improving crops with gene editing provides a range of options: by altering only a few nucleotides from billions found in the genomes of living cells, altering the full allele or by inserting a new gene in a targeted region of

[CRISPR/Cas system for genome editing in pluripotent stem cells].

Science.gov (United States)

Vasil'eva, E A; Melino, D; Barlev, N A

2015-01-01

Genome editing systems based on site-specific nucleases became very popular for genome editing in modern bioengineering. Human pluripotent stem cells provide a unique platform for genes function study, disease modeling, and drugs testing. Consequently, technology for fast, accurate and well controlled genome manipulation is required. CRISPR/Cas (clustered regularly interspaced short palindromic repeat/CRISPR-associated) system could be employed for these purposes. This system is based on site-specific programmable nuclease Cas9. Numerous advantages of the CRISPR/Cas system and its successful application to human stem cells provide wide opportunities for genome therapy and regeneration medicine. In this publication, we describe and compare the main genome editing systems based on site-specific programmable nucleases and discuss opportunities and perspectives of the CRISPR/Cas system for application to pluripotent stem cells.

Environmental site description for a Uranium Atomic Vapor Laser Isotope Separation (U-AVLIS) production plant at the Paducah Gaseous Diffusion Plant site

International Nuclear Information System (INIS)

Marmer, G.J.; Dunn, C.P.; Moeller, K.L.; Pfingston, J.M.; Policastro, A.J.; Yuen, C.R.; Cleland, J.H.

1991-09-01

Uranium enrichment in the United States has utilized a diffusion process to preferentially enrich the U-235 isotope in the uranium product. The U-AVLIS process is based on electrostatic extraction of photoionized U-235 atoms from an atomic vapor stream created by electron-beam vaporization of uranium metal alloy. The U-235 atoms are ionized when precisely tuned laser light -- of appropriate power, spectral, and temporal characteristics -- illuminates the uranium vapor and selectively photoionizes the U-235 isotope. A programmatic document for use in screening DOE site to locate a U-AVLIS production plant was developed and implemented in two parts. The first part consisted of a series of screening analyses, based on exclusionary and other criteria, that identified a reasonable number of candidate sites. These sites were subjected to a more rigorous and detailed comparative analysis for the purpose of developing a short list of reasonable alternative sites for later environmental examination. This environmental site description (ESD) provides a detailed description of the PGDP site and vicinity suitable for use in an environmental impact statement (EIS). The report is based on existing literature, data collected at the site, and information collected by Argonne National Laboratory (ANL) staff during a site visit. 65 refs., 15 tabs

Environmental site description for a Uranium Atomic Vapor Laser Isotope Separation (U-AVLIS) production plant at the Paducah Gaseous Diffusion Plant site

Energy Technology Data Exchange (ETDEWEB)

Marmer, G.J.; Dunn, C.P.; Moeller, K.L.; Pfingston, J.M.; Policastro, A.J.; Yuen, C.R.; Cleland, J.H. (ed.)

1991-09-01

Uranium enrichment in the United States has utilized a diffusion process to preferentially enrich the U-235 isotope in the uranium product. The U-AVLIS process is based on electrostatic extraction of photoionized U-235 atoms from an atomic vapor stream created by electron-beam vaporization of uranium metal alloy. The U-235 atoms are ionized when precisely tuned laser light -- of appropriate power, spectral, and temporal characteristics -- illuminates the uranium vapor and selectively photoionizes the U-235 isotope. A programmatic document for use in screening DOE site to locate a U-AVLIS production plant was developed and implemented in two parts. The first part consisted of a series of screening analyses, based on exclusionary and other criteria, that identified a reasonable number of candidate sites. These sites were subjected to a more rigorous and detailed comparative analysis for the purpose of developing a short list of reasonable alternative sites for later environmental examination. This environmental site description (ESD) provides a detailed description of the PGDP site and vicinity suitable for use in an environmental impact statement (EIS). The report is based on existing literature, data collected at the site, and information collected by Argonne National Laboratory (ANL) staff during a site visit. 65 refs., 15 tabs.

Dicty_cDB: Contig-U06307-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06307-1 no gap 637 6 29174 29801 PLUS 4 5 U06307 4 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06307-1 Contig ID Contig-U06307-1 Contig update 2002. 9.13 Contig sequence >Contig-U06307-1 (Contig...-U06307-1Q) /CSM_Contig/Contig-U06307-1Q.Seq.d CCCGCGTCCGAATGCCTCGTATTTTACACACTATGCTCCGTGTGGGTAAT TTAG...ATAGTATTTTTATTTTATT CTTTTTCTTTTAAAAATTTTTTATATTGTCAACAATATAATCAAATAAAT GTATTTAATTATCGGGTATTAAAAAAAAAAAAAAAAA Gap no gap Contig...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06307-1 (Contig-U06307-1Q) /CSM_Contig/Contig-U063

38 CFR 3.363 - Bar to benefits under 38 U.S.C. 1151.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Bar to benefits under 38... Purposes § 3.363 Bar to benefits under 38 U.S.C. 1151. (a) Claims subject to this section. This section.... (b) Administrative award, compromises, or settlements, or judgments that bar benefits under 38 U.S.C...

Dicty_cDB: Contig-U15566-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15566-1 gap included 1830 4 3730704 3729599 MINUS 4 8 U15566 0 0 1 0 1 0 0 0 2 0 0 0 0 0 Show Contig...-U15566-1 Contig ID Contig-U15566-1 Contig update 2004. 6.11 Contig sequence >Contig-U15566-1 (Contig-U15566-1Q) /CSM_Contig/Contig-U1556...CAAGATCCAA TGGAATTTTAATAATAAATAAGAATAATAAAAAAAAAAAA Gap gap included Contig length 1830 Chromosome number (1...ITLTPSEDIEKKLKEI QDENLSNSEIWFAVKSYLEDNNLKEHLYNLVFHYTMPRIDEPVTIGLDHLGNVLVSNR*c tflvvvvvytfgcriephni*qerivlqf*...asilnhirvelsqnqipilkrsfdqillphfekc iieeqqiftnekqrknflsllpisykrqdrkipltpsediekklkeiqdenlsnseiwfa vksylednnlkehlynlvfhytmpridepvtig

Initial report for magnetostratigraphy of IODP Site U1490

Science.gov (United States)

Kumagai, Y.; Hatfield, R. G.; Nakamura, N.; Yamazaki, T.

2017-12-01

We report preliminary paleomagnetic results from between 175-296 meters composite depth (Miocene in age) of IODP Site U1490 recovered during Expedition 363. Site U1490 is located at 05°48.95´N, 142°39.27´E (the northern edge of the Eauripik Rise in the equatorial Pacific) in 2341 m water depth. A primary objective of Expedition 363 was to reconstruct the regional climate variability within the Western Pacific Warm Pool (WPWP) in a broad spatial coverage and different temporal resolutions through the time interval from the middle Miocene to late Pleistocene. The recovered pelagic sediments contains calcareous and siliceous nannofossils with varying proportions of clay and ash. It is also characterized by current-controlled mud waves with gradually decreasing amplitude upsection (Rosenthal et al., 2017). Since deep water is enriched in dissolved oxygen due to downwelling in polar regions, the mud waves were probably formed in an oxic environment by bottom currents, hindering the dissolution of magnetic minerals in the sediments. Shipboard analysis revealed that magnetic minerals between 20-175 m composite depth at Site U1490 have been dissolved by diagenetic alteration and the paleomagnetic data is uninterpretable. But the upper 20 m and below 175 m have a stable magnetization that spans from present to early Pleistocene (0-1.9 Ma) and middle to late Miocene period ( 9-19 Ma), respectively. The latter is an exceptionally long-time range continuous core sample, so it provides us an opportunity to reveal long-range variations of paleomagnetic field. We will show stepwise alternate-field (AF) demagnetization of the natural remanent magnetization on U-channel samples from the composite stratigraphic section to establish magnetostratigraphy at this site.

Dicty_cDB: Contig-U13065-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13065-1 no gap 718 1 3561021 3561729 PLUS 1 1 U13065 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U13065-1 Contig ID Contig-U13065-1 Contig update 2002.12.18 Contig sequence >Contig-U13065-1 (Contig...-U13065-1Q) /CSM_Contig/Contig-U13065-1Q.Seq.d NNNNNNNNNNCAATCAAAGCAATCAATGGTAAATTAACTTTGTTACCATT ...TGATTCAACTCTCTCTG TTTCAAATTTACAACTTGCTTTAGATGAATCCTTTGAAGTTGATTTTGTA TTATATTAAAAATTATCA Gap no gap Contig...kny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13065-1 (Contig-U13065-1Q) /CSM_Contig

Dicty_cDB: Contig-U15058-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15058-1 no gap 1987 4 4423139 4424727 PLUS 2 4 U15058 0 0 0 0 0 0 0 0 1 0 1 0 0 0 Show Contig...-U15058-1 Contig ID Contig-U15058-1 Contig update 2004. 6.11 Contig sequence >Contig-U15058-1 (Contig...-U15058-1Q) /CSM_Contig/Contig-U15058-1Q.Seq.d AAAAAAGGTTACTCACAAAGTTAAAGAAATCAATGAAAGATTTACCACCC...ACTCAAGGGGGTAGGAGAATAAAATCAACCGATTATCCAGGCNTTAAG CGACCTTTTTCCCAAAAAAAAAAGATGTTCAGAAAAT Gap no gap Contig len...srx*atffpkkkdvq k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15058-1 (Contig-U15058-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U09640-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09640-1 gap included 1368 2 219988 218635 MINUS 4 5 U09640 0 0 2 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U09640-1 Contig ID Contig-U09640-1 Contig update 2002. 9.13 Contig sequence >Contig-U09640-1 (Contig...-U09640-1Q) /CSM_Contig/Contig-U09640-1Q.Seq.d ACTGTTGGCCTACTGGNAAAAAATAGTGTAATAATAACCAACAAT...AACAACAACAACAAAAACAAAAACAAATTTTAATT AAATAAAATAATAATATAAAATATAATA Gap gap included Contig...ate 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09640-1 (Contig-U09640-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U14745-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14745-1 no gap 1780 6 3063854 3065579 PLUS 2 4 U14745 1 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14745-1 Contig ID Contig-U14745-1 Contig update 2002.12.18 Contig sequence >Contig-U14745-1 (Contig...-U14745-1Q) /CSM_Contig/Contig-U14745-1Q.Seq.d GCGTCCGGACAATTTCAATAAAACAAATTTAAAAATAAATAATTTTTAAT...AATAAAATA ATTTAAATAAAAAAATATTTATTTTATTTTAAGATTAACAAAATAAAATA ATTTAAATAAAAAAATATTTATTTTAAAGA Gap no gap Contig...k*kniyfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14745-1 (Contig-U14745-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U03367-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U03367-1 no gap 323 - - - - 2 1 U03367 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig-U03367-1 Contig... ID Contig-U03367-1 Contig update 2001. 8.29 Contig sequence >Contig-U03367-1 (Contig-U03367-1Q) /CSM_Contig/Contig...TTGCGGGTTGGCAGGACTGTNGGNAGGCATGGNCATCGGTATNNTTGGAG ATGCTNGTGTGAGGGCGAATGCT Gap no gap Contig length 323 Chro...HLXXGLXCGLAGLXXGMXIGXXGDAXVRANA own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U03367-1 (Contig...-U03367-1Q) /CSM_Contig/Contig-U03367-1Q.Seq.d (323 letters) Database: CSM 6905 sequ

Dicty_cDB: Contig-U16086-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16086-1 gap included 1018 - - - - 3 4 U16086 0 0 0 0 0 1 1 0 0 0 1 0 0 0 Show Contig-U16086-1 Contig... ID Contig-U16086-1 Contig update 2004. 6.11 Contig sequence >Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig.../Contig-U16086-1Q.Seq.d AATTTGATGAAGTAGTAGTAGAGGTAAAACATGTATCAAAACATTATAAG ATTGCAGG...ACTTGGATATAAATGAAG GTAGCTCATCAAATTTTTCAAATAATGATAATTTTAAATCGGTAGATCAA ATTACCAATGACCTTAGCCGTATTTTAT Gap gap included Contig...KSVDQI TNDLSRIL own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U13737-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13737-1 no gap 672 6 1762420 1761754 MINUS 1 1 U13737 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13737-1 Contig ID Contig-U13737-1 Contig update 2002.12.18 Contig sequence >Contig-U13737-1 (Contig...-U13737-1Q) /CSM_Contig/Contig-U13737-1Q.Seq.d NNNNNNNNNNAAAATTAGAAAATGGTACAATTGTTTTTAGAGATATTTCA...AGAATAGAAGGAAAATAT AGATCAATGGGGTGGCACAACA Gap no gap Contig length 672 Chromosome...gwhn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13737-1 (Contig-U13737-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U15541-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15541-1 gap included 2750 - - - - 634 1127 U15541 1 129 1 375 19 0 2 32 4 69 1 0 1 0 Show Contig...-U15541-1 Contig ID Contig-U15541-1 Contig update 2004. 6.11 Contig sequence >Contig-U15541-1 (Contig...-U15541-1Q) /CSM_Contig/Contig-U15541-1Q.Seq.d ATAATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTAG...AAAAAT AAAAATAAAAATAAATAAATAATCATTTCATATTAATATTTTTTTTTATT TTTAAAAAAA Gap gap included Contig...ffyf*k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15541-1 (Contig-U15541-1Q) /CSM_Contig/Contig

Spatio-temporal regulation of ADAR editing during development in porcine neural tissues

DEFF Research Database (Denmark)

Venø, Morten Trillingsgaard; Bramsen, Jesper Bertram; Bendixen, Christian

2012-01-01

Editing by ADAR enzymes is essential for mammalian life. Still, knowledge of the spatio-temporal editing patterns in mammals is limited. By use of 454 amplicon sequencing we examined the editing status of 12 regionally extracted mRNAs from porcine developing brain encompassing a total of 64...... putative ADAR editing sites. In total 24 brain tissues, dissected from up to five regions from embryonic gestation day 23, 42, 60, 80, 100 and 115, were examined for editing....

Dicty_cDB: Contig-U01997-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01997-1 gap included 886 2 1683026 1682230 MINUS 3 4 U01997 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U01997-1 Contig ID Contig-U01997-1 Contig update 2001. 8.29 Contig sequence >Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig/Contig-U01997...ATTGAAATAATATTTATTTATTTTTTTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap gap included Contig...nfkvfgieiifiyffkkkkkkkkkkkkkkkkkkk own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig.../Contig-U01997-1Q.Seq.d (896 letters) Database: CSM 6905 sequences; 5,674,871 total l

Dicty_cDB: Contig-U13254-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13254-1 no gap 575 5 203798 203233 MINUS 1 1 U13254 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U13254-1 Contig ID Contig-U13254-1 Contig update 2002.12.18 Contig sequence >Contig-U13254-1 (Contig...-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d AAATAATTTATTTAATTTTAAAATTAATAGATAAAAAGATGGAAATGATA A...CATTTTAACATTATTGGATAAT GTCAATGATTGGCCAANNNNNNNNN Gap no gap Contig length 575 Chromosome number (1..6, M) 5 ...2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13254-1 (Contig-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d

Dicty_cDB: Contig-U13891-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13891-1 no gap 1355 6 799802 798446 MINUS 4 4 U13891 0 0 0 0 1 1 1 0 0 0 1 0 0 0 Show Contig...-U13891-1 Contig ID Contig-U13891-1 Contig update 2002.12.18 Contig sequence >Contig-U13891-1 (Contig...-U13891-1Q) /CSM_Contig/Contig-U13891-1Q.Seq.d TTTTAAAATATTTCAAAATTAGCGAGCACGCATTCGCATATAAATATATT ...ACAAATAAAAAAAAAAAATAAAAAAAATA ATTTA Gap no gap Contig length 1355 Chromosome numb...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13891-1 (Contig-U13891-1Q) /CSM_Contig/Contig-U138

Dicty_cDB: Contig-U16093-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16093-1 gap included 1020 2 4899973 4899063 MINUS 29 31 U16093 7 0 0 0 0 2 ...18 0 0 0 0 0 2 0 Show Contig-U16093-1 Contig ID Contig-U16093-1 Contig update 2004. 6.11 Contig sequence >Contig-U16093-1 (Contig...-U16093-1Q) /CSM_Contig/Contig-U16093-1Q.Seq.d TTTTTTTTTTTTTTTTTAATTTTTTTTTTTCATAAAACTT...AAAATTAAATT Gap gap included Contig length 1020 Chromosome number (1..6, M) 2 Chr...pdate 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16093-1 (Contig-U16093-1Q) /CSM_Contig/Contig-U16093-1Q

Dicty_cDB: Contig-U06384-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06384-1 no gap 660 5 3008439 3007779 MINUS 2 2 U06384 2 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06384-1 Contig ID Contig-U06384-1 Contig update 2001. 8.30 Contig sequence >Contig-U06384-1 (Contig...-U06384-1Q) /CSM_Contig/Contig-U06384-1Q.Seq.d TGAAAAAATTAGAGACAACAAGTGGATCAGCACGTAAAGTATGGCGTTTA...AAATAAAAATTAATTTCC AAAAATAAAA Gap no gap Contig length 660 Chromosome number (1.....own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06384-1 (Contig-U06384-1Q) /CSM_Contig/Contig-U063

Dicty_cDB: Contig-U12545-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s

Dicty_cDB: Contig-U10823-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10823-1 gap included 1750 1 3559501 3561234 PLUS 85 124 U10823 0 5 0 30 1 0... 0 20 0 29 0 0 0 0 Show Contig-U10823-1 Contig ID Contig-U10823-1 Contig update 2002.12.18 Contig sequence >Contig-U10823-1 (Contig...-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d ACTGTTGGCCTACTGGTATTTTTGGTAGTGTGTTAAAA...CAACAAATAAAATTAAAATTA GTTATATTTTTTTTAAATTAAAAAAAAAAATAAAAAAAATAAATTATTTA TTAAATTTTT Gap gap included Contig ...4. 6.10 Homology vs CSM-cDNA Query= Contig-U10823-1 (Contig-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d (1

Tokamaks (Second Edition)

Energy Technology Data Exchange (ETDEWEB)

Stott, Peter [JET, UK (United Kingdom)

1998-10-01

The first edition of John Wesson's book on tokamaks, published in 1987, established itself as essential reading for researchers in the field of magnetic confinement fusion: it was an excellent introduction for students to tokamak physics and also a valuable reference work for the more experienced. The second edition, published in 1997, has been completely rewritten and substantially enlarged (680 pages compared with 300). The new edition maintains the aim of providing a simple introduction to basic tokamak physics, but also includes discussion of the substantial advances in fusion research during the past decade. The new book, like its predecessor, is well written and commendable for its clarity and accuracy. In fact many of the chapters are written by a series of co-authors bringing the benefits of a wide range of expertise but, by careful editing, Wesson has maintained a uniformity of style and presentation. The chapter headings and coverage for the most part remain the same - but are expanded considerably and brought up to date. The most substantial change is that the single concluding chapter in the first edition on 'Experiments' has been replaced by three chapters: 'Tokamak experiments' which deals with some of the earlier key experiments plus a selection of recent small and medium-sized devices, 'Large experiments' which gives an excellent summary of the main results from the four large tokamaks - TFTR, JET, JT60/JT60U and DIII-D, and 'The future' which gives a very short (possibly too short in my opinion) account of reactors and ITER. This is an excellent book, which I strongly recommend should have a place - on the desk rather than in the bookshelf - of researchers in magnetic confinement fusion. (book review)

Tokamaks (Second Edition)

International Nuclear Information System (INIS)

Stott, Peter

1998-01-01

The first edition of John Wesson's book on tokamaks, published in 1987, established itself as essential reading for researchers in the field of magnetic confinement fusion: it was an excellent introduction for students to tokamak physics and also a valuable reference work for the more experienced. The second edition, published in 1997, has been completely rewritten and substantially enlarged (680 pages compared with 300). The new edition maintains the aim of providing a simple introduction to basic tokamak physics, but also includes discussion of the substantial advances in fusion research during the past decade. The new book, like its predecessor, is well written and commendable for its clarity and accuracy. In fact many of the chapters are written by a series of co-authors bringing the benefits of a wide range of expertise but, by careful editing, Wesson has maintained a uniformity of style and presentation. The chapter headings and coverage for the most part remain the same - but are expanded considerably and brought up to date. The most substantial change is that the single concluding chapter in the first edition on 'Experiments' has been replaced by three chapters: 'Tokamak experiments' which deals with some of the earlier key experiments plus a selection of recent small and medium-sized devices, 'Large experiments' which gives an excellent summary of the main results from the four large tokamaks - TFTR, JET, JT60/JT60U and DIII-D, and 'The future' which gives a very short (possibly too short in my opinion) account of reactors and ITER. This is an excellent book, which I strongly recommend should have a place - on the desk rather than in the bookshelf - of researchers in magnetic confinement fusion. (book review)

Dicty_cDB: Contig-U15828-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15828-1 gap included 1593 1 4184040 4182448 MINUS 12 19 U15828 0 0 6 0 0 0 ...0 0 2 0 4 0 0 0 Show Contig-U15828-1 Contig ID Contig-U15828-1 Contig update 2004. 6.11 Contig sequence >Contig-U15828-1 (Contig...-U15828-1Q) /CSM_Contig/Contig-U15828-1Q.Seq.d ATAAAAAAAATTAAAAAATTAAAAAAGTTATCCACCCAAGT...ACA AATATTATAACTGGTACTGCTACTGTTTCAATCCCTCAAAAAAATTTAAT TTATATTTTACCAAATTCAAATACAATTAATCAATCAACAATTACAATTA CAA Gap gap included Contig...SFNPANSDFSFSYNINTTITQPTQIYLNQDIYYPNGFTTNIITGTATVSIPQ KNLIYILPNSNTINQSTITIT own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U01750-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01750-1 no gap 811 3 3337090 3336279 MINUS 2 2 U01750 1 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01750-1 Contig ID Contig-U01750-1 Contig update 2001. 8.29 Contig sequence >Contig-U01750-1 (Contig...-U01750-1Q) /CSM_Contig/Contig-U01750-1Q.Seq.d GGAAGTTGTAATAATAAAAAAATAAAAATAAAAATAAAAAAATAAAAAAA...GAATACCAAGGTGAAAGAATTTTTCAAAAACTTCCTCAA ATCAACACAAATTTCGAAAAATTAACAATTTGGGAAAAGAAAATCGTTTC AAATCTTTATT Gap no gap Contig...crncnciwsktl*tywiyskiinpi**i*ipr *knfsktssnqhkfrkinnlgkenrfksl own update 2004. 6. 7 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U09822-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS

Dicty_cDB: Contig-U15573-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15573-1 gap included 2005 4 5020093 5018210 MINUS 13 13 U15573 0 5 0 1 1 0 ...0 0 0 1 1 0 2 2 Show Contig-U15573-1 Contig ID Contig-U15573-1 Contig update 2004. 6.11 Contig sequence >Contig-U15573-1 (Contig...-U15573-1Q) /CSM_Contig/Contig-U15573-1Q.Seq.d AGTCTTGAGCTTTTATTGGGTCAACCATTGGGTGAATATAC... AGCNTTAACNGGNAA Gap gap included Contig length 2005 Chromosome number (1..6, M) ...xxlfrsnxslxxxxxxsxnxx Frame C: s*afigstig*iyiylkrfhlfl*skryyqskw*fkifpilkqttiiyen

Vom work Book Journal, 2011 1st Edition PDF

African Journals Online (AJOL)

USER

American camelids: Llama, Alpaca, Vicuno, nd. Guanaco. 2 edition, Iowa State University Press,. Iowa, U.S.A.. SASTRY, G.A. AND RAMA, P.R. (2004): Veterinary th pathology. 7 edition, Satish Kumar Jain, New Delhi,. India. SAYED, S.M.; RATEB, H.Z.; ARAFA M.I.; ABDEL-HAFEEZ. M.M. AND AMER A.A (2007): Field study ...

Dicty_cDB: Contig-U04432-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04432-1 no gap 600 1 1520578 1521098 PLUS 1 1 U04432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04432-1 Contig ID Contig-U04432-1 Contig update 2001. 8.29 Contig sequence >Contig-U04432-1 (Contig...-U04432-1Q) /CSM_Contig/Contig-U04432-1Q.Seq.d AATTATAATCAAAACAAATTAATAAAAAAAATGATTAATAGTTTTGTCTC ...TCAACAATATGAAATTGCAAGAT TAAATGGTTATGATAATGCCCATAATTTACCAAGAGATATTAGTCAAATA Gap no gap Contig length 600 Chro...ni**fkgrnsnknyfsrymgtiessti*n ckikwl**cp*ftkry*sn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U04432-1 (Contig

Dicty_cDB: Contig-U15201-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 2e-04 2 ( EX698640 ) GF_AW109651c08 AW1 Schistosoma mansoni cDNA clone... 44 2e-04 2 ( CD147...-0107T-L395-E12-U.B MG1-0107 Schistosoma manso... 44 2e-04 2 ( CD147233 ) ML1-0002T-M131-E11-U.G ML1-0002 Sc

Dicty_cDB: Contig-U06822-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06822-1 no gap 468 3 438742 439211 PLUS 1 1 U06822 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06822-1 Contig ID Contig-U06822-1 Contig update 2001. 8.30 Contig sequence >Contig-U06822-1 (Contig...-U06822-1Q) /CSM_Contig/Contig-U06822-1Q.Seq.d ATATTATTCTATTCACTCGTAATAATACATATAAATTGATATCAATCAGA AA...TGCTATTAAGACTTTGGAGCAAAAAAC TAACAAATCAATTCAAAA Gap no gap Contig length 468 Chromosome number (1..6, M) 3 Ch...*mmlklkeikllvllrlwskkltnqfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06822-1 (Contig-U06822-1Q) /CSM_Contig/Contig

Patient-oriented interactive E-health tools on U.S. hospital Web sites.

Science.gov (United States)

Huang, Edgar; Chang, Chiu-Chi Angela

2012-01-01

The purpose of this study is to provide evidence for strategic planning regarding e-health development in U.S. hospitals. A content analysis of a representative sample of the U.S. hospital Web sites has revealed how U.S. hospitals have taken advantage of the 21 patient-oriented interactive tools identified in this study. Significant gaps between various types of hospitals have also been found. It is concluded that although the majority of the U.S. hospitals have adopted traditional functional tools, they need to make significant inroad in implementing the core e-business tools to serve their patients/users, making their Web sites more efficient marketing tools.

Radioactive contamination, what actions for the polluted sites; Contamination radioactive, quelles actions pour les sites pollues

Energy Technology Data Exchange (ETDEWEB)

NONE

2004-07-01

The nuclear safety authority and the direction of prevention of pollutions and risks have organised the first edition of the national colloquium: radioactive contamination: what actions for polluted sites. Four axes can be taken to follow this colloquium: prevention, outstanding tools to evaluate risks and rehabilitation, a better responsibility of operators and memory keeping. (N.C.)

Dicty_cDB: Contig-U06829-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06829-1 no gap 449 5 4394444 4394893 PLUS 1 1 U06829 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06829-1 Contig ID Contig-U06829-1 Contig update 2001. 8.30 Contig sequence >Contig-U06829-1 (Contig...-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d GTAAAAGAATGTAATGAAAATGAAAAAATTAATTTTATAATAAAATTATT ...ATGATTTAGAATTGGTACAATTAGTTTA Gap no gap Contig length 449 Chromosome number (1..6, M) 5 Chromosome length 50...04. 6.10 Homology vs CSM-cDNA Query= Contig-U06829-1 (Contig-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d (

RNA editing in Drosophila melanogaster: new targets and functionalconsequences

Energy Technology Data Exchange (ETDEWEB)

Stapleton, Mark; Carlson, Joseph W.; Celniker, Susan E.

2006-09-05

Adenosine deaminases that act on RNA (ADARs) catalyze the site-specific conversion of adenosine to inosine in primary mRNA transcripts. These re-coding events affect coding potential, splice-sites, and stability of mature mRNAs. ADAR is an essential gene and studies in mouse, C. elegans, and Drosophila suggest its primary function is to modify adult behavior by altering signaling components in the nervous system. By comparing the sequence of isogenic cDNAs to genomic DNA, we have identified and experimentally verified 27 new targets of Drosophila ADAR. Our analyses lead us to identify new classes of genes whose transcripts are targets of ADAR including components of the actin cytoskeleton, and genes involved in ion homeostasis and signal transduction. Our results indicate that editing in Drosophila increases the diversity of the proteome, and does so in a manner that has direct functional consequences on protein function.

On the equation - Δu+c=Keu

International Nuclear Information System (INIS)

Duong Minh Duc.

1989-10-01

We establish the Sobolev inequality for limiting case. Using this result, the method of McOwen, the Ekeland variational principle and our generalized critical values results, we study the existence of solutions of the equation - Δu+c=Ke u for the case in which K and c may not tend to zero as x tends to infinity. (author). 25 refs

Dicty_cDB: Contig-U09694-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09694-1 gap included 1129 1 4027135 4026071 MINUS 3 4 U09694 2 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09694-1 Contig ID Contig-U09694-1 Contig update 2002. 9.13 Contig sequence >Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig-U0969...TTAAATTAAAACAACAACAATTTCATAATATAAATAAT Gap gap included Contig length 1129 Chromosome number (1..6, M) 1 Chr...iklkqqqfklkqqqfhninn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig...E Sequences producing significant alignments: (bits) Value Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig

Dicty_cDB: Contig-U12086-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig

Site Characterization Data from the U3ax/bl Exploratory Boreholes at the Nevada Test Site

International Nuclear Information System (INIS)

2005-01-01

This report provides qualitative analyses and preliminary interpretations of hydrogeologic data obtained from two 45-degree, slanted exploratory boreholes drilled within the Area 3 Radioactive Waste Management Site (RWMS) at the Nevada Test Site. Borehole UE-3bl-D1 was drilled beneath the U3ax/bl mixed waste disposal unit, and Borehole UE-3bl-U1 was drilled in undisturbed alluvium adjacent to the disposal unit. The U3ax/bl disposal unit is located within two conjoined subsidence craters, U3ax and U3bl, which were created by underground nuclear testing. Data from these boreholes were collected to support site characterization activities for the U3ax/bl disposal unit and the entire Area 3 RWMS. Site characterization at disposal units within the Area 3 RWMS must address the possibility that subsidence craters and associated disturbed alluvium of the chimneys beneath the craters might serve as pathways for contaminant migration. The two boreholes were drilled and sampled to compare hydrogeologic properties of alluvium below the waste disposal unit with those of adjacent undisturbed alluvium. Whether Borehole UE-3bl-D1 actually penetrated the chimney of the U3bl crater is uncertain. Analyses of core samples showed little difference in hydrogeologic properties between the two boreholes. Important findings of this study include the following: No hazardous or radioactive constituents of waste disposal concern were found in the samples obtained from either borehole. No significant differences in physical and hydrogeologic properties between boreholes is evident, and no evidence of significant trends with depth for any of these properties was observed. The values observed are typical of sandy materials. The alluvium is dry, with volumetric water content ranging from 5.6 to 16.2 percent. Both boreholes exhibit a slight increase in water content with depth, the only such trend observed. Water potential measurements on core samples from both boreholes show a large positive

Site Characterization Data from the U3ax/bl Exploratory Boreholes at the Nevada Test Site

Energy Technology Data Exchange (ETDEWEB)

Bechtel Nevada; U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office

2005-08-01

This report provides qualitative analyses and preliminary interpretations of hydrogeologic data obtained from two 45-degree, slanted exploratory boreholes drilled within the Area 3 Radioactive Waste Management Site (RWMS) at the Nevada Test Site. Borehole UE-3bl-D1 was drilled beneath the U3ax/bl mixed waste disposal unit, and Borehole UE-3bl-U1 was drilled in undisturbed alluvium adjacent to the disposal unit. The U3ax/bl disposal unit is located within two conjoined subsidence craters, U3ax and U3bl, which were created by underground nuclear testing. Data from these boreholes were collected to support site characterization activities for the U3ax/bl disposal unit and the entire Area 3 RWMS. Site characterization at disposal units within the Area 3 RWMS must address the possibility that subsidence craters and associated disturbed alluvium of the chimneys beneath the craters might serve as pathways for contaminant migration. The two boreholes were drilled and sampled to compare hydrogeologic properties of alluvium below the waste disposal unit with those of adjacent undisturbed alluvium. Whether Borehole UE-3bl-D1 actually penetrated the chimney of the U3bl crater is uncertain. Analyses of core samples showed little difference in hydrogeologic properties between the two boreholes. Important findings of this study include the following: No hazardous or radioactive constituents of waste disposal concern were found in the samples obtained from either borehole. No significant differences in physical and hydrogeologic properties between boreholes is evident, and no evidence of significant trends with depth for any of these properties was observed. The values observed are typical of sandy materials. The alluvium is dry, with volumetric water content ranging from 5.6 to 16.2 percent. Both boreholes exhibit a slight increase in water content with depth, the only such trend observed. Water potential measurements on core samples from both boreholes show a large positive

Dicty_cDB: Contig-U13894-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13894-1 no gap 1550 2 2081463 2079913 MINUS 30 31 U13894 1 0 15 0 9 1 1 0 1 1 1 0 0 0 Show Contig...-U13894-1 Contig ID Contig-U13894-1 Contig update 2002.12.18 Contig sequence >Contig-U13894-1 (Contig...-U13894-1Q) /CSM_Contig/Contig-U13894-1Q.Seq.d CTTTTTGATTGTATAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAA...TAAATTAAATAATTAAAAAAAACAAAAAAATTAAGTGAAAATCAAAAAA Gap no gap Contig length 1550 Chromosome number (1..6, M) ...V*kkkkikk*k*sk*fklnn*kkqkn*vkikk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13894-1 (Contig

Dicty_cDB: Contig-U15462-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15462-1 no gap 546 4 3384206 3383661 MINUS 2 2 U15462 0 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U15462-1 Contig ID Contig-U15462-1 Contig update 2004. 6.11 Contig sequence >Contig-U15462-1 (Contig...-U15462-1Q) /CSM_Contig/Contig-U15462-1Q.Seq.d CTTTAGATTGGGGNTCAAGAAAAATATTGAAGTATTTGGTGGTGATAAGA...ATTCGATTCACTATCTTATA Gap no gap Contig length 546 Chromosome number (1..6, M) 4 Chromosome length 5430582 St...VMKLGFEVKDLITNDPKCDLFDSLS Y own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15462-1 (Contig

A RecET-assisted CRISPR-Cas9 genome editing in Corynebacterium glutamicum.

Science.gov (United States)

Wang, Bo; Hu, Qitiao; Zhang, Yu; Shi, Ruilin; Chai, Xin; Liu, Zhe; Shang, Xiuling; Zhang, Yun; Wen, Tingyi

2018-04-23

Extensive modification of genome is an efficient manner to regulate the metabolic network for producing target metabolites or non-native products using Corynebacterium glutamicum as a cell factory. Genome editing approaches by means of homologous recombination and counter-selection markers are laborious and time consuming due to multiple round manipulations and low editing efficiencies. The current two-plasmid-based CRISPR-Cas9 editing methods generate false positives due to the potential instability of Cas9 on the plasmid, and require a high transformation efficiency for co-occurrence of two plasmids transformation. Here, we developed a RecET-assisted CRISPR-Cas9 genome editing method using a chromosome-borne Cas9-RecET and a single plasmid harboring sgRNA and repair templates. The inducible expression of chromosomal RecET promoted the frequencies of homologous recombination, and increased the efficiency for gene deletion. Due to the high transformation efficiency of a single plasmid, this method enabled 10- and 20-kb region deletion, 2.5-, 5.7- and 7.5-kb expression cassette insertion and precise site-specific mutation, suggesting a versatility of this method. Deletion of argR and farR regulators as well as site-directed mutation of argB and pgi genes generated the mutant capable of accumulating L-arginine, indicating the stability of chromosome-borne Cas9 for iterative genome editing. Using this method, the model-predicted target genes were modified to redirect metabolic flux towards 1,2-propanediol biosynthetic pathway. The final engineered strain produced 6.75 ± 0.46 g/L of 1,2-propanediol that is the highest titer reported in C. glutamicum. Furthermore, this method is available for Corynebacterium pekinense 1.563, suggesting its universal applicability in other Corynebacterium species. The RecET-assisted CRISPR-Cas9 genome editing method will facilitate engineering of metabolic networks for the synthesis of interested bio-based products from renewable

Dicty_cDB: Contig-U12073-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12073-1 gap included 912 2 2118980 2119867 PLUS 4 5 U12073 0 0 0 2 0 0 0 1 0 1 0 0 0 0 Show Contig...-U12073-1 Contig ID Contig-U12073-1 Contig update 2002.12.18 Contig sequence >Contig-U12073-1 (Contig...-U12073-1Q) /CSM_Contig/Contig-U12073-1Q.Seq.d CTGTTGGCCTACTGGNAATTGAAACAATTGTTTCAGCAAATATTA...AAGA Gap gap included Contig length 912 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point ...GPXSXDY*r own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12073-1 (Contig-U12073-1Q) /CSM_Contig/Contig

Zebrafish Adar2 Edits the Q/R site of AMPA receptor Subunit gria2α transcript to ensure normal development of nervous system and cranial neural crest cells.

Directory of Open Access Journals (Sweden)

I-Chen Li

Full Text Available BACKGROUND: Adar2 deaminates selective adenosines to inosines (A-to-I RNA editing in the double-stranded region of nuclear transcripts. Although the functions of mouse Adar2 and its biologically most important substrate gria2, encoding the GluA2 subunit of AMPA (α-amino-3-hydroxy-5-methyl-4-isoxazole propionic acid receptor, have been extensively studied, the substrates and functions of zebrafish Adar2 remain elusive. METHODS/PRINCIPAL FINDINGS: Expression of Adar2 was perturbed in the adar2 morphant (adar2MO, generated by antisense morpholio oligonucleotides. The Q/R editing of gria2α was reduced in the adar2MO and was enhanced by overexpression of Adar2, demonstrating an evolutionarily conserved activity between zebrafish and mammalian Adar2 in editing the Q/R site of gria2. To delineate the role of Q/R editing of gria2α in the developmental defects observed in the adar2MO, the Q/R editing of gria2α was specifically perturbed in the gria2αQRMO, generated by a morpholio oligonucleotide complementary to the exon complementary sequence (ECS required for the Q/R editing. Analogous to the adar2-deficient and Q/R-editing deficient mice displaying identical neurological defects, the gria2αQRMO and adar2MO displayed identical developmental defects in the nervous system and cranial cartilages. Knockdown p53 abolished apoptosis and partially suppressed the loss of spinal cord motor neurons in these morphants. However, reducing p53 activity neither replenished the brain neuronal populations nor rescued the developmental defects. The expressions of crestin and sox9b in the neural crest cells were reduced in the adar2MO and gria2αQRMO. Overexpressing the edited GluA2αR in the adar2MO restored normal expressions of cresting and sox9b. Moreover, overexpressing the unedited GluA2αQ in the wild type embryos resulted in reduction of crestin and sox9b expressions. These results argue that an elevated GluA2αQ level is sufficient for generating the

Thermodynamic assessment of the HTGR fuel system Th-U-C-O

International Nuclear Information System (INIS)

Ugajin, M.; Shiba, K.

1978-01-01

Carbon monoxide pressures and uranium segregation at 2000 K have been calculated for the three-phase equilibria [(ThU)O 2 + (ThU)C 2 + C] in the Th-U-C-O system. This study is concerned with the thermochemical behavior of (Th, U)O 2 particle fuel for the high-temperature gas-cooled reactor (HTGR). The following two points are considered: (1) Reduction of the in-particle CO pressure of (Th, U)O 2 kernels by doping (Th, U)C 2 to make it an oxygen getter. (2) Prediction of U segregation between (Th, U)O 2 and (Th, U)C 2 , doped in the kernel. (Auth.)

Restriction digest screening facilitates efficient detection of site-directed mutations introduced by CRISPR in C. albicans UME6.

Science.gov (United States)

Evans, Ben A; Smith, Olivia L; Pickerill, Ethan S; York, Mary K; Buenconsejo, Kristen J P; Chambers, Antonio E; Bernstein, Douglas A

2018-01-01

Introduction of point mutations to a gene of interest is a powerful tool when determining protein function. CRISPR-mediated genome editing allows for more efficient transfer of a desired mutation into a wide range of model organisms. Traditionally, PCR amplification and DNA sequencing is used to determine if isolates contain the intended mutation. However, mutation efficiency is highly variable, potentially making sequencing costly and time consuming. To more efficiently screen for correct transformants, we have identified restriction enzymes sites that encode for two identical amino acids or one or two stop codons. We used CRISPR to introduce these restriction sites directly upstream of the Candida albicans UME6 Zn 2+ -binding domain, a known regulator of C. albicans filamentation. While repair templates coding for different restriction sites were not equally successful at introducing mutations, restriction digest screening enabled us to rapidly identify isolates with the intended mutation in a cost-efficient manner. In addition, mutated isolates have clear defects in filamentation and virulence compared to wild type C. albicans . Our data suggest restriction digestion screening efficiently identifies point mutations introduced by CRISPR and streamlines the process of identifying residues important for a phenotype of interest.

Remaining Sites Verification Package for the 116-C-3, 105-C Chemical Waste Tanks. Attachment to Waste Site Reclassification Form 2008-002

International Nuclear Information System (INIS)

Dittmer, L.M.

2008-01-01

The 116-C-3 waste site consisted of two underground storage tanks designed to receive mixed waste from the 105-C Reactor Metals Examination Facility chemical dejacketing process. Confirmatory evaluation and subsequent characterization of the site determined that the southern tank contained approximately 34,000 L (9,000 gal) of dejacketing wastes, and that the northern tank was unused. In accordance with this evaluation, the verification sampling and modeling results support a reclassification of this site to Interim Closed Out. The results of verification sampling demonstrate that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also show that residual contaminant concentrations are protective of groundwater and the Columbia River

U2AF1 mutations alter splice site recognition in hematological malignancies.

Science.gov (United States)

Ilagan, Janine O; Ramakrishnan, Aravind; Hayes, Brian; Murphy, Michele E; Zebari, Ahmad S; Bradley, Philip; Bradley, Robert K

2015-01-01

Whole-exome sequencing studies have identified common mutations affecting genes encoding components of the RNA splicing machinery in hematological malignancies. Here, we sought to determine how mutations affecting the 3' splice site recognition factor U2AF1 alter its normal role in RNA splicing. We find that U2AF1 mutations influence the similarity of splicing programs in leukemias, but do not give rise to widespread splicing failure. U2AF1 mutations cause differential splicing of hundreds of genes, affecting biological pathways such as DNA methylation (DNMT3B), X chromosome inactivation (H2AFY), the DNA damage response (ATR, FANCA), and apoptosis (CASP8). We show that U2AF1 mutations alter the preferred 3' splice site motif in patients, in cell culture, and in vitro. Mutations affecting the first and second zinc fingers give rise to different alterations in splice site preference and largely distinct downstream splicing programs. These allele-specific effects are consistent with a computationally predicted model of U2AF1 in complex with RNA. Our findings suggest that U2AF1 mutations contribute to pathogenesis by causing quantitative changes in splicing that affect diverse cellular pathways, and give insight into the normal function of U2AF1's zinc finger domains. © 2015 Ilagan et al.; Published by Cold Spring Harbor Laboratory Press.

Dicty_cDB: Contig-U12316-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12316-1 gap included 1238 4 1925901 1927143 PLUS 5 6 U12316 0 4 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12316-1 Contig ID Contig-U12316-1 Contig update 2002.12.18 Contig sequence >Contig-U12316-1 (Contig-U12316-1Q) /CSM_Contig/Contig-U12316...GAGTTGAAGATTTAGTTTTATCAGNANGAANAAATAAGAT Gap gap included Contig length 1238 Chromosome number (1..6, M) 4 C...,915,1174 Translated Amino Acid sequence lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig...lip*r*rtrkttn*kiknny*itketkiqs*t*rvmmmi*vedlvls xxxnk Frame B: lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig

Dicty_cDB: Contig-U12682-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12682-1 no gap 1408 4 4961739 4963050 PLUS 47 48 U12682 0 0 0 5 0 0 2 30 0 10 0 0 0 0 Show Contig...-U12682-1 Contig ID Contig-U12682-1 Contig update 2002.12.18 Contig sequence >Contig-U12682-1 (Contig...-U12682-1Q) /CSM_Contig/Contig-U12682-1Q.Seq.d AAACACATCATCCCGTTCGATCTGATAAGTAAATCGACCTCAGGCC...ATGA AACTACTG Gap no gap Contig length 1408 Chromosome number (1..6, M) 4 Chromosome length 5430582 Start po... kwniikwysyinwykswyn**fihsiklqwsy*qcke*si*yiir*ny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

Interdiffusion among U-Mo-Zr and alloys of Al to 550oC

International Nuclear Information System (INIS)

Komar Varela, C.L; Arico, S.F; Gribaudo, L.M

2006-01-01

The international community, by means of the project 'Reduced Enrichment for Research and Test Reactors' is interested in the development of a new nuclear fuel of very high density of uranium and low enrichment (≤ 20% de U 235 ) for reactors of investigation and production of radioisotopes, that permit to reach greater neutron flows, with good capacity to be reprocessed One of these assemblies are the alloys of U with Mo contents between 7 and 10% in weight. In the fuels 'dispersed type plate' the particles of U-Mo are mixed with dust of aluminum and are co - laminated between two plates of an alloy of the same material. The existing contact among the particles permits the interdiffusion of the materials with the consequent apparition of new phases. Studies pursuit-irradiation have shown a badly behavior of these new phases. It is for this that is necessary to control the presence of these products of interaction. The aggregate of a third element to the alloys U - Mo has begun to be practiced with this purpose. In this work the modification of the start of the disorder of the phase γU in the alloy U-7%Mo-1%Zr was studied and the interdiffusion between pure aluminum and the same alloy to 550 o C. The results obtained are compared with other obtained for peers U-Mo/Al. The techniques of characterization utilized were: optical microscopy, analysis by diffraction of X-rays and microanalysis quantitative by microprobe electronic. It was observed that the aggregate of Zr refines the grain for a processing of homogenized in composition of Mo to 1000 o C and accelerates the start of the disorder of the phase γU to 550 o C. As for the zone of interaction, was found that the composed identifying do not they differ to them reported in the in peers U-Mo/Al. These are: (U,Mo)Al 4 y UAl 3 (AG)

Site Monitoring at the U.C. Observatory of Santa Martina

Science.gov (United States)

Gatica, C.; Vanzi, L.; Toledo, I.; Lombardi, G.

2011-11-01

This work presents an astroclimatologic analysis of the UC Santa Martina Observatory site. This site is located near Santiago at latitude 33.3°S, longitude 70.5°W and an altitude of 1492 meters above sea level. The analysis was performed using data of temperature, pressure, humidity, and wind collected with a Davis Net Vantage Pro 2 meteo station in a period from December 2007 to January 2011. We estimated average values for the parameters monitored on different time scales and examined daily as well as seasonal variations. We also estimated the downtime due to clouds average with an 37.23% of nights in 2010, humidity, wind over the period examined. The average relative humidity is 49%, wind is predominantly (24% of time) from southsouthwest with an average speed of 0.6 m/s. Finally, we describe Seeing measurements obtained with a DIMM monitor recently installed in the site.

48 CFR 15.403-4 - Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).

Science.gov (United States)

2010-10-01

... or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b). 15.403-4 Section 15.403-4 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 15.403-4 Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C...

Tracer experiment administering L-phenylalanine-U-{sup 14}C and L-tyrosine-U-{sup 14}C to the tissue slices of bamboo shoots

Energy Technology Data Exchange (ETDEWEB)

Kozukue, E. [Kenmei Women' s Junior Coll., Himeji, Hyogo (Japan); Mizuno, S.

1987-09-15

Uniformly {sup 14}C-labeled L-phenylalanine and L-tyrosine were administered to tissue slices of both top and base sections of bamboo shoots. Alcohol soluble substances were extracted and then separated into organic acid, sugar and amino acid fractions by ion exchange chromatography. The homogentisic acid fraction among the organic acids was collected by high-performance liquid chromatography (HPLC) and its radioactivity was measured, while the alcohol insoluble residue was used for the analysis of lignin aldehyde by the method of alkaline nitrobenzene oxidation. 1. The two labeled amino acids were steadily incorporated into the tissues during incubation and rapidly converted to organic acid, sugar and alcohol insoluble residue, especially the latter. 2. On determining the amount of phenylalanine converted to tyrosine, it was found that this was extremely small. 3. The incorporation of phenylalanine-U-{sup 14}C into alcohol insoluble residue was higher than that of tyrosine in both sections. 4. Although the conversion into lignin aldehyde from phenylalanine-U-{sup 14}C was higher than that from tyrosine-U-{sup 14}C, it was found that tyrosine incorporated into the shoots was converted to a remarkable extent for formation of lignin aldehyde. 5. The incorporation of phenylalanine and tyrosine into homogentisic acid was very low. From these results, we assume that the conversion of phenylalanine to tyrosine or of tyrosine to homogentisic acid is very small, and that a part of the high amount of tyrosine in the shoots may be used for formation of lignin.

Mojo Hand, a TALEN design tool for genome editing applications.

Science.gov (United States)

Neff, Kevin L; Argue, David P; Ma, Alvin C; Lee, Han B; Clark, Karl J; Ekker, Stephen C

2013-01-16

Recent studies of transcription activator-like (TAL) effector domains fused to nucleases (TALENs) demonstrate enormous potential for genome editing. Effective design of TALENs requires a combination of selecting appropriate genetic features, finding pairs of binding sites based on a consensus sequence, and, in some cases, identifying endogenous restriction sites for downstream molecular genetic applications. We present the web-based program Mojo Hand for designing TAL and TALEN constructs for genome editing applications (http://www.talendesign.org). We describe the algorithm and its implementation. The features of Mojo Hand include (1) automatic download of genomic data from the National Center for Biotechnology Information, (2) analysis of any DNA sequence to reveal pairs of binding sites based on a user-defined template, (3) selection of restriction-enzyme recognition sites in the spacer between the TAL monomer binding sites including options for the selection of restriction enzyme suppliers, and (4) output files designed for subsequent TALEN construction using the Golden Gate assembly method. Mojo Hand enables the rapid identification of TAL binding sites for use in TALEN design. The assembly of TALEN constructs, is also simplified by using the TAL-site prediction program in conjunction with a spreadsheet management aid of reagent concentrations and TALEN formulation. Mojo Hand enables scientists to more rapidly deploy TALENs for genome editing applications.

Mojo Hand, a TALEN design tool for genome editing applications

Directory of Open Access Journals (Sweden)

Neff Kevin L

2013-01-01

Full Text Available Abstract Background Recent studies of transcription activator-like (TAL effector domains fused to nucleases (TALENs demonstrate enormous potential for genome editing. Effective design of TALENs requires a combination of selecting appropriate genetic features, finding pairs of binding sites based on a consensus sequence, and, in some cases, identifying endogenous restriction sites for downstream molecular genetic applications. Results We present the web-based program Mojo Hand for designing TAL and TALEN constructs for genome editing applications (http://www.talendesign.org. We describe the algorithm and its implementation. The features of Mojo Hand include (1 automatic download of genomic data from the National Center for Biotechnology Information, (2 analysis of any DNA sequence to reveal pairs of binding sites based on a user-defined template, (3 selection of restriction-enzyme recognition sites in the spacer between the TAL monomer binding sites including options for the selection of restriction enzyme suppliers, and (4 output files designed for subsequent TALEN construction using the Golden Gate assembly method. Conclusions Mojo Hand enables the rapid identification of TAL binding sites for use in TALEN design. The assembly of TALEN constructs, is also simplified by using the TAL-site prediction program in conjunction with a spreadsheet management aid of reagent concentrations and TALEN formulation. Mojo Hand enables scientists to more rapidly deploy TALENs for genome editing applications.

The Role of Unions in the American Economy. Second Edition.

Science.gov (United States)

Marshall, Ray; Rungeling, Brian

Intended as a resource for secondary teachers, this book analyzes the role of unions in the American economy and examines the main forces influencing unions in the United States. This second edition includes important domestic and external events that have affected U.S. economic policy and unions since the first edition was published in 1976.…

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC154 (Link to dictyBase) - - - Contig-U16363-1 VFC154Z (Link... to Original site) - - VFC154Z 551 - - - - Show VFC154 Library VF (Link to library) Clone ID VFC154 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16363-1 Original site URL http://dict...s: (bits) Value N U82513 |U82513.1 Dictyostelium discoideum random slug cDNA25 protein (rsc25) mRNA, partial...producing significant alignments: (bits) Value U82513_1( U82513 |pid:none) Dictyostelium discoideum random s

Comparison of calculated and experimental isotope edited FTIR difference spectra for purple bacterial photosynthetic reaction centers with different quinones incorporated into the QA binding site.

Directory of Open Access Journals (Sweden)

Nan eZhao

2013-08-01

Full Text Available Previously we have shown that ONIOM type (QM/MM calculations can be used to simulate isotope edited FTIR difference spectra for neutral ubiquinone in the QA binding site in Rhodobacter sphaeroides photosynthetic reaction centers. Here we considerably extend upon this previous work by calculating isotope edited FTIR difference spectra for reaction centers with a variety of unlabeled and 18O labeled foreign quinones incorporated into the QA binding site. Isotope edited spectra were calculated for reaction centers with 2,3-dimethoxy-5,6-dimethyl-1,4-benzoquinone (MQ0, 2,3,5,6-tetramethyl-1,4-benzoquinone (duroquinone, DQ, and 2,3-dimethyl-l,4-naphthoquinone (DMNQ incorporated, and compared to corresponding experimental spectra. The calculated and experimental spectra agree well, further demonstrating the utility and applicability of our ONIOM approach for calculating the vibrational properties of pigments in protein binding sites.The normal modes that contribute to the bands in the calculated spectra, their composition, frequency and intensity, and how these quantities are modified upon 18O labeling, are presented. This computed information leads to a new and more detailed understanding/interpretation of the experimental FTIR difference spectra. Hydrogen bonding to the carbonyl groups of the incorporated quinones is shown to be relatively weak. It is also shown that there is some asymmetry in hydrogen bonding, accounting for 10-13 cm-1 separation in the frequencies of the carbonyl vibrational modes of the incorporated quinones. The extent of asymmetry H-bonding could only be established by considering the spectra for various types of quinones incorporated into the QA binding site. The quinones listed above are tail-less. Spectra were also calculated for reaction centers with corresponding tail containing quinones incorporated, and it is found that replacement of the quinone methyl group by a phytyl or prenyl chain does not alter ONIOM calculated s

Closure Report for Corrective Action Unit 116: Area 25 Test Cell C Facility, Nevada National Security Site, Nevada

Energy Technology Data Exchange (ETDEWEB)

NSTec Environmental Restoration

2011-09-29

This Closure Report (CR) presents information supporting closure of Corrective Action Unit (CAU) 116, Area 25 Test Cell C Facility. This CR complies with the requirements of the Federal Facility Agreement and Consent Order (FFACO) that was agreed to by the State of Nevada; the U.S. Department of Energy (DOE), Environmental Management; the U.S. Department of Defense; and DOE, Legacy Management (FFACO, 1996 [as amended March 2010]). CAU 116 consists of the following two Corrective Action Sites (CASs), located in Area 25 of the Nevada National Security Site: (1) CAS 25-23-20, Nuclear Furnace Piping and (2) CAS 25-41-05, Test Cell C Facility. CAS 25-41-05 consisted of Building 3210 and the attached concrete shield wall. CAS 25-23-20 consisted of the nuclear furnace piping and tanks. Closure activities began in January 2007 and were completed in August 2011. Activities were conducted according to Revision 1 of the Streamlined Approach for Environmental Restoration Plan for CAU 116 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2008). This CR provides documentation supporting the completed corrective actions and provides data confirming that closure objectives for CAU 116 were met. Site characterization data and process knowledge indicated that surface areas were radiologically contaminated above release limits and that regulated and/or hazardous wastes were present in the facility.

Self-association and domain rearrangements between complement C3 and C3u provide insight into the activation mechanism of C3.

Science.gov (United States)

Li, Keying; Gor, Jayesh; Perkins, Stephen J

2010-10-01

Component C3 is the central protein of the complement system. During complement activation, the thioester group in C3 is slowly hydrolysed to form C3u, then the presence of C3u enables the rapid conversion of C3 into functionally active C3b. C3u shows functional similarities to C3b. To clarify this mechanism, the self-association properties and solution structures of C3 and C3u were determined using analytical ultracentrifugation and X-ray scattering. Sedimentation coefficients identified two different dimerization events in both proteins. A fast dimerization was observed in 50 mM NaCl but not in 137 mM NaCl. Low amounts of a slow dimerization was observed for C3u and C3 in both buffers. The X-ray radius of gyration RG values were unchanged for both C3 and C3u in 137 mM NaCl, but depend on concentration in 50 mM NaCl. The C3 crystal structure gave good X-ray fits for C3 in 137 mM NaCl. By randomization of the TED (thioester-containing domain)/CUB (for complement protein subcomponents C1r/C1s, urchin embryonic growth factor and bone morphogenetic protein 1) domains in the C3b crystal structure, X-ray fits showed that the TED/CUB domains in C3u are extended and differ from the more compact arrangement of C3b. This TED/CUB conformation is intermediate between those of C3 and C3b. The greater exposure of the TED domain in C3u (which possesses the hydrolysed reactive thioester) accounts for the greater self-association of C3u in low-salt conditions. This conformational variability of the TED/CUB domains would facilitate their interactions with a broad range of antigenic surfaces. The second dimerization of C3 and C3u may correspond to a dimer observed in one of the crystal structures of C3b.

{sup 15}N and {sup 13}C- SOFAST-HMQC editing enhances 3D-NOESY sensitivity in highly deuterated, selectively [{sup 1}H,{sup 13}C]-labeled proteins

Energy Technology Data Exchange (ETDEWEB)

Rossi, Paolo, E-mail: rossip@umn.edu; Xia, Youlin; Khanra, Nandish; Veglia, Gianluigi, E-mail: vegli001@umn.edu; Kalodimos, Charalampos G., E-mail: ckalodim@umn.edu [University of Minnesota, Department of Biochemistry, Molecular Biology and Biophysics (United States)

2016-12-15

The ongoing NMR method development effort strives for high quality multidimensional data with reduced collection time. Here, we apply ‘SOFAST-HMQC’ to frequency editing in 3D NOESY experiments and demonstrate the sensitivity benefits using highly deuterated and {sup 15}N, methyl labeled samples in H{sub 2}O. The experiments benefit from a combination of selective T{sub 1} relaxation (or L-optimized effect), from Ernst angle optimization and, in certain types of experiments, from using the mixing time for both NOE buildup and magnetization recovery. This effect enhances sensitivity by up to 2.4× at fast pulsing versus reference HMQC sequences of same overall length and water suppression characteristics. Representative experiments designed to address interesting protein NMR challenges are detailed. Editing capabilities are exploited with heteronuclear {sup 15}N,{sup 13}C-edited, or with diagonal-free {sup 13}C aromatic/methyl-resolved 3D-SOFAST-HMQC–NOESY–HMQC. The latter experiment is used here to elucidate the methyl-aromatic NOE network in the hydrophobic core of the 19 kDa FliT-FliJ flagellar protein complex. Incorporation of fast pulsing to reference experiments such as 3D-NOESY–HMQC boosts digital resolution, simplifies the process of NOE assignment and helps to automate protein structure determination.

Dicty_cDB: SSD250 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSD250 (Link to dictyBase) - - - Contig-U14716-1 SSD250E (Link... to Original site) - - - - - - SSD250E 491 Show SSD250 Library SS (Link to library) Clone ID SSD250 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14716-1 Original site URL http://dict...t alignments: (bits) Value N U20432 |U20432.1 Dictyostelium discoideum TagB (tagB) gene, complete cds. 151 1...cName: Full=Cytochrome b-c1 complex subunit 7; AltNam... 45 0.001 DQ399515_1( DQ399515 |pid:none) Ictalurus

Genome-Independent Identification of RNA Editing by Mutual Information (GIREMI) | Informatics Technology for Cancer Research (ITCR)

Science.gov (United States)

Identification of single-nucleotide variants in RNA-seq data. Current version focuses on detection of RNA editing sites without requiring genome sequence data. New version is under development to separately identify RNA editing sites and genetic variants using RNA-seq data alone.

Neighborhood of 16S rRNA nucleotides U788/U789 in the 30S ribosomal subunit determined by site-directed crosslinking.

OpenAIRE

Mundus, D; Wollenzien, P

1998-01-01

Site-specific photo crosslinking has been used to investigate the RNA neighborhood of 16S rRNA positions U788/ U789 in Escherichia coli 30S subunits. For these studies, site-specific psoralen (SSP) which contains a sulfhydryl group on a 17 A side chain was first added to nucleotides U788/U789 using a complementary guide DNA by annealing and phototransfer. Modified RNA was purified from the DNA and unmodified RNA. For some experiments, the SSP, which normally crosslinks at an 8 A distance, was...

Synthesis and applications of selectively {sup 13}C-labeled RNA

Energy Technology Data Exchange (ETDEWEB)

SantaLucia, J. Jr.; Shen, L.X.; Lewis, H.; Cai, Z.; Tinoci, I. Jr. [Univ. of California, Berkeley, CA (United States)

1994-12-01

Spectral overlap is a substantial problem in NMR studies of RNA molecules >30 nucleotides. To overcome this difficulty, we synthesized selectively {sup 13}C-labeled RNAs and adapted several isotope-edited two- and three-dimensional NMR experiments originally developed for protein studies. We optimized protocols for synthesis of multi-gram quantities of CTP, UTp, ATP, and GTP using a combination of synthetic organic and enzymatic methods. Uracil is prepared in 40 to 50% yield from {sup 13}C-cyanide in two steps. Using acetyl- tribenzoyl-ribose and standard chemistry uracil is then attached to the sugar (90% yield). The tribenzoyl-uridine intermediate is converted into uridine or cytidine quantitatively, depending on the deblocking protocol. Labeled purines are synthesized using simple pyrimidine precursors and reacting with {sup 13}C-formic acid (80% yield). Purine nucleosides are then synthesized using uridine phosphorylase and purine nucleoside phosphorylase. The nucleosides were converted to NMPs by treatment with POC1{sub 3} in triethylphosphate. We converted NMPs to NTPs by standard enzymatic methods. Selectively labeled RNAs were synthesized by run-off transcription using {sup 13}C-labeled NTPs. Several different strategies help solve over-lap problems in larger RNAs. Isotope-edited two-dimensional NMR experiments such as {omega}1-1/2 X-filtered NOESY simplify NMR spectra by dividing the normal NOESY spectrum into two subspectra-one involving NOEs from protons bound to {sup 12}C and one from protons bound to {sup 13}C. For example, we labeled A and U residues of a 34-nucleotide pseudoknot, and the {sup 12}C subspectrum of the 1/2 X-filtered NOESY contained NOEs only from G and C residues (along with adenine 2H); the {sup 13}C subspectrum contained NOEs only from A and U residues. Each subspectrum has less overlap than the NOESY of an unlabeled sample; the editing strategy allows each resonance to be identified by residue type (A, C, G, or U).

Human Germline Genome Editing.

Science.gov (United States)

Ormond, Kelly E; Mortlock, Douglas P; Scholes, Derek T; Bombard, Yvonne; Brody, Lawrence C; Faucett, W Andrew; Garrison, Nanibaa' A; Hercher, Laura; Isasi, Rosario; Middleton, Anna; Musunuru, Kiran; Shriner, Daniel; Virani, Alice; Young, Caroline E

2017-08-03

With CRISPR/Cas9 and other genome-editing technologies, successful somatic and germline genome editing are becoming feasible. To respond, an American Society of Human Genetics (ASHG) workgroup developed this position statement, which was approved by the ASHG Board in March 2017. The workgroup included representatives from the UK Association of Genetic Nurses and Counsellors, Canadian Association of Genetic Counsellors, International Genetic Epidemiology Society, and US National Society of Genetic Counselors. These groups, as well as the American Society for Reproductive Medicine, Asia Pacific Society of Human Genetics, British Society for Genetic Medicine, Human Genetics Society of Australasia, Professional Society of Genetic Counselors in Asia, and Southern African Society for Human Genetics, endorsed the final statement. The statement includes the following positions. (1) At this time, given the nature and number of unanswered scientific, ethical, and policy questions, it is inappropriate to perform germline gene editing that culminates in human pregnancy. (2) Currently, there is no reason to prohibit in vitro germline genome editing on human embryos and gametes, with appropriate oversight and consent from donors, to facilitate research on the possible future clinical applications of gene editing. There should be no prohibition on making public funds available to support this research. (3) Future clinical application of human germline genome editing should not proceed unless, at a minimum, there is (a) a compelling medical rationale, (b) an evidence base that supports its clinical use, (c) an ethical justification, and (d) a transparent public process to solicit and incorporate stakeholder input. Copyright © 2017 American Society of Human Genetics. All rights reserved.

A Historical Evaluation of the U15 Complex, Nevada National Security Site, Nye County, Nevada

Energy Technology Data Exchange (ETDEWEB)

Drollinger, Harold [Desert Research Inst., Nevada University, Reno, NV (United States); Holz, Barbara A. [Desert Research Inst., Nevada University, Reno, NV (United States); Bullard, Thomas F. [Desert Research Inst., Nevada University, Reno, NV (United States); Goldenberg, Nancy G. [Desert Research Inst., Nevada University, Reno, NV (United States); Ashbaugh, Laurence J. [Desert Research Inst., Nevada University, Reno, NV (United States); Griffin, Wayne R. [Desert Research Inst., Nevada University, Reno, NV (United States)

2014-01-01

summer of 2011. It was discovered that major modifications to the terrain have resulted from four principal activities. These are road construction and maintenance, mining activities related to development of the tunnel complex, site preparation for activities related to the tests and experiments, and construction of drill pads and retention ponds. Six large trenches for exploring across the Boundary geologic fault are also present. The U15 Complex, designated historic district 143 and site 26NY15177, is eligible to the National Register of Historic Places under Criteria A, C, and D of 36 CFR Part 60.4. As a historic district and archaeological site eligible to the National Register of Historic Places, the Desert Research Institute recommends that the area defined for the U15 Complex, historic district 143 and site 26NY15117, be left in place in its current condition. The U15 Complex should also be included in the NNSS cultural resources monitoring program and monitored for disturbances or alterations.

A Historical Evaluation of the U15 Complex, Nevada National Security Site, Nye County, Nevada

Energy Technology Data Exchange (ETDEWEB)

Drollinger, Harold [Desert Research Inst., Nevada University, Reno, NV (United States); Holz, Barbara A. [Desert Research Inst., Nevada University, Reno, NV (United States); Bullard, Thomas F. [Desert Research Inst., Nevada University, Reno, NV (United States); Goldenberg, Nancy G. [Desert Research Inst., Nevada University, Reno, NV (United States); Ashbaugh, Laurence J. [Desert Research Inst., Nevada University, Reno, NV (United States); Griffin, Wayne R. [Desert Research Inst., Nevada University, Reno, NV (United States)

2014-01-09

summer of 2011. It was discovered that major modifications to the terrain have resulted from four principal activities. These are road construction and maintenance, mining activities related to development of the tunnel complex, site preparation for activities related to the tests and experiments, and construction of drill pads and retention ponds. Six large trenches for exploring across the Boundary geologic fault are also present. The U15 Complex, designated historic district 143 and site 26NY15177, is eligible to the National Register of Historic Places under Criteria A, C, and D of 36 CFR Part 60.4. As a historic district and archaeological site eligible to the National Register of Historic Places, the Desert Research Institute recommends that the area defined for the U15 Complex, historic district 143 and site 26NY15117, be left in place in its current condition. The U15 Complex should also be included in the NNSS cultural resources monitoring program and monitored for disturbances or alterations.

Cytochrome c1 exhibits two binding sites for cytochrome c in plants.

Science.gov (United States)

Moreno-Beltrán, Blas; Díaz-Quintana, Antonio; González-Arzola, Katiuska; Velázquez-Campoy, Adrián; De la Rosa, Miguel A; Díaz-Moreno, Irene

2014-10-01

In plants, channeling of cytochrome c molecules between complexes III and IV has been purported to shuttle electrons within the supercomplexes instead of carrying electrons by random diffusion across the intermembrane bulk phase. However, the mode plant cytochrome c behaves inside a supercomplex such as the respirasome, formed by complexes I, III and IV, remains obscure from a structural point of view. Here, we report ab-initio Brownian dynamics calculations and nuclear magnetic resonance-driven docking computations showing two binding sites for plant cytochrome c at the head soluble domain of plant cytochrome c1, namely a non-productive (or distal) site with a long heme-to-heme distance and a functional (or proximal) site with the two heme groups close enough as to allow electron transfer. As inferred from isothermal titration calorimetry experiments, the two binding sites exhibit different equilibrium dissociation constants, for both reduced and oxidized species, that are all within the micromolar range, thus revealing the transient nature of such a respiratory complex. Although the docking of cytochrome c at the distal site occurs at the interface between cytochrome c1 and the Rieske subunit, it is fully compatible with the complex III structure. In our model, the extra distal site in complex III could indeed facilitate the functional cytochrome c channeling towards complex IV by building a "floating boat bridge" of cytochrome c molecules (between complexes III and IV) in plant respirasome. Copyright © 2014 Elsevier B.V. All rights reserved.

AAV Vectorization of DSB-mediated Gene Editing Technologies.

Science.gov (United States)

Moser, Rachel J; Hirsch, Matthew L

2016-01-01

Recent work both at the bench and the bedside demonstrate zinc-finger nucleases (ZFNs), CRISPR/Cas9, and other programmable site-specific endonuclease technologies are being successfully utilized within and alongside AAV vectors to induce therapeutically relevant levels of directed gene editing within the human chromosome. Studies from past decades acknowledge that AAV vector genomes are enhanced substrates for homology-directed repair in the presence or absence of targeted DNA damage within the host genome. Additionally, AAV vectors are currently the most efficient format for in vivo gene delivery with no vector related complications in >100 clinical trials for diverse diseases. At the same time, advancements in the design of custom-engineered site-specific endonucleases and the utilization of elucidated endonuclease formats have resulted in efficient and facile genetic engineering for basic science and for clinical therapies. AAV vectors and gene editing technologies are an obvious marriage, using AAV for the delivery of repair substrate and/or a gene encoding a designer endonuclease; however, while efficient delivery and enhanced gene targeting by vector genomes are advantageous, other attributes of AAV vectors are less desirable for gene editing technologies. This review summarizes the various roles that AAV vectors play in gene editing technologies and provides insight into its trending applications for the treatment of genetic diseases.

U.B.C.: Past, present and future

International Nuclear Information System (INIS)

Wall, W.D.

1993-01-01

This report documents the involvement of the International Conference of Building Officials (ICBO) in hazard mitigation, particularly in relation to earthquakes. It encompasses the history of the Uniform Building Code TM (U.B.C) provisions as they apply to earthquake hazard mitigation. Also discussed is Executive Order 12699. Conference membership services and benefits are reviewed and the future of ICBO, building codes and hazard mitigation are examined. The U.B.C. seismic provisions make a vast contribution to the design of buildings for seismic safety

Dicty_cDB: CHD152 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHD152 (Link to dictyBase) - - - - - (Link to Original site) C...HD152F 603 - - - - - - Show CHD152 Library CH (Link to library) Clone ID CHD152 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHD...Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum...UF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to

Fan edits and the legacy of The Phantom Edit

Directory of Open Access Journals (Sweden)

Joshua Wille

2014-09-01

Full Text Available A fan edit can generally be defined as an alternative version of a film or television text created by a fan. It offers a different viewing experience, much as a song remix offers a different listening experience. The contemporary wave of fan edits has emerged during the remix zeitgeist of digital media and at a time when digital video editing technology has become more affordable and popular. The increasing number of alternative versions of films and the works of revisionist Hollywood filmmakers such as George Lucas have contributed to a greater public understanding of cinema as a fluid medium instead of one that exists in a fixed form. The Phantom Edit (2000, a seminal fan edit based on Lucas's Star Wars Episode I: The Phantom Menace (1999, inspired new ranks of fan editors. However, critics have misunderstood fan edits as merely the work of disgruntled fans. In order to provide a critical and historical basis for studies in fan editing as a creative practice, I examine previous interpretations of fan edits in the context of relevant contemporary works, and I use an annotated chronology of The Phantom Edit to trace its influence on subsequent fan editing communities and uncover their relationship with intellectual property disputes.

Radioactive contamination, what actions for the polluted sites

International Nuclear Information System (INIS)

2004-01-01

The nuclear safety authority and the direction of prevention of pollutions and risks have organised the first edition of the national colloquium: radioactive contamination: what actions for polluted sites. Four axes can be taken to follow this colloquium: prevention, outstanding tools to evaluate risks and rehabilitation, a better responsibility of operators and memory keeping. (N.C.)

The somatic FAH C.1061C>A change counteracts the frequent FAH c.1062+5G>A mutation and permits U1snRNA-based splicing correction.

Science.gov (United States)

Scalet, Daniela; Sacchetto, Claudia; Bernardi, Francesco; Pinotti, Mirko; van de Graaf, Stan F J; Balestra, Dario

2018-05-01

In tyrosinaemia type 1(HT1), a mosaic pattern of fumarylacetoacetase (FAH) immunopositive or immunonegative nodules in liver tissue has been reported in many patients. This aspect is generally explained by a spontaneous reversion of the mutation into a normal genotype. In one HT1 patient carrying the frequent FAH c.1062+5G>A mutation, a second somatic change (c.1061C>A) has been reported in the same allele, and found in immunopositive nodules. Here, we demonstrated that the c.1062+5G>A prevents usage of the exon 12 5' splice site (ss), even when forced by an engineered U1snRNA specifically designed on the FAH 5'ss to strengthen its recognition. Noticeably the new somatic c.1061C>A change, in linkage with the c.1062+5G>A mutation, partially rescues the defective 5'ss and is associated to trace level (~5%) of correct transcripts. Interestingly, this combined genetic condition strongly favored the rescue by the engineered U1snRNA, with correct transcripts reaching up to 60%. Altogether, these findings elucidate the molecular basis of HT1 caused by the frequent FAH c.1062+5G>A mutation, and demonstrate the compensatory effect of the c.1061C>A change in promoting exon definition, thus unraveling a rare mechanism leading to FAH immune-reactive mosaicism.

The synthesis of [U-14C phenyl] LS 840606, an agricultural fungicide

International Nuclear Information System (INIS)

Madegard, G.; Mestre, P.; Raimond, P.; Noel, J.-P.

1995-01-01

2,2',4'-Trichloro-[ring U- 14 C]acetophenone was the key intermediate of this synthesis patterned after the industrial route. An unexpected poor yield was observed during the preparation by the Friedel-Crafts reaction of chloroacetyl chloride with 1,3-dichloro-[U- 14 C]benzene, possibly the result of an isotope effect although this poor yield might be explained by other factors. Two routes were checked for the preparation of 1,3-dichloro-[U- 14 C]benzene. The action of CCl 4 with 1,3-dinitro-[U- 14 C]benzene at 280 o C was entailed with explosions. A safer route started from [U- 14 C]aniline via 2,4-dichloro-[ring U- 14 C]acetanilide. Friedel-Crafts reaction with acetyl chloride gave rise in 52% yield to 2',4'-dichloro-[ring U- 14 C]acetophenone which was brominated to 2-bromo-2',4'-dichloro-[ring U- 14 C]acetophenone; was condensed with 2,2-ethylenedioxy)etylmagnesium bromide to compound, was condensed with 1,2,4-triazole then successively treated with HCl:water:dioxane and 2,2,2-trifluoroethanol/HCl. Separation of the two diastereomers by medium pressure liquid chromatography. 7% overall radioactivity yield from [U- 14 C]aniline. Radiochemical purity 99%. (author)

REDItools: high-throughput RNA editing detection made easy.

Science.gov (United States)

Picardi, Ernesto; Pesole, Graziano

2013-07-15

The reliable detection of RNA editing sites from massive sequencing data remains challenging and, although several methodologies have been proposed, no computational tools have been released to date. Here, we introduce REDItools a suite of python scripts to perform high-throughput investigation of RNA editing using next-generation sequencing data. REDItools are in python programming language and freely available at http://code.google.com/p/reditools/. ernesto.picardi@uniba.it or graziano.pesole@uniba.it Supplementary data are available at Bioinformatics online.

Regulatory factors governing adenosine-to-inosine (A-to-I) RNA editing.

Science.gov (United States)

Hong, HuiQi; Lin, Jaymie Siqi; Chen, Leilei

2015-03-31

Adenosine-to-inosine (A-to-I) RNA editing, the most prevalent mode of transcript modification in higher eukaryotes, is catalysed by the adenosine deaminases acting on RNA (ADARs). A-to-I editing imposes an additional layer of gene regulation as it dictates various aspects of RNA metabolism, including RNA folding, processing, localization and degradation. Furthermore, editing events in exonic regions contribute to proteome diversity as translational machinery decodes inosine as guanosine. Although it has been demonstrated that dysregulated A-to-I editing contributes to various diseases, the precise regulatory mechanisms governing this critical cellular process have yet to be fully elucidated. However, integration of previous studies revealed that regulation of A-to-I editing is multifaceted, weaving an intricate network of auto- and transregulations, including the involvement of virus-originated factors like adenovirus-associated RNA. Taken together, it is apparent that tipping of any regulatory components will have profound effects on A-to-I editing, which in turn contributes to both normal and aberrant physiological conditions. A complete understanding of this intricate regulatory network may ultimately be translated into new therapeutic strategies against diseases driven by perturbed RNA editing events. Herein, we review the current state of knowledge on the regulatory mechanisms governing A-to-I editing and propose the role of other co-factors that may be involved in this complex regulatory process.

Salmon Site Remedial Investigation Report, Appendix C

International Nuclear Information System (INIS)

1999-01-01

This Salmon Site Remedial Investigation Report provides the results of activities initiated by the U.S. Department of Energy (DOE) to determine if contamination at the Salmon Site poses a current or future risk to human health and the environment. These results were used to develop and evaluate a range of risk-based remedial alternatives. Located in Lamar County, Mississippi, the Salmon Site was used by the U.S. Atomic Energy Commission (predecessor to the DOE) between 1964 and 1970 for two nuclear and two gas explosions conducted deep underground in a salt dome. The testing resulted in the release of radionuclides into the salt dome. During reentry drilling and other site activities, liquid and solid wastes containing radioactivity were generated resulting in surface soil and groundwater contamination. Most of the waste and contaminated soil and water were disposed of in 1993 during site restoration either in the cavities left by the tests or in an injection well. Other radioactive wastes were transported to the Nevada Test Site for disposal. Nonradioactive wastes were disposed of in pits at the site and capped with clean soil and graded. The preliminary investigation showed residual contamination in the Surface Ground Zero mud pits below the water table. Remedial investigations results concluded the contaminant concentrations detected present no significant risk to existing and/or future land users, if surface institutional controls and subsurface restrictions are maintained. Recent sampling results determined no significant contamination in the surface or shallow subsurface. The test cavity resulting from the experiments is contaminated and cannot be economically remediated with existing technologies. The ecological sampling did not detect biological uptake of contaminants in the plants or animals sampled. Based on the current use of the Salmon Site, the following remedial actions were identified to protect both human health and the environment: (1) the

Salmon Site Remedial Investigation Report, Appendix C

Energy Technology Data Exchange (ETDEWEB)

US DOE/NV

1999-09-01

This Salmon Site Remedial Investigation Report provides the results of activities initiated by the U.S. Department of Energy (DOE) to determine if contamination at the Salmon Site poses a current or future risk to human health and the environment. These results were used to develop and evaluate a range of risk-based remedial alternatives. Located in Lamar County, Mississippi, the Salmon Site was used by the U.S. Atomic Energy Commission (predecessor to the DOE) between 1964 and 1970 for two nuclear and two gas explosions conducted deep underground in a salt dome. The testing resulted in the release of radionuclides into the salt dome. During reentry drilling and other site activities, liquid and solid wastes containing radioactivity were generated resulting in surface soil and groundwater contamination. Most of the waste and contaminated soil and water were disposed of in 1993 during site restoration either in the cavities left by the tests or in an injection well. Other radioactive wastes were transported to the Nevada Test Site for disposal. Nonradioactive wastes were disposed of in pits at the site and capped with clean soil and graded. The preliminary investigation showed residual contamination in the Surface Ground Zero mud pits below the water table. Remedial investigations results concluded the contaminant concentrations detected present no significant risk to existing and/or future land users, if surface institutional controls and subsurface restrictions are maintained. Recent sampling results determined no significant contamination in the surface or shallow subsurface. The test cavity resulting from the experiments is contaminated and cannot be economically remediated with existing technologies. The ecological sampling did not detect biological uptake of contaminants in the plants or animals sampled. Based on the current use of the Salmon Site, the following remedial actions were identified to protect both human health and the environment: (1) the

5 CFR 2640.302 - Waivers issued pursuant to 18 U.S.C. 208(b)(3).

Science.gov (United States)

2010-01-01

... actual or potential profit or loss or cost of the matter to the company issuing the stock, the change in...) Requirements for issuing an individual waiver under 18 U.S.C. 208(b)(3). Pursuant to 18 U.S.C. 208(b)(3), an...) The type of interest that is creating the disqualification (e.g. stock, bonds, real estate, other...

Book Review: Astronomy: A Self-Teaching Guide, 6th Edition

Science.gov (United States)

Marigza, R. N., Jr.

2009-03-01

The sixth edition of Moche's book is up-to-date with the latest in astronomy. It contains accurate astronomical data on stars and constellations. The topics are incorporated with web site addresses for the reader to expand his/her knowledge and see high-resolution images of the celestial targets. This edition incorporates new discoveries and suggestions made prior to the first editions. Among the new developments is the twenty-first-century research into black holes, active galaxies and quasars, searches for life in space, origin and structure of our universe, and the latest in ground and space telescopes.

In vivo carbon-edited detection with proton echo-planar spectroscopic imaging (ICED PEPSI) : [3,4-(CH2)-C-13] glutamate/glutamine tomography in rat brain

NARCIS (Netherlands)

Hyder, F; Renken, R; Rothman, DL

1999-01-01

A method for in vivo carbon-edited detection with proton echo-planar spectroscopic imaging (ICED PEPSI) is described. This method is composed of an echo-planar based acquisition implemented with C-13-H-1 J editing spectroscopy and is intended for high temporal and spatial resolution in vivo

A Historical Evaluation of the U16a Tunnel, Nevada National Security Site, Nye County, Nevada Volume 2

Energy Technology Data Exchange (ETDEWEB)

Jones, Roberrt C. [Desert Research Inst. (DRI), Reno, NV (United States); Drollinger, Harold [Desert Research Inst. (DRI), Reno, NV (United States)

2013-06-01

a Tunnel complex is eligible to the National Register of Historic Places under criteria a and c, consideration g of 36 CFR Part 60.4 as a historic landscape. Scientific research conducted at the tunnel has made significant contributions to the broad patterns of our history, particularly in regard to the Cold War era that was characterized by competing social, economic, and political ideologies between the former Soviet Union and the United States. The tunnel also possesses distinctive construction and engineering methods for conducting underground nuclear tests. The Desert Research Institute recommends that the U16a Tunnel area be left in place in its current condition and that the U16a Tunnel historic landscape be included in the Nevada National Security Site monitoring program and monitored on a regular basis.

A Historical Evaluation of the U16a Tunnel, Nevada National Security Site, Nye County, Nevada Volume 1

Energy Technology Data Exchange (ETDEWEB)

Jones, Robert C. [Desert Research Inst. (DRI), Reno, NV (United States); Drollinger, Harold [Desert Research Inst. (DRI), Reno, NV (United States); Bullard, Thomas F. [Desert Research Inst. (DRI), Reno, NV (United States); Ashbaugh, Laurence J. [Desert Research Inst. (DRI), Reno, NV (United States); Griffin, Wayne R. [Desert Research Inst. (DRI), Reno, NV (United States)

2013-01-01

a Tunnel complex is eligible to the National Register of Historic Places under criteria a and c, consideration g of 36 CFR Part 60.4 as a historic landscape. Scientific research conducted at the tunnel has made significant contributions to the broad patterns of our history, particularly in regard to the Cold War era that was characterized by competing social, economic, and political ideologies between the former Soviet Union and the United States. The tunnel also possesses distinctive construction and engineering methods for conducting underground nuclear tests. The Desert Research Institute recommends that the U16a Tunnel area be left in place in its current condition and that the U16a Tunnel historic landscape be included in the Nevada National Security Site monitoring program and monitored on a regular basis.

Geodatabase of sites, basin boundaries, and topology rules used to store drainage basin boundaries for the U.S. Geological Survey, Colorado Water Science Center

Science.gov (United States)

Dupree, Jean A.; Crowfoot, Richard M.

2012-01-01

This geodatabase and its component datasets are part of U.S. Geological Survey Digital Data Series 650 and were generated to store basin boundaries for U.S. Geological Survey streamgages and other sites in Colorado. The geodatabase and its components were created by the U.S. Geological Survey, Colorado Water Science Center, and are used to derive the numeric drainage areas for Colorado that are input into the U.S. Geological Survey's National Water Information System (NWIS) database and also published in the Annual Water Data Report and on NWISWeb. The foundational dataset used to create the basin boundaries in this geodatabase was the National Watershed Boundary Dataset. This geodatabase accompanies a U.S. Geological Survey Techniques and Methods report (Book 11, Section C, Chapter 6) entitled "Digital Database Architecture and Delineation Methodology for Deriving Drainage Basins, and Comparison of Digitally and Non-Digitally Derived Numeric Drainage Areas." The Techniques and Methods report details the geodatabase architecture, describes the delineation methodology and workflows used to develop these basin boundaries, and compares digitally derived numeric drainage areas in this geodatabase to non-digitally derived areas. 1. COBasins.gdb: This geodatabase contains site locations and basin boundaries for Colorado. It includes a single feature dataset, called BasinsFD, which groups the component feature classes and topology rules. 2. BasinsFD: This feature dataset in the "COBasins.gdb" geodatabase is a digital container that holds the feature classes used to archive site locations and basin boundaries as well as the topology rules that govern spatial relations within and among component feature classes. This feature dataset includes three feature classes: the sites for which basins have been delineated (the "Sites" feature class), basin bounding lines (the "BasinLines" feature class), and polygonal basin areas (the "BasinPolys" feature class). The feature dataset

Contribution to the study of U-Ti and U-Pu-Ti carbides

International Nuclear Information System (INIS)

Milet, C.A.

1968-01-01

After having discussed the reasons to use (U,Pu) carbides as fast reactor fuel, we examine the influence of the addition of titanium to these carbides. A preliminary study has been done on the system of U-C-Ti and some properties have been measured such as: density, thermal expansion, electrical resistivity, atmospheric corrosion and compatibility with stainless steel. The systems U-Pu-C-Ti (Pu/U + Pu equal to 15 per cent) and U-C-Ti have been found to be very similar. There exists a two phases region (U,Pu)C + TiC, an eutectic between (U,Pu)C and TiC for approximately 15 at %. The solubilities of U + Pu in TiC and of Ti in (U,Pu)C is less than 1 % at. The addition of titanium does not markedly change thermal expansion coefficients of (U,Pu)C. However the resistance to atmospheric corrosion and compatibility with stainless steel is improved. Thermal conductivity, calculated from electrical resistivity, has increased. On the other side, the density of fissile material is lowered. The combination of (U,Pu)C + TiC seems to be the most promising alloy for application as nuclear fuel. (author) [fr

Nevada National Security Site-Directed Research and Development FY 2011 Annual Report

Energy Technology Data Exchange (ETDEWEB)

Howard Bender, comp.

2012-04-25

This fiscal year 2011 annual report of the Site-Directed Research and Development program, the 10th anniversary edition, recognizes a full decade of innovative R&D accomplishments in support of the Nevada National Security Site (NNSS). Last year the NNSS itself was renamed to reflect a diversifying mission, and our R&D program has contributed significantly to shape emerging missions that will continue to evolve. New initiatives in stockpile stewardship science, nonproliferation, and treaty verification and monitoring have had substantial successes in FY 2011, and many more accomplishments are expected. SDRD is the cornerstone on which many of these initiatives rest. Historically supporting our main focus areas, SDRD is also building a solid foundation for new, and non-traditional, emerging national security missions. The program continues its charter to advance science and technology for a broad base of agencies including the U.S. Department of Energy (DOE), U.S. Department of Defense (DoD), U.S. Department of Homeland Security (DHS), and many others.

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC171 (Link to dictyBase) - - - Contig-U16478-1 VFC171P (Link... to Original site) VFC171F 482 VFC171Z 633 VFC171P 1115 - - Show VFC171 Library VF (Link to library) Clone ID VFC171 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...ptttrlptt trlstttrlptttrlptttrlptttrlptttrlsttrlxtttrlstswctswctswictr ygswissrllcwynhs*l*t*c*sfkksnerywyk*i...ologous to C-terminal repeat sequence of rhodopsin and synaptophysin. 88 1e-15 3 X54062 |X54062.1 Dictyostel

Explanatory Supplement to the Astronomical Almanac, Third Edition

Science.gov (United States)

Seidelmann, P. Kenneth; Urban, S. E.

2010-01-01

"The Explanatory Supplement to the Astronomical Almanac" (hereafter "The Explanatory Supplement") is a comprehensive reference book on the topic of positional astronomy, covering the theories and algorithms used to produce "The Astronomical Almanac" (AsA), an annual publication produced jointly by the Nautical Almanac Office of the US Naval Observatory (USNO) and Her Majesty's Nautical Almanac Office (HMNAO) of the UK Hydrographic Office. The first edition of The Explanatory Supplement appeared in 1961 and was reprinted with amendments during the 1970s. The second edition was printed in 1992 and reprinted until 2006. Since the second edition, several changes have taken place in positional astronomy regarding reference systems and internationally accepted models, data sets, and computational methods; these have been incorporated into the AsA. Additionally, the data presented in the AsA have been modified over the years, with new tables being added and some being discontinued. Given these changes, a new edition of The Explanatory Supplement is appropriate. The third edition has been in development for the last few years and will be available in 2010. The book is organized similarly to the second (1991) edition, with each chapter written by subject matter experts. Authors from USNO and HMNAO contributed to the majority of the book, but there are authors from Jet Propulsion Laboratory, Technical University of Dresden, National Geospatial-Intelligence Agency, University of Texas Austin, and University of Virginia. This paper will discuss this latest edition of the Explanatory Supplement.

[Advances in CRISPR-Cas-mediated genome editing system in plants].

Science.gov (United States)

Wang, Chun; Wang, Kejian

2017-10-25

Targeted genome editing technology is an important tool to study the function of genes and to modify organisms at the genetic level. Recently, CRISPR-Cas (clustered regularly interspaced short palindromic repeats and CRISPR-associated proteins) system has emerged as an efficient tool for specific genome editing in animals and plants. CRISPR-Cas system uses CRISPR-associated endonuclease and a guide RNA to generate double-strand breaks at the target DNA site, subsequently leading to genetic modifications. CRISPR-Cas system has received widespread attention for manipulating the genomes with simple, easy and high specificity. This review summarizes recent advances of diverse applications of the CRISPR-Cas toolkit in plant research and crop breeding, including expanding the range of genome editing, precise editing of a target base, and efficient DNA-free genome editing technology. This review also discusses the potential challenges and application prospect in the future, and provides a useful reference for researchers who are interested in this field.

Dicty_cDB: SLC465 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLC465 (Link to dictyBase) - G01923 DDB0190872 Contig-U14177-1 SLC4...65P (Link to Original site) SLC465F 725 SLC465Z 393 SLC465P 1118 - - Show SLC465 Library SL (Link to library) Clone ID SLC4...Contig-U14177-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC4...65Q.Seq.d/ Representative seq. ID SLC465P (Link to Original site) Representative DNA sequence >SLC465 (SLC465Q) /CSM/SL/SLC4...-C/SLC465Q.Seq.d/ CGTTAACAGATTTTAATATTACTAATATTGTAGAAAATGATTTTAAATAAAGTAGCAAAA TGTTATG

Site-selective 13C labeling of proteins using erythrose

International Nuclear Information System (INIS)

Weininger, Ulrich

2017-01-01

NMR-spectroscopy enables unique experimental studies on protein dynamics at atomic resolution. In order to obtain a full atom view on protein dynamics, and to study specific local processes like ring-flips, proton-transfer, or tautomerization, one has to perform studies on amino-acid side chains. A key requirement for these studies is site-selective labeling with 13 C and/or 1 H, which is achieved in the most general way by using site-selectively 13 C-enriched glucose (1- and 2- 13 C) as the carbon source in bacterial expression systems. Using this strategy, multiple sites in side chains, including aromatics, become site-selectively labeled and suitable for relaxation studies. Here we systematically investigate the use of site-selectively 13 C-enriched erythrose (1-, 2-, 3- and 4- 13 C) as a suitable precursor for 13 C labeled aromatic side chains. We quantify 13 C incorporation in nearly all sites in all 20 amino acids and compare the results to glucose based labeling. In general the erythrose approach results in more selective labeling. While there is only a minor gain for phenylalanine and tyrosine side-chains, the 13 C incorporation level for tryptophan is at least doubled. Additionally, the Phe ζ and Trp η2 positions become labeled. In the aliphatic side chains, labeling using erythrose yields isolated 13 C labels for certain positions, like Ile β and His β, making these sites suitable for dynamics studies. Using erythrose instead of glucose as a source for site-selective 13 C labeling enables unique or superior labeling for certain positions and is thereby expanding the toolbox for customized isotope labeling of amino-acid side-chains.

U S spacesuits

CERN Document Server

Thomas, Kenneth S

2012-01-01

Spacesuits are far more than garments. They are a personalized spacecraft that allows direct contact and interaction with everything beyond our world, and a last refuge for survival in a disaster. Creating safe, reliable, and comfortable spacesuits is an ongoing challenge that has spanned over four decades. "U. S. Spacesuits, 2nd Edition" by Kenneth S. Thomas and Harold J. McMann details the technical evolution of U. S. spacesuits from their roots in high altitude aviation and vacuum tube development to present day, with an additional look into the future. This primary source of spacesuit information explains the functions, historical development, and use of spacesuits from a worldwide perspective. In this new edition, the authors update the story of U.S. spacesuit development and efforts, from the design challenges modern engineers face to the latest roles of spacesuits in space exploration. The book also provides a close up look at NASA's new Constellation Space Suit System as well as Apollo prototype confi...

Edit Distance to Monotonicity in Sliding Windows

DEFF Research Database (Denmark)

Chan, Ho-Leung; Lam, Tak-Wah; Lee, Lap Kei

2011-01-01

Given a stream of items each associated with a numerical value, its edit distance to monotonicity is the minimum number of items to remove so that the remaining items are non-decreasing with respect to the numerical value. The space complexity of estimating the edit distance to monotonicity of a ...

Determination of the hydrothermal degradation products of D-(U-14C) glucose and D-(U-14C) fructose by TLC

International Nuclear Information System (INIS)

Bonn, G.; Bobleter, O.

1983-01-01

Hydrothermal degradation was examined using D-(U- 14 C) glucose and D-(U- 14 C) fructose. By thin layer chromatography with methylene chloride, tetrahydrofuran (THF), acetic acid - 60:20:20 as a mobile phase; it was possible to separate and identify the carbohydrates and their reaction products, glyceraldehyde, dihydroxyacetone, methylglyoxal, glycolaldehyde, 5-hydroxymethylfurfural and furfural. Up to 99% of the initial activity was determined by scintillation counting of the TL-chromatograms. A reaction scheme for the hydrothermal degradation of glucose and fructose was obtained from these results. (author)

Dicty_cDB: VSK476 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VS (Link to library) VSK476 (Link to dictyBase) - - - Contig-U07114-1 VSK476Z (Link... to Original site) - - VSK476Z 291 - - - - Show VSK476 Library VS (Link to library) Clone ID VSK476 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07114-1 Original site URL http://dict...239C9 in linkage group 3. 46 0.24 1 BM495069 |BM495069.1 IpCGBr1_4_C04_22 Ictalur...us punctatus Brain1 primary library Ictalurus punctatus cDNA clone IpCGBr1_4_C04_22_07Mar00_034 3', mRNA seq

Development of a CRISPR/Cas9 genome editing toolbox for Corynebacterium glutamicum.

Science.gov (United States)

Liu, Jiao; Wang, Yu; Lu, Yujiao; Zheng, Ping; Sun, Jibin; Ma, Yanhe

2017-11-16

Corynebacterium glutamicum is an important industrial workhorse and advanced genetic engineering tools are urgently demanded. Recently, the clustered regularly interspaced short palindromic repeats (CRISPR) and their CRISPR-associated proteins (Cas) have revolutionized the field of genome engineering. The CRISPR/Cas9 system that utilizes NGG as protospacer adjacent motif (PAM) and has good targeting specificity can be developed into a powerful tool for efficient and precise genome editing of C. glutamicum. Herein, we developed a versatile CRISPR/Cas9 genome editing toolbox for C. glutamicum. Cas9 and gRNA expression cassettes were reconstituted to combat Cas9 toxicity and facilitate effective termination of gRNA transcription. Co-transformation of Cas9 and gRNA expression plasmids was exploited to overcome high-frequency mutation of cas9, allowing not only highly efficient gene deletion and insertion with plasmid-borne editing templates (efficiencies up to 60.0 and 62.5%, respectively) but also simple and time-saving operation. Furthermore, CRISPR/Cas9-mediated ssDNA recombineering was developed to precisely introduce small modifications and single-nucleotide changes into the genome of C. glutamicum with efficiencies over 80.0%. Notably, double-locus editing was also achieved in C. glutamicum. This toolbox works well in several C. glutamicum strains including the widely-used strains ATCC 13032 and ATCC 13869. In this study, we developed a CRISPR/Cas9 toolbox that could facilitate markerless gene deletion, gene insertion, precise base editing, and double-locus editing in C. glutamicum. The CRISPR/Cas9 toolbox holds promise for accelerating the engineering of C. glutamicum and advancing its application in the production of biochemicals and biofuels.

Introduction to nuclear science, second edition

CERN Document Server

Bryan, Jeff C.

2013-01-01

This book was written to provide students who have limited backgrounds in the physical sciences and math with an accessible textbook on nuclear science. Expanding on the foundation of the bestselling first edition, Introduction to Nuclear Science, Second Edition provides a clear and complete introduction to nuclear chemistry and physics, from basic concepts to nuclear power and medical applications. Incorporating suggestions from professors using this book for their courses, the author has created a new text that is approximately 60 percent larger and more comprehensive and flexible than the first.New to This Edition: Thorough review of nuclear forensics, radiology, gamma cameras, and decay through proton or neutron emission More detailed explanations of the necessary mathematics A chapter on dosimetry of radiation fields Expanded discussion of applications, introduced earlier in the text More in-depth coverage of nuclear reactors, including a new chapter examining more reactor types, their safety systems,...

Introduction to Energy - 2nd Edition

Science.gov (United States)

Cassedy, Edward S.; Grossman, Peter Z.

1998-12-01

Energy issues such as pollution, resource depletion, global warming, nuclear power and waste are problems that demand timely solutions. This book provides a critical examination of the resources, market forces, and social impacts of modern energy production. The book addresses the dilemmas that have arisen due to society's crucial dependence on energy, particularly fossil fuels, and explores the available alternative energy producing technologies. The second edition has increased emphasis on those issues at the forefront of the current energy debate: energy sustainability, climate change, and the radical restructuring of the power industry due to de-regulation. Assuming no prior technical expertise and avoiding complex mathematical formulation, it is directed at a broad readership. The second edition will follow the first in proving especially useful as a textbook for undergraduate programs in Science, Technology and Society (STS), and as a supplementary text in a variety of courses which touch upon energy studies, including environmental and technology policy, environmental, mineral and business law, energy and resource economics. Fully updated second edition of successful first edition that was adopted on Science, Technology and Society courses Provides a critical examination of all aspects of modern energy production for non-technical readers For a broad readership from a variety of backgrounds

Dicty_cDB: SLH678 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLH678 (Link to dictyBase) - - - Contig-U04159-1 SLH678E (Link... to Original site) - - - - - - SLH678E 373 Show SLH678 Library SL (Link to library) Clone ID SLH678 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04159-1 Original site URL http://dict... producing significant alignments: (bits) Value N ( AU039970 ) Dictyostelium discoideum slug cDNA, clone SLG...865. 323 e-129 2 ( AU039381 ) Dictyostelium discoideum slug cDNA, clone SLH678. 3

Genome Editing of Monkey.

Science.gov (United States)

Liu, Zhen; Cai, Yijun; Sun, Qiang

2017-01-01

Gene-modified monkey models would be particularly valuable in biomedical and neuroscience research. Virus-based transgenic and programmable nucleases-based site-specific gene editing methods (TALEN, CRISPR-cas9) enable the generation of gene-modified monkeys with gain or loss of function of specific genes. Here, we describe the generation of transgenic and knock-out (KO) monkeys with high efficiency by lentivirus and programmable nucleases.

Characteristics and Effectiveness of the U.S. State E-Government-to-Business Services

Science.gov (United States)

Zhao, Jensen J.; Truell, Allen; Alexander, Melody W.

2008-01-01

This study examined the user-interface characteristics and effectiveness of the e-government-to-business (G2B) sites of the 50 U.S. states and Washington, D.C. A group of 306 online users were trained to assess the sites. The findings indicate that the majority of the state G2B sites included the user-interface characteristics that provided online…

Contribution to the U$_2$C$_3$ formation by the synthetic reaction and by the decomposition of UC$_2$; Beitrag zur U$_2$C$_3$-bildung nach der synthetischen reaktion und durch zerfall von UC$_2$

Energy Technology Data Exchange (ETDEWEB)

Buschinelli, A. J.A.

1974-06-01

This work is a contribution to the study of the mechanism and of the kinetics of the U$_2$C$_3$ formation by the synthetic reaction. The influences of a mechanical and a thermical pre-treatment of the samples on the reaction kinetics were investigated and discussed taking into account other information from the literature. The relative increasing of the U$_2$C$_3$ nucleation rate due to the pulverization corresponds approximately to the surface enlargement of the pulverized material. The activation energy for the synthetic reaction in powder was found to be 94 +- 7 kcal/mol. The negative influence of nitrogen, oxygen and tungsten on the U$_2$C$_3$ formation was reported. In the decomposition of UC$_2$ to U$_2$C$_3$ and graphite, the influences of the morphology of the graphite precipitate and the fast neutron irradiation on the beginning of the U$_2$C$_3$ formation were also investigated.

Double-target Antisense U1snRNAs Correct Mis-splicing Due to c.639+861C>T and c.639+919G>A GLA Deep Intronic Mutations

Directory of Open Access Journals (Sweden)

Lorenzo Ferri

2016-01-01

Full Text Available Fabry disease is a rare X-linked lysosomal storage disorder caused by deficiency of the α-galactosidase A (α-Gal A enzyme, which is encoded by the GLA gene. GLA transcription in humans produces a major mRNA encoding α-Gal A and a minor mRNA of unknown function, which retains a 57-nucleotide-long cryptic exon between exons 4 and 5, bearing a premature termination codon. NM_000169.2:c.639+861C>T and NM_000169.2:c.639+919G>A GLA deep intronic mutations have been described to cause Fabry disease by inducing overexpression of the alternatively spliced mRNA, along with a dramatic decrease in the major one. Here, we built a wild-type GLA minigene and two minigenes that carry mutations c.639+861C>T and c.639+919G>A. Once transfected into cells, the minigenes recapitulate the molecular patterns observed in patients, at the mRNA, protein, and enzymatic level. We constructed a set of specific double-target U1asRNAs to correct c.639+861C>T and c.639+919G>A GLA mutations. Efficacy of U1asRNAs in inducing the skipping of the cryptic exon was evaluated upon their transient co-transfection with the minigenes in COS-1 cells, by real-time polymerase chain reaction (PCR, western blot analysis, and α-Gal A enzyme assay. We identified a set of U1asRNAs that efficiently restored α-Gal A enzyme activity and the correct splicing pathways in reporter minigenes. We also identified a unique U1asRNA correcting both mutations as efficently as the mutation-specific U1asRNAs. Our study proves that an exon skipping-based approach recovering α-Gal A activity in the c.639+861C>T and c.639+919G>A GLA mutations is active.

Single-edition quadrangle maps

Science.gov (United States)

,

1998-01-01

In August 1993, the U.S. Geological Survey's (USGS) National Mapping Division and the U.S. Department of Agriculture's Forest Service signed an Interagency Agreement to begin a single-edition joint mapping program. This agreement established the coordination for producing and maintaining single-edition primary series topographic maps for quadrangles containing National Forest System lands. The joint mapping program saves money by eliminating duplication of effort by the agencies and results in a more frequent revision cycle for quadrangles containing national forests. Maps are revised on the basis of jointly developed standards and contain normal features mapped by the USGS, as well as additional features required for efficient management of National Forest System lands. Single-edition maps look slightly different but meet the content, accuracy, and quality criteria of other USGS products. The Forest Service is responsible for the land management of more than 191 million acres of land throughout the continental United States, Alaska, and Puerto Rico, including 155 national forests and 20 national grasslands. These areas make up the National Forest System lands and comprise more than 10,600 of the 56,000 primary series 7.5-minute quadrangle maps (15-minute in Alaska) covering the United States. The Forest Service has assumed responsibility for maintaining these maps, and the USGS remains responsible for printing and distributing them. Before the agreement, both agencies published similar maps of the same areas. The maps were used for different purposes, but had comparable types of features that were revised at different times. Now, the two products have been combined into one so that the revision cycle is stabilized and only one agency revises the maps, thus increasing the number of current maps available for National Forest System lands. This agreement has improved service to the public by requiring that the agencies share the same maps and that the maps meet a

The synthesis of [U-{sup 14}C phenyl] LS 840606, an agricultural fungicide

Energy Technology Data Exchange (ETDEWEB)

Madegard, G.; Mestre, P.; Raimond, P.; Noel, J.-P. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France)

1995-12-01

2,2`,4`-Trichloro-[ring U-{sup 14}C]acetophenone was the key intermediate of this synthesis patterned after the industrial route. An unexpected poor yield was observed during the preparation by the Friedel-Crafts reaction of chloroacetyl chloride with 1,3-dichloro-[U-{sup 14}C]benzene, possibly the result of an isotope effect although this poor yield might be explained by other factors. Two routes were checked for the preparation of 1,3-dichloro-[U-{sup 14} C]benzene. The action of CCl{sub 4} with 1,3-dinitro-[U-{sup 14} C]benzene at 280{sup o}C was entailed with explosions. A safer route started from [U-{sup 14}C]aniline via 2,4-dichloro-[ring U-{sup 14}C]acetanilide. Friedel-Crafts reaction with acetyl chloride gave rise in 52% yield to 2`,4`-dichloro-[ring U-{sup 14}C]acetophenone which was brominated to 2-bromo-2`,4`-dichloro-[ring U-{sup 14}C]acetophenone; was condensed with 2,2-(ethylenedioxy)etylmagnesium bromide to compound, was condensed with 1,2,4-triazole then successively treated with HCl:water:dioxane and 2,2,2-trifluoroethanol/HCl. Separation of the two diastereomers by medium pressure liquid chromatography. 7% overall radioactivity yield from [U-{sup 14}C]aniline. Radiochemical purity 99%. (author).

RNA editing makes mistakes in plant mitochondria: editing loses sense in transcripts of a rps19 pseudogene and in creating stop codons in coxI and rps3 mRNAs of Oenothera.

Science.gov (United States)

Schuster, W; Brennicke, A

1991-01-01

An intact gene for the ribosomal protein S19 (rps19) is absent from Oenothera mitochondria. The conserved rps19 reading frame found in the mitochondrial genome is interrupted by a termination codon. This rps19 pseudogene is cotranscribed with the downstream rps3 gene and is edited on both sides of the translational stop. Editing, however, changes the amino acid sequence at positions that were well conserved before editing. Other strange editings create translational stops in open reading frames coding for functional proteins. In coxI and rps3 mRNAs CGA codons are edited to UGA stop codons only five and three codons, respectively, downstream to the initiation codon. These aberrant editings in essential open reading frames and in the rps19 pseudogene appear to have been shifted to these positions from other editing sites. These observations suggest a requirement for a continuous evolutionary constraint on the editing specificities in plant mitochondria. Images PMID:1762921

Study on the leach mechanism of 90-19/U glass form in underground water of disposal site

International Nuclear Information System (INIS)

Sheng Jiawei; Luo Shanggeng; Tang Baolong

1996-01-01

The leach behavior of 90-19/U glass form in underground water (UW) of disposal site and in the deionized water (DIW) is studied. The total mass losses of glass form and the normalized element mass losses of B, Li and Si in UW are presented and compared to DIW. It is found that the ions in UW affect the leach behavior of 90-19/U glass. At the beginning of the reaction the reaction rate of the glass is smaller in UW than in DIW due to the low glass dissolution affinity in UW which is defined as (1-c/K). The rate determining step of leach reaction of 90-19/U glass in UW during the entire reaction period is the ion-exchange reaction. The apparent activation energy of glass reaction in UW is 51.6 kJ/mol

Dicty_cDB: Contig-U14477-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available vmvvvivfylqviynlriivilmvqlivivf*mglvmvtviiivivii i*rinnnnsnnnnnsnnnkikmif*yqiinrlnnyf*shyqkfiiiqrldfwdyqrler* *hhlyqrlvnqvvivq*fhwisl...amvlaimxxx own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14477-1 (Conti

Environmental site description for a Uranium Atomic Vapor Laser Isotope Separation (U-AVLIS) production plant at the Oak Ridge Gaseous Diffusion Plant Site

Energy Technology Data Exchange (ETDEWEB)

1991-09-01

In January 1990, the Secretary of Energy approved a plan for the demonstration and deployment of the Uranium Atomic Vapor Laser Isotope Separation (U-AVLIS) technology, with the near-term goal to provide the necessary information to make a deployment decision by November 1992. The U-AVLIS process is based on electrostatic extraction of photoionized U-235 atoms from an atomic vapor stream created by electron-beam vaporization of uranium metal alloy. A programmatic document for use in screening DOE sites to locate the U-AVLIS production plant was developed and implemented in two parts (Wolsko et al. 1991). The first part consisted of a series of screening analyses, based on exclusionary and other criteria, that identified a reasonable number of candidate sites. These sites were then subjected to a more rigorous and detailed comparative analysis for the purpose of developing a short list of reasonable alternative sites for later environmental examination. This environmental site description (ESD) provides a detailed description of the ORGDP site and vicinity suitable for use in an environmental impact statement (EIS). The report is based on existing literature, data collected at the site, and information collected by Argonne National Laboratory (ANL) staff during a site visit. The organization of the ESD is as follows. Topics addressed in Sec. 2 include a general site description and the disciplines of geology, water resources, biotic resources, air resources, noise, cultural resources, land use, socioeconomics, and waste management. Identification of any additional data that would be required for an EIS is presented in Sec. 3. Following the site description and additional data requirements, Sec. 4 provides a short, qualitative assessment of potential environmental issues. 37 refs., 20 figs., 18 tabs.

Environmental site description for a Uranium Atomic Vapor Laser Isotope Separation (U-AVLIS) production plant at the Oak Ridge Gaseous Diffusion Plant Site

International Nuclear Information System (INIS)

1991-09-01

In January 1990, the Secretary of Energy approved a plan for the demonstration and deployment of the Uranium Atomic Vapor Laser Isotope Separation (U-AVLIS) technology, with the near-term goal to provide the necessary information to make a deployment decision by November 1992. The U-AVLIS process is based on electrostatic extraction of photoionized U-235 atoms from an atomic vapor stream created by electron-beam vaporization of uranium metal alloy. A programmatic document for use in screening DOE sites to locate the U-AVLIS production plant was developed and implemented in two parts (Wolsko et al. 1991). The first part consisted of a series of screening analyses, based on exclusionary and other criteria, that identified a reasonable number of candidate sites. These sites were then subjected to a more rigorous and detailed comparative analysis for the purpose of developing a short list of reasonable alternative sites for later environmental examination. This environmental site description (ESD) provides a detailed description of the ORGDP site and vicinity suitable for use in an environmental impact statement (EIS). The report is based on existing literature, data collected at the site, and information collected by Argonne National Laboratory (ANL) staff during a site visit. The organization of the ESD is as follows. Topics addressed in Sec. 2 include a general site description and the disciplines of geology, water resources, biotic resources, air resources, noise, cultural resources, land use, socioeconomics, and waste management. Identification of any additional data that would be required for an EIS is presented in Sec. 3. Following the site description and additional data requirements, Sec. 4 provides a short, qualitative assessment of potential environmental issues. 37 refs., 20 figs., 18 tabs

Excavation of Site U14/1945, Oropi Valley, Tauranga

International Nuclear Information System (INIS)

Campbell, M.

2004-01-01

Site U14/1945 was originally recorded as two small terraces, with two probable kumara storage pits visible on the surface of the upper terrace, and shell midden visible on the surface of the lower terrace, on a low, approximately 4 m high, hill. The most unusual feature in the site, and my main purpose in writing this paper, was the oven scoop in Trench 1. This feature appeared rather unusual when excavated for a number of reasons. 6 refs., 6 figs., 1 tab

Oxidation behavior of U-Si compounds in air from 25 to 1000 C

Science.gov (United States)

Sooby Wood, E.; White, J. T.; Nelson, A. T.

2017-02-01

The air oxidation behavior of U3Si2, USi, and U3Si5 is studied from room temperature to 1000 C. The onsets of breakaway oxidation for each compound are identified during synthetic air ramps to 1000 C using thermogravimetric analysis. Isothermal air oxidation tests are performed below and above the breakaway oxidation onset to discern the oxidation kinetic behavior of these candidate accident tolerant fuel forms. Uranium metal is tested in the same manner to provide a reference for the oxidation behavior. Thermogravimetric, x-ray diffraction, and scanning electron microscopy analysis are presented here along with a discussion of the oxidation behavior of these materials and the impact of the lack of oxidation resistance to their deployment as accident tolerant nuclear fuels.

IMRT fluence map editing to control hot and cold spots

International Nuclear Information System (INIS)

Taylor Cook, J.; Tobler, Matt; Leavitt, Dennis D.; Watson, Gordon

2005-01-01

Manually editing intensity-modulated radiation therapy (IMRT) fluence maps effectively controls hot and cold spots that the IMRT optimization cannot control. Many times, re-optimizing does not reduce the hot spots or increase the cold spots. In fact, re-optimizing only places the hot and cold spots in different locations. Fluence-map editing provides manual control of dose delivery and provides the best treatment plan possible. Several IMRT treatments were planned using the Varian Eclipse planning system. We compare the effects on dose distributions between fluence-map editing and re-optimization, discuss techniques for fluence-map editing, and analyze differences between fluence editing on one beam vs. multiple beams. When editing a beam's fluence map, it is essential to choose a beam that least affects dose to the tumor and critical structures. Editing fluence maps gives an advantage in treatment planning and provides controlled delivery of IMRT dose

Initial Characterization of the Wave Resource at Several High Energy U.S. Sites

OpenAIRE

Dallman, Ann; Neary, Vincent S.

2014-01-01

Wave energy resource characterization efforts are critical for developing knowledge of the physical conditions experienced by wave energy converter (WEC) devices and arrays. Developers are lacking a consistent characterization of possible wave energy test sites, and therefore Sandia National Laboratories (SNL) has been tasked with developing a catalogue characterizing three high energy U.S. test sites. The initial results and framework for the catalogue are discussed in this paper. U.S. De...

Dicty_cDB: VFB113 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd

Overview of C-2U FRC Experimental Program and Plans for C-2W

Science.gov (United States)

Gota, H.; Binderbauer, M. W.; Tajima, T.; Putvinski, S.; Tuszewski, M.; Dettrick, S.; Korepanov, S.; Smirnov, A.; Thompson, M. C.; Yang, X.; Cappello, M.; Ivanov, A. A.; TAE Team

2016-10-01

Tri Alpha Energy's experimental program has been focused on a demonstration of reliable field-reversed configuration (FRC) formation and sustainment, driven by fast ions via high-power neutral-beam (NB) injection. The world's largest compact-toroid experimental devices, C-2 and C-2U, have successfully produced a well-stabilized, sustainable FRC plasma state with NB injection (input power, PNB 10 + MW; 15 keV hydrogen) and end-on coaxial plasma guns. Remarkable improvements in confinement and stability of FRC plasmas have led to further improved fast-ion build up; thereby, an advanced beam-driven FRC state has been produced and sustained for up to 5 + ms (longer than all characteristic system time scales), only limited by hardware and electric supply constraints such as NB and plasma-gun power supplies. To further improve the FRC performance the C-2U device is being replaced by C-2W featuring higher injected NB power, longer pulse duration as well as enhanced edge-biasing systems and substantially upgraded divertors. Main C-2U experimental results and key features of C-2W will be presented. Tri Alpha Energy, Inc.

Water-rock interactions in volcaniclastic sediments across the Izu-Bonin-Mariana Arc: comparison of sites U1438, U1201, 792 and 793.

Science.gov (United States)

van der Land, C.; Sena, C.; Loudin, L. C.; Zhang, Z.

2014-12-01

The rapid deposition of volcanogenic sediments, highly susceptible to alteration by seawater has led to distinct pore water geochemical profiles throughout the sedimentary basins of the Izu-Bonin-Mariana Arc. Drilling at Site U1438, in the Amami-Sankaku Basin, recovered a 1300 m thick volcaniclastic section overlain by a 160 m thick section of sediments largely devoid of volcanic input. At Site U1438, 67 porewater samples were analyzed onboard for salinity, pH, oxidation-reduction potential and major and trace element concentrations. Here we focus on the depth profiles of elements which were also analyzed at Sites U1201, 792 and 793. Chloride and Bromide concentrations display similar trends; near constant in the upper 160 m and a linear downward increase to maximum concentrations from 600 mbsf onwards. This increase is likely caused by uptake of water by secondary minerals, resulting in chloride and bromide enrichment in the porewater. Calcium and magnesium porewater concentrations display opposite trends in the upper 440 m; the first increases from 11.5 to 140 mM, and the latter decreases from 53 mM until its depletion in the porewater. Leaching of Ca from the glass-rich sediments and underlying igneous basement are potential sources for Ca in the porewater, while Mg, Na and K presumably replace Ca through cation-exchange. Compared to Site U1438, similar trends of major elements concentration in the pore water were observed at the nearby Sites U1201 (serpentine mud volcano in the forearc of the Mariana subduction system), 792 and 793 (both in the Izu-Bonin forearc sedimentary basin). However, differences in depositional rates, thickness and age of the sedimentary basins, geothermal gradients and the influence of serpentine mud flows, have led to distinct pore water geochemical profiles.

Application of binomial-edited CPMG to shale characterization.

Science.gov (United States)

Washburn, Kathryn E; Birdwell, Justin E

2014-09-01

Unconventional shale resources may contain a significant amount of hydrogen in organic solids such as kerogen, but it is not possible to directly detect these solids with many NMR systems. Binomial-edited pulse sequences capitalize on magnetization transfer between solids, semi-solids, and liquids to provide an indirect method of detecting solid organic materials in shales. When the organic solids can be directly measured, binomial-editing helps distinguish between different phases. We applied a binomial-edited CPMG pulse sequence to a range of natural and experimentally-altered shale samples. The most substantial signal loss is seen in shales rich in organic solids while fluids associated with inorganic pores seem essentially unaffected. This suggests that binomial-editing is a potential method for determining fluid locations, solid organic content, and kerogen-bitumen discrimination. Copyright © 2014 Elsevier Inc. All rights reserved.

New traits in crops produced by genome editing techniques based on deletions

NARCIS (Netherlands)

Wiel, van de C.C.M.; Schaart, J.G.; Lotz, L.A.P.; Smulders, M.J.M.

2017-01-01

One of the most promising New Plant Breeding Techniques is genome editing (also called gene editing) with the help of a programmable site-directed nuclease (SDN). In this review, we focus on SDN-1, which is the generation of small deletions or insertions (indels) at a precisely defined location in

Oxidation behavior of U-Si compounds in air from 25 to 1000 C

Energy Technology Data Exchange (ETDEWEB)

Sooby Wood, E., E-mail: sooby@lanl.gov; White, J.T.; Nelson, A.T.

2017-02-15

The air oxidation behavior of U{sub 3}Si{sub 2}, USi, and U{sub 3}Si{sub 5} is studied from room temperature to 1000 C. The onsets of breakaway oxidation for each compound are identified during synthetic air ramps to 1000 C using thermogravimetric analysis. Isothermal air oxidation tests are performed below and above the breakaway oxidation onset to discern the oxidation kinetic behavior of these candidate accident tolerant fuel forms. Uranium metal is tested in the same manner to provide a reference for the oxidation behavior. Thermogravimetric, x-ray diffraction, and scanning electron microscopy analysis are presented here along with a discussion of the oxidation behavior of these materials and the impact of the lack of oxidation resistance to their deployment as accident tolerant nuclear fuels.

Dicty_cDB: CHA362 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHA362 (Link to dictyBase) - - - Contig-U15579-1 | Contig-U156... library) Clone ID CHA362 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U155...79-1 | Contig-U15687-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...XACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVT...GNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVP

Dicty_cDB: SSF210 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSF210 (Link to dictyBase) - - - Contig-U16581-1 SSF210P (Link... to Original site) SSF210F 183 SSF210Z 197 SSF210P 380 - - Show SSF210 Library SS (Link to library) Clone ID SSF210 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...nt alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 339...01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ictacalcin, mRNA s

Dicty_cDB: SSG552 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSG552 (Link to dictyBase) - - - Contig-U16581-1 - (Link to Or...iginal site) SSG552F 449 - - - - - - Show SSG552 Library SS (Link to library) Clone ID SSG552 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dictycdb.b...A Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoide.... 44 1.7 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ictacalc

Dicty_cDB: VHI285 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHI285 (Link to dictyBase) - - - Contig-U16073-1 - (Link to Or...iginal site) VHI285F 136 - - - - - - Show VHI285 Library VH (Link to library) Clone ID VHI285 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16073-1 Original site URL http://dictycdb.b... DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ423035 ) Dict...yostelium discoideum cDNA clone:ddv47i22, 5' ... 72 2e-27 3 ( BJ419916 ) Dictyostelium discoideum cD

Environmental Radioactivity from Natural, Industrial and Military Sources. 4th Edition

Energy Technology Data Exchange (ETDEWEB)

Jones, Steve

1998-09-01

Merril Eisenbud's series of books on environmental radioactivity have long had a place on the bookshelves of those involved with the environmental aspects of radiation protection. They provide authoritative coverage of the subject including sources, transport mechanisms and effects. The first edition, published in 1963, was naturally mostly concerned with the effects of nuclear weapons testing in the atmosphere. The second edition, published in 1977, reflected the then expansive phase of nuclear power development worldwide and included an extensive treatment of the nuclear fuel cycle and its contributions to environmental radioactivity. In 1987 the third edition included coverage of the Three Mile Island accident and the Chernobyl accident against the background of cessation of new orders for nuclear plant in the United States. The fourth edition is a major revision with a lot of new material, and the welcome adoption of SI units throughout. The principal additions to the new edition are chapters on environmental surveillance, radiological assessment and dose reconstruction, and the remediation of contaminated sites; nothing has been lost from the extensive coverage of other topics in the third edition, whilst the text and bibliography have been revised and brought up to date. Earlier editions of the book have provided good summaries of accidents which have resulted in environmental contamination, and the updating here results in more extensive and up-to-date coverage of the Three Mile Island and Chernobyl accidents, including the more recent evidence of health effects from the latter, together with new sections on the Palomares nuclear weapons accident in Spain, the Mayak/Chelyabinsk complex in Russia, and the accidents involving lost gamma radiation sources in Juarez, Mexico and Goiania, Brazil. Both here and in the extensive coverage of contamination at the USDoE production sites the new edition reflects and benefits from the increased public availability

40Ar/39Ar dating and zircon chronochemistry for the Izu-Bonin rear arc, IODP site U1437

Science.gov (United States)

Schmitt, A. K.; Konrad, K.; Andrews, G. D.; Horie, K.; Brown, S. R.; Koppers, A. A. P.; Busby, C.; Tamura, Y.

2016-12-01

The scientific objective of IODP Expedition 350 drilling at Site U1437 (31°47.390'N, 139°01.580'E) was to reveal the "missing half of the subduction factory": the rear arc of a long-lived intraoceanic subduction zone. Site U1437 lies in a 50 km long and 20 km wide volcano-bounded basin, 90 km west of the Izu arc front, and is the only IODP site drilled in the rear arc. The Izu rear arc is dominated by Miocene basaltic to dacitic seamount chains, which strike at a high angle to the arc front. Radiometric dating targeted a single igneous unit (1390 mbsf), and fine to coarse volcaniclastic units for which we present zircon and 40Ar/39Ar (hornblende, plagioclase, and groundmass) age determinations. All zircons analyzed as grain separates were screened for contamination from drill-mud (Andrews et al., 2016) by analyzing trace elements and, where material was available, O and Hf isotope compositions. Igneous Unit 1 is a rhyolite sheet and yielded concordant in-situ and crystal separate U-Pb zircon ages (13.7±0.3 Ma; MSWD = 1.3; n = 40 spots), whereas the 40Ar/39Ar hornblende plateau age (12.9±0.3; MSWD = 1.1; n = 9 steps) is slightly younger, possibly reflecting pre-eruptive zircon crystallization, or alteration of hornblende. U-Pb zircon and 40Ar/39Ar plateau ages from samples above igneous Unit 1 are concordant with biostratigraphic and paleomagnetic ages (available to 1300 mbsf), but plagioclase and groundmass samples below 1300 m become younger with depth, hinting at post-depositional alteration. A single zircon from 1600 mbsf yielded a U-Pb age of 15.4±1.8 Ma; its trace element composition resembles other igneous zircons from U1437, and is tentatively interpreted as a Middle Miocene age for the lowermost lithostratigraphic unit VII. Oxygen and Hf isotopic values of igneous zircon indicate mantle origins, with some influence of assimilation of hydrothermally altered oceanic crust evident in sub-mantle oxygen isotopic compositions. Lessons from site U1437 are

Promoting School Success. Third Edition

Science.gov (United States)

Lovitt, Thomas C.

2007-01-01

Like its two predecessors, "Preventing School Dropouts" [C1991] and "Preventing School Failure" [C2000], this third edition is a book about teaching. Although primarily written for teachers, tutors and parents may also find this book helpful. It is a collection of carefully selected teaching techniques aimed at helping young adults learn important…

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB590 (Link to dictyBase) - - - Contig-U09552-1 VFB590P (Link... to Original site) VFB590F 225 VFB590Z 118 VFB590P 343 - - Show VFB590 Library VF (Link to library) Clone ID VFB590 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Original site URL http://dict...ed Amino Acid sequence IAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEEXKT...--- ---riyqinkvvmxhxlhn*lxvaxivxlgxvnvkihvexix Frame C: IAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT

Environmental site description for a Uranium Atomic Vapor Laser Isotope Separation (U-AVLIS) production plant at the Portsmouth Gaseous Diffusion Plant site

International Nuclear Information System (INIS)

Marmer, G.J.; Dunn, C.P.; Filley, T.H.; Moeller, K.L.; Pfingston, J.M.; Policastro, A.J.; Cleland, J.H.

1991-09-01

Uranium enrichment in the United States has utilized a diffusion process to preferentially enrich the U-235 isotope in the uranium product. In the 1970s, the US Department of Energy (DOE) began investigating more efficient and cost-effective enrichment technologies. In January 1990, the Secretary of Energy approved a plan for the demonstration and deployment of the Uranium Atomic Vapor Laser isotope Separation (U-AVLIS) technology with the near-term goal to provide the necessary information to make a deployment decision by November 1992. Initial facility operation is anticipated for 1999. A programmatic document for use in screening DOE sites to locate a U-AVLIS production plant was developed and implemented in two parts. The first part consisted of a series of screening analyses, based on exclusionary and other criteria, that identified a reasonable number of candidate sites. The final evaluation, which included sensitivity studies, identified the Oak Ridge Gaseous Diffusion Plant (ORGDP) site, the Paducah Gaseous Diffusion Plant (PGDP) site, and the Portsmouth Gaseous Diffusion Plant (PORTS) site as having significant advantages over the other sites considered. This environmental site description (ESD) provides a detailed description of the PORTS site and vicinity suitable for use in an environmental impact statement (EIS). This report is based on existing literature, data collected at the site, and information collected by Argonne National Laboratory (ANL) staff during site visits. The organization of the ESD is as follows. Topics addressed in Sec. 2 include a general site description and the disciplines of geology, water resources, biotic resources, air resources, noise, cultural resources, land use. Socioeconomics, and waste management. Identification of any additional data that would be required for an EIS is presented in Sec. 3

Environmental site description for a Uranium Atomic Vapor Laser Isotope Separation (U-AVLIS) production plant at the Portsmouth Gaseous Diffusion Plant site

Energy Technology Data Exchange (ETDEWEB)

Marmer, G.J.; Dunn, C.P.; Filley, T.H.; Moeller, K.L.; Pfingston, J.M.; Policastro, A.J.; Cleland, J.H.

1991-09-01

Uranium enrichment in the United States has utilized a diffusion process to preferentially enrich the U-235 isotope in the uranium product. In the 1970s, the US Department of Energy (DOE) began investigating more efficient and cost-effective enrichment technologies. In January 1990, the Secretary of Energy approved a plan for the demonstration and deployment of the Uranium Atomic Vapor Laser isotope Separation (U-AVLIS) technology with the near-term goal to provide the necessary information to make a deployment decision by November 1992. Initial facility operation is anticipated for 1999. A programmatic document for use in screening DOE sites to locate a U-AVLIS production plant was developed and implemented in two parts. The first part consisted of a series of screening analyses, based on exclusionary and other criteria, that identified a reasonable number of candidate sites. The final evaluation, which included sensitivity studies, identified the Oak Ridge Gaseous Diffusion Plant (ORGDP) site, the Paducah Gaseous Diffusion Plant (PGDP) site, and the Portsmouth Gaseous Diffusion Plant (PORTS) site as having significant advantages over the other sites considered. This environmental site description (ESD) provides a detailed description of the PORTS site and vicinity suitable for use in an environmental impact statement (EIS). This report is based on existing literature, data collected at the site, and information collected by Argonne National Laboratory (ANL) staff during site visits. The organization of the ESD is as follows. Topics addressed in Sec. 2 include a general site description and the disciplines of geology, water resources, biotic resources, air resources, noise, cultural resources, land use. Socioeconomics, and waste management. Identification of any additional data that would be required for an EIS is presented in Sec. 3.

A COMPARISON OF (PuU)C AND (PuU)O$sub 2$ FUELED FAST BREEDER REACTORS

Energy Technology Data Exchange (ETDEWEB)

Kazi, A. Halim; Rosen, Stanley

1963-11-15

BS>A conceptual evaluation is presented of a (PuU)C 500Mw(e) reactor which uses a moderate power generation of 40 kw/ft and a maximum fuel temperature of 2900 deg F, well below the 4500 deg F melting point of Pu/sub 0.2/U/sub 0.8/C. The principal design characteristics and fuel cycle costs are tabulated together with those of a (PuU)O/sub 2/ design of equal power. The comparison shows that the carbide core has significant economic and safety advantages over the oxide core. (D.L.C.)

11 CFR 100.11 - State (2 U.S.C. 431(12)).

Science.gov (United States)

2010-01-01

... 11 Federal Elections 1 2010-01-01 2010-01-01 false State (2 U.S.C. 431(12)). 100.11 Section 100.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND DEFINITIONS (2 U.S.C. 431) General Definitions § 100.11 State (2 U.S.C. 431(12)). State means each State of the United States, the District of...

Targeted Genome Regulation and Editing in Plants

KAUST Repository

Piatek, Agnieszka

2016-03-01

The ability to precisely regulate gene expression patterns and to modify genome sequence in a site-specific manner holds much promise in determining gene function and linking genotype to phenotype. DNA-binding modules have been harnessed to generate customizable and programmable chimeric proteins capable of binding to site-specific DNA sequences and regulating the genome and epigenome. Modular DNA-binding domains from zinc fingers (ZFs) and transcriptional activator-like effectors (TALEs) are amenable to engineering to bind any DNA target sequence of interest. Deciphering the code of TALE repeat binding to DNA has helped to engineer customizable TALE proteins capable of binding to any sequence of interest. Therefore TALE repeats provide a rich resource for bioengineering applications. However, the TALE system is limited by the requirement to re-engineer one or two proteins for each new target sequence. Recently, the clustered regularly interspaced palindromic repeats (CRISPR)/ CRISPR associated 9 (Cas9) has been used as a versatile genome editing tool. This machinery has been also repurposed for targeted transcriptional regulation. Due to the facile engineering, simplicity and precision, the CRISPR/Cas9 system is poised to revolutionize the functional genomics studies across diverse eukaryotic species. In this dissertation I employed transcription activator-like effectors and CRISPR/Cas9 systems for targeted genome regulation and editing and my achievements include: 1) I deciphered and extended the DNA-binding code of Ralstonia TAL effectors providing new opportunities for bioengineering of customizable proteins; 2) I repurposed the CRISPR/Cas9 system for site-specific regulation of genes in plant genome; 3) I harnessed the power of CRISPR/Cas9 gene editing tool to study the function of the serine/arginine-rich (SR) proteins.

Geochemical control on the reduction of U(VI) to mononuclear U(IV) species in lacustrine sediments

Science.gov (United States)

Stetten, L.; Mangeret, A.; Brest, J.; Seder-Colomina, M.; Le Pape, P.; Ikogou, M.; Zeyen, N.; Thouvenot, A.; Julien, A.; Alcalde, G.; Reyss, J. L.; Bombled, B.; Rabouille, C.; Olivi, L.; Proux, O.; Cazala, C.; Morin, G.

2018-02-01

Contaminated systems in which uranium (U) concentrations slightly exceed the geochemical background are of particular interest to identify natural processes governing U trapping and accumulation in Earth's surface environments. For this purpose, we examined the role of early diagenesis on the evolution of U speciation and mobility in sediments from an artificial lake located downstream from a former mining site. Sediment and pore water chemistry together with U and Fe solid state speciation were analyzed in sediment cores sampled down to 50 cm depth at four locations in the lake. These organic-rich sediments (∼12% organic C) exhibited U concentrations in the 40-80 mg kg-1 range. The sediment columns were anoxic 2-3 mm below the sediment-water interface and pore waters pH was circumneutral. Pore water chemistry profiles showed that organic carbon mineralization was associated with Fe and Mn reduction and was correlated with a decrease in dissolved U concentration with depth. Immobilization of U in the sediment was correlated with the reduction of U(VI) to U(IV) at depth, as shown by U LIII-edge XANES spectroscopic analysis. XANES and EXAFS spectroscopy at the Fe K-edge showed the reduction of structural Fe(III) to Fe(II) in phyllosilicate minerals with depth, coincident with U(VI) to U(IV) reduction. Thermodynamic modeling suggests that Fe(II) could act as a major reducing agent for U(VI) during early diagenesis of these sediments, leading to complete U reduction below ∼30 cm depth. Shell-by-shell and Cauchy-Wavelet analysis of U LIII-EXAFS spectra indicates that U(VI) and U(IV) are mainly present as mononuclear species bound to C, P or Si ligands. Chemical extractions confirmed that ∼60-80% of U was present as non-crystalline species, which emphasizes that such species should be considered when evaluating the fate of U in lacustrine environments and the efficiency of sediment remediation strategies.

Dicty_cDB: CHR241 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM

Investigation of Hexavalent Chromium Flux to Groundwater at the 100-C-7:1 Excavation Site

Energy Technology Data Exchange (ETDEWEB)

Truex, Michael J.; Vermeul, Vincent R.; Fritz, Brad G.; Mackley, Rob D.; Horner, Jacob A.; Johnson, Christian D.; Newcomer, Darrell R.

2012-11-16

Deep excavation of soil has been conducted at the 100-C-7 and 100-C-7:1 waste sites within the 100-BC Operable Unit at the Department of Energy (DOE) Hanford Site to remove hexavalent chromium (Cr(VI)) contamination with the excavations reaching to near the water table. Soil sampling showed that Cr(VI) contamination was still present at the bottom of the 100-C-7:1 excavation. In addition, Cr(VI) concentrations in a downgradient monitoring well have shown a transient spike of increased Cr(VI) concentration following initiation of excavation. Potentially, the increased Cr(VI) concentrations in the downgradient monitoring well are due to Cr(VI) from the excavation site. However, data were needed to evaluate this possibility and to quantify the overall impact of the 100-C-7:1 excavation site on groundwater. Data collected from a network of aquifer tubes installed across the floor of the 100-C-7:1 excavation and from temporary wells installed at the bottom of the entrance ramp to the excavation were used to evaluate Cr(VI) releases into the aquifer and to estimate local-scale hydraulic properties and groundwater flow velocity.

Dicty_cDB: SHI867 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

Dicty_cDB: VHB478 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHB478 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHB478Z 556 - - - - Show VHB478 Library VH (Link to library) Clone ID VHB478 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...cid sequence ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPV YSSLCMAMPDMSQCANWTKMCSSSGQLYNSQITT...xxcxlf*trknp*kyfrkkmdsqqkrfxr*xfn*vhlsl sgxy Frame C: ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTT

Dicty_cDB: SHL102 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHL102 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - SHL102Z 634 - - - - Show SHL102 Library SH (Link to library) Clone ID SHL102 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...TCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*...A FSTCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*kkiklnnk Frame C: ---lk

Entrance C - Meyrin site: new access conditions

CERN Multimedia

2013-01-01

Entrance C on the Meyrin site, which drivers of motorised vehicles can use Mondays to Fridays from 7 a.m. to 9 a.m. and from 5 p.m. to 7 p.m., has been altered to include a turnstile to allow cyclists and pedestrians to use their access card to get in and out of the site from 6 a.m. until 10 p.m.   The following video illustrates how to use the new turnstile: A new type of entrance gate fitted with a number plate reader similar to that installed at the entrance to the Prévessin site should, once fully tested, allow drivers of motorised vehicles to access the site. For the time being, the conditions of use of Entrance C remain unchanged. Further information on the entry into force of new arrangements will be issued in due course. For further information about CERN entrances: CERN opening hours CERN control access GS Department

The Elgar companion to social economics : Second edition

NARCIS (Netherlands)

Davis, John B.; Dolfsma, Wilfred

2015-01-01

Social economics is a dynamic and growing field that emphasizes the key roles social values play in the economy and economic life. This second edition of the Elgar Companion to Social Economics revises all chapters from the first edition, and adds important new chapters to reflect the expansion and

Dynamic Contacts of U2, RES, Cwc25, Prp8 and Prp45 Proteins with the Pre-mRNA Branch-Site and 3' Splice Site during Catalytic Activation and Step 1 Catalysis in Yeast Spliceosomes.

Directory of Open Access Journals (Sweden)

Cornelius Schneider

Full Text Available Little is known about contacts in the spliceosome between proteins and intron nucleotides surrounding the pre-mRNA branch-site and their dynamics during splicing. We investigated protein-pre-mRNA interactions by UV-induced crosslinking of purified yeast B(act spliceosomes formed on site-specifically labeled pre-mRNA, and analyzed their changes after conversion to catalytically-activated B* and step 1 C complexes, using a purified splicing system. Contacts between nucleotides upstream and downstream of the branch-site and the U2 SF3a/b proteins Prp9, Prp11, Hsh49, Cus1 and Hsh155 were detected, demonstrating that these interactions are evolutionarily conserved. The RES proteins Pml1 and Bud13 were shown to contact the intron downstream of the branch-site. A comparison of the B(act crosslinking pattern versus that of B* and C complexes revealed that U2 and RES protein interactions with the intron are dynamic. Upon step 1 catalysis, Cwc25 contacts with the branch-site region, and enhanced crosslinks of Prp8 and Prp45 with nucleotides surrounding the branch-site were observed. Cwc25's step 1 promoting activity was not dependent on its interaction with pre-mRNA, indicating it acts via protein-protein interactions. These studies provide important insights into the spliceosome's protein-pre-mRNA network and reveal novel RNP remodeling events during the catalytic activation of the spliceosome and step 1 of splicing.

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB760 (Link to dictyBase) - - - Contig-U12286-1 VFB760P (Link... to Original site) VFB760F 474 VFB760Z 691 VFB760P 1165 - - Show VFB760 Library VF (Link to library) Clone ID VFB760 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12286-1 Original site URL http://dict...CCACTTAATTCCAGAAGG sequence update 2001. 6. 1 Translated Amino Acid sequence LLAYWNKCQVNSCDKTTGNCKPENLKCPDRSNECLKNTGCDDLTGCKYVSICT...cmfllqsfxnplnsrr Frame C: LLAYWNKCQVNSCDKTTGNCKPENLKCPDRSNECLKNTGCDDLTGCKYVSICTDS

Dicty_cDB: FC-BS24 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS24 (Link to dictyBase) - - - Contig-U16209-1 FC-BS24Z (Li...nk to Original site) - - FC-BS24Z 721 - - - - Show FC-BS24 Library FC (Link to library) Clone ID FC-BS24 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...nce. 52 9e-12 4 BQ096846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ict...N SA ;, mRNA sequence. 44 1e-10 4 BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDN

Determination of sites of U50,488H-promoted phosphorylation of the mouse κ opioid receptor (KOPR): disconnect between KOPR phosphorylation and internalization.

Science.gov (United States)

Chen, Chongguang; Chiu, Yi-Ting; Wu, Wenman; Huang, Peng; Mann, Anika; Schulz, Stefan; Liu-Chen, Lee-Yuan

2016-02-15

Phosphorylation sites of KOPR (κ opioid receptor) following treatment with the selective agonist U50,488H {(-)(trans)-3,4-dichloro-N-methyl-N-[2-(1-pyrrolidiny)cyclo-hexyl]benzeneacetamide} were identified after affinity purification, SDS/PAGE, in-gel digestion with Glu-C and HPLC-MS/MS. Single- and double-phosphorylated peptides were identified containing phosphorylated Ser(356), Thr(357), Thr(363) and Ser(369) in the C-terminal domain. Antibodies were generated against three phosphopeptides containing pSer(356)/pThr(357), pThr(363) and pSer(369) respectively, and affinity-purified antibodies were found to be highly specific for phospho-KOPR. U50,488H markedly enhanced staining of the KOPR by pThr(363)-, pSer(369)- and pSer(356)/pThr(357)-specific antibodies in immunoblotting, which was blocked by the selective KOPR antagonist norbinaltorphimine. Ser(369) phosphorylation affected Thr(363) phosphorylation and vice versa, and Thr(363) or Ser(369) phosphorylation was important for Ser(356)/Thr(357) phosphorylation, revealing a phosphorylation hierarchy. U50,488H, but not etorphine, promoted robust KOPR internalization, although both were full agonists. U50,488H induced higher degrees of phosphorylation than etorphine at Ser(356)/Thr(357), Thr(363) and Ser(369) as determined by immunoblotting. Using SILAC (stable isotope labelling by amino acids in cell culture) and HPLC-MS/MS, we found that, compared with control (C), U50,488H (U) and etorphine (E) KOPR promoted single phosphorylation primarily at Thr(363) and Ser(369) with U/E ratios of 2.5 and 2 respectively. Both induced double phosphorylation at Thr(363)+Ser(369) and Thr(357)+Ser(369) with U/E ratios of 3.3 and 3.4 respectively. Only U50,488H induced triple phosphorylation at Ser(356)+Thr(357)+Ser(369). An unphosphorylated KOPR-(354-372) fragment containing all of the phosphorylation sites was detected with a C/E/U ratio of 1/0.7/0.4, indicating that ∼60% and ∼30% of the mouse KOPR are phosphorylated

Site-selective {sup 13}C labeling of proteins using erythrose

Energy Technology Data Exchange (ETDEWEB)

Weininger, Ulrich, E-mail: ulrich.weininger@physik.uni-halle.de [Lund University, Department of Biophysical Chemistry, Center for Molecular Protein Science (Sweden)

2017-03-15

NMR-spectroscopy enables unique experimental studies on protein dynamics at atomic resolution. In order to obtain a full atom view on protein dynamics, and to study specific local processes like ring-flips, proton-transfer, or tautomerization, one has to perform studies on amino-acid side chains. A key requirement for these studies is site-selective labeling with {sup 13}C and/or {sup 1}H, which is achieved in the most general way by using site-selectively {sup 13}C-enriched glucose (1- and 2-{sup 13}C) as the carbon source in bacterial expression systems. Using this strategy, multiple sites in side chains, including aromatics, become site-selectively labeled and suitable for relaxation studies. Here we systematically investigate the use of site-selectively {sup 13}C-enriched erythrose (1-, 2-, 3- and 4-{sup 13}C) as a suitable precursor for {sup 13}C labeled aromatic side chains. We quantify {sup 13}C incorporation in nearly all sites in all 20 amino acids and compare the results to glucose based labeling. In general the erythrose approach results in more selective labeling. While there is only a minor gain for phenylalanine and tyrosine side-chains, the {sup 13}C incorporation level for tryptophan is at least doubled. Additionally, the Phe ζ and Trp η2 positions become labeled. In the aliphatic side chains, labeling using erythrose yields isolated {sup 13}C labels for certain positions, like Ile β and His β, making these sites suitable for dynamics studies. Using erythrose instead of glucose as a source for site-selective {sup 13}C labeling enables unique or superior labeling for certain positions and is thereby expanding the toolbox for customized isotope labeling of amino-acid side-chains.

Reactions of saccharides catalyzed by molybdate ions. XXXIII. Use of. cap alpha. (U-/sup 14/C)glucan for preparation of /sup 14/C-labelled saccharides

Energy Technology Data Exchange (ETDEWEB)

Bilik, V; Biely, P [Institute of Chemistry, Centre for Chemical Research, Slovak Academy of Sciences, Bratislava (Czechoslovakia); Kolina, J [Ustav pro Vyzkum, Vyrobu a Vyuziti Radioisotopu, Prague (Czechoslovakia)

1984-01-01

D-(U-/sup 14/C)glucose obtained in acid hydrolysis of ..cap alpha..-(U-/sup 14/C)glucan (2 M-HCl) was epimerized under a catalytic action of molybdate ions to D-(U-/sup 14/C)mannose isolated with a 20% yield. Oxidative degradation of 4-nitrophenylhydrazones of D-(U-/sup 14/C)arabinose and D-(U-/sup 14/C)xylose resulted in D-(U-/sup 14/C)erythrose and D-(U-/sup 14/C)threose, respectively, with a 15% yield relative to the starting aldopentoses. Nitromethane synthesis with D-(U-/sup 14/C)lyxose followed by oxidative decomposition of the corresponding nitrohexitols yielded /sup 14/C-labelled D-galactose. Described is also the preparation of D-(U-/sup 14/C)arabinose from D-(U-/sup 14/C)glucose and the conversion of D-(U-/sup 14/C)arabinose to D-(U-/sup 14/C)xylose and D-(U-/sup 14/C)lyxose.

Single-site properties of U impurities doped in La2Zn17 (abstract)

Science.gov (United States)

Suzuki, H.; Anzai, K.; Takagi, S.

1997-04-01

Thermodynamic and transport properties of heavy Fermion (HF) U compounds show similar behavior to HF Ce compounds. Although most of the magnetic properties of HF Ce compounds can be qualitatively understood on the basis of the impurity Kondo model, no such consensus for HF U compounds has been reached. In addition to this, the single-site properties of U impurities are not understood so well, in contrast to the case of Ce impurities. Recent works for dilute U systems reported new features as are not seen in dilute Ce systems. We have investigated a dilute-U2Zn17 system of (La1-zUz)2Zn17 in order to reveal the single U ion site properties of this system by preparing single crystals. The impurity contributions to various physical quantities such as ρimp(T), χimp(T), and Cimp(T) can be scaled by the U concentration between z=0.025 and 0.05, and the system is considered as in the dilute limit still for z=0.05. The electrical resistivity shows the typical impurity-Kondo upturn at low temperatures. The electronic specific-heat coefficient is strongly enhanced (γimp≈1.5 J/K2 mole U) and about 4 times as large as that for dense U2Zn17. Suppressions of the Kondo effect by the magnetic field are seen in γimp(H) and magnetoresistance. The relatively large anisotropy in χimp(T) indicates an existence of the crystal field. These features of this system will be explained in terms of the Kondo effect in the presence of the crystal field.

Remediation System Evaluation, Tutu Wellfield Superfund Site, St. Thomas, U.S. Virgin Islands

Science.gov (United States)

The Tutu Wellfield Superfund Site is a 1.5 square mile site located on the eastern end of St. Thomas, U.S. Virgin Islands (USVI) within the upper Turpentine Run surface drainage basin in the Anna’s Retreat area.

Dicty_cDB: SSH414 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSH414 (Link to dictyBase) - - - Contig-U16581-1 SSH414Z (Link... to Original site) - - SSH414Z 448 - - - - Show SSH414 Library SS (Link to library) Clone ID SSH414 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium... SAMPLING. 44 1.7 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

Dicty_cDB: SSG316 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSG316 (Link to dictyBase) - - - Contig-U16509-1 SSG316F (Link... to Original site) SSG316F 231 - - - - - - Show SSG316 Library SS (Link to library) Clone ID SSG316 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideu...m mRNA. 64 3e-12 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

Dicty_cDB: AFF235 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFF235 (Link to dictyBase) - - - - AFF235F (Link to Original s...ite) AFF235F 602 - - - - - - Show AFF235 Library AF (Link to library) Clone ID AFF235 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...date 2001.11.24 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dict... 3 CK420742 |CK420742.1 AUF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to ER

Dicty_cDB: SFJ801 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFJ801 (Link to dictyBase) - - - - SFJ801P (Link to Original s...ite) SFJ801F 633 SFJ801Z 345 SFJ801P 978 - - Show SFJ801 Library SF (Link to library) Clone ID SFJ801 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...t alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mRNA, complete cds. 1021...IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to ER-resident chaperone calretic

Dicty_cDB: SSF105 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSF105 (Link to dictyBase) - - - Contig-U16581-1 SSF105F (Link... to Original site) SSF105F 432 - - - - - - Show SSF105 Library SS (Link to library) Clone ID SSF105 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 387 e-126 3 BZ46365...028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

Dicty_cDB: SSF865 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSF865 (Link to dictyBase) - - - Contig-U16581-1 SSF865Z (Link... to Original site) - - SSF865Z 436 - - - - Show SSF865 Library SS (Link to library) Clone ID SSF865 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...s producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 387 e-115...0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

Dicty_cDB: VHO349 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHO349 (Link to dictyBase) - - - Contig-U11939-1 - (Link to Or...iginal site) - - VHO349Z 412 - - - - Show VHO349 Library VH (Link to library) Clone ID VHO349 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11939-1 Original site URL http://dictycdb.b...4 |CK424794.1 AUF_IpSto_12_h11 Stomach cDNA library Ictalurus punctatus cDNA 5', mRNA sequence. 42 6.1 1 dna...ial 8.0 %: Golgi 4.0 %: vesicles of secretory system >> prediction for VHO349 is

Dicty_cDB: AFJ817 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFJ817 (Link to dictyBase) - - - Contig-U15574-1 AFJ817F (Link... to Original site) AFJ817F 172 - - - - - - Show AFJ817 Library AF (Link to library) Clone ID AFJ817 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15574-1 Original site URL http://dict...alue N AC116920 |AC116920.2 Dictyostelium discoideum chromosome 2 map 3879572-4071762 strain AX4, complete s...es. 42 1.1 2 BE213059 |BE213059.1 IpBrn01690 Brain cDNA library Ictalurus punctatus cDNA 5', mRNA sequence.

Dicty_cDB: AHA115 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AH (Link to library) AHA115 (Link to dictyBase) - - - - - (Link to Original site) A...HA115F 669 - - - - - - Show AHA115 Library AH (Link to library) Clone ID AHA115 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AH/AHA...(bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mRNA, complete cds. 1243 0.0 2 BD24838... 7e-04 1 CK420742 |CK420742.1 AUF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar

Dicty_cDB: SSK129 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSK129 (Link to dictyBase) - - - Contig-U16021-1 SSK129Z (Link... to Original site) - - SSK129Z 372 - - - - Show SSK129 Library SS (Link to library) Clone ID SSK129 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16021-1 Original site URL http://dict...Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dict...419632 |CK419632.1 AUF_IpOva_21_i24 Ovary cDNA library Ictalurus punctatus cDNA 5', mRNA sequence. 36 0.54 2

Dicty_cDB: SSC474 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSC474 (Link to dictyBase) - - - Contig-U07719-1 SSC474P (Link... to Original site) SSC474F 368 SSC474Z 238 SSC474P 606 - - Show SSC474 Library SS (Link to library) Clone ID SSC474 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07719-1 Original site URL http://dict...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU071762 ) Dictyostelium di...scoideum slug cDNA, clone SSC474. 448 e-121 1 ( AU060185 ) Dictyostelium discoideum slug cDNA, clone SLA535.

A to I editing in disease is not fake news.

Science.gov (United States)

Bajad, Prajakta; Jantsch, Michael F; Keegan, Liam; O'Connell, Mary

2017-09-02

Adenosine deaminases acting on RNA (ADARs) are zinc-containing enzymes that deaminate adenosine bases to inosines within dsRNA regions in transcripts. In short, structured dsRNA hairpins individual adenosine bases may be targeted specifically and edited with up to one hundred percent efficiency, leading to the production of alternative protein variants. However, the majority of editing events occur within longer stretches of dsRNA formed by pairing of repetitive sequences. Here, many different adenosine bases are potential targets but editing efficiency is usually much lower. Recent work shows that ADAR-mediated RNA editing is also required to prevent aberrant activation of antiviral innate immune sensors that detect viral dsRNA in the cytoplasm. Missense mutations in the ADAR1 RNA editing enzyme cause a fatal auto-inflammatory disease, Aicardi-Goutières syndrome (AGS) in affected children. In addition RNA editing by ADARs has been observed to increase in many cancers and also can contribute to vascular disease. Thus the role of RNA editing in the progression of various diseases can no longer be ignored. The ability of ADARs to alter the sequence of RNAs has also been used to artificially target model RNAs in vitro and in cells for RNA editing. Potentially this approach may be used to repair genetic defects and to alter genetic information at the RNA level. In this review we focus on the role of ADARs in disease development and progression and on their potential use to artificially modify RNAs in a targeted manner.

Multi site Kinetic Modeling of 13C Metabolic MR Using [1-13C]Pyruvate

International Nuclear Information System (INIS)

Damian, P.A.G.; Sperl, J.I.; Janich, M.A.; Wiesinger, F.; Schulte, R.F.; Menzel, M.I.; Damian, P.A.G.; Damian, P.A.G.; Haase, A.; Janich, M.A.; Schwaiger, M.; Janich, M.A.; Khegai, O.; Glaser, S.J.

2014-01-01

Hyperpolarized 13 C imaging allows real-time in vivo measurements of metabolite levels. Quantification of metabolite conversion between [1- 13 C]pyruvate and downstream metabolites [1- 13 C]alanine, [1- 13 C]lactate, and [ 13 C] bicarbonate can be achieved through kinetic modeling. Since pyruvate interacts dynamically and simultaneously with its downstream metabolites, the purpose of this work is the determination of parameter values through a multi site, dynamic model involving possible biochemical pathways present in MR spectroscopy. Kinetic modeling parameters were determined by fitting the multi site model to time-domain dynamic metabolite data. The results for different pyruvate doses were compared with those of different two-site models to evaluate the hypothesis that for identical data the uncertainty of a model and the signal-to-noise ratio determine the sensitivity in detecting small physiological differences in the target metabolism. In comparison to the two-site exchange models, the multi site model yielded metabolic conversion rates with smaller bias and smaller standard deviation, as demonstrated in simulations with different signal-to-noise ratio. Pyruvate dose effects observed previously were confirmed and quantified through metabolic conversion rate values. Parameter interdependency allowed an accurate quantification and can therefore be useful for monitoring metabolic activity in different tissues

Dicty_cDB: VHA365 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHA365 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHA365Z 352 - - - - Show VHA365 Library VH (Link to library) Clone ID VHA365 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...TTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTT sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...wfmv Frame C: ---QLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS SSGQLY

Dicty_cDB: SSB322 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSB322 (Link to dictyBase) - - - Contig-U03539-1 SSB322Z (Link... to Original site) - - SSB322Z 393 - - - - Show SSB322 Library SS (Link to library) Clone ID SSB322 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03539-1 Original site URL http://dict...KGKXYILQDKQYKERGVGTIRVNKDLEEKXRIIMNAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfil...NAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfilkkkk Homology vs CSM-cDNA Score E

Dicty_cDB: SLA340 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLA340 (Link to dictyBase) - - - Contig-U16510-1 - (Link to Or...iginal site) - - SLA340Z 466 - - - - Show SLA340 Library SL (Link to library) Clone ID SLA340 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16510-1 Original site URL http://dictycdb.b.... 2 Translated Amino Acid sequence ---CGKPSPIPTCTRKLSPISICIIKLCPIFICITKLCSIYICTISICIIFICIICSNYS CNYNCNYSCNYN...qpqlqlqlqlqpqpqlqpqlqpq lplkfnqktffikyhynnffnnnsikk*y*kspffl Frame C: ---CGKPSPIPTCTRKLSPISICIIKLCPIFICITKLCSIYICT

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB826 (Link to dictyBase) - - - Contig-U16584-1 VFB826F (Link... to Original site) VFB826F 430 - - - - - - Show VFB826 Library VF (Link to library) Clone ID VFB826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16584-1 Original site URL http://dict... (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657875-4914984 strain AX4, c...vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VFB82

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB868 (Link to dictyBase) - - - Contig-U15649-1 VFB868F (Link... to Original site) VFB868F 110 - - - - - - Show VFB868 Library VF (Link to library) Clone ID VFB868 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15649-1 Original site URL http://dict...c 4.0 %: cytoskeletal >> prediction for VFB868 is nuc 5' end seq. ID VFB868F 5' end seq. >VFB868F.Seq TATTAA

A C-terminal, cysteine-rich site in poliovirus 2C(ATPase) is required for morphogenesis.

Science.gov (United States)

Wang, Chunling; Ma, Hsin-Chieh; Wimmer, Eckard; Jiang, Ping; Paul, Aniko V

2014-06-01

The morphogenesis of viruses belonging to the genus Enterovirus in the family Picornaviridae is still poorly understood despite decades-long investigations. However, we recently provided evidence that 2C(ATPase) gives specificity to poliovirus encapsidation through an interaction with capsid protein VP3. The polypeptide 2C(ATPase) is a highly conserved non-structural protein of enteroviruses with important roles in RNA replication, encapsidation and uncoating. We have identified a site (K279/R280) near the C terminus of the polypeptide that is required for morphogenesis. The aim of the current project was to search for additional functional sites near the C terminus of the 2C(ATPase) polypeptide, with particular interest in those that are required for encapsidation. We selected for analysis a cysteine-rich site of the polypeptide and constructed four mutants in which cysteines or a histidine was changed to an alanine. The RNA transcripts were transfected into HeLa cells yielding two lethal, one temperature-sensitive and one quasi-infectious mutants. All four mutants exhibited normal protein translation in vitro and three of them possessed severe RNA replication defects. The quasi-infectious mutant (C286A) yielded variants with a pseudo-reversion at the original site (A286D), but some also contained one additional mutation: A138V or M293V. The temperature-sensitive mutant (C272A/H273A) exhibited an encapsidation and possibly also an uncoating defect at 37 °C. Variants of this mutant revealed suppressor mutations at three different sites in the 2C(ATPase) polypeptide: A138V, M293V and K295R. We concluded that the cysteine-rich site near the C terminus of 2C(ATPase) is involved in encapsidation, possibly through an interaction with an upstream segment located between boxes A and B of the nucleotide-binding domain. © 2014 The Authors.

General edition program

International Nuclear Information System (INIS)

Vaturi, Sylvain

1969-01-01

Computerized edition is essential for data processing exploitation. When a more or less complex edition program is required for each task, then the need for a general edition program become obvious. The aim of this study is to create a general edition program. Universal programs are capable to execute numerous and varied tasks. For a more precise processing, the execution of which is frequently required, the use of a specialized program is preferable because, contradictory to the universal program, it goes straight to the point [fr

Targeted genome editing in human repopulating haematopoietic stem cells

NARCIS (Netherlands)

P. Genovese (Pietro); G. Schiroli (Giulia); G. Escobar (Giulia); T. Di Tomaso (Tiziano); C. Firrito (Claudia); A. Calabria (Andrea); D. Moi (Davide); R. Mazzieri (Roberta); C. Bonini (Chiara); M.V. Holmes (Michael); P.D. Gregory (Philip); M. van der Burg (Mirjam); B. Gentner (Bernhard); E. Montini (Eugenio); A. Lombardo (Angelo); L. Naldini (Luigi)

2014-01-01

textabstractTargeted genome editing by artificial nucleases has brought the goal of site-specific transgene integration and gene correction within the reach of gene therapy. However, its application to long-term repopulating haematopoietic stem cells (HSCs) has remained elusive. Here we show that

Dicty_cDB: Contig-U04201-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( CN212621 ) 26120 Suspension culture Solanum tuberosum cDNA, ... 58 6e-04 1 ( BU880962 ) UM57TA10 Populus flower cDNA library...m cD... 58 6e-08 2 ( EX067768 ) BR052412 pollen cDNA library KBPL Brassica rapa s... 48 8e-08 3 ( EX122995 ) BR106825 mature gre...2 ( EX137140 ) BR120970 root cDNA library KHRT Brassica rapa sub... 48 1e-07 3 ( EX124319 ) BR108149 matur...5', mRNA ... 48 2e-07 2 ( BU822514 ) UB38BPG02 Populus tremula cambium cDNA library Po... 58 4e-07 2 ( EX032...U359299_1( EU359299 |pid:none) Rickettsia helvetica isolate 73-3-... 171 3e-41 EU543436_1( EU543436 |pid:none) Uncultured Ric

Vegetation response to invasive Tamarix control in southwestern U.S. rivers: a collaborative study including 416 sites.

Science.gov (United States)

González, Eduardo; Sher, Anna A; Anderson, Robert M; Bay, Robin F; Bean, Daniel W; Bissonnete, Gabriel J; Bourgeois, Bérenger; Cooper, David J; Dohrenwend, Kara; Eichhorst, Kim D; El Waer, Hisham; Kennard, Deborah K; Harms-Weissinger, Rebecca; Henry, Annie L; Makarick, Lori J; Ostoja, Steven M; Reynolds, Lindsay V; Robinson, W Wright; Shafroth, Patrick B

2017-09-01

Most studies assessing vegetation response following control of invasive Tamarix trees along southwestern U.S. rivers have been small in scale (e.g., river reach), or at a regional scale but with poor spatial-temporal replication, and most have not included testing the effects of a now widely used biological control. We monitored plant composition following Tamarix control along hydrologic, soil, and climatic gradients in 244 treated and 172 reference sites across six U.S. states. This represents the largest comprehensive assessment to date on the vegetation response to the four most common Tamarix control treatments. Biocontrol by a defoliating beetle (treatment 1) reduced the abundance of Tamarix less than active removal by mechanically using hand and chain-saws (2), heavy machinery (3) or burning (4). Tamarix abundance also decreased with lower temperatures, higher precipitation, and follow-up treatments for Tamarix resprouting. Native cover generally increased over time in active Tamarix removal sites, however, the increases observed were small and was not consistently increased by active revegetation. Overall, native cover was correlated to permanent stream flow, lower grazing pressure, lower soil salinity and temperatures, and higher precipitation. Species diversity also increased where Tamarix was removed. However, Tamarix treatments, especially those generating the highest disturbance (burning and heavy machinery), also often promoted secondary invasions of exotic forbs. The abundance of hydrophytic species was much lower in treated than in reference sites, suggesting that management of southwestern U.S. rivers has focused too much on weed control, overlooking restoration of fluvial processes that provide habitat for hydrophytic and floodplain vegetation. These results can help inform future management of Tamarix-infested rivers to restore hydrogeomorphic processes, increase native biodiversity and reduce abundance of noxious species. © 2017 by the

Residential and Light Commercial HVAC. Teacher Edition and Student Edition. Second Edition.

Science.gov (United States)

Stephenson, David

This package contains teacher and student editions of a residential and light commercial heating, ventilation, and air conditioning (HVAC) course of study. The teacher edition contains information on the following: using the publication; national competencies; competency profile; related academic and workplace skills list; tools, equipment, and…

Site-specific standard request for underground storage tanks 1219-U, 1222-U, 2082-U, and 2068-U at the rust garage facility buildings 9754-1 and 9720-15: Oak Ridge Y-12 Plant, Oak Ridge, Tennessee, Facility ID No. 0-010117

International Nuclear Information System (INIS)

1994-12-01

This document represents a Site-specific Standard Request for underground storage tanks (USTs) 1219-U,1222-U and 2082-U previously located at former Building 9754-1, and tank 2086-U previously located at Building 9720-15, Oak Ridge Y-12 Plant, Oak Ridge, Tennessee. The tanks previously contained petroleum products. For the purposes of this report, the two building sites will be regarded as a single UST site and will be referred to as the Rust Garage Facility. The current land use associated with the Y-12 Plant is light industrial and the operational period of the plant is projected to be at least 30 years. Thus, potential future residential exposures are not expected to occur for at least 30 years. Based on the degradation coefficient for benzene (the only carcinogenic petroleum constituent detected in soils or groundwater at the Rust Garage Facility), it is expected that the benzene and other contaminants at the site will likely be reduced prior to expiration of the 30-year plant operational period. As the original sources of petroleum contamination have been removed, and the area of petroleum contamination is limited, a site-specific standard is therefore being requested for the Rust Garage Facility

Radionuclide and metal contamination in pit lakes in former U mining sites in Central Asia

Energy Technology Data Exchange (ETDEWEB)

Skipperud, L.; Rosseland, B.O.; Heier, L.S.; Salbu, B. [Centre for Environmental Radioactivity - CERAD, Norwegian University of Life Sciences - NMBU (Norway); Stegnar, P. [Josef Stefan Institute (Slovenia); Yunusov, M. [IA Vostokredmet (Tajikistan); Burkitbaev, L.M. [Al-Farabi Kazakh National University (Kazakhstan)

2014-07-01

The uranium mining industry in the USSR was established in the late 1940's - early 1950's in the former Soviet Republics of Kazakhstan, Kyrgyzstan, Tajikistan and Uzbekistan as part of the nuclear weapon program. In most countries, uranium mining is considered a hazardous step of nuclear materials production, both in terms of radiation doses and in the number of people affected. Key problems have been associated with the transport of uranium and its daughters in aquatic and terrestrial ecosystems, where radionuclides are transferred from air, water, and soils into plants, fish/animals and finally to man. In this paper, special attention is paid to the assessment of radionuclides and metals in Central Asian Pit Lakes. Field works to Kurday, Kasakhstan, and Taboshar, Tajikistan, Pit Lakes have been performed. In addition to sampling of water, fish, sediments, and vegetation, in situ fractionation of water were achieved. The concentrations of U and associated trace metals were enriched in the Kurday Pit Lake and in the artesian water at the Kurday site (U exceeding the WHO guideline value for drinking water), and decreased downstream from the mining area. Uranium, As, Mo and Ni were predominantly present as mobile low molecular mass species in waters, while a significant proportion of Cr, Mn and Fe were associated with colloids and particles. Due to oxidation of divalent iron in the artesian ground water upon contact with air, Fe served as scavenger for other elements, and peak concentrations of U, Ra-isotopes, As and Mn were seen. The U concentrations in water from Taboshar Pit Lake (2.0 mg U/L) were higher than waters collected in other areas in Tajikistan. The Pit Lake and the stream water from the tailing mountain were also characterized by elevated concentrations of As, Mo, Mn and Fe, exceeding the WHO recommended values for drinking water. Uranium, As, Mo and Ni were present as low molecular mass species in the waters, and are therefore considered

U.S. Government Initiatives in Afghanistan: An Application of Diffusion of Innovations Theory

Science.gov (United States)

2012-05-17

Second Reader Derek Basinger, LCol. ___________________________________ Director, Thomas C. Graves, COL, IN School of Advanced...19 Another project Rogers cites, as an example of his concept of sustainability, is the efforts of Dr “Chicken” Davis, a U.S. poultry science...Centric Counterinsurgency: A False Idol? Edited by Dan G Cox, & Thomas Bruscino. Fort Leavenworth, KS: Combat Studies Institute Press, 2011. 63-98

Closure Report for Corrective Action Unit 537: Waste Sites, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

NSTec Environmental Restoration

2007-01-01

Corrective Action Unit (CAU) 537 is identified in the ''Federal Facility Agreement and Consent Order'' (FFACO) of 1996 as Waste Sites. CAU 537 is located in Areas 3 and 19 of the Nevada Test Site, approximately 65 miles northwest of Las Vegas, Nevada, and consists of the following two Corrective Action Sites (CASs): CAS 03-23-06, Bucket; Yellow Tagged Bags; and CAS 19-19-01, Trash Pit. CAU 537 closure activities were conducted in April 2007 according to the FFACO and Revision 3 of the Sectored Clean-up Work Plan for Housekeeping Category Waste Sites (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2003). At CAS 03-23-06, closure activities included removal and disposal of a 15-foot (ft) by 15-ft by 8-ft tall wooden shed containing wood and metal debris and a 5-gallon plastic bucket containing deteriorated plastic bags with yellow radioactive contamination tape. The debris was transported to the Area 9 U10c Landfill for disposal after being screened for radiological contamination according to the ''NV/YMP Radiological Control Manual'' (NNSA/NSO, 2004). At CAS 19-19-01, closure activities included segregation, removal, and disposal of non-friable, non-regulated asbestos-containing material (ACM) and construction debris. The ACM was determined to be non-friable by waste characterization samples collected prior to closure activities. The ACM was removed and double-bagged by licensed, trained asbestos workers and transported to the Area 9 U10c Landfill for disposal. Construction debris was transported in end-dump trucks to the Area 9 U10c Landfill for disposal. Closure activities generated sanitary waste/construction debris and ACM. Waste generated during closure activities was appropriately managed and disposed. Waste characterization sample results are included as Appendix A of this report, and waste disposition documentation is included as Appendix B of this report. Copies of the Sectored Housekeeping Site Closure

Dicty_cDB: CHA851 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHA851 (Link to dictyBase) - - - Contig-U16368-1 - (Link to Or...iginal site) CHA851F 614 - - - - - - Show CHA851 Library CH (Link to library) Clone ID CHA851 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dictycdb.b...TCCXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT...nly*skttgttttllnlcraiism*srwn dlysstkqlyqy*ipmlpis--- Frame C: VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT

Dicty_cDB: SFF103 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFF103 (Link to dictyBase) - - - Contig-U11967-1 SFF103Z (Link... to Original site) - - SFF103Z 655 - - - - Show SFF103 Library SF (Link to library) Clone ID SFF103 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11967-1 Original site URL http://dict...nslated Amino Acid sequence ---rgsf*FLKIIITLLAYKIICTPNHMHLTRGNHETTDMNRFYGFQGEVVAKYSEMVFD LFSELFNWFPLAFVLDESF...*rkrlsnr**wfshhcflc skll*siw*swliykynxdkikittxklxtsexppmhsqk Frame C: ---rgsf*FLKIIITLLAYKIICT

Dicty_cDB: CHF177 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHF177 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - CHF177Z 395 - - - - Show CHF177 Library CH (Link to library) Clone ID CHF177 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...LLLWDVQGFPCXFAVEG GQCIDPSSLKVGGKYSFIAFSTCRXKFDNQKIHDCDWIIQGPTTPSXCANCGKICTSKCT TNYCDRDXQT Translated Amino A...XKFDNQKIHDCDWIIQGPTTPSXCANCGKICTSKCT TNYCDRDXQT Homology vs CSM-cDNA Score E Sequences producing significant

Dicty_cDB: VHP243 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHP243 (Link to dictyBase) - - - Contig-U16236-1 - (Link to Or...iginal site) VHP243F 134 - - - - - - Show VHP243 Library VH (Link to library) Clone ID VHP243 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16236-1 Original site URL http://dictycdb.b...AXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence CWPTGIXKTTICT...kilsif*ynfkyyqqpkkk--- Frame B: llaywyxqnnnlyqyyyyfyl*kyflsfniilniinnpkk--- Frame C: CWPTGIXKTTICTNTTIISICKN

Dicty_cDB: AFA460 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFA460 (Link to dictyBase) - - - Contig-U15574-1 AFA460Z (Link... to Original site) - - AFA460Z 170 - - - - Show AFA460 Library AF (Link to library) Clone ID AFA460 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15574-1 Original site URL http://dict...date 2001. 6. 2 Translated Amino Acid sequence ---QIHQTIQVVKITLSSASSSSSSSSSSILNKTRICTYINSNSTHSLXXNIYKYKLPK T...it* Frame B: ---QIHQTIQVVKITLSSASSSSSSSSSSILNKTRICTYINSNSTHSLXXNIYKYKLPK Frame C:

Dicty_cDB: SSI527 [Dicty_cDB